Gulf Coast breeze.

MISSING IMAGE

Material Information

Title:
Gulf Coast breeze.
Physical Description:
Newspaper
Language:
English
Publisher:
R. Don McCleod, Jr.
Place of Publication:
Crawfordville Fla
Creation Date:
July 23, 1915
Publication Date:
Frequency:
weekly
regular

Subjects

Subjects / Keywords:
Newspapers -- Crawfordville (Fla.)   ( lcsh )
Newspapers -- Wakulla County (Fla.)   ( lcsh )
Genre:
newspaper   ( marcgt )
newspaper   ( sobekcm )
Spatial Coverage:
United States -- Florida -- Wakulla -- Crawfordville
Coordinates:
30.176111 x -84.375278 ( Place of Publication )

Notes

Dates or Sequential Designation:
Vol. 1, no. 1 (May 28, 1897)-
General Note:
"For the people."
General Note:
Publisher: Herbert S. Moore, <1915>.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
All applicable rights reserved by the source institution and holding location.
Resource Identifier:
oclc - 01456015
lccn - sn 95047266
System ID:
UF00075904:00094

Full Text








GUF O REZ..



W A RgH 22 1901-V4 .4.


PROESSQA JEAWEN'LR5,
*ip~siniig is ettr ii ft W ot er.%radc undef Saec 34, chapter 43g.
nIt.fyn %Va~ ha esomletimnes here merchants Atoye at La. 1h, to- the you Colleto ofLaws
;9_______ dt"5 not pay to adtvertinie, but ItI njf1 'o 1 h no- Attrne a clrida to ahewax Clete ao W4
8M FiuIlftlE ifnde a dying trip to In notan mhdes do 111s.~ me called feaeV. 'O00 watch CrawfordvilC Fla. kulLa county Florida, to be collected T41111"lscody "MadbsnsmnoI.Avr hain to a Orve Jewelry for the current year, 190. and theape
2r 1-iilimo two iio i s~ng has been going on Ofl1ime the Ia" Come to be article of portlonment of the same to the oever0
9PP1.0. yesterdaIn, o V oillage. first newspaper W"ages ami dross. a) funds for which such taxes were
________ 96 d dnPy-Wy4 b epeke o ilby wo ;m levied, Including poll tan with county
ape ~ ~ ~ -tp tu etedyIn vlag.' ddfOM soJ, o hyou f Irieple that you gewho for when
]W K. Trice, of Tallahassee, wasl in 9"Pe~ y~g oy orre d )sho u d
911119 &ht' eekoilbusnes. wso 1111 to yeu and asko uyYUo ti ficho ud
9tlaeth.wekoiYbsneOU70 for you buy of W. 0 l' Sopehoppy T 340 amosst chaJgedkG
________ eip, would yes help them or would Flu, who has a to Pill of the' o'. aod pd. to Trosats MaM I AN~ W46
Ikis a sin to steal a pin-espeelgly 7,11 me and hel*aothor one of your 'A'. Fr. MAIN 00. *4very article Ali ka.A i ilaond attached tu it. friend4whaoijd a(,& ask you. fittesegoos is f. A ntt e
Advertise let the Poidke know that mie9 so 6OATIORMUIS?
guarantee to this given With~ APOTINU
1'uoc okit* it"s wre"ku -Many a you wan$ their trade, and tell ithom pach article o4t st purchased oiGprseta,,17
.strp on Moe natimonial on., what YOU have got fuar sale. Jet the atter tr.oly~ roe t sh2 15, 74
It dunt ouk -mue like w nw tht YOUt Am tll 10 the business. IV F. ?Alfl Co. la T toTe toW rb2,M .874
to Lo nt lyu s tue 0iew ane gains It tPAP to advertise in a big eity, Eastern rsety endship and' M....83
n a~,~b8~r.Irng weather &bhis ygvjr. siyahul is not pay to advertlee in eddy Sts.. 1. 2 1 coo a ,10,9

br. Ji. II. launlt oil lupping arotaul o ___________ W ste r n t Je*o i eb o a 0
____ ___ ___ leg Ailt wo k 5.a o ts r n o w ow Cot. wAn pd, to T rsv., to. liarch 1901, -* 41(thu Wella if Bryan- is46~ wa. &VA floor2,~ spee rn"

3455ft J lirwvI iajrans au offer you (l(* no' pric -f.Q".
4464L i" bln~ynot icef"L I E-1A4.ad pd. to Tres., to NrIMonh %A, IS
4rasin Drvgoods Shoes DP QAI fE
W-1IWPW il o Mv ats and Cap. # W HISKEY MI
W. Dval Atlest J. M. Toolee
la e i tu otwwjL ". t'amo. wo"bt19V6e, rad ra any kind ;o.A.5D BY. rGt, eia
Saywha ~ ~ o vebicie call A Duval. wailm 411 -" atsnal are t
~1 I ~osljjf est Sairy a etbWE au" eleeot prmotseylM. i 64. bd poket t~~Rlh teti fe th
&A&1 Mtu'un',WA 114w lowilI probably DuvaL is the bWhb.W go4a Ri'ght 37 htoe.
*ilovm 14a foalily lager Urn. aue Rd oltS *--

A.ussaN tlI uu owW knw ays carry5I5 aUULU large assotmes Nuod -wlttwuIOU
)Ie f AIJS Mhio bL-outy i sa of fine smileawith which to r, a s ieA., I
iyaeau ~iqp~p.. NSAU ~ i~i~ ead e hen ott101111601
greet my ustoiners,11goLA ee btfth bmi s'
11" J#110" of Qarrebae i, F. W. Duval for siting 0 eled ISY odt s
visiting waiMI mnldftjsivee "out hsuy 9d wa&





~ eh wteIgAM1 and uA~ get" b) Vap _11"
m1111balme mai Is S bm vdips SQ1 ner slit lull hustrotiuea to aol. the meef theoompleus 04 printetm
ssestishs aa 111441ft oar-,les40whr meeaeeasoe wr

Ut~~~whwwwm 1- -sbetogltimef na d at igr of d" an combined In l I

W'* WoF.owe Duvcwhen ta-.te, I will aaja gA We leftwlo teNew York WorM
It .nmde. to nmta drasy. io0Dvl liabd0 nykd
Whl eachm pachm fo~ a Th tanliavy Americast












THE D:9 ."EA PEARL. nr H1IG'4FTP
Ave ii.'il '. I ti ~ h le BEST SP~RIG MEDICINE H

l i*l i .* 1
hlltiilt The Palmi~tKil
I .sit FIi tt~Imlit
Th.,~~~i Inv n;, rlI:, ~
file leaS j 1* l itilr lrny liw t it re:
Flo ;'nrl,) 1%.14N af the len*I i t -1 1f The Pald Jury, te POpl, Hrene' Aor tnl i r ont th1e getKnnm rl

B l ,th I% o II I rf N ;IIk L sIl tual 1h o r D eci ed1 T o : g e a h l INfE Iv :ne I t' '
tit flit- r~n 'i il .Vitf.(r't
nxte Ivon A' lteIt gray gown~ Uard bv Eundred ofhoumble i~iI'lv* ;I


till Ino il And i kly. n rc te~ grett K ing" wanl
thee fth n-f Dr. d Jrene hervPra lesn nerle stfli. i l,1 n n
I IiiiI i L i Ii i th lii t o ~upo enwi i SJ sualn .oj i l o pin 51 Dnecied ha. com to bel jeto witiu'rnlzlt'li 'ti, ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ le t onc inovb~ I Isp ~ nhnill eril tlJgdwi~ er ln nmorconiei y lm theyod as~ro the --.Tlch i. --- 111r.1iI~lQ
t ~ ~ ~ ~ ~ ~ ~ ~ ~ nx mor (tilt iiatP, Iti wax1 longt tiU I tliI h.1t i~hrI~i aeu ne tcntb 'e-hsto poble Hunrlnediie thouake, in-wlr -v f,, W
ittit ~ ~ ~ ~ ~ ~ ~ ~ ~ fe Wi iliIh i*tiiIiitf I ul ~ iIIle~ th~tj'~i z, ~~~1,ie 1. f'ntie ter sli- Plad 1unred o1 wayad oforrUOeOHEGY
tAunllil llI liI t'illItt "it in tWedd1111iniJ i Gowne .h "I""~ dol noufq' Sepueidring thaBlo e trin pin
it r ~ ~ l i ~ mm ag ii i UiH~et Wui",l, 3!roo*,, Ii bac l t he o lidt t m nt. o tne pa~ thf el I l srloed 11:141 li t 'I. a iI!r


Iilit :u t IIT' I p gown luig a ~ 1 :14 Ii%~l 1111 11t:114.t Soh l iih iIr lie t h p eiod I f(loopti i'ii t iltti x I r~e med Is snried "Th(i e hi ;r Grne e t po el it. owie'rienn.r;%
1111* 1 Iiii i. va i t,E it lit .i l 111 -1 1. i i~l~ cttg t ui u of'n ion\ Ired awat fii t I N," mh saitS th e Sprin Awih e ke i n rt ho e lt h b A '* i In niil I f lii er
%%-till~~~~~~~~~~ ~ anlly vigork duringll" th. "I tiangesI m frri lyomeffl a d tt un ) ier. Thwla lfe ec gni ed y llo t e'eyitdy s t e uug' _1tcqri' ICre --tv.it, f.
ott?.'-a Ii i'e iiiti'l 11111al ld 'lzi mo' W i tt 413 -il l u trt iII mo r gal p In tl. )144E1t benict h possible spring edic ne r. 1clf tfItar' t t hi': ~ 'iu
1111it I 41 hi l ie ii in im o or l~i l~ I 'it) n t' he s i t it s 1411' ('Itir t INi in' t h r B e n u nd erd r o o ds and ne orvle t i ilt hUM R O ul T HE O AY'i. 1
I'er tiughiy II, ra ':Ii N i4 iiiiat wm l ili 1 4 :I kI i th e r o i tr i t ti read ire Yolitiao (10 1 u i ng he pu eopey se ei t y hagti thein spreindgtd ti* mo
li r :kisii it, eri %~-it fi it ill. ti oiiw linge : lei t sl Il fi le i otin Wlow rld tt, .1 MiN. V n t t h co nte of mn s at o this ason. It h re lye OI wwvl w I'0111eqirv c~
lilt-',1t eh lII.ri1014. Mii n l s. \i', "li li iii itil I lel 4i f u ir voiii 4)1 i'rs. l S tri il; nu flotrs n o e d e rives, a ut me s ~ichra ed bld;rc fiA itgl lIlY n ..-.p ia lp;l I' till
ii'Ifi kl(vil' ol (ull I lio~ l i, I v I itiin i i w a li l(.I for1 iI ti t('lt 1e11tOa l I t'j'~ i lit It find olnldt l no-te blonl te g h n ni ii.giaCiN 't t ttiliiPP list: irth
ti r e~1 1:i. i l i\, l.ev -v r I i e a i vi v o w fE. u ~ ~ i l l tr tn i o t r e m i kn s l i n v t v1! a t h a d lu g th s ngo u s y s t ce bI t a n e ies y l m r c n o o
fai I l ,4 : 1:111 fl t- g I t'l of lilt-i Ilei xi ,1 f e li -it moIi Ilielf I ti ole r mlofl *'Auiit. 'fr lt rvefi' n to I :I ande re10ais es t o nerves bype fe edingth 'u tt' ofti3' .T lni i livt Iit
A rk fi %i es it Jit'ew yili a: e o t es It iiI gi t f I ihiPi1 a iile ii an se 4)1113 t lit' as ed wase! them~ wan ithr dr nw e ner e frt a nd fl 1) i i Ikeilrtht i l~V re il e.'0' :1 11
ill"~~~~~~~a ill 11 :114 h erl'~i to r-nlin lit valtiet 7f~i r re'n sil du~iieol Wil i
ut~le'lii :tel I ii- Sitliluleel i gill': tutue Si i~hit llinter to foummill giiThisllgrandof spring ite' s short On tht'sotilplwe. It i notColy:anaid todiges Iii I~l ueieuv a Io g 0 V 1111'4 1 .1 Ili' e 'I t rv te %-(- Uhf wn li''et t otin o li le I Ila e 'i h 'g 'i tio n but it r ts, a regular, nt ral 13 le t i I it he i''ii W01114 be 'ti le
411 ci ra )Iie' riij lelsl ooIlt 11 ooi r "'1' i i nl ror wil itc f1esht ivi ten, tirle Withut f~k I .i ii pit he iit it e lities r emn d y e Ih eact lyn of a the ow ls liver, Anidi Itd tor Ii i n.''- 'nt*
boliilni4m rro i a m (1t~ o hileT t il k- 111"1111-141h l l tien y flwe rs it( llelil out.4 of th nedsoy t which i n he pr n ot ore lay I I' N-,'e' th \%t Ill, S iss iig ee n
and~is amil vhv' snii I, Ii, h int' iwor n ali lt Ka oll ived. str cullra ,t~sito the btill@ wayls u t mands inctivre. 'lod i e'l Ise tt 1101.ke Vtttlf siu)ftVyl
EE i i~l I U no .' lie' P 1 i ll I t l,'it10 111 tl; 1.'s I it s t I-, Sa id 1 1 111 1 eli i l e l l g o i lmr 1 0 l Iut
ivhe n I-Y In't n e i shiu. T w ii ih' w v. M r, tn, iii'lo lil o l t un s S t 4h ilN go he I n efa to tu s sy stm hat peopllle needs w ould n't- t r r i n l hl l: ig t fl ov t 1t 410
care, ~ ~ ~ ~ ~ ~ ~ '14 l'iaiS1.1 fieiiiig and wiih only IsiA nl ir tugg~' i'hen gnt lotyd o the bd ad b rtTt ak hn elad k them well reniewed nerv forc andi h' 155'1

tIll til ii I ). lowti sh lat f tel uiIi' tilt ls l I's iles ralin rotth' iove'nh, of une h il w r t t the helIlaidlie heZ-j to ,b th of c atl, an r euant ua 1s co-f'etlad Pant
4.1-1111114,1 theui le'8 o t silkt-tvi a I at hoile' --ti l'i-en3 dg lins hi dn." i lr~ 1110 t t444h1rsid if i ioter.'' sa jd lIcit.j aned athyati Dr f tre ne' s ler a v PeIttoi-tld l ik'to knw wh en
S I do 11.1so iit tsiitlh' laspe N.13'1y liii i gut n ii. dien, tMrs, eVin. "elobi I'l i le~ ou w ne klit bodaNd nerve remted spig mae en- q oo i nt a tleu sitt'' ugnelI hit s iiunid in cae"pl nfltoyli'-'f-I 'Il'ui tier 111) 11t s 'eatr ] It lied tit( e r. dug ol silk I never C tte Au tireay fo plu re,~ heIat-iving veete- a~? c r k e Ii-it oor." si'l Piar11111"
wll.Il til- v ice 411,11 llwl~v '. f 'elt ithY trolel I A114' Ta ihas e d k Tlli it; o tli I i k u rv itrd and t I n'a t t I u t w a e p e n e x ri sta n i sil r egi a il
'IIie ]lis gimngs 'i)' iti mih'n'~ tldrl ae r em i ell and thteepem giel "G od Bu t h~ o, Jien. Iti iii s hivc'
tile girls for outl gleuwnl th en inn lea the bed~n Iid in.s la W .
Iny ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ i Very own. It th'utgh Ilow othe. htwelln on f vrfir ~t i-l.d rn ree month, so onre an e aete xm4tlt ^1001ai ehi I-n wtoiitfior1.hln -, Il, t litl e eelen stai'l is ar btil p oer, hIlitl n eitllo Iseie l'ia nn ou tta it is th eobetsrng t('tieeI hnu helal e e r.tli
~~l~thc. 1Fi; wvl's r'tin tolle the wish1t of klew anditle thee
idelt what Iv o~ t i u Itivr o ue tli.t tIN.vr fw hatgit m hi s tl~ing, for wan flinta h ti d e.ttotu i o ofthe' old renii sd ed that eve rybod to us e via P asn "' iet n wI isn
(10N nuip,11011- tll"4pet a iin gr et-Ae'ry uutii ii offi-r "ow Y0 e I fir. o 37an thisg in Mr.v Sl iel t t Wotx
abates?.l MilI 0want(,( tauhat Guboodaneve reedyh Firs madet ein- I lettert isBeeail'
rh eii' t w orI il i a r e 113' litta g~ liilie iut r i i t( pon droust N ha il eArd, c nb t hi g n w y u n v v It mrte t m n a .o.ur"h n a y I d n t t i k o o n t i u t h v
of a l g p n -ll, N r a t shi eli tf ,I t i n o x mfi tf i u i i l l 14 aV o C r lt c o h q n i t r ~o lie l it o f k no t'' v ol 111Ii li
tnhe g~~eirlt hadl ti g,(I % k litth Iiimn b i'- Iite'ri 13 .1 (.tillithy n l IN In fist, for onc l ttlh owother kIwa roued wieath i.hd he, no onetli11 ca t th nele ra v 7' ,it-Iske h'h
cothesh i-ad r s, gm i ii't Ieas1111ivit l'it g l It 11114 i' e elt' 1it?1a g et i bhl' oilnmti 11 I fltI ri st y litd seeBer"th a ng "and ou ld not t iste ey acou t ofin theih n w wh t e t ee
thln i l iti ltii e sson fpp o rhe tlhi' fit lni t'luo it I liin fo an op ra ha tt t wo it I l o ou of pan ind mee y h eeayd y to tin e rin any.- tthi tng In N i S'(eii ile f It."

('(ii114M it It' l t sl l'. Infatt, llIg g am a lijo tt very 11 a to el thf t lin t Iow We( e I "calways '-'m launoethnyingm tm c would ~''h elil tol lis4111 f"-Pllil.
it- huV iittijr fr lii ,I reem tt e ~ ,u' Nin g ilye111.1A & Io feer hanl ed atot .er" ) .ntw n t iie sort eso. Iiy hN. to strvysf to have%, M y~ Lf ti log as g e tit hint lIne It ai lItle itik kert fo t e'n intili- luit'rll ap titi i t iaatliizt un 'ttil wa tf or Itc e A i -'is g o e t o k" al l troubh ed wt h g i des upt work att od ra ? hiagoe lt-'or.t orf- btt tiwork. 1-1te, it ltt r viii o 11i~i AvIili'l1 ttit i',fergi al n nth e rctlt :rs ". lantd co l w o s ee n r os ac nd oiserab e ter 1 iic-T h Chy or on e s'sleroldOnghe r a Illa fi ti' fo t ~e r g l r I ilx a0 tca'tal wit -tn T a il hcithas ( lC" ,,Do y u tlise verhta nd d y wtly p p i ,c udA i ad iih ga d a t oil'yar

socia' i il'P111hsc-1.l its-et whued 1they heardv tl" at11 hnst t Ie fie fltitice m~~ wrsthrnn want lat someoine, rycomendeud D.:ein p-'t-tdt e aci erl
inohY bal f ubctl pi or it,.fornthe bof, thtir tItII r itats prto ti'far I mst fori ty ieas oI'i' as te bwe 'ed. trie oefe bhttle legd bea as fallong in--hh a s~
lir with daclittle sons for forft'eil-3e li'. gvett gils. intl th i g i e s" sI' t things nihe A -!,, il gindin hero he n I ikdu ;hat;m ed ue h ''li ot hicag Recorid.t ture I f2dit~ thatle lltl'r either(' Illi ltart, I.p~nts waii n 13Iah s sp erd, and miweanes TholeT'? at er ohft '1111'I'ms il itiOld
'i'ucnthre er' awas eho les tht 111l olno nIt islft wastc reaed- neh Ie i'ht m i ohr.'vve b-'rn soursto ach wentawa. Iuse ho3tuti' "h oi' l Is n'otbl h t V14et'I7t .Ongeclass: gotvwi fo r aeiten htab cr ati. It iil'tlt WE "atn litend rult n'ewt me.atl It'h t tried'I 6.1 'on'. thint mtott lety? TowikneowmIcnno 1 ahr

~~t'hen~IM :tiiuitiltt thesee mit Iord thlr' wallt Atale aist' seomeoneo 1111.ti~tifti hdlI v tieoii iIei m a ap -abrdcomn de prng nee oliv isin te t o eihoa'a.
oi''r frti na e zi~l ~n?.wus ifili tie' ws t'h" 'ey Ie'r te' alt' Iit e ti nnot'lia they: ifitih iT h i tl wos NIn- so en mi erle, a lays an t enlng, rlway Tol i me to fit dai-e g i thout
phietiite i n oerii mou' th 'i) vey uuit wa ') g le'f g ii' In si'i t le'an terat loiig t'iei va". eti ent ('ro'itiey I le in. panbu ow a k egan t fa lng'' i'O-Piile aTiln tiretls i' 11
itybe by11 a l ie' litt e ll to~I ite ha h II theii' ot heriu %%e a to wli ea r o tI t l ei git futill i . 1iey s fP)Etie'l a h m e D r. re neb te ru' lo n '~~~ecilhtIit ii l iti~ite
feer ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ i ad.' is'l Improve.t II' ttalt. eteni to iat all right I"I t hiiel fquotllesei' 'ul lfiIyi'11 ttegreatt evere ey hsdeal, o i s hof poetiry.'"li iliii y 'owsmik
Inu fo Ber i th th' aithn. tle dia ughte' r. Avt'r' ht', teitilit! Ale'i Ilie' eflin't o s tI''cil tIill,- I ittl hnl( nh rg g*t f t he d Is pi ery ad tpre:scri at h;~ of adl- !is d jite us i feel' 111011.1j -ii TlwIi'lior by te'tcli 11h u leo s for Itid o'hiireh s wtlerI li',fs iing, fiend iehe n'v ht t iit its Phl -iltili tIf ysetilrltv nw hscin r ree f 3
lathe iI'JIO'l iiitheltt~ilIe lh o Ii~lli it''t her pa 'e an leeti- uttlihrp liiacI o icruinIle W h s L Niap ewd an or miy, w hoknes sthilin' [in( iidout eltehli I sIa'i Mitss of( ;,5elth Mri moter We'vetit 11aMt Iitu e'Iilt
Tik (I tiet iter nii' til ltogoI lit'" Ith' 1hi.' no!iuntillpt N load. V eeii it f sttIland'sour'stomach went away.Ii -tiout,- a said: responsible forpitbabeneficial action,
Itt'n slit l Ait i' h~iti ulm: V Ia t'el f 11111 1119 flinl o t' ttIiII e l i'' nis lk be.sd ho dredftS.i 4: i~s andu 11n g-ii tt 's~ ande wols candb coul d ree of nighitf~ue t f itn nee u t 1witt St itli t
fle 'la'c gii s ii I ttIS e' hremu t e'iik ltteit( litln ttii loo1( A~t fery 311iiio use Aoum, TAnd :'s cih a e Ier uen si by tte. an o lit, ii'I1 Ifoli''to a yyt t i nk fr s' rIlerha- teni c-l -tl I-ihIl 4itu't ofNt thetv Buthln 1'zrd le ll lkeano aiicann wlt ahr
lice?.~~~~~~~~~~~~~~~ uteri" to sa' oil lit-, 011,i' ale le o bu i ie I Itlt '' hi gutt lat.'e'" 'Ige c 'tlit 's o r li e ntion'rnitm'*' c lilt v- wS ll-v r t',Ult. I' tiie guilty'' i il l Ii II i,1 liiysaIs te waalrtoreftadd an a fuy A g stIt.oi smu arItsokh It~
nnd~~~~~~~' illkandjt hetjl,-ow pttua p%,Itret r-eldon't thinkr I ever bllIorei!''vtit, b in; stl.ind we'lor w e1 ay' wokiwthot a y toube.indh1;1L..eol Stll,
Be-huP. w'eal calltlhm (11) IN!,t' It ni eao an hapiy ..-. a bitrd th t' spretty Iwas
ttirt ganirla fit'' liittIl3 l e'it'-a dnie itt1t1t,14 I lo li i 1. 1t te" tfena, thear- iiui'lit eli I'li w I t litpa le rAPy 11 si lone oribed always pifrn ,aw y o d a ii't-he erq ile nt o
overto triil')' i s a t Ithat Avi. i llfil"l' g a % sotdo I r tlisFh11 'uigherl ow. tit,'!i tioir' raw !I talluout knowll life3 Cnvictio no he acke of br wain Be Q;40 eggs.cv l'oiiT l h te 01113' u'mltile
Ile liht i.t iu..'..e. V. mtire to. theln 1111e Illfrt i ~ j te lieii rutln for iote at liumgn)t ls ietts tha for tl- alatg lisi.4 tlitlnme







4L




. ...........
1(,Illrtllll.ll limor. moiwil fn-o. Otir 100 .'.'r A C.IR:.',3 CZ1-11CE.
04 L) ILDRE
Talks';A bour l'i-41111 11'1 C 11 .111 4
I)- I'',. oill., till ot lil'o li\ -114" 1 111 1
inankindl ill till14-111' 4"A3 1, Jq lilo a IL
.:I I' C I I It. 11, ill I Ss tof o)4J :1 ii '. I I:k I lit hkitrik
of it. Ir it Itiall
MXlY :ill- 4101- flit- kimllill--N i)r \I. i.,4 of rinisitig Pi,
Ilici it: .1
of 4:11-111:111 shoul(I 13:1 % it y ill,(. tlikil:11;4 :111cl. this sitilatioll that collfrolit-4 ) Jll
their wity Into fill- litiloliv print". S1W r4o, all, Ilart-IJAW till' ;10-itiVill for :tit eariy arrangedd Y111-41
was ridill" willi :1 coill,11. of M11,10:11W, if ,lilt*? yvs; lilt- 011tift ill' told Jige 111111 ey to I!e 111iii tin! .14 Ito
Through illo It Jlago tir vw nwir anifil fliv wro-k fill""l, "'it i'll
Oll not (lit \4
PotIlfaw, ret-clilly. 11,1.1 Ilaiiii.,will till- I-H of 11-4 o\\ 11 IversollAily iq Ill till' begilllilge sf-1141,411 it -If till- Ililit: if nlit to fiat Ille
N 14.4 :lilt] tit(, riti. -it) %\ i;
11-hl :1114-Itl il'll. N\ hilt, w o art. Ilk fill- fit fill Ill Ilic I ti:h -l
4)JwI11 41 :1 tivilldow IN'lill'. Illooil",ii'll (.r 11111, 1% w lllliv :. fit cre:11141 I \\;Ivo [Ill
till xi'l o 41 w4 it iii akitirw tift. lit Tlwy 64141 of of ;I tit -.k\.f
w ),:I t I lit, sit 1 1) f HIS I I 1 11, Hillillply railed for., :111-1 li-N 11111.
ill 1- I., lilt liklitil -Ilc
Ig slivillill )),I It -I-11 fit 1 .1 cowiwr or iiii,
thilt it 1\':Il 111%tol.l. I licrfil sill t: \-iLnbr. constwitly ilivreasil IN 4111 lilt' Sill' TA r, I It 111-1
hat It li-valt'll 411 1 )w iii-rit'll or 4-njo -nwiit. wi, I it(. 10,
years 4' r"I'M M. Ill A :'it MV ril:lit :111,11 lilt.
for Qi1cell lit-, Koi:i- :11141 tl;I. wi)riit iii-til, iii iiitm kill. rhis ll'llnist or twii scre 1 11:1,11 lit I All. ill It
the I t, full"I. I;ll!,1 W .I till-1114-1. :114,11L a l Illy lo i*z. N\ 1. 11,11 It I I I, x i, 1,
11, 0,f 1111kiii;'.1. to g., flit %%-lilt sl)ii.it roI(Iiiii-i-s fill. it,,, litirri-itim, Ito till' Ill o It- a wall nt 1-:1,41 L:I;l lict, :11 filitill wholl :1 010 loll *cwpll
11114" If'- Q) AVIII10 14110 11,141HICAL SlIO l1i4irp 111:ill Ih:li we Ivarli to IoVil twil- (If "oll" ( it i'milo ill nt lilt, rIvIll :11111 Slie Ioli I till
Willi. Ill 41tiliriii" Illwycli. 111111 fill- ')1.('P a. I JI(It'. Not 11111t. lil(f. thi% In I .41111t Ilrolit, two foet IIII(It 1. WIA NI lilt I. it Iwi
W. Ill, 1. v %\illl nli 11114.11t
4111111-11... or in hoitr 1wr M p iy re- :111ti it-litirl, We are to) 8111111 ill(. wori I 414CZ11II'll 114,11ig :1 Sian, Slit, Illti, 11 '1.4 Im
1.. Johnii. In Ne anti I Io lilt t .1i
111:11111,41 at III$- willilow, lipt-:111,zil, Wit lo\*4- ollrsvh-cs. We Will
1441 I'll w-cill .411f, Willi ti,, Fitv.pay tak-(l, ro\-ittimize (or the iliour-4 Draft )lilt) Ill I
Tit" l It Itho 1441, Anowlill riolloWl"I Cl I
Owl 1611(. toill th"Ill Uh. 1114)1114-Illiq others make no For a 110it ti-t-I oksl. illl iul- m qlll ;111,1 1*, ;11141 -Illy tllq' IAIIIII Ill
WoUld trf:lt till 14) calo. linill lit-111:1114 11poll list, lint] 111,41-:1111 of 1,111141111. Ill-m-i-S4111. I (litill't 1'.111
choutilmt, very tioon :1iiii rfliIii off ninlill ii)g otit 1.) foroe our dvimillds 111)011 11111k, slikiiiiii lit- very 111,111 V 11, I o 1,411140 111141
Till- vhrvrt4 or iii Tile fill. world, Ive Will otay -It 110111P 41111(btlf. to flit, to Ilar, flit it I ;1,11\ iwaz in 1. Iollldill,, It I
0
loiiiiig ol;tv the Pchonhimster rit-cilhed all-ine with our soils. Illarper's 111azar. lilt- flit, rti4l-itanc, till 4111 Jljlllll 11 l. It\ A ilk liltn noto, fn:m her Majettly --ayina thrit over Ili(, wm-kiii I.Oll1l" 1,31,11
tit(- Uornim schnnIvIii1dr(tv- 14111 Ili der. Am I lit, lot so it \\ I IL: lit .lit ItY sit(. .3\ 41 it 100 Mid till il. 111114.

till, h itch 1411" 11.1 1 1.-,. 1 It'll. it, :ill or ri.,in, \Jr. Illil Jillfli-A
T" U R %,Yit, ir 11,3. It'll" 1111,%. COMM
Llio %%lilt croallk and vako lit fill- 1-11 when tho Ienlo 1: oml 3t I
14-:11 it( 1,
Llgvo ilill. 111:1t 1114"re Was Jov Ill flit' W AIS wo I I.\ a Ill I I I.% w Ilell r vrY 111 "1 ). I I 1' 11:141 Pal i"Ilt I. \\.It it 16111 fill, 1111111111-4
till:. .11141 1111.4 is Ill C1.111141 Iw 111.11,1111,41 h all ill"111,41 4,41 lit'
villawo Ill' 114trilif') 11iiell Ito( Ilo st.1toll, Illtell low so tit-- I Ill 4111WIl. I
W 11,11 i"Ild
I,,),- it,-ii III(. r:i,.t tij:lt lilt, 101oprv- Q11jik.11 Noptilill(.1111111:1 Jilt to tem- the gr itid. Ill 11 1 -m .1 111:11 1 11:141 11111 .111. 1111 11 1.4 to-1.111 till
I's I ilere P0 14 ly loyal little perillice" 01liplell 1101-11:1 of I tit ly t 0 simill-411 :11141 di- 41 1- flit 441.1 ilf till, vollvgO CiNtolll-ii. Slit, 11:111 ill-it Mr.4 -1:1111"A
t-. goofl lioliscliveliollig. liltell pulls tlivil, 11411 rt-0.11%1.11 Illy 111110 111,411cl..
I lit.!43 lk 1.1
vie ittwilt.iig of NI.iN*(,IIi.JIt% is a lovoir 4-aro,, mllq)%41 .... .. :11,411it 4,11414,11. 1 111.)IIzilt olle nrli(ll, ill
A4i.Icp to Hat-firlor fliffila. (if ilogs, IIII(I lilts taki-ii many prizeii S I It g'al lilt or s:,ii,4r%, tiiiiiii.
Sollic ( .14-4-111-1111 Ill;Cco to Ilachill 1. 11,111 4 lilt. slit, 101 11114011 It
with her w!re hillred fox til"I'lurs. 114.4-okin. of v:111ill. A ill. :11141 1 0-:1111ill nti llill III 11111101,L:11 the 4:11114, I'mill) 111;111;1,1,111. Milt
--11-14 Is IIN. it wrili'l, In flit- IlitI's- I I'll 11 11
A ititaille of Q1141(11 I'll-torl" III' Prill- fit, 1)(1w4lori'd still 1.,14 :IL Nltw 1 41111,11, :W11111:11111 iii:tt iiii:,Lotilito, Duchellit of ArIZVII lilt 4 placeif 1 wo or I lirril es -I I I It 4111111 1111 i I ; lilt It -I
illien given hy 11cl. Royal IligIlliess to silly Ill-:11.4 fliv t1l.-I Ili 0 1 -.1 11 Ill- lwar:., In Iho lillj 1 -.11111 Ilvr :11111 Ilink''. 1:1;11 lilt- 4-141 l';I\W1IV it
I till ilown 111:1 Ily ill w4;!II_ (14111t unre Up. 1.11 "Ti I 4111141q. wi-I 11:11ilcil
kill 1%1141. :11 Civ 6."11111111g, fit Ilivir var- Ille city of Millie"14istor. Iwr 414111 111:1411
Farint-r. Till- slowlt, lilt- 111-411.1ters, wwKr(l f, lgllitek it ii-mrs a (I it y. ii-ollI14-11 of Victoria.
1.o l. 11111 It I
'I Ills iiul-(-,-:iry, !,lit Avs1ralin, half f(Ir flit- sixth til"O re. er l'ill-ti.
To Prare to Nq.\\, Yl.)rk Still. i"Illitl WA,
It was Ill't wiso, 211tholl.-.11 tno lwrsliil lilt. wololtn'4 Nuffra-w hill. It 11-loll" wa t ip orl lily top 4,11oW J
(114.1-Y W1111-11 4 11:114 also rejected 11 proposal to Milbillit a col-114.1. plist f;-Ili
0ii, WISE WORDF. 111kille-4 14--ki 11o'll Poao* 41
11i'llr(I I. tile it I Ilestioli to it refttitndiiiii. 111111111j: it 11111 it r ilk lit 111:111 It-,
"Tho iitosi prolit,11-lo Indtilgoref- Ivi; if 1111% It,:In Pownit roi, I lit- French it Will, it till rllck,4. A Ilv:It- lrjf r(..Isq.4 \\.ill, lilt, Inotion-41w, I"11111k: 111111 It, I)it(
sibil. i4 th.1t. givell to Fooll. wholesillm, explorpr. Ito about tit start till another vill. of 911111.
recreation. Which Ilia oilly fillprovi'lif (.xI)-dIt loll. Thisi tillil. Hit-, wIll P4111(- iIIIII, 111,11t is "I.Itilliz 11111) :1 proll, illgi lwur Rol P, ',WY %\ 11
1111111)11-41 hy lilt, Y1111119 1111141iff lit, 4.11"
lilt. fillaill V of tilli".4 effort hilt .11yo (,X- Irate lilt- Sahara and Writf- R 11,001C I'ratiklln. rit'll hvr \\ iiII 111111 1111111111 11111, .
tondif till, lit wiliell to Will Mll('- ;II)oIlt flit, f"'INtollis of Me r..-ItJVp?4. of;ooll 114.11oll.4 i-Illiolol., its. awl live tire Imik livi- sollit-III"", 10 4-:01 I'll I'll'
The period of :1 WolliII11'r, Dr. Coliall Do.y1f. SaY4 that tit(' saill. flit. Nons for our own (1--ils. I itil-I wililill Parl'), III-V 411M
Uri.. 1.1 a(Ell!" P-11olild foi-Ill it conshil'i .. I I /.I .", V 0 L .
Irivell by Ills little girt Wll('Il tit', 7( Nothiiii.: sooner orcrthrowit A w"111% stri-el. If lw' Wilt"'llt-dablo I-lellivilt ill a youll rettirnid honte after Ills ilefent lit Iho 41c 111111orhy. Sir Illiq1t of hi-r illill not 110
noll 4)
reemitition. ()it this point I speak Willi 111witilry elef-floll wilm, "Oh, (11111- Ijig-y's Imikiii, bill. I'llit lilt
voi.vietion froin wy own persontill ti-, dy, 1 ifin too sorry yoit (lift not pasit. it, will. 111le M, lilt 11 14)
perit-isce. I (-an rectill scarcely a day
evrinin wov tip he 1-110"ItUl .4 to it
MI-4. It. K. Bruce. tile widww of lilt, r:1114-Y killed's Mor Illore ('111111ing to play with Ills doll its If Ile %I
:n flit, course of whieh I Wive not spout only volored llian who served a (till others. Charroll. little Iiiirl I siv:11411 of It dtIli:from one to two hourm or more rundint.; URACZ IFOU A COINER P( 8
term lit tit(- I'lillcd StAte-4 Holkill-MV. IN lime tilly, Whell 110 Illid N14111
something milbstanthill-himtory, polviry, "a Decisioll of cliararler will offliii k7iVe 111S little t,411 it lilt 1110111 A 1411149 fille, Mrko.
political eco-flowy. or histoilleall rr.- now liend of lift- woman's department (ir and more RuCtlealf Method In to to lift Inferior mind vomitialld over it It) Illm reproat It filly.
uf t1w Tuskelsop InsUlluilke W Ilkiftem- t -a.- ww.-", a tbwtno ad 11 r 4)w yiju do d1juse pour
Not only have I found this it is said that comparatively verr Post to A otolle It UILtJ I W W It t. why, Rollo, I
one of tfi;* arrest pleasurips of my lift- -Ight feet fr its Ilane, In a
few women In I I no looked aiil'
--ogland rend the dilkilly I I'lix or
I)ut it hap, to a very considerable ex- tin(- Will) tit(- fence. at will call for rellilitill: still %-I(wm from Illy hand WHO
HeWHI)aIlcirp. preferring the weeklie
tent, inade ill) for the lack of a collect, lit, vach corner. -American Agri- worthy action done.- Hobart. 104 mistresto it liflnute or two, as It he
rhis to given no tit(- calls wily London two aho had said.
education. StiMy In ottaxion nnd out lilts Ruch a wimber of high chips wele Culturist. Ito. WIlo has niver deiiii-il hinitis If for wi-ro thinkilig over what
of season. Netier stop half waY along ly intilgit7ines. 1111% %tlllt % of Ulillg. 1!314 11111 g13II,-t.1I Ill lit a very repentant Wily. he Ileany line. I Filtart Wills One Variety aftPoulfry. glill Io lick hipif (loll; nor (lift fie stol')
M ister it or keep at It milil 0111 Joys (if charity. Sw(.11-111114..
forced to n4llnlt it han milidered yort. Ntlox Helen Could nlwn)"4 4"Neltex n Selem tint- or two varieties of pold- 1,:%-(-ry thile :I man swilem, "lit I he 1111(i licked her till uver. That
,'rver f4irgpi or overlook an old friend. great tl(.:Il of int-ri-tit wherever "it-- try thilt still your fancy anti require- (14) "M %%,fly of k
i more who-ii he littigh-4, it ailds Motllcand lillike its litany new ones ao possi- n() %vooniall lit Atileriell intents, anti ido not attempt if) kept) 1 1 Another 111114. Itollo tloltptl over to)
tile, witholit the Fneritlee of R whit is better known to tht, illore. at oily rnte not until yon 111vol thing ((I Milk Itinginew oir iiiii. sit rtw. JgllII4)1* fif
of self-ficsilwet or Individunilty. Df) and ilierv Iiii 111wiyiI a great I)peolllp Wi-11 nooplainted with what yoll 1111-141AP41114-S'4 11-01114blIS lit 0W 314-0111- visit it III 114,
-lit off wir (Itisli-cm. will lit mir wirow, Itell 11,4191ty Wmll, too.
.4 curiololly to slit, hot". have. ()fit- breed aloue can Ilk. 11011,4pil pilolinit
Inak,11111ch jig it 1, 1111in to Whoill ill. WlIM lillying flit, Viit
through otir friend; that the best oil- 'Mrs. -fime M01. Slulth. lilt' n(%Iv anti varcill for Willi less expeliple. and 1111%.Ing Conly regillar Allgily 14, til,1111 It paller ovir to Mr









an un. Margery, joyfully. And the gra
ZLFL CU T B EEMdisturbed smileo-him father, turnig hair was false, and the wrinkles were
T h i r away at last and rubbing his forehead put on, and all that dreadful powder?
Arsal Organ of Wakuils Cousity. VIorids.
...... g Seely, gazing at her daughtor-in-li' "I begged himv not to." said the
PUBLulnRD 'nLY UDAY. BY EMMA A. OP with a dreadful fascination, and the i pretty bride, raising her (lark eyes
........ girls, shaking Into chairs In dismayed sweetly. "I told him it was cruel:
DU)|VAL,, ditor and Man..itger q4i iq~ -f~f~~~
.v. ...... r and Mngevsilence. and such a time as I had, saying all
J. M. TOWLY.N. Associntr VdItor.
..Your last dOay?, Deart dr u aidlt'. "Well, mother," said Harvey, light- those shocking things he had taught
CRAWFORDVILLE, FLORIDA. "Tou' last day? Dear, dear, must said. 1 s that's because ly, "of course a new addition to the me, and keeping my wig straight, and
you go today. Harvey?" said Mrs. See- l'm to I don't think she family is an object of interest; but trying not to laugh! Shall you ever
,Rntered at the Postomoe at Craw- ly, looking across the breakfast table would auty. And as for don't forget that I have an appetite, forget us?"
fordville as second class mail matter. at her son, with affectionate concern. genui lever at accounts.; and getting married hs rather Is- "Forgive you Oh, my dear!" cried
One Year inAdvano.... .0. ... And her daughters Kitty and Mar- but she or paint, or any. proved it. Take off your bonnet, my Mrs. Seely, incoherently.
Oneean o.. .. gery echoed her words. thing o She's never had ov Tke offtyo An s e hrentlyh
Six Months ................ 50 Centa "Couldn't you have got off for an- the tim for such things, own Here. Kitty!" And she hurried forward, with a
otr w sKitty came forward with a set face sob of Joy, and embraced her daugh-rank ....... o at his father, brearl- Poor girl and tightly-closed lips, to receive the ter.In.law wildly.
,oFrank ieverett of the united States Ing a ht roll carefully. "Now that But M turned away w.h marvelous combination of beads and "It was rath,'r rough." said Harvey.
geological survey has been in the youre partner, though--" an impat n," silk flowers held out to her with a gaily. "I flt like a villain when r
neighborhood of Ann Arbor, Mich., for "Now that I'm partner, It's hard "There then," she said, disgusting air of sprightliness. She saw the way you all took It. Dut about six months making a study (i work getting off," riesponded Harvey despair it couldn't be was afraid to trust herself to speak. you now what you said, every one of
Seely. 'it was all I could dlo--" worse!" Poor Mrs. Seely, sick at heart, had you-that it 'couldn't be worse.'
surface geography for th government, lie paused suilddenly. Harvey his seat, with an made her way to the bell and rang it, thought I'd demonstrate to you that
He finds that the site of Ypsilanti was "What was all you could do?" In- energy w t bell In the castor and dinner came down presently. it could. Dora Is 19 Instead of at one time the bottom of a lake, whih quired Kitty. jingling. "Turtle soup!" the bride observed, 40; she can speak correctly when
was connected with Lakes Huron and "Well." said Harvey, laying (town "This III sa id indignantly. looking round the table with a girllbh she makes an effort: and I can heart
his knife and fork, with a beamiui "It is m )Iurt iit is uJuut smile; "ain't nothing I admire so' fly recommend her for a 'willing and
smile, "here goes; ere's the news and narro d Howrensible-pre. Just pus that celery, father-in-law, obliging.' good-tempered and thoroughThere is a great deal to be (lone to I've been saving ip for you till the Iat. sumably i people," Harvey Delicious! ain't it, darling?" ly capable girl-the sweetest in the
make wireless telegraphy applicable from a natural modesty. It was all corrected, terly, "can say,.in "Extremely, my dear," said the world."
to all the necessities of the telegraph I could do to get things arranged so regard to they have never bridegroom, complacently. Mr. Beely left the fireplace anO
isonel that I could go on my wedding trip a seen, that not be worse,' is Ignorant and vulgar! What dread- came and clasped his daughter-in-law business; and by the tim that d month hence. 1 am going to be mar- past my c slon." ful things would they discover next? In his arms, with a beaming face, and
the function of the telegraph will tied. "We wll of It," said Mrs. It was an evening they never for- Kitty kissed her effusively.
probably be so enlarged that It will Kitty's spoon fell Into her saucer Seely, hol restraining hand. got. The unfortunate parents sat with "It was a dreadful lesson." said Mrs.
take all the wire lines and wireless with a clatter, and Mr. Seely dropped "Discussio I ot mend matters. pale faces and unsteady hands, star- Ieely, looking up with a tearful smile: lines together to do the business Ratio his roll hastily. And you be married next ing Into their, empty plates, or looking "but I am afraid we needed it, my
"Married!" said Margery breathless- month?" at each other with fresh horror at son."-Saturday Night.
factorily. And what of the possible ly. "On the Harvey rejoined, each simpering, senseless. ungramapplication of wireless telegraphy to Mrs. Seely alone remained calm. "Of course I all be there?" he matical remark of their terrible daugh- A RACE FOR A MINE.
telephony? We may, after all, be She rolled up hber napkin, put it In added, rath ously. ter-in-law.
only on the threshold of a wireless its ring and looked at her son through "By no id his father, Kitty and Margery excused them- A Midwinter Diah to locate the LE
age, observes the Now York Commer. her gold-bowed glasses composedly. shortly. selves during the second course, and fler Mine.
She felt, however, that this was an "You coul ly expect It." said flew to their rooms to cry themselves "An exciting race for a mine took
clal. Important crisis. Mrs. Seely, 'hfully. to sleep, in an agony of dismay and place in February, 1896. For many
When Hfarvey-their only son-had, "Very we Mohammed won't mortification. years it had been known that the ColThe prospective development of ot with commendable independence, left come-' Yo ard the observa. "I shan't think of setting up," said ville Indian reservation was rich In
sub-marine boat Is likely to nuke a his pleasant home to "get a start" In tion. We sh you a visit Immr- the bride, rising from the table with minerals, and prospectors had slipped lew demand (in our naval training sys- the neighboring city, they had il diately on o rn from our wed- an apologetic giggle, and with the last in, eluding the vigilance of the Indian tern. With only one such bat now in vc.ted great things of him. (ling tour, wi ir kind permission, of her d'ssrt held aloft. "I'm too police, to explore the mountains in
Ile %% P':hd be' rapidly successfll; he You must ka ra." wore out. !f anybody ealls-o' course northern Washington. But long be.
existenc. the Holland, h rqur would llstingulsh hhnWf In the prhe When ,e house, anhuev an hour everybody'll all--Just tell 'em I'll see fore white men had entered the In.
nmxnts of the lervco lavn lei t 't l y resslon ho. hd hou n and amass a for later, he had th, quired permission. 'enm tomorrow. ('o:nl on, dear!" dians knew that the top of a low

volunteers; but when the half-dozn tune'; and he would woo and win mountain near the nation's border
vessels of the kind now building are some sweet girl. with a long row of kissed him good In an injured and juvenile nod over hr ::boulder, and line was covered with bright blue an,',stors-the 'eg,. being them- reproachful way nd his father had with her beaming ycung husband fol. tones, so gaudy that many were car, completed it will not be possile to rel- sives a good old family, were great shaken hands, c( ly. lowing. rk, d off and placed In the wigwans.
]y only on volunteers. and it l'cl ally respeters of blue blood-a host of But his ears Ill rang with that Mrs. Seely wrung her hands despair- The prospectors knew that these gay trained force of "submnritists" will be accomplishments and it heavy dowry. odious assertion "It could not Il, lntly. stones betokened the existence of cop.
worse!" and he s thoughtful all the p r v i s n a y a h n r y
needed. The duty on these vesseih will Their hopes had seemed likely to he woe and o the "We said it could not be worse," per veins, and many a hungry eye
call for a high order of skill; it will fulfilled. llarvey had proved himself way back to th Y she said, faintly. "But this! How was cast at that rock.strewn patch of
posessed of remarkable business qual- shall we endure it?" ground before the government lifted
bepOoseshead rrise uiness a hare- The Seelys wer, In a state of sub- "I shnll not endure it!" said her the ban that kept out paleface in. a nso very htazardous. O..ur s5.Lhd's ities; he had risen quickly, and had rehave never hesitated to volunteer for gently exceeded their wildest ambl- dued excitement. Lusband; hi'i face had grown almost truders.
dl H'fvey's wedding tour was com. careworn during the last two hours. "But congress passed a law opening
dangerous work, as witns Cushing's lions by being made a Junior party r em pleted, and they lad received a tele- "I shall send them packing tomorrow, part of the reservation to mineral Iocrew and Hiobson's; but the require- his firm.
All that now remained to be desir' l gram that afternooa to the effect that and If ever he enters my house cation. oas his safe conquest of the beautiful he would be "on Land" tonight, with again-" "Waiting for the president to sign
met by merely personal bravery. A and aristocratic young person of thl/ his new wife. He brought his hand down on the the formal proclamation, two parties
new rating seems needed, composed of dreams, with her many talents aild The dining-room table was set for table threateningly. quietly entered the forbidden territory
trained men, who shall receive special substantial Inheritance. dinner; and Mrs. ly wandered "But that will not help matters," and camped alongside the promising
pay for their very up work. cam- It is not to be wondered at, there, from one end said his wife, miserably. "He is vein. At Marcus, the nearest telepayfortheirvery fore, that the arls were "ed; we are dlsgriced; and every, graph station, two young men waited
me~nua wt to nity an olr husband's uno cad body will know It. with tense nerves for the ff1 r'cll ..
Srog htatr. lSeely fumbled tier with his eve ng newspaper; but There was a silence. that would tell that the president had
brought with his watch chain in nervous suH- he was not read It. Kitty and "I had pictured her to myself," said signed the proclamation. It was a before the navy 'department already, pense, and that Mrs. Seely opened her Margery fluttered about uneasily. Mrs. Seely, beginning to sob, "as a cold, gray winter day, and the snow and will be provided for shortly, in all lips twice before she found strength watching through the window for the young girl-a person of suitable age was piled high. Late In the afternoon to propound the all-important que- carriage from the railroad station, for my poor, misguided boy, decently the word came, and there was a simulprobability, says the New York Sun. tion: "I hope," said Margery, with a ner- educated, and at least a lady. And taneous dash for the horses that were
"Who is she?" vous attempt at cheerfulness, "that even then, when I did not doubt that waiting outside. Then the race began.
The Torrens land-registration law !s "She Is a Miss Dora Berdan at pres- se will be barely decent-present- it was such a one he had chosen. I Plunging through drifts, tumbling
growing slowly In favor in Massachu- ent." said Harvey smilingly, able. Think of the people who will thought myself the most unhappy down declines, toiling desperately up
setts, and in recent months the court "Berdan?" Mrs. Seely repeated, and call! I hope she' won't be worse than creature in the world, because she steep hills and bounding at full speed raised her brows inquiringly. "I don't we're prepared to see her." had not wealth and an old name. over the level stretches, these two
has been doing about all the business think I have heard of the family." "She couldn't be." said Mrs. Seely, Surely it Is a judgment upon us. Oh' horses bore their riders. Sometimes for which It has facilities. For the "Not at all likely," Harvey rejoined. dismally. was there ever so dreadful a thing," one was ahead and sometimes the
last two years the record of fees paid "They are quiet people." There was a roll of wheels, and the "Probably not," said her husband, other. The sun disappeared and the
over quarterly Is as follows: January, "Berdan!" Mrs. Soely repeated, twinkle of the carriage-lamp at the grimly. hurrying pair blundered along through
389,$9160 prl.$1158 ulmuingly. "No; I have not heard of door, and the bell rng sharply. It was a solemn group which waited the deepening twilight. and then in
A99,1.0 ; obr l $688.91: Jury, them. Where do they live?" Kitty and Margery clasped hands In in the dining-room, next morning, for the light of the stars reflected by the
$94.02 Ocobe, $A8.1; anury, "In Weyman street,' respondeel sympathetic agitation; Mr. Seely the appearance of the newly.wcdded glistening snow. Spurs were plunged 1900, $350.02; April, $908.85, July, Harvey. dropped his newspaper and arose, and oplso deep that flecks of blood ptalned
$887.83; October, $1154.08. The entire Mrs. Seely fell hack in her chair Mrs. Seely advanced toward the hall There were mark'i of a tossing I: soy lotsd ysd hy
assessed value of the land covered by with a little gasp; her husband turned door with dignity. night on every face--in troubled scrambled up the mountain. The yells
petitions presented to the court since a dismayed face upon his son; and It opened wide before she could brows, swollen lids and pale cheeks- of the riders were heard in the disKitty and Margery gave little screans reach it, and Hlarvey entered, his face and a general gloom prevailed. tance by the rival watchers, who did its formation, both the cascs settled "Weyman street! It was miles from suffused with genial, blissful smiles. Mr. Seely stood in front of the fire- not wait a further hint, but drove the and those still pending, amounts to the region of aristocracy; it wa-i "This is my wife," he said, proudly, place, watching the half-door with a stakes that were to locate the La $1,430,557. An illustration of the ad- peopled with working girls, and meanm- "My mother, Dora; my father; my stern face. He was master in his own Fleur mine.
:vantage of the system for business stroees and small shopkepers; with sisters Kitty and Margery!" house at last, and he was determined "Then followed wordy disputes, fist
street venders and old apple-wome, And, with a caressing touch, he that it should not be disgraced by his fights and the flourishing of WinchesSputrposes it. furnished by the Recorder. for all the Seelys knew. took by the hand and 4.4 forward son', wife f other hour, ters, but before the mine was chrisA man with real estate in the North "Not Weyman street, Harvey?" among them-- "Pleafe etthemi away before any- tened with blood, one party concluded
End of Boston. which was valued at said his father, appealingly. What? body comes, papa!" said Kitty. "It to withdraw and fight its battle in
aot$000hareitrdiunr "Criny Wean tre"Ha- Mr. Scely gazed with startling eyes; would be dreadful if anybody were to the courts."-Eugene B. Palmer, in
~the Torrens law. He went to the vey repeated. Mrs. Seely dropped the hand she had see her" Ainslee's Magazine.
"But she is not--she cannot be of started to hold out, .wlth her face "Dreadful!" Margery echoed, with a -___bank and wanted to borrow on the cer'- gen family, living In Weyman growing ashy, and Kitty and Margery Ioa. ned to Siamrelm a Cat.
tificate. The representative of the street?' sild Mrs. Seely, anxiously, gasped. There were footsteps on the stis An old lady living In Paris has
batnk saw the property in the morning, "The family i quite respectable." For what they saw' was a woman of Mrs. Seely turned with a shiver, and brought an action for slander against nnd the papers were alpsdn teher son responded, quietly. "Dora's apparently 40 years. with a face the girls caught their breath. a neighbor for speaking Ilbeloui
al asdadtemother is a widow. She seFws for a powdered ad painted in the most us. The hall door opened, things about her pet cat. She cowtransa.tihn finished about I oclock the lace-goods house, and Dora has been blushing manner, with thin gray hair The waiting group looked up slow- plains that her Tabby has been s~aine dlay, Instexd of covering two or asistant bookkeeper in our estab- crimped over a wrinkled forehead in ly Would she not be still more terra, treated in a scandalous manner by the
: three weeks with the search of the lihment; that is how I met her, a ickening affectation of youthfulness, ble in the broad daylight-that artifi- neighbor, who attributed to the depre, title and other delays. Mrs. Sely groaned, and with a diminutive, gaily-trimmed clal, simpering horror? dations of pussy the disappearance
.. .._ --i*A"A bookkeeper--e seamstres!" she bonnet perched thereon; with an I But it was not the Ight they were of certain game and poultry which had
WI~V v LO INt ejaculated. "Oh, Harvey, you could fected, mincing gait and a sipering prepared to see which the open door been left lying outide the kitchen
-ji I LOI not hedoewre"diclosed; it was not a painted pw- window. When the owner of the cat
Iro~t "A penniless girl!" said his father, "This is my wife," Harvey repeated. dered semblance of a woman who heard of the charges made against her
hoped for you! No; it could not he The bride tiitered, and downcast eyes. dered her dear Tabby should go to
~Kidney aud BIadder wore.." "Mebbe they' think I in't good It was a slender, sweet-faced young court, if there was any law in France.
-TnoIJIL3. "A common working-girl!" said enough for 'em,. de'ar?" she observed, lady, with shining brown hair crown- She took out summons In due form,
Kitty, in a choking voies. "And tartly. ing a charming head, peachy cheeks, charging libel and slander against the
lb ?Ot e OM FORT everybody wll knowlit! Oh, Harvey, impossiblee. my pet," Harvey re- in which the color cam~eand went,.and cat. It was found soon after that the
he';t (',ntryKtdney Mediclne, ,~lus'as- it couldn't be worse!" sponded; and patted her falsely- soft, dark eyes, which studied the game and poultry had been stolen by
te i I,, cur. ,am~ansi ,,r the Kidney. NIaldee The young man loked frown one to blooming cheek :a!Tectionately. "Be- carpet in pretty timidity; with dinty, a butcher's boy, and the neighbor, of
aned i'ricery dlrg-.Ia ace' bna Irighis Disee another in astonished. hurt and half- sides, if you wen, but a shadow--a slippered feet. and a lace-trimmed course, apologized for the hard things
1 _B 'itarrh.1 ,, t ie r llrthrayel. t)iabeitoa, loel*
anl Rhce C aii.ic 3* to caum' frcom an el- contemptuous silence. calricature of 0'or beautiful self, they wrapper, fitting snugly to a perfect she had said of the cat. But the ,', reeeI WI 2t r '3 n., d e ,,us tie:@ if it d,.onflt Margery turned to him, with a gen. would not have be'e'u surprisd-. Th[ey form. owner of the net still declares that
d,, jid.( '.a et ,.eett we. wi r'eiuaei yeItr Imolley.
I.-- CUM FOI r' eoil t, e'v.ry 0.tiii e,1 naati'e. Ue sympathy milnlling with the were prepared for the worst." "Goad morning," she said, gently. she will "have the law on" the woInCdi 'a.n ),,ur d'rueodl~t for a tre.'aIectlle bottle ima nhe.ae He lookt.d at his horrified relative Harvey had followed her closely, an who slandered her cat.
' J~f a,, hlt it. write tuc suc we will iceaU it free. dim yI he fa .
ILargc MuItc,. Mil 4eucte at all druggsie~f "Perhapi," she said, hopefully-- meaningly. "Well, Dora,"' he said, looking from
'ii rN S'.IIALD-o.vl rl "perhaps there is so mthingX to make The truth of his wordsi Sashed over cne to an other of his speech les re la- Whem a.. ,M I. IIhoeked.
',APCO CHSMICAL O up: Perhaps sheo is a wonderful them. tives, quizzically, 'they don't seem in- The average girl may ma be sip
., te 31 ,513 beauty, on a great genius, or somes- Yes, they had all Idk. I'sIeItodly. clined to speak to you." prIed when a man prIoposes to heIr.
4 __CKSONo YEiLSvI. nfLA. thing?"' that "it could not be wese." Dut Dut Margery had come toward her but it's a terrible shock to ehe average
Bcerreepa.sdne i thermes. recb u Harvey gave her a grateful smile. this wretched, w rinh'-'-- beis-e-ed hatily, and sizled bth-of her hands, -na when the gir aoepts,8.-Mov
(in wrting ror sample bote- "I think henr retty, ot course," he ceanture-=had they dremme ut ris? "Wase it you all the time?" wried York Press.


- tJ~ttVJ' ..,,'",.r
C I' l "










THEMANWIT A APPY SMIt.
EYESIGHT OF SAVAGES. may be from an Instinct of pl-- CENTURY WONDERS. o t s In proen of the work of THE MAM WITH A HAPPY SMI
fece, never cultivates at all. but p olton in moulding th an a at il t i to tr 4 1 11 a
illits to fio t1ilnt4'(. 1 Is f I" t e vgetable king oim Itoth' ilh the vast
NO DOUBT THAT IT IS SUPERIOR TO pa,,.li that in a ch:r. dry air :,. ITS SCIENTIeIC VERIES HAV" gaub,.i'nt pr''lhis., an,. %Ih:it is fmi'ore l onh u, tue wrhl a twtter
TrAT OF CIVIL:Z .D MEN, that of 4South Africa the eyt, qCtul ,t PROFOUNOLY A ED OUR LIFE. in prta tnt fi h Io h i ra ,tic, ip n! t of i 1,, 1 t on
a certain keennebs w hich Is wanting viw. Ill out. wn titil' W hile I ant I . t i m.; nt h! w ,n
In it Ill i !. It-, 1%'.,l W
B t W e th e r t hI N ulp i or3 y )i I n ntlle to th e e y e u se d fo r g ton e ra t i l s t.) ; hl l N nll t r h 1 a l I nk1 ost 1 i i th e re' is ti i t iLrn a tl1io l ll 0o r
or lh* ]ecult if Tr ihuni I'nter a h midl atmosiphre; hut that, if It o t14'1 io oe i,. I 1 em11atee f trill 1' Ihi: h 1'.k iit hi
Wider Iloriaon Ii A another ihing-l I* curs. is not dte to any defect impose 'I cssiu itrile-Th. Itiu, t a r I aide rl, I plIntiS ~anl l aslli1AIS illn lire'-t relathll
ferencesm Are N l All on i ne aIdaIc. by the conditions of civil zition. it is All our t Iarwin's v rk. Thl, show the, way Ili ki. tie, litthi. chibllrot, hIe siterokol
ill whh'h t he" iott lest rat~ K'u 'rallza, Ihci r ,,ueleluI, eu11
That mn who can see well will more like the extra thicknean of skull The following was w\r htten t wh th m at anstr'.it th i. lill tir's brt with
learn to h ( ot better than men who do which enables the negro to resist the for the tth e. n f the Naew t a t I tmay aco(fl industry. lih t tie h i lli tl t, ir h hl o lera t witha
not seet woll is a fact so patent that direct rays if an African sun without York World In rila L.t e'r' the whole t- range' Indluwst ry of Ihrila I h *il ri th gi
we do n)t (wonder S r Retivers liul- discompoit ure or braIn li iease. K. ('. . % th e'r if T iey t t e abai ne ul a Y r lie iin tr yg I to lillug hliU.A, eli e;i'er
l4r's rei : k a blecut the s ,pe ri r T he ti ulith is, W e i lev, i., that civil- S uli c lac'e i n \I* an i e sutre d wi hti w ilst tU lli fra':t. h l r .
sight (f tlh iile' S attl'rate i puhblit' at. Ize'd, 111m11 w h n!l l eilltIvatel up111 to a c T here ca tll Ii I It Iin the .I i t ho wi l uii i inlld re e f r i .e
tention. l th, thinks, It i sai l that tilhe tain poit acqilulres a latent spite Utlttll'et, hlutbory I wh!, ,lr thi Nt nl hit and a nfr,)n n tr, nrloer has the "eyesight of a savage." against civilization, as essentially sands of )ear 1 t th t h int and yy strange to te ll, tl, t t i, Iw tit ithe 'Il, n ru aa-t sa agI as1 tha 111. it of l i too Isl plite.
and sees two miles further than the based upon a system of rather warl- just passed awa b Il Lel an a nees her hayet. str eualle'd any e' t-,a gflt oI i thi ig that ai rtle.
Engliinall. and (f course that fact, son, restrictions. He longs for more one of the most abi, if n t the other to which I have redferred. w %a 'I t Ihan e'i right
if It is proved, furnlshes suflicient ex. freedom, or, as lihe calls it, sim plicity most ehmo rab ,e. hih a t l t iall I an an li man n wiv but still I dis I'hhay vted him n is n'11n1 ni feitoL
planation (if many British mishaps in of life, and. I)Png half Inclined to can be drawn. T h vol it.ali will tinctly remember how largo in my --'Ch Oi. a 'l'h ,.iii e. lrail.
the South African campaign, and ac- revert to savagery, wishes to credit be awarded to It he grom n! that youthItl wats the number of faces HUMOROUS.
counts for losses of life which might the savare with all the attractiveness it is the one which! mt prfuntd marked with the u suall-prox efceunotherwise be attributed to a reckloss he can. So strong was this feeling in ly affected the 11 editions iof the teredi in an hotir's walk. Such lght Professor--What kind of iron tldisregard of necessary precautions. the last century that the "state of na- human race. nd the death and ravages caused by hness is your father in. Mr. fIresh tin?
But we do not quite understand the ture," which s rally the state of th The salent p but th nine. this fell das have practically hen reshman-Why---r, I thilk it's mededuction so generally drawn from Sir brutes, was represented through an teenth century is it i- the,, scieu- abollhd by vacination trodued talli Iron atr.
Rodvers' statement that savage eye- entire literature as worthy of admir- tific century. Th art, larnitng abolhoy Jenner in the first half of the cont ha t makelli you think ira h
sight Is naturally better than the eyoe tlon. Serious thinkers, In France es- in the ordinary y n at th, d tury. Pasteur and istor half ve madl'e alary raied?" tisked l herful
sIght of civilized men. Why should specially. actually believed in the of it pretty much eli e wor, at the for themselves Immortal name since M "es taken up golf" replied the
it be b tter? There Is no difference "noble" savage. and even in some in- beg inning th n, and at the ed of the century b f i' tuy, o in gly
of structure in the eyeball, and the stances ventured to paint him as the The gift of sadl, to the' opening we find ourselves on the track of their Wise Guy, couvincingly.
difference in health Is rather in favor "geltlest" of human beings. He Is., as years of the cent was the team- causes of most diseases. The germs Tommy- Pep, what is a fatalist of the civilized man. The latter no a matter of fact, neither gentle nor engine then comli 0 'cm use. from which they spring are known, Tommy's l'op-A fatallst, my son, is doubt very often loses something of noble. Allowing, of course, for a very Watt's patent exp in 1800. When andti preventive medicine is now a a man who knows he's going to get the
the keennees of his sight from much few Individual exceptions, he is more one reads how as that Watt well.understood science. Hydropho- worst of it, and doesn't care.
reading and the use of artificial light, capricious, revengeful, listful, and achieved one of t oit tremendous Ida. diphtheria, tonsunption and "Which in the head harher?" inbut Tommy Atkins Is no philosopher, cruel than the lowest of the civilized revolutions recor in history one other dire human maladies show signs quired the customer. "We're all head reader little more than the savage, and tribes, with the addtlon of a callous- cannot help feell .at his, ,osltion of capitulation, while Llptortsm ena- barbers." replied the artist. "What burns no midnight oil. ness like that of Fiji King Thakom- as "mathematical truntrnt maker bles the surgeon to surcoed in opera- did yeou suppose wee were.-corn hcThe truth is the Boer, like the say- bau. who used to launch his new war to the university t (11aegow) had tions which were formerly never at- I tore?"
age. habitually trains his eye, as the boats by running them to the water everything to do w it; he lived with tempted.Mr Youngwif-My ear th ank
sailor does, to look into the far dis- over the bodies of his slaves, whom his friend Black I atmosphere of Muh f this tremendous a aton ounwte-My dear, t bank
tance, and aequires from that train, the weight of the boats disembowelled research. The ste nine, t close, of human pain and the attendant n- in which my money it dpoited hat l, and the habit of close attention o as they passed. Htie is usually treachor- ly are all solentific liatimns bound crease it the span of life have depe'n- broken' M rs. Youthgwekok Wat all ars of movement on the part o oito partlygether, underl i our modern l il upon the Improvement In the mI. hlert'y you've gat ytur ch'ckuk at
on, part.Progress, for the ena that fard
his quarry, a power of quick percep-. progress, for thef r lt gt that htathl reseope brouttht about by the study of hecne, he,,'
tlon which seems to those without it for continue u rplac opti. Stramgoiy enough, the last i- The two t frlendas had met aft er a
almost miraculous. ite sees game or gre dy, while he is almost without ex- by greater powers. pocrtant prgrcss to whilh I shall ref r hing time. "And .veyr daughter?" a? itl
an enemy minutes before Tommy can, caption more inclined to drunkenn1s8 One of the first etions during I eins to a large extent from the same oe, 's she mlllarr d N" epIlid just as the sailor sees a sail or a than the least abstinent of the civil- Ithis century of t new socrie f s ccu .'c-,, th i thirl "I hav e nev er felt that I
smoke minutes before a landsman ized races.-London Spectator. power was to h-o titin This wait The, ,arllist victories f astronomy t'iclldi affordi ai sitll-lh law."
can, but there is no difference of ort .- done by Watt him f ntiv Siyltniing- were a'hilaved without aivny instreent. Ihlbs It's erly n questeln ef time
ginal or natural powers. Tommy GETTING A WIFE ON TICK, ton on the Forth a ('lyal, ('anal in 'he horizon formed the cly point of tfore, all ipoutantl' demai etys will .ci
could lit trmilne'eI, if we took sufficient A Forme hoelizron ()pcratnr'. thisr onl pon of902. ttIpotn (,tmtt4wl
trouble t rain, him anti we took sufflent A Form r rlelraph Oprator's story of 1802. available refterenc': then came lt- r rd n ogah Shstrouble to train him a allowed su aes orhihp i ih n. Our present eno oui hattle-ships atruments without the telescope and h e h tece
ulent tm. Jut as well as the Boer. "I found my wife In an odd way,- and mail steamers d ceur estr cer's clock; next these were added. The of the hadwritig r ht't?
and very often is trained when he is a said an ex-telegraph operator, who is going at 36 miles a hmur, are doubly stoam-engie. Improvements in the oA t h lhdwritil I ctXls tf h'te'
gamekeeper, or In any other way de- now a prominent officer of a western the result of Watt' work. It ili the mnianufacturcie of glass followed, ud A teher had t a of Juvenpondent upon the acuteness of his railroad. "It was my third year in steam-engine which bullets thum and permitted the construction of enor- lie phplis that Milton, the Ioct, was sight. Let any one who doubts this the railroad business, but I had not drives them when I tit It may even mouse telescopes. Finally we have the blind. Th et ay she kei if any
just take a walk with an ornitholo- forgotten the tick language, and I bal be that Mr. Parson at the end of the optical studies,. to which I have reo. of them coul remebr what Milton's
gist, and remark what the latter sees, a room in a hotel in Chicago whic century will porve us that Watt's ferred, carried on in strict alliance great affletlon was. "Yes'mni," replied
and at what distance, when compared had a party wall with a boarding method of applyin steam to marine with chemistry. Celestial objects one little fellow. "He was a poet.
with himself. house adjoining. In the boarding locomotion can be ptrove'd upon for which the human eye will never see Angellna That waste a lovely en. The matter is of some Interest, not house lived a mighty pretty girl wihe some uses. are now studied in a hundred ways gagement ring you gave me last night.
only because the private soldier has to was attending a commercial college in Land locomotion by nesns of steam by means of photography, and the dear; but what do these initials "E.
be taught to shoot as well as any ene- the next block, where there was also a followed In 1829, the Rocket and the heavens have been expanded for tuse C." mean on the inside? Edwin-Why my, but because it bears upon the course of telegraphy taught, and I Stockton and Darlinton railway In. a thousand-fold, and chemistry ban -er--that is--don't you know? That's very large question whether civilsa.- guessed by seeing the books and augurating the loag serles of engines not stopped there. The substances of the new way of stamping eighten t ftion necessarily diminishes the phy- papers she carried that s. wels tab.- *%f *... ,id which the most distant worlds are ats!
---.f e ict--ewers of the average human be- lag that course. You see, I w's and safe transit poble almost over composed are now well within o carats!
ing. If it does, that is a great draw- watching her rather closly, for I was the whole surface bf the civlllsed ken.
back to cvilIsation, because it pre interested from the first time I ever world, both speed and economy being With hundreds of thousands of the first time, and on her return her cludes the hope of man ever develop, saw her on the street. secured by James's laventUon of the firm facts at nur disposal we can now grandma asked her how she liked it.
ang a kind of aristocracy with the "She was a stranger in town, and, tubular boiler. watch the gradual formations of "I didn't like the organ very well,"
powers of both body and mind In. of course, there wasn't any chance for Electricity comes next, with its won. worlds and study both cause and of. was the reply. "Why not?" asked the creased to a point far beyond present my being introduced to her, and as for derful record of electric telegraph. feet. Hence a new idea of cosmical old lady. 'Cause." answered Edith,
experience. That is the dream, the flirting, she showed no more signs of electric light, electric traction, tele- evolution, and hence alo an idea of "there wasn't any monkey with it."
rather lofty dream as it seems to us, It than a sister of charity would, phones and wireless telegraphy, and another evolution which deals with f supple," said the visitor, "It's of the dons who foster athletics though I gave her every opportunity, all since 1886. Of the applications of the gradual formation of the chemical like pulling teeth to get any money out well as reading in their pupils; but if I found out by a careful study of wI- electricity, after what has happened, substances of which our own earth cf your husband these days." "O!"
'the reading spoils physical as much dows that her room in the boarding he would be a bold man who would as well as the distant worlds are built chipped in lIttla Tommy, before his as it develops mental power, that Is house was next to mine In the hotel, venture to predict where they will up. mther could pesak, "ma don't have
a dream impossible of realization, and that only made me feel wors)e-so stop, or that n eoqualUtY striking de. All the world knows of the many ap. any troule pulling teeth. he just But does study necessarily have the near and yet so far, you understand,!. velopments are yet In store for us. plications of the old astronomy. sonee taes 'em out and puts 'em in a glass."
effect of spoiling sinews? That It I knew she would not be in the school If they come it will be because the of which have Ioen so inmiroved in re.
does so is a very natural idea, because much more than three months, and as future will prdue its Paradays or Its c'ent years that a ship at 16 kots aeless Seuns from (ad.
the savage seems so much more agile, half that time had gone by and I still KelvIns. speed can determine her positlon to a
and is. beeldes, trained by his mode of had made no progress. I began to The saving of the lives of our small. mile in any part of the trackless Perhaps the most Interesting experllife, which the civilized man Is not; grow desperate, for I couldn't bear ors by storm warnings and the study ocean. The applications of the new ence of musc'ai sands is that recorded but we do not know that there I any the thought of losing her. You know of the laws of storms is one of the astronomy are yet to seek, but they Iy Kinglake in his journey across th, Idsert. He says: "As I drooped my
solid evidence for the notion, a romance like that makes a del applications of the sc.ince of meteor- will come. bead under the sun's fire and clmed my
The "big. black, bounding beggar," more ImpresaIon on a fellow than the ology which the century has brought Thae leurbins Racer, eyes agaInst the glare that surrounded
as Rudyard Kipling called him, can real thing. us-a result undreamed of by him who It was just at the most Imprsalv4 me. I slowly fell aleep--tor how many
outrun the citizen, or outwalk him in "One Sunday afternoon I was In my first "weighed the air." Nor do the point of the great Shakespearaln pro minutes or moment i cannot tell; but
a long march, or throw him in a wres. room and she was in hers, and I could benefits of scle e to our soafarlng duction. The big audience gazed after a while I was gently awakened y tie for life, but the trained runner will hear her driving a nail in the wall and seagoing populatloas end here. spellbound at the massive splendor of a peal of church bells-my native bells outstrip the savage, the gamekeeper and a great thought came to me sud- Ocean currents as well as air currents the stage, and drank in eagerly the --the Innocent bells of Marlen, that will walk with him till he drops from denly. The next minute I had caught up have been investigated and charted by impassioned eloquence of the famous never before sent their music beyond fatigue, and the Cumberland wrestler one of my shoes and was pounding Its hydrographors, who have added to actor. His subtle art had touched a the Blagdon hills! My first idea naturwill like nothing better than to throw heel on my wall, but I wasn't driving these benefits by maps showing responsive chord in the hearts of his ally was that I still remained fast him over his head. The whole differ- nails. Not much, I was making a tele- depths, so that now the contours of hearers. The quiet intensity of the under the power of a dream. I roused ence is that the savage is always, from graph call. It wasn't anything in par- the bottom of seas and oceans are scene caused men ad women to hobt myself and drew aside the milk that the habits of his life, in a condition ticular, only an 'attention' call, and nearly as well known as those of the their breaths. The stIllness was al- covered my eyes and phnged my bare which the citizen only reaches after after repeating it till I was about to land surfa'es. most death-like. It was a triumph face into the light. Then, at least. I
weeks of careful training have re- give up in depair, it was answered More than this man himself has of illusion. And just then a man was well enough awakened; but still stored him to the full exercise of his from the other side. Then I tele- been proved tai have been present on snored-a gentle, peaceful snore that those old Marlen bells rang on, not natural powers. Just give a savage graphed, 'How do you do?' and that the scene cntemporaneously with told of refreshing slumber. The ten- ringing for joy, but properly, prsily, who has never been accustomed to was answered, a little bit slow, per- many now extinct animals at a time slon was broken. People laughed hys- steadily, merrily ringing for church.
carry weight, say a red Indian of the haps, but answered all right, and the long antecedent to that favored by terically, as they do when sharply After a wble the sound died away
North American forest, the weight to conversation continued. Arohbishop tshe r. This work has eonLrasted emotions are brought sud- slowly."
carry under which the British soldier "She was not the most skilled op- been extended by the modern science denly and unexpectedly into play. Kinglake thought he had been the habitually marches, and see which of orator I had ever takes, but certain'y of archaeology, which has demonstrat- Again sad again came that gentle victim of a hallucination; but it la them will give out first, though the the most laterestlng one, and we ed the existence ot settled commun- snore, and finally It ws drowned in a probable that he heard actual musical savage has even then the advantage of talked through the wall till supper ties and by no means rude civillza- rustling of gowns and a buss of com. sounds, either issulng from the rocks having walked every day to his full time. That evenln I began asain, ions thousands ot years ago, and it is ment as people turned to look. The beneath the sand, or caused by the power all his life. If it were not so, but she was not at home, and when I now evident that "in the noblest study great actor, who boasts the eccen- friction of the particles of sand over man as an animal would differ from all got In at midalght I wisely forebore of mankind" the geologist and archae* tricty of genius, knew that something which the travelers were walking; aa other animals, for it is notorious that sending a 'good nlght' to her. Neit ologist must work together to dive had happened, but it is doubtful If the in the case of a curious mountain no wild horse can keep pace with a morning I hailed her with 'good still further into man's early history. snore had penetrated across the foot- which Darwin visited in Gulana. It il
racer and no wild dog can escape a morning' and got an answer, and than But there has also been another lights. He halted, paused a moment, called by the natives ICl Hramador-or hound. The Kanaka, it is true, of the I asked her if I couldn't meet her very practical application of geologic, and then went on, but with a notice- the Bellower-lcause of the sound South Scas, can usually swim much after breakfast and walk to school cal study. (,.igraphy loag ago gave i able coldness of manner. Had he given forth when the sand covering farther than any civilized man, but with her, but she would not have it. us maps of lanai surfaces; geology known the truth he might have rurng it Is put in motion.--'hambers' Jour.
then what civIlized man passes half You see, she was shy wIthout a brict has now baed unon them geologial down the, curtain, for do doews sue-h nal.
his life in swimming in water Juest wall between us. I was three or four maps of pric',lo. value to all Inter things.-Phladelphlia Ieord.
warm enough to give his lungs fair lays pleading with her with my shoe ested in the proir!'its of the mine. whos d Indum May Vet,.
heel on that wall before she agreed to It was fornerly thought that the tue..Ian stllt. An Indian may not vote as long as
play? meet me. and by that time I had tolt study of rgani," nature could have no The manuftar, of b.ell'; hts for c'n he' renmais a member of a tribe, but
There is, we admit, one faculty in her everything, and she just couldn't poesIbl applIcation; that the study of turie: ibeen uarrled on in Ito ,la. On i,. giv,. up is trthat relathos and
which the savage appears hopelessly refuse to give me some kind of a animals ate- lants led to classifica- "nt o i thi Immense number of .tie'r a citz,.n up h may vet,. under to distance his rival. He retails, or show. After my first walk to school tion rhltly if not oxclusively, church throughout the ethlr,,, th the' same conditions as any other citl.
appears to retain, the superior sense with her I was utterly gone, and In thls rog'mn of thought we find an- demand for bells has always been of smell, which belongs to so many though she staid on and was gradu- a other revolution as striklg, if not great. As far back as 10;53 the ,ole.
animals, or perhaps. in dlfferent de- ated in telegraphy she never had a more striking, than these already re- brated boll, called "Tyar Kolokol." was In 1893 California shipped to mggrees, to all, detecting, for example, chance to practice what she learned, ferred to. The geala et Darwln las made. It is the largest ball in the land 95,817 cases of canned fruits. In the odor of water or of land from a for before she got a job I had madam evolved from this a "the orgia of world, belng 16 feet in diameter and 1899 the number of cases were 859,203 reat distance; but thea smell is the her promise to marry me and give up species"-that is the Wal 0o8** of the 19 feet high. No less than 17 4 tons of -an increase of ever 000 percent io
eme sease whleh the ctvilised man, it telegraphy."-New York 8u. Satroduction of aew ema-*ad has copper were used In its manufacture. seven years.


'4

C

," ".- iv,' U

!l I I~! s :,,/ : :, % =* ";' . ,"-









-,T 1, KE MAN.n 00i 00 O.000 Ii llst un* on an vxpc(nf~tl!re of thoir o l'N n omtmgvt~
~ .~ u K I'~ M A '~i ..;uitli vy w t li iuo o e' i iii, l il~ .1 fl t o orty 1)r (,(t. o
F O T H R j ma n t at all what youY5 AN EATTLE CROW r4r.i' "it- zti .qj~mf for II II IlJir onus. C rry for eilg n, vn tt
ArlUliJLUgm f auinUCitiny lAJlJ T i a really femninnp woman. El TEN OUR SUPREM- .11i)11 (dill I1 )vIINI'4. l.1in: .11liti Iii Stlitil Amle'ricaJ to v'*o~fi jwtlti'
Adm (~gcnofakllauiniyIlrid. ts ulasculine ways."' hol II l~ &Ztl)XIos Iholit oiiit.,'-ig1t I He bri'vlN lIt lireadI a big: 1Jll.e4.
PUBLISIMP XVktY VI~UDAY. W? EE' :aR hugh 0 thtvy41 i 1114 Fii 1ii 4~ 1 'll the' jiititt' Ilrt'ltim aure troct~
L ell for instance, yesterday I saw1.StlS.i oeg ol ilfatp
W.~ Il l 'dio ndNsngr Ive a street car conductor a nickel -HlE WORLD. ngi 1,14111t~tlf 14 .1 Ilulll'. i ; Ii age on attlu 1 ti ult t'gLtia'g1
F. 1111111VL, A 41t ltov adMngr L islip had five P0n1.1411 he 000000 tIll IA til ( '1l' WaXI M 1114 14 blll'tr811ntljtiti ulllVi
J R. A W F R I)V ~ oiL L ,1 FO44~ E di C i a g 'i i h s l eltor "Y ."I i 11.'P ai 1 101t hi. il e' g altel l Cro oti IT JIIt l n d o f ct tie rnng. e
h c g P o s t e r i c -1 -o l e t o s u e r w htv i c h i s p i e d~ll 4 t o Iu lz u 1 1 14)1 11r t' n h I t pc u i l d e Is ii i in l r g e' li t u I r'
F, n Ite -red at the Postoffice at Craw. I HI-uBBY'S FAVORITEI ";ICT sed nitlt ta ttes an till%~ $3 .1 itilith. CowboysM rr~&;1'I*~Kctii, tritpo' Ahllinai
fordile an second clals mai1lfl tter. "What is your husband's tavo ~ Xre Ide if bitof for tilt- wItth rool contilg $l)Xfti i'IlOfj iO~~~~~.'ielM (hn
~* Action?"~ asked the inquisitive person. q w Ph ':r oliI! Aziierit 'I'lil lit' of 'Non lie Iarngtiay aire iioii. .1iontmin. 1Wyotni rig' Cuiloratq
One Year in Advance. .. ... *.9~ heO I can hardly SAY at A mno mn t's neres )ortc't its rivl to tilt' :llllfll' if, fliv isxnst Ittit', ltinf.- fr N ewlt l*itxle. A rlizonai. I toh.I, Neiili
Sgix 3!ontii e ab........ o t ot ibe' said the patient wife, ',wheth- United s N lprotitVl'r of 1)11' rti iiy asi gloo tiIuck tillc iniich tm1 it 11 1 ,4 inM lgtoni. :11(~lidC .
F ran L ov ret o&lsto e bout of n o p e e s t e s c r e d oyoti e, T hen A l itin P r a .~ o wl 11 t -it nol mzi i tl 'l'uu rl i ac t oLtg tlit'j' i 1iiti 1111 .1 tor~pe l hf h g e l r a l 5~e ert rt r i~ l~ d to an ih e a i eth o ffice o n b u slnS 'A g u n y n i I 113 4 i th l N 1 t 1111.1. a:r e i[t,~ I N Jl'I ll ih~ I c(t 1lhV V "fi ll 1.1i l'i i a lva hli i 'le' tx gelgclsrtn*Jfolr arrative.''- Indl anapolis Press Ith 1111' 0i, itt millah I.l 1h
mclghiborb t 1t :041-111ty ilA
eur'lt Ill:,& rvi'fI'll 11111,4 tlir if) i ~ J'* lit, t))acco o ilt. to,. r 0 is Ii. r
sul: grt'n Iwv li t l~ 41f (.1111 I vat [ll. '1'llI' valuet of 11zim ~als lc
1BA NKUL TU MRIS, PINKBAM Alli I. ht 1: lt.lI'cccc"til


Letters Proving Positively that Iii01,( I.t.1soMo 1:1fviy n

there is No M edicine 9o W om a 's. jorl tiat lit'l heir i lit' wi tll u
Ills Equal to Lydia E. Pinkliam. s jorin th lt, or tilil.nl' Aretoint'
mil oflt' Frucciitft "urtihing vt ie

Vegetable Compound. .1____I___v~to ihtit 7nti
Sttes a ii inre 11111 wlfloe .ttm fcltlt mokn at
S out A i ct'ecut ik's nam itl vst
regitUIN11 yel tii ('ltil uitiied


roai over llltgt's but are praictlIcaliy kept titll' i lit' glnuizing


cowbioy 0 m iit'coiie IiiIgely it
'feu11 rider. I lolling tit( otitsitlc of
u t nc'ostr mtie that the fenes f,i li'i11 Illrillil-ti o l'X -)tt'll hy til(, .r;:
a re n o t b ro W i. fun it f th t 1 (1 ".011 ) 't il i cr i t ) :11 ~' r0 0119 i n i i
tli-e e ot I rayed or' stolen. nit~y 'I.. I'NI-yni' 'g z y lu h h
cow11oya ai rigrate'd to Xolhill ('oiipa rat I vl sinali lnat io n. 11.1- s oWiela tehaeIkikll1ltwii lzing groundiits. and11 four yt'i'
t heir old( free' 1.- attlon sltt id or i' t h1:1- ago) wasR nrt'l -it'l ami haviig 5.S 41)2
tire gaucihos I tlt-i wIle-swept llul 'T I H TfEX\AS MliI11.htIvl of' entte 4111o its ni11 ngCS, It n11i111'1

In Parrugua I larIgte l'l'gioii v'lll't c'all caliy lit liwo'tiit Oil to tilt ranlgts ine'. tho Chaco ling imt bli tipt'iit' upi to) of IlI iiut-. i front tilt' Blrazilian prov- Sout hern Brauzil Joins with ileAr
~~intc' of MatIto ( lssmo, w lt'li udjolu4 gclltilt'. Pa raguiay and I ligull'ili

CIiitie hitc:ue if, Iw l favlor'edlan L tilt h Illttit' trad('. Ill tfll' Sttet ofli) of I 'nra.-aian' are' steltdoma seu. In tile' 1;nild (t10 d H iii till' vt- ttle indtist ry I north1 they art' unkniowni. Ini the south already Imnportant, .til Is growing onie occt't'loaltlay runsm across cases of
"laci(k lt'g." but e'ven ihlu ouly uIniong
calves, and tile pereetntuage of such
cases In I1Cvr alalrmng. Lossl of Pattile owing to tlic' (,oid of winter or tu a
dry sealsoo Is tlnknowil.
(ALI L~fltg Aly BY11PCIALPZRINSIN-)it will Ile seen that Northiern Paraguny is no idenl place for the raising
,,I cainnotay enough in rvegard toip Ltil&I'E. P'i nkham's Veg'etable Compound. .of ('attie. As yet, of 'ourse, these
It has done me more good1 thiull 'III t IlO doctors. I haveS beenl troubfrit with South American regions hiave not the
female weakness in its worltt furm for about ten years. I had luciiao facilities for trotnsportation which the
ad was so weak that I could not do my housework.
I also had falling Pf the womb and Ilifismuunation of the womb 1 !Pisae
anda possess, but it is only a questfb of
An os timet when they wili bare them. andl
stndonmyfet on a atie. yhisbas spent hundreds of dollars flt then, c.nteUie ttnhl t
doctors but they did me no god y husband's ister wrao what the Vegfe' w nteepr fbeJs o
table Compound had done11 for her, and wat mo to try it, but I did not theu ia coinblint ion of capital Is sauid to
think it would do me any good. After a time, I concluded to try it. and I can hate aetquired practical control of the
truly say it does all that is claimed for it. Ten bottles of the Ve eabl o-Txscate.Apolso fti oi
and seven paceslO 11 Of fialnative Wash have made a new woman 0f me, I avi'tx att sl Iu p i- ries. Ifti of
had no womb trouble since taking the fifth bottle. I weigh more than I have booinatiee whoud ut un tditicea Inf
in years; can do all my own housework, sleep well, have a foo aPPetit0. and heftute o l the an addileitioali- ,. now feel that life is worth living.IoealtLyiL ik be wis Sou cth ire fri athedvlpntrief the
table Comapound. I feel that It has saved my life and would not bwth ot mrcncti nutis h
out it for Anything. I am always glad to recommend it to all my sex, for I Houth American field Is Jusmt now UPknow If they will fIJllow Mrs. 111in'k ham's directions, the), will be curedl."wilntocte lninam nr
Gratefully yoursi, Amn A.NNIE Tiiomrsozxl South Hot Springs, Ark. wh'aich trouicante en iImportant rer
whtgicprmisatempran e
CHANOB1 OF LIFE. PROFUSE PERIODS. sft ilaey














Spoiled For Hard Work. liils I 50 KINDS
ol Scvrral yeanrs a70l a poor Hungarian First Le in n esDr. Bull' restut 011 t 16 K ND
lo'dt both legiiIna accident. He a ta pr. lib IW I :iei t,~Tb si oP"!s:i e t
bar fir'4 In a es by belig Cog yu l IolosOs o e t
pealedl to the litingarlau society. They toto* ug yrp 'i ;'~; ~ to
sentaeisesobL~tutes. Get L1il ui, ht.uigtAVSuq. L we
hadn't czilugh funds to justify thefim lit :n~ 0i.ier WO~~T WishNIE Full6oll liltA In 141. MaA5i
one case, but they fixed the man "up tor1 his.1 or. raoir itolsoesect~o
\b'viQj evtig heprceoftw lg, 20. o~dih p.At Bokr Wa Vshington", hlmJi. otrl ~lss sdls.M
B9.rlholornr.# on crutches and set him.* to selling Tilt, lit. M Et .iIIMi TS WANTE o.4 eret e
leadi pencils on a busy corner. They I To a thougi!y'lit rol tom pit .,i iinkiip --r $1.01 1. 1i I r Flt0s t' 7laoatt I .Ibe~it tU or.e 11* told him to make what ho could, anti if is one of sorl-i I'- !- Il.:.' !.t d~i 0%..~t~ ? :Pao 4~~. *
he raised part of the price of new legs, rV)e with,. f, vi i~e~'*pl~i ...
HOUSECLEANING HINTS. they'd fit him out with the rest. In ro.poet mnuoh r, 11 '" L 1 J.i M.0 -IBO V, .16. tlna i~~~
Ltwo week he made his $200. 1 know orders whit%i t, 4. li 11 OR41. 'd 1 .
4trlig (if Il)4inti For ill-'1w Di.tIrenard that to be a fact. lie was a pitiful ob- ecntl~lipti Il' i T. 0 WT UEEDSSi rON tALo, it"6,1 o
T~'Iultii~iiIc ii~i~ l~t ject and quarters rained into his box. toilorsal' till, r' ic le .*gsmwn Let Crosett, Wis.
1,01 114 u-ijla.l 113. ever since, lieai got his legs tt)-!i lit FIRLE WIT SEEM'
tliecrougla ~ ~ ~ ~ ;I n What's more, ho has been selling pen- gri 0 malarialt u ltiur*b..senoaugnt
li u~cca~ i. ill till furnished them, but he was spoiled for The Art, 1, 4 tac.otil ..: L
ii~~lwi3. 'it. etict'i r zlgt I 1st hard work. His friends got him~ a l hk he e't % ... Pso, twod wella. *4r..b al, s.I
It, enov'c (te lmss, zi Mvkti.place as cashier In a saloon at $10 a I ih~~bats a i(4mil thu k.. To J. K~ING CIS 5..0dsmcn. 11chsesid. To.
or iiinitP~ U ie n n II~. ti~'i~oz~week, but he held It down only a we ofwar lit eviitl11onii.. .~, te .~A*
are lue.or two. The temptation to make more
otit,, twe' Itih o ii''"; *iutelii'money by less work wasn too much for be' (cit Ilvt~ in rli11:1 11111-1-1 ullom him. lie took off his legit and went whlov.'r eI1I~ititi'. Ih oliey mi iiilie Ih ciro- back to thle lead pencill business. He
And' e i tidc Il- Iil 1i:1 works at it In pleasant weather and mstdiln it room. III, ni. ,ttif 114'. 1m makes from $25 to $50 a week, if times oriit. ii (hs itiv ~uui. owecci titL ~i re fair. In the evening he puts on'
of lt'hal.4 hme IIi' Iirt e lt ~'him legm andi enjoys life. They are a' hi-um pill a way auti Ili"~c' ami sort of full Idtross costume for him, you Fslall arm omoVetils. animny l sir.' so ew York Sun. pliees of (ililturt giti~il l 1141 FE
fully wvrapjiuI, 1 Iho iii.' i.imie a iis Watiltpii-At Oncelt pa per ti) thlirk wvor4t Treingti aftit'Aief witi (or witlimit eXlete U U Y IHN H R A H OFA L
4111 il) iniitatie IViinali would1 li'stii *Stolk (Ii, .i exiec A I-cr icarlictiliki ytri, to-Y W h~ IN '~ EA H O l
th'il- pap rliillel.;: f'F ii.M i ll I~~t!S1 Pe.'k_ ~ li w(sci ,,~ rks, ir~arI y c t3' of re iivr~Il titeapi," lmit toy-A hit
wt' allc knou h I ii'' m It o lie' i k. so ies -Yi..1 a 11t' iiteg hun tiieibiamua-il i AMt he l lt- rtilli Imoi lIII,, mu1 ye Iiii~t ik i t'it, eV foat v itb girl -opituit ill that Ie i~v- ogun 1 hep ou wua?'ac ep
lt~ 3 waft a l-iluow (' i t 14
hi l- dt ltme hste, oheii ao nil lie MtP)I i 11tvalISi i-l i a u siu e v n i
no it t e e t liot l runii ''t -gt iter
itrary, den, glIttiiit, ootti. or wlai'Vt'r NoB BntacepY 'sbsi
anti aclit dining roomi, lit dis~cmrt L Iii' Iea ______for will Ile but little felt; indileed. ha rdly
felt tit all, If only ('ltnnig ig to Ile Is I N O F E
done. (.kil eovryotly lo'ls noit pit: EX T A C
stll papter t'vt-ry roomi every yearr)
Two goodti vorkeurq t'an clt'i i thoroeugh-itsbon tourotaciJy. hxv ltig l(t li lii b acuk lin p14111 ofmnvelwctwt io
ono room lit a tiny. a
T1oo uniit haste, however nmkesi Made without regard to econ- Itesrnt i h in
wast, nicltheeomteu~ o ~h~!~ cmv WVe use tile best becf.
tilletd with treasures must 1be eonii. get all tile essence Ifrm it, and Ithornx mvrleet
ered~~~~~~~~ a fiaeto, ob aeul oncentrate it to the uttermost.
gon oae wunce skile hand upo You want ION COFFEE beCaUse It 'is LION COFFEE.
Ign ve ih kle hnsupna- there is all the nutrition of many 4.
other occaon, or. at least, away from pounds of beef. To get Imore Ifjon the er hand' you want a coffee which, in order to hide imperfections, is "highly
tihe. real scc'ne or operations. nutrient to the ounce is im-1
One really can't feel much -*.mpntliy possible. Few extracts have JOIshCd''.i e itadohrpeainl hnd o u
for the womann who taken In tiny~ un- as much.,ih adohrpeaatos hnd o u
known person andt sets him or lien to) f Ot booklet. "Ile" to Mako Good XP PW M
fine work, andt, though Iti may be Things to vast," tells manyi ways to
uso hcet extract, It AieS irteceuris for
mean, one can't cry whien ile tells hiev. uncle stiliil( iae deful dish. Send 0LI Nwere comnt riaysuf ofedrneswudn nito ai
till*- of woe, how that "lerrihie ct-eat- your address, for t.~~.m o~raayaii ~iOdikr ol'tiss nh
tut lroe sm. piesm elinn. anti LIeST, "ItfL1 & LOBBYlgI. ti Iions of homes because it is the beat coffee Im the World for the
hue ow sit i creu' prls'n. iitl itnt to UMa.~*I take a single package home and try it.
when told hov miuc'h it wrim worth 7 la
fro association ut Insite that rItI' ION COPPER you will %it &- luly iliu*WMe ete d"93111
mIntioned, "bcas an-n __ot -RODS NW Dis LOV E RY;' ist No hoL_,aak i fact. no woman, man, boy or. girl will fall to find In the list som article
tha th hot etsof hin, ith112na PSY 7 q I alr".4'cnw which will contri I their happinm. comfort and convenience, and which they may have by
pieces. cos1t but $55." And till thii, poor ir.v aassm. o tac imply cutting o'ut ae atain number of Lion Heads from the wrappers of out one pound scaled
woman couldl doe watt to gtnsh her col of:v"ID : pasex ,whc h the only form in wihthis excellent coffee Isa sold).
tet-th or pull her haIir. act'ordiig; to 'ISE CERTAIN C~U URLI~eSag (w WOLSON~ JFIC2 CO., TOWBD. OHIO.
which she lhad! lie tost of. 0etetoiietie,
In hountice'niing. as In teverythifng cantion this Paper"""""'.l~iil
else, discretion Is of prime Inipotanict. ----- __________Wih Pan ________________________ F orwelt, l ony ag."I DYSPEPSIA
Th'le miodetrn Idea of furnishing never Fi ht on frwatod" oe as"m.In)Iavnueldr1~eri~aca
plat-cs it plano, withI its beack Itt filie youriVer In drying upand bowecls wear ielt'th nuotaltItgrtoIi
wall. Much h~ritter nti monte ffahlon- r
nhIt t'ffr.*ct art- obtainetl by pi ie 71V F ig out, soin day you will cry aloud for













r in .n

I .!l a ~ .V t5 Il.k. 5
(A3. .4V1I.&i..l! ..;4
-- . ; fl1'~ "~*eb 4.i~rzgot4444 m "Iv 1 "! 1,i4

0~. U .ka (4 '~ 4 ...I Lt 'i~ ~ ~ 'i~dj ~ ~,.' .at..YR,
Y1 1)44 7. 14 It I,



C~ *.r, .1 I. AND EN CIA.

IV~ IolI .is;and
I It .;, k + Figuilmes on at'lo, a go
190 0VR o CT.ar-r"u
4ll a .- 1t I4 tI) (" I ir SPEC ULL T
T4 'stA o C.11.
4 4 f i l l 1 1 1 1 1 4 1 1 1 t4- i t' m a n f r o t il4 '
%Vill II. 01 19 M ato~ ito Turn s
r,. x -, ZZC74 .I I

44 ~ ~ 1 1 ,.41 4 4, Ot r fcro returned if. wo fail. Any or~i.drgrkd .a 2
~41 443 .4~j~~4~.*. ,. Yr P0 tiC4a1f my3 in; etiton ivill lr'nI~ !OU1 .ft~!II I
i 4 1 1 I~i v t E~b ; ~ n l 1 co 9 ( h v o r r Q o P 4 ~ ' U Y U r i 1 t i
~4 4n~ i~ ')*'R& ,' 2 b nt t h P i- ,3 (c 0~lin ieiitv of trtne. I~4 lo tt id~a7 :.n . c~ol, :1
Ai ~ I II ,S arnd 1)1. g i I, i pL'rtikitl Inad tfotan .Paznt t' ti 1 '.i'.,.4. '~t hL. 2
anC~j~. rultU inj I4 l.L.... J'.iA
444 ,Tr p 'rC't434,4444, *W-- advertImemeifth must be ).lid Ppi" "d 4 IA vN
I'Wai. Pof plotation ini 190. V. vi
4r41,.444,,. *, ~ '. S .co South JALrium I
4*~~~~Lj~~~4~~4 'Fa. E, 4e2, I, C4.4 414.t.i. 41
,~* 4.'Al1144~l 4~. 4. ~ 14414I*4 444,14 4 war. Pan- reuican Expoitio
~ 44~ .1144. 4r4.4. ~ ~ :~.~r ~ 4'4... l~1 14., (i 90. -ts puent @On- "VauI z~s -A 4~4,*~ jd v
d L'4;414r ~ f,,,~4.,'.144., '' It t'l~lilr ,4r)t~. II1td1(lI1., dftioh and uis among n~ation&.
4I4~l?~4 41144 4t~t4~j~44I 44'~ a.ifact 44* 4 , Roster of rat of flen of tbe4.4 *4S '4


OT T

t win4ppre tly 4t zi 4y





~ I of L tm c
"'p f'~kw~ iil '~ ~er 4 0 S r)mr hale .4,.. '..1... .-of I~~ a~bd rc dia to nh tof- On t

th;a : 0.(U4' Tor* .. .... Ill -., '?. 4 4.
Wor~gn t ainte. Trp aoit- estin rmr hv ...

I4('~I1.Ah~o ~tedt Jrcdia o Ol e f
p2latad htM thev bnt~ t *-i3 th.A 4to'lr' ie 'n '1 31 id tit folnIpa Ott- 44'.ala ,o 4
bbe~' PikI t.;. ~l'ru o~k 1)t(1l&4 lti. tml3tteeict vic hon;r via.'.,44,(uiL X'oadct1w lash ~i.i".~I
Yu 0tt: UsA comae bit.--.~'.- a fdwdr' ne t. h t t t.' :ti 'ea W&T Carra!#~4 4. le4.' i.k I I io1L II

.4il beVPI Milo .01. 4 .hw. m4..m44a U in 4J),'l. 0: .444otoI
'11110. Judge L i Ki. S :1 1 hlto hefo (A41 111;
Ala r4t 4~ 61 Cie lat
Ch111t 11oi.'n a43 ~ ciliat ds 4W ~ htwieh edtthpyI...~~ 'L'tIF4:h'*4 "*;S e P''t.hieia f4.44 hi,4a~l pa. Tribune C11-i a.)t n d m.4 M~c o thr bnk' i -ar'klin411 41 ceehiy ill -ait .e Vail,~ --to




Full Text

PAGE 1

DaughtefjLriCOMFORTTheirHowconslbleprca-umablyBRHHZEiJfr-tgeWtSSSntfiatTIrwritlnIourenmpleCHEMICALJlesaidindignantiyGKAWFORDYILLEThoro-dospalrlnjAR-BTROUBLElandregistrationaccomplishmentsformGoodYL-AfirFpaLOOKINU-Irwtrepeatedly-thatgailytrimmedgoodtemperedretrainingrepresentativebookkeeperdisappearanceKidneynewlyweddedscreans-Weymanyouthfulnessneighborhoodtightlyclosedcastor-jinglingcomplacentlyR-tJAOISONVILLRthreateninglycarriagelampcontemptuousBladderaffectionately1lorlitn-PUnlBIIRDproclamationindependencenilImportantdevelopmentproclamationsprightlinessoverybodyllsatis-factorilysympatheticincoherentlyMassachu-settsauhmnrinlstarequire-mentsdespair-inglycolrequire-mentsAFCOdisappearedprobabilityhandkerchiefestab-lishmentmortification-IappealinglyapplewornocommendablerespectablegovernmentdruggUU-JffMJlWWashingtonmiserablydesperatelyapplicationneighboringdepartmentcomposedlybridegroomlacetrimmedprospectiveassertlopInquiringlyapplicabletelephonyahopkepersgovernmentcheerfulnesssimul-taneousprospectorsbookkeeperandnarrowquizzicallygoldbowedUlatlngulshreproachfulbreathless-lydisgustingtelegraphyMohammedprospectorsun-disturbedcombinationejaculatedapologizedthoughtfulspeechlesseverybodymeaninglytelegraphythorough-lyExtremelyaristocracygeographyapparentlyaffectionatepermissionImportantdemonstrateill-expectedpermissionCertainlyWinches-tersgeologicalcompletedsimperingsimperingregisteredsympathyrockstrewnsomethingdeepeningflourishingrespondedunfortunatesimperingeveningsubniarlnoapologeticdaughtersDiscussionrespondedeffusivelyfascinationshadowasurprisedrespondedexcitementrecommendtransactionDepartmentdismayedFLORIDAImpossiblethemselvesdangerousreservationquarterlyIaristocraticpromisingglisteningpresontpdanxiouslyconcluded-totelegraphdeterminedreservationmisguidedpreparedincnsuratonecessitiesscandalousFebruaryseam-stressessemblanceillustrationremarkableforeheadpresidentastonishedsllpperedprobablymusinglydismayedtelegraphpennilesspresidentsubstantialInheritancebeginningvolunteerscomposedpresentlydiminutiveaverageSometimesre-spondedad-vantageCushingPostoflloobedizenedaffectationpropoundhopefullysubmarineappearancerepeatedgirlthoJudgmentvolunteersmorning-tcharmingsmilinglypowderedsickeningthem-selvesmarvelousSaturdaychande-lierRecorder-AdisgraceddaughterliuddnrUrnvolua-ForgivewigwamssometimespetitionscarefullyrespecterspossessedwatchingHflfvoyscaressingalongsideprevailedPlunginganothersolemnlymountainsseamstressIntereststartlingYpallantiWaitingMagazinebloomingunsteadyneighborneighborspeciallyprovidedrepeatedsuddenlyrepeatedpowdercorrectlyim-provedfordvilloProbablychargingdaughterfireplacewanderedwatchingtumblingboundingarrangedWeymanshockinghurryingcaricatureMargerypreparednewspapernewspaperscramblednTsVtlckpossibleAdvanceWeymanhazardouslooking-atpersonalbetokenedSlanderingWoymanconnectedembracedagitationsur-prisedvigilancespeakingblue-stonesneighboruneasilythresholdmnttors-bodowncastappetiteWoymanminglingfol-lowingwonderfulsuccessfulIMBIHB-ACittfirrtianybodyexistencecoveringunhappybeamingterritorydaugh-terCouldntpleasantdisputesconquestrepeateddecentlyfootstepsailthoafternoonambi-tionstogetherMargerybeaminggrowingmlcalltyslanderedenlargedbeamingdismallywithdrawfurnishedpropertyJoyfullyHarveyformationrelativespro-fessionHarveytele-graphgrimly-ItforbiddenJuvenileMargeryattributedmodestydisclosedobligingbeautifulanybodyafternoonbutchersproudlydignity-ItdreamedHarveyMargeryIgnorantpalefacoTinedany-bodyMargeryDeliciousmountainHarveyvolunteerobservedKntorodpossiblestrengthPerhapsdaylightpendingMargeryblunderedslan-deredremainedMargerywrinkledassistantsenselessblushingMargerybraverydroppedrejoinedweddingpicturedAlnslcosexistenceMargeryremainedfreomiujdoperhapsopeningrejoinedbreakfastmorningmorningnotshefon-wouldpackingkeepingnothingsharplybreak-ingIn-quiredpreparedworkinghesitatedtrainingdreadfulcapablecarriagehorrifiedcorrectedMargerygrowingIn-truderscer-tificatennccstorafire-placewrinklestomorrowwonderedMargeryadvancedmountainthroughweddingexcitingmincingrubbingsweetlydroppedbuildingPerhapsworkingcouldntslqnderpeopledstretchesbusinessgroanodtimiditybroughtstraightmakingMargeryforeheadmineralswatchersthere-foreagainst-aLovcrottthoughtDreadfulclaspedplungeddroppedaccountsobservedJanuarysilenc-eIbecauserela-tivesdeclareschokingcrimpedeveningfacilitiesshoulderturningqual-itiesbeautifulnorthernlookingthoughteducatedtomorrowsinkingHarvoywirelesswrinkledweaklybroughtobserveswatcheddreadfulthroughtwilightHobsonsalreadywirelessCommondreadfulsweetestdeclaredattemptcampedacceptsheart-ilyMidwinterJanuarybroughtclaspedexceededrrIIwiroleshwirelesspurposesthroughHarvoyMonthsassessedexplorereflectedwhoeverJilvPIJ1lidreadfulshortlywed-dingagainstfunctionbusinesstroubledgratefulMnniKurlookingbloodnwaitinghusbandwaitingpresentHarveyeludingadditionamountsgettingHarveyquietlyHarveynhuumeltemflutteredthroughchargescqnlredlookingreceivedartifi-cialTltOUHLKdiscoverwretchedperchedpaintedcouldntInjureddismaytrippedpoultrypoultryyiflagainstquicklyHarveyBerdanNight-Ahoweverquietlydread-fulbusinessbusinesswelcomeI3AIA1AHarveyparentslookingHarvoytonightdiatolyperfectforwardbusinessfumbledobsorvafollowedhusbandpartnerHarveyunjustrufbconHarveyHarveyshiningproposesHarveyspecialhusbandfollowedrailroadcouldntmerelyrapidlysettingpeachyKittyshastilyTOVLKSanothertele-gramSeejysshortlyraisingre-centlymarriedforwardmarriedpartnerdeclinessayInslippedtossingdreadful1430557husbandgettingdarlingOctobergeneralHarvoyHarveyhusbandehrrcHarvoyopenedpartiesforwardenteredfamilyEugenespccwlhastilynapkinHarveystainedMarriedglasseslo-cationIn-clinednationsflashedcreaturevendorsbeggedAMoclntntaceInOctobersilencemineralcalmogazingMar-gerywrapperwillingques-tiondis-tancecloselyexcusedHarveydismayHarveySeolyuoUictadsub-duedmyselfmyselfTorronscouldntaoooudenoughhungrywitnessterribletaughtunhandterribleopenedHarveySurelysuffusedbecauselibelousfaintly151158thoughsus-pensewindowwindowfalselysayingpassedmotherthingsgaspedaf-fectedpainteddemandblissfulsystemfamilypeoplecongressfinishedpausedanuglysuitablecreatureprovedgirlishbeautystation-ImonthsopenedcaughtglrlncoveredTorronsSeelysalowlyswollenduringthereonhurriedfulfilledmattersKittygentlykitchentrainedCO-tcoveredenteredtrainedmittorIn-diansiiaW5surfacetwlnkloraatlcalfamilyanothertitteredlayingtreatedI3D002light-lyhimselfexpectmonthsterri-bledinlnggroundturnedTabbyvulgarcouplegeniuswildlywantedWnkutlaflowerstowarddationsslanderpeopleobjectplaceddaintyregionfamilyslowlyaverageAlmostturned-aduringungrnmshakensolemnhimselfratinghfullyfamilySeelysTabbyadmiremothercarpetsignedslandermotherPalmerthingsregardJuniorthingsdowryTheythingsrccoivoInsteadbottomuorvlcocertainenteredsavingnearestoutsidePeopleemptytryingandtollingstudiedvesselsgonuisnaturalsummonsceleryherselfBe-sideswildestdreamsthingsborrowseemedmotherhopedremarkprettywordyoclockreceivefollowstowardbarelydesirefurtherdlningpassedthingsdessertvesselsdaughthingsdelaysmar-ried115108neededoutsidechosenflownCountyDordangigglefittingbrightgaudyplainstargetwheelsInsteadsettledspeakUnitedMarcuscarewornbonnetplatespoliceendurecheekschecksheavyFranceScolyenergyKVhAYneededchosenbonnetendureclatterSurdJUJUstartedturnedpattedcoursealmosttalentsechoedsFrankPleaseWouldhorsesDerdanformalforgotdinnertearfulprettyBurvoylikelysilencefor-tuneCrawshorrorSeelycommonWhoregloomrlsngwaitedneededgoodsSeelyodiousShockedwaitedcannotwouldspeakrathermasterlookedthingKittyvillaindecentwinterTurtlelikelySeolyechoedshouldfatherselvessys-temScalydinnersistersturnedshouldSeelyrathergenialwealthlivingSeelystudygoingSoelySeelyKnmytlikissedlookedsailorsSeelyKittylldltorsecondprettybreathlivingspeakroughspeedwordsOnturylikelythatsdeprebeforedoingfightsknownSeolySeolymonthlookedIndianrecordsearchMINE-AModlitnolessonfatherfatherfatherlandSpurstartlybeganhopesnervoussmilesIndianBostonSeelyKittySeelyHerespatchLA-IleiirlookedhorsesstakesIcnGltmakesSeolylaughSeelysmile-Iwidowmonthfatherworse-AKittychairsrecentbeforekissedhours-IvaluedhorrorbordertrlniryalongSootybeforeSeelySeelyaboutplaceThoroSeelycur-riedshantwfluidHuronfatherfathereveryentiretodaySeelyDoraswhichstolenMebbeDlabrtenouslySoelyKittyKittyconcernwhichwhichactionfor-gotbeforequiteSeolyOrganhandsNorthyoungmarksCentbeingagainpaperspersonaddedThereseizedICIttySeelythingLbrownbeforeStntcafatherKittycop-perKittynighthandshousoshockstationpersonlocateKittyafraidworsewhichstonesamongbeforewomanKittyleverworldSeolyshiverThinkTherobrowshandsafraidwhichKldnorgailyAprilKittyLakesWhenhandswouldwrungulvlllwdraisedAprilquietgazedgreatbeinghouseheardwouldthingArborhandswouldwhichmannersleepwhichwatchTheretouchSeelycheekbrownriderswordsTheyyoungmannerWhenwhichaheadTherestreetentersWhatmakorolledpartybattlelmpadontyoureunderwouldstreetwouldroundShosderedsteepweeksunderaboutflecksgreattheropartyheardwom-anaboutNowhouseaboutbeadsPresspaintWhocourtssmileWhenstreetstairsHrtRlitnthinkKidneyagonyIramenutygreatworststreetyoungthinkRACE88783wouldridersfoundKrtllorsmileWasbloodNowstairslyingVeryhousegrownnavalhearddoubtwomanTholrfoundpiledchainsmilecoursostreetdrovesighthenceeffecteffortheardoInKsgoodgoodyellsthinkterlythoseFORTyoungcould19160dozonworldNosyBladdersweetaboutthinkestateYearsonsheartTakeheroWhatBmllcwhengreat94902broadwhitewhenwontyounglightstreettwicereachWhatwhen10000smallcouldawaytimiddontyoungcouldmakecouldorderothermendthoSOUitlbstlrLarcuothermadegirlsawayabout90885FlourspoongroanbodycoursewhenotherShallsweetsmiledownwhenwontComo08891voicetheyothersmileonlytablecriedOrgAtiiItdoesnhopetheygoodgirlscouldalonecouldknowthesebrideYorkIlllbrideboatscourtvaluefacedveinsliftedtherebridetablocourteverysaucerdriftsonlyonlyJulyashytheycouldcouldcouldthesegroupcriedmadecouldcruelmilestherehopedeepmanypussyhandmanygirlscoursetheyhavehomeknowtherethreecrisisHavecouldstoodknowgirlswhatchairthinkfreshdearyearsonlytheydownknowWithtenedthemcoursethereOPPtenseNeiirIIMMellworkdontfavorotherknowwhenbloodpaidmanyringworksinceknifethornthosemadeTheParismalltheyladytheirhighJulytheykeptFrenchgamedutywlhcoursetablecouldtableownerThenworsetheirmakodowntablethesegroupcolorwhatwordtheyhelptheirlonggoodtheyworkthemfightcourttholrlittlemostHerominewithYorkthemyearsThenfindshandeverytheytheytheybackmustafterstateleastworseyearsthcliwhatsternlaterlinesminebankLocateMichYorklittleshallfalsepaloneverrulChtthemladytimehavetheirbridect-WodontbankfrontLetterafterYourweekrisenmanyfromsuchtheirrovernorvcsforcestarstheytramhavewithshallhavegirlsladytrustgraychristheytacostheiramassWellworsotruthshalltheirwithshallawaythemhourhavominelinesWelllongpasttsionnavyDorabaudDorahavobackleveltramtlf-1iThiswentafterdonohaveleasthandrivalseemsworsepairsignhighkindtimeOnodoneDoraroomsaintcalmthemwentworsewithsnowErieaintaintgamethatvllloacrosspalecrownthanwithvistlmowithLandtimesuchstartPoorpartworsetakodarktookboonwithWelleachbeenoklllwithtlmohardwithwithvisitwifewithwithwithfromhavohaveeachbeenwithaloftheadthenpogrdoorCUMbothbottlrjwithwithownerfromHowkindbeenJustsenddoordonehavedarkbeenboonwithhairholdcityCMIIIOIneverwithslowsuchwithwithwithcomeswithbeenDorafrommostformDorabeenwithwirewithwithwithwithwithwithIIWOsuchwithbothdoorhavethenthenwaitthatwiththatLatedashhardpapauponwithWhenDearyourdearwithhourdoordeardearbore1899withwithwithThisJustwithwithtookrtclnlsaidmustnextverydoorllnfromthathairtuerannextdearwithIntowithwithwithwidewithtookfromrangneverthatverywitheyesdearrathbeenwiththatwithgavelandhurtThishillsupongavehostwithwifewithlibelsoupthqMisswithAndAndwithnextgrayworseholdsaidsaidthatboatNowtitletourwithveincameopenrangwithtookwifeworseFORthatsaidtripAndgirlnamewithdaysaidsaidthatthatarosodealthatthatthatfaceheldthatthatwithcardreadthatAnnbluesaideyessoldsaidflowwigboythatsaidlacosaidthatthatthatsaidthatthatthatgraypoor4tEndhowthatcowlhaircamelipssaidsaidmoneyDAT-VhalfboatlipssaidTherangmetsaidthatableseatthatthatsaidAndwifeheldsaidwhoOVMsayseyesnationcomeAndsaidhowthatforecoldthatboonmayliutllvwhosafethatstoic1900forksamesnowtourAndsaidsaiddaygirlsaidlakealsothatthatsaidsoldsaidsaidthatAndthatwho189GthatfacethatwerehallseemherstillgirlyourThosaidsaidsaidthatThecamethishintSixgiriboythathalfsaidsaidwifewhofacethatwhocamegnllllpassfacesllfdfaceMrscasthallthishimthinThoIntosidewilltlontoldgirlcamecomeThoThenorAndsaidAndwaythatMineeyesfaceearsfacesomecamewillsidehalflawThotinylaststillTheMrsTheThesaidMrsrichwhogirlAndstarThocasesOuUfacepreswillclalhimandlastworeliarMrslinestillbadgaitButwayButlastcrowovenoverhashbarThoAndsaidsaidmayweroweresnowre-lyMrssowsandwillSuedthiswillselfandwillhimworehnnutYouYouSholastMrsTheMrsThofaceMrsputroomsoftThoMrsMrswayfirmwayaltosilknewswillrealwillhadwillandandandgoesbelllasvthisandingjoymotTheThowerewillButIntothoby-awereoversoongotwinShoherandwillendandlefthlebworelikepowbottlelasthadandandbollMrsherandandhimNothimandNotandSheShebutSunfeetandwerewerewereroomweroMrsButputMrshindcalllefthadloftandwillwillandButandandhindhadsomepaypetandandnndfeesMrsandButantiShowereweroButhadandandhadandMrsandandandandandandweroshoandingOurandMrsMrsmetmorearmshadandSheandandandandandnUllandandlawlawandandIvoMrsundandandandlawshesheherhadnullwillandlastandshoandlawhadhasandandthoandandButMrsMrstwoworeandhadMrswerecomovenshehasandYeswolnndhadlawthoandbanandandandSheandanddueandtholawantiandhudliveIllshindcallbellhadlawandandhadlawandhadandhadhasandShoandandnndhadyouthoovarymanialiucallshethoandtheandandyouyouhadhadnodlidshadhadshoButherhadshethetwoanytwoshoherhadbutsoonButandandhadtwoandandandhadsheheryouandandandButpetantigettopovergetpetthorollhasoveryouandvousbutandherandForandhadyouForButrollherget>youyouhasandshehasandandandandworemanIfHsaidVIOlovernearbuthersheherhorfeltForbutshethoyouyoucatWohersheherherandhershesobandhadSinnfeltthorollbutthetheyoutwoyouSooherherWeheryouherherherherhertheherthoheryounowherhershethofellthoherherandsheherYouherthofullbutoverovermantheloftthoMyBYthothethethothethethethothethepetyounowherherandandlownotoverraceshesheherthotollthethoandhasracetellyoushethothoherherthonotthetheherBobthoColthethothothothethoyoushehergaythobutthothothothothothevoythemennothershenotthothethothotheliarthothothothothothothethothothethothothothethethethothesheoutcathothershethoshethothofistthothothethothoherthothethoagoanyhisfellledtholIotthothethonowwasmormannowwritBynotherbutnotnottheoutnotthothothothothothothothetheherbutthethenotnotthethothothothothothoImthothethothethothethethothemennowthothothotheandownmenthohisnotthethethenotthothethethethothetheyouthethodidthothowasthothemynotthonotthothethothothothothehadthegenyouthethothothothohulahishishisnotwashisyourownthothethothewasnotthonotthethotheentthethethothoItsnowhisallforhisnewwasfromnowsawwaswasnotnotoldthonotsatImeyetho10andmyhisthothethethehisnn-cHosetsalcgagosixAllhiscomwaswasyourwaseachwashisItatwonotouttoonotthecatwaswasyouliforhisthothoforoldoldwassawwasroadwaswasandhishisMrhishishishisnotwasMrwoowaswaswascatsotdidhisforforforforoldhishisforhisforcomwasOncanJustcrytillOhwasteedrowwaswaswascatforforhisforHefortorforImoutmyoutWEtedforhishisbyMrwaswaswaswaswaswasmymymyTrynotOhmyforforforwasAnforforforhisforMrbybybywaswassawwasliltpTlilttaltmymymymywasforforcnowasMrairAnwasNohisonobyonohishisbybybyfornotmyforwasAnNoHoHoforourlieonoonocanbymyHoUoOhoursonnorOhforIllallsunfor417forHeforfreoOhallonobybysononeoffPillitsonosoldseaHoallallsonournercanallallofturnbymyallall4ITonoalloffsonallallwillsadnilallandendsonseeallthothsonwillCatoffnilboallbeseeupallLaItsallOfcuruto50ItshebourichouphooutIdhoareseeareAturodohohohohohobohohohegaboItshoareemjlupdoatbohoallbewhinbodoupbehelylyamaupboupofIhodouplyhohoboheforbeemdobobohomeupatgobealtbebohoboambowl40upboatboItlofhobero-JatbegobeacesofofhobeofofoftowowobowotyInintoofofofIntoatinoftotoofofofofatofoftowegoofofInofofofofof80ofofatfttoIntoemtoIntoofthoInanofoftoofofInofIninInofinofatofatofoftoofattoofofatofinoftooftoofofofatoftoofsetonInininIninInInofofoftototoiaofofofofofofatofoftoat40atatofofatofontoofonnttoInMInInIntoinInIIIunIninIninofinInoftotoofofforannnonononanannoonnnofoftooftoofinofto19oftoofoftooftotoVooanananananInonInintoInInInInIIIInintoattotoofInoftotoInIntotototooftorilltotooftototoat01toonoontothetoonananInItof1InInInInIntoofattoIsIsInInnoanonnsanallasofItisIsIsItItIsedInitAUordoononhtsoorIsortoIstoJsItusorAisItItItIsitIsItIsiaItItitIsIsAisItorasWisorIsIsAIsIfsosoasitititItIsItItiflidi1-ati1sosoAIsIsItItitItitIsItIfAllItItItashosoIfItItitItItitItItitMitIf+itItItsytotoItraItILBofaInofPtwowontAItanftol2JfrcAboncc01KBairwntogIccCtonesMitkItItleaIfntJofalitaaaannItaaaaaaaaaanaaaiaa1aaaaaaaaaaaaatIaaaaaaaaaaadaaaaaaaaaaaaaaaaaaaaaaaaaanaooaJ1aatraajIpJIaIIaEnI1rfIIaorIttIIInIIItIIIItnu>tIIIIrtIIItfrsIIitIItI+54vyIrI>httrIritIjrta>iIILiJtIt1I


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\spin01.iarchives.com\scan1\jobq\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01343\ocr\0410a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:14217
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1316
splitwords:0
ScansoftOCREngine Character Count:17888
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:18436
Abbyy6OCREngine Character Count:20617
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;20617;2713;45.149;94.2091
language:en
ScansoftOCREngine Predicted Accuracy:86.17%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:6128
ScansoftOCREngine Character Error Ratio:0.1702
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;18436;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:94.21%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:94.21%
ImgPrep Component Range:11194,14217
version:Newpah v2.32 RoundBox
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;17888;3045;0.911225;86.1652
noPunctuation:1
ImgPrep Component Count Low Estimate:11194
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.32Styles TextStyle ID3 FONTSIZE 10.0 ID5 9.0 ID6 11.0 ID7 12.0 ID8 16.0 ID9 21.0 ID10 14.0 ID11 15.0 ID12 13.0 ID14 31.0 ID15 26.0 ID18 4.0 ID19 8.0 Layout Page ID1 HEIGHT 29380 WIDTH 19444 PHYSICAL_IMG_NR 4 PRINTED_IMG_NR [4] PROCESSING PrintSpace 29063.0 19252.0 HPOS 180.0 VPOS 308.0 PC 0.9421 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 596 17240 2192 308 ns1:type simple language en TextLine 436.0 8892.0 10540.0 String 1768.0 CONTENT jLri WC 0.8095238 STYLEREFS 60.0 28.0 17388.0 612.0 I SP 5080.0 12308.0 228.0 100.0 19332.0 412.0 jl 1916.0 17416.0 68.0 40.0 2192.0 836.0 r xmlns:ns2 ID4 28171 4748 180 1168 ns2:type 640.0 3400.0 1480.0 1168.0 452.0 260.0 1356.0 56.0 36.0 2016.0 1692.0 t 276.0 1740.0 404.0 152.0 2624.0 L 572.0 2052.0 408.0 360.0 3056.0 1176.0 col 280.0 2776.0 168.0 3496.0 1180.0 s 80.0 3416.0 416.0 920.0 3912.0 1188.0 BRHHZE 248.0 3664.0 BRHHZEt ALTERNATIVE BRHHZEAdt-920.0 4832.0 304.0 4072.0 1192.0 RO -760.0 400.0 184.0 4696.0 1208.0 or 320.0 4376.0 3596.0 1248.0 1808.0 132.0 1840.0 cg 120.0 368.0 1880.0 rtclnl 0.82539684 Adt500.0 1380.0 164.0 2460.0 AcInlUrgnnoflvnkullnCouutyI -368.0 2248.0 136.0 2308.0 1816.0 Organ 0.95238096 UrKl1n-2032.0 4340.0 112.0 2800.0 1820.0 of or2760.0 116.0 648.0 2992.0 1824.0 Wnkutla 2952.0 384.0 3256.0 1828.0 IUn -384.0 3640.0 520.0 3680.0 1836.0 County 432.0 Cuuui -520.0 4200.0 556.0 4288.0 1844.0 1lorlitn Jlorlclulnrida176.0 4112.0 1lorlitnPUnlBIIRD -556.0 4844.0 JlorlcluIUDL18IIRD 440.0 4400.0 lnridacg -444.0 2088.0 2224.0 2108.0 852.0 2132.0 PUnlBIIRD IUDL18IIRDPCDGiAIIBn144.0 480.0 3176.0 KVhAY EVhYYVhtY3076.0 108.0 240.0 3760.0 2148.0 Pill 104.0 3656.0 352.0 Pliln -240.0 4000.0 508.0 3804.0 rIUDAT -308.0 rIUDATo -508.0 4312.0 292.0 4020.0 2152.0 DAT -292.0 DATV 4128.0 A7 -184.0 A7P 3204.0 1704.0 2448.0 P 20.0 1776.0 2488.0 o -48.0 140.0 2004.0 2456.0 W iV208.0 1796.0 88.0 2056.0 V -88.0 2144.0 124.0 236.0 2296.0 2464.0 IIU 596.0 2300.0 JUJU DUVAL-232.0 2532.0 2672.0 2468.0 AI -224.0 2896.0 492.0 3364.0 2476.0 Krtllor JIltorIAltor2856.0 264.0 3920.0 2480.0 and nnil64.0 3856.0 128.0 4056.0 lit -128.0 4184.0 660.0 4244.0 2484.0 Me111gnrJ 4248.0 MnniKur Me111gnr-656.0 4904.0 2552.0 1716.0 84.0 J 0.96825397 31912.0 2628.0 M 1800.0 72.0 T -136.0 2048.0 720.0 2160.0 2632.0 TOVLKS TWJjlTOWLEy1984.0 2808.0 2640.0 S -72.0 2880.0 696.0 3012.0 AMoclntn AAAoelltnAesocintn3784.0 lldltor dltlrEdllor76.0 3708.0 EdllorORA11FOIt1YIISLE -480.0 4264.0 3788.0 2648.0 lldltorGKAWFORDYILLE -476.0 2652.0 l 4268.0 3900.0 dltlrCIt 3844.0 1752.0 2820.0 ORA11FOIt1YIISLE 156.0 1592.0 1996.0 2904.0 GKAWFORDYILLE WFOImVIILE-1592.0 3588.0 148.0 CIt 800.0 3752.0 2912.0 FLORIDA LOIlIUAFLOiillht1528.0 FLORIDAKntorod -800.0 4552.0 FLOiillhtrntoroct 676.0 3876.0 LOIlIUAFntcrcI -676.0 2968.0 1928.0 3196.0 652.0 Kntorod FntcrcIrntoroct3212.0 at nt2580.0 252.0 2908.0 tho 2804.0 776.0 3272.0 Postoflloo PostofficoPoatofoo3160.0 4160.0 3220.0 4048.0 472.0 4424.0 Craw Craws4316.0 CrawsIordvillc -472.0 4896.0 4428.0 Crawfordvillo -468.0 Crn -412.0 4840.0 Crnforctvillo -276.0 4704.0 3092.0 1744.0 3384.0 692.0 fordvillo forctvilloIordvillc160.0 2500.0 3432.0 AU as2436.0 2584.0 u -76.0 2660.0 540.0 2728.0 3392.0 aoooud Becondacooud380.0 3340.0 oInKs closaclass3268.0 336.0 3860.0 mall innilwnl13720.0 528.0 4308.0 3404.0 mittor mUormttor4196.0 mittorOno -528.0 4836.0 mUorOno mttorOno 2764.0 1756.0 3692.0 328.0 3696.0 Ono 376.0 Year 2084.0 2588.0 in 2520.0 680.0 Advance AdvnncoAclvaulco2740.0 Sl 708.0 3488.0 SlSix -164.0 4360.0 216.0 4304.0 10 -56.0 10Six -216.0 4520.0 3140.0 3880.0 Six 2080.0 3884.0 Months 2020.0 4208.0 50 GO1516.0 2692.0 4456.0 3896.0 Cent ConUCont4384.0 ConUPrnnk -440.0 372.0 ContFrank CentFrank -372.0 4828.0 2928.0 1948.0 488.0 Frank Prnnk656.0 2524.0 4300.0 Lovcrott IoverottLoverettor3180.0 3484.0 the3412.0 512.0 3816.0 United 92.0 3724.0 464.0 4408.0 Stateageological 4328.0 4412.0 Stntca StntesStatea-460.0 4872.0 Stntcaecological -464.0 4876.0 Stntesgcooglca 172.0 3100.0 1780.0 4524.0 788.0 ecological gcooglcageological516.0 4564.0 Burvoy Rurvoynurvoy2568.0 3336.0 4535.0 has hl183208.0 344.0 4540.0 boon been4276.0 212.0 4064.0 4640.0 4532.0 thethoneighborhood 4880.0 thonolghlJOrhoOll thenelghborltood 1784.0 4756.0 1072.0 neighborhood nolghlJOrhoOllnelghborltood2936.0 4776.0 ot3156.0 4772.0 Ann 3084.0 3560.0 Arbor AIhorArlnor3476.0 364.0 4124.0 4768.0 Mich 4012.0 220.0 4664.0 4764.0 for tor4488.0 forabout -220.0 4884.0 torabout forabort 4988.0 about abort2328.0 4996.0 six alx96.0 2232.0 5004.0 months month82556.0 592.0 4999.0 making nmkhlg3232.0 5036.0 a 3928.0 32.0 4108.0 420.0 4204.0 study stuely4052.0 4728.0 4992.0 ot4624.0 ofsurface -152.0 otourrnco ofeurfnco 5228.0 576.0 surface ourrncoeurfnco804.0 2428.0 5232.0 geography geogruphy2356.0 3308.0 5236.0 tor3604.0 the3528.0 912.0 3924.0 government governmontgovernmentHo governmontHo-912.0 1792.0 5456.0 Ho 2096.0 5460.0 finds nnlla316.0 2540.0 5463.0 that thlt244.0 2932.0 the3240.0 site3592.0 5472.0 at3516.0 3828.0 Ypallanti YpsllnntlYpallnntl3740.0 284.0 4592.0 5484.0 was W184508.0 wasat -284.0 W18at 3108.0 1772.0 5700.0 5712.0 2000.0 5740.0 ono one1944.0 tlmo time2264.0 2736.0 5716.0 tube3044.0 bottom 2980.0 3644.0 5720.0 or3584.0 5748.0 3796.0 3944.0 lake Inlee460.0 4420.0 which whichwas whichwaa 3080.0 5908.0 300.0 5948.0 waa2176.0 5927.0 connected 3036.0 5924.0 with 456.0 3480.0 Lakes lnlectl3388.0 Huron 3936.0 4596.0 nnd4512.0 andErie -280.0 272.0 4600.0 nndErlo -272.0 6148.0 Erie ErloErieThoro -344.0 2136.0 ErloThoro ErieThero 2888.0 1980.0 6460.0 6484.0 Thoro TheroIs 182444.0 6516.0 2656.0 -92.0 2828.0 6488.0 great grent2768.0 312.0 3396.0 6476.0 deal dea3316.0 to 4028.0 ho bo356.0 4280.0 6472.0 done llano4192.0 4724.0 4636.0 tomako -144.0 4868.0 tomnlto 3068.0 6680.0 6712.0 mako mnlto6708.0 wireless wlrolosBwlroos8828.0 3128.0 6703.0 telegraphy toegral1hy2996.0 4080.0 applicable nplltlcnblo3956.0 applicableto nplltlcnbloto-788.0 3064.0 6911.0 6948.0 6940.0 all nl11960.0 2324.0 6944.0 848.0 6936.0 necessities nocoflsltlcsnocoRslties3580.0 at3500.0 3812.0 6928.0 the3728.0 728.0 4136.0 telegraph tologrnphtelegraphbusiness -728.0 4864.0 tologrnphbusiness telegraphbusinesa 7144.0 7167.0 business businesaInd7164.0 by 3224.0 the340.0 3536.0 7160.0 time3468.0 3940.0 7156.0 thnt7148.0 dono done4436.0 donotho -360.0 -356.0 donethe 7364.0 7400.0 the644.0 7396.0 function 204.0 2060.0 3024.0 at3292.0 7388.0 the724.0 3652.0 7375.0 tolegrnph4584.0 will wiltwillprobably wiltprolmbly 192.0 7592.0 7620.0 probably prolmbly2616.0 7624.0 bo2504.0 2900.0 7652.0 so ao2784.0 3172.0 7612.0 enlarged enarged7608.0 thnt3824.0 4364.0 7604.0 it 4252.0 4580.0 wll14476.0 willtako wll1tako willtake 7820.0 7856.0 tako take188.0 7852.0 nil allthe2452.0 2924.0 7848.0 wire wlro3380.0 7844.0 lines linosIInos3264.0 7835.0 ami3732.0 632.0 4232.0 wirolesh wlrolesbwireleab4116.0 wireleablines -632.0 628.0 4236.0 wiroleshlines -628.0 wlrolesbJines 3060.0 1804.0 8047.0 8084.0 Jines2256.0 8080.0 together togetber2180.0 8076.0 3192.0 do 3124.0 3440.0 8072.0 the tho3368.0 3744.0 8064.0 buslnoss3676.0 348.0 4464.0 satis aatlsnatls4388.0 satisfactorily -348.0 4812.0 aatlsfactorlly natlsiactorlly 8108.0 4808.0 8276.0 684.0 8308.0 factorily factorllyiactorlly2724.0 8303.0 And 392.0 3152.0 8299.0 what 3648.0 ot3544.0 8296.0 3792.0 616.0 possible posslbopossibleapplication -616.0 8280.0 posslboapplication 8511.0 876.0 8532.0 application 2788.0 at2680.0 3052.0 8524.0 wlrooss2944.0 808.0 tolegrallhy3684.0 4720.0 4604.0 totelephony tote01lhony1 8736.0 864.0 8763.0 telephony te01lhony1256.0 8760.0 Wo We296.0 3356.0 8788.0 may 3840.0 8752.0 after acter4336.0 4212.0 bo be4516.0 boonly -168.0 beonly 1812.0 8956.0 8992.0 only 2268.0 9020.0 on 8988.0 the8980.0 threshold throRhod2812.0 at3660.0 4044.0 9008.0 3932.0 620.0 wlrolosswirelessago -620.0 wlrolossngo 9200.0 9252.0 ago ngo2208.0 9216.0 observes obBorvoa2972.0 9212.0 the3300.0 9208.0 No 3216.0 Nosy -208.0 3508.0 3736.0 York YorleCommon CammerCommer4100.0 Commonclal 4860.0 636.0 Cammerclll Commerclal -636.0 4820.0 9444.0 clal clll2868.0 1976.0 9784.0 9803.0 Tho fhorho2360.0 9832.0 pro 2272.0 880.0 2364.0 9795.0 prospective proopeclvo-248.0 2612.0 536.0 2704.0 poctlvo -540.0 3244.0 968.0 3332.0 9788.0 development dovololllnentdovolopmentat4616.0 our ouioutouisubniarlno -228.0 ouraubmnrlno 224.0 outnubmarine 10016.0 888.0 10032.0 subniarlno aubmnrlnonubmarine10036.0 boat hont2700.0 3252.0 10028.0 3144.0 424.0 10024.0 likely llkolyIIkeymake nmkomnllo4172.0 4788.0 10044.0 un4676.0 anow unow nnow 3048.0 10252.0 10300.0 now 2184.0 10267.0 demand cJenu1l1l2128.0 2844.0 10296.0 3088.0 10292.0 3028.0 3408.0 10259.0 naval nlvnl3344.0 3892.0 training lrnlnlng232.0 4568.0 10276.0 systeen 4572.0 sys 4800.0 system 10284.0 8 52.0 4648.0 10280.0 > 4736.0 4700.0 Stem -64.0 10304.0 10488.0 10508.0 tem teen10500.0 With 1Vit11196.0 2100.0 10496.0 ol1ly2688.0 10528.0 one3104.0 such 8uch3444.0 324.0 3948.0 bonl10515.0 1I0W4272.0 In 4644.0 Inexistence -140.0 InxlBtonco inexistence 3072.0 10731.0 744.0 10752.0 existence xlBtonco2720.0 the604.0 10744.0 Holland unhand2964.0 II -604.0 3712.0 3248.0 011 3228.0 268.0 10748.0 nl1l1 3424.0 3904.0 tho544.0 requiremeats 4148.0 4284.0 require 4824.0 requirements -544.0 requirementa 10792.0 10948.0 476.0 10972.0 meats mentsmenta2344.0 10964.0 ot2276.0 10960.0 tim2492.0 2872.0 uorvlco ucrvlcoaorvico10956.0 have havohno332.0 hoenbean3848.0 10952.0 mot molmet4256.0 4692.0 hy4628.0 byvolunteers -176.0 hyoluntcers 11180.0 11195.0 volunteers oluntcers11191.0 but hut3188.0 when whon3716.0 the784.0 halfdozen hattdozon3960.0 halfdozenvessels -784.0 hattdozoncasols 288.0 11184.0 half 4440.0 dozon 4368.0 dozonvessels -424.0 1788.0 11416.0 552.0 11428.0 vessels casols2440.0 11432.0 at2340.0 2696.0 the2596.0 3040.0 11424.0 kind Illnll3492.0 11451.0 3376.0 3908.0 building Imlllllng3800.0 11443.0 uro are4536.0 urocompleted uroc0Il11lote1 areconnploted 3004.0 11651.0 11659.0 completed c0Il11lote1connploted2664.0 11664.0 2848.0 wJJ12780.0 not 3132.0 3532.0 11655.0 hebe3460.0 3768.0 IWRslble4444.0 4372.0 4660.0 11680.0 ro re4588.0 roly rely 11880.0 11900.0 ly 2040.0 11896.0 unly1952.0 11928.0 2372.0 11892.0 2644.0 mid nullnod4036.0 11924.0 n specially I1I1Cclnl1yspeciallytrained -660.0 I1I1Cclnl1ytrnlnel 12115.0 560.0 12127.0 trained trnlnel2432.0 12132.0 force forcotorce2884.0 ot1084.0 12119.0 auhmnrinlsta 118uhmnrlnlstnsllbnturluista4348.0 boboneeded honecllell honeeded 12348.0 524.0 12364.0 needed necllell2516.0 The Thofheduty Iutyduly3284.0 12388.0 396.0 12360.0 these theaothoBO12352.0 vessenvosselnw1l1willcall w1l1cnl1 -268.0 4856.0 12579.0 12596.0 call cnl112600.0 tor2068.0 12628.0 a2396.0 2676.0 12591.0 high 2576.0 3112.0 order 3616.0 3524.0 12587.0 oklll fllcllIskill3776.0 24.0 4228.0 12616.0 j It wilt4484.0 willbo willbe 12820.0 12832.0 110be12824.0 also nlBo1968.0 12856.0 very 2388.0 2948.0 hazardous Imznrllou2840.0 3972.0 Our 496.0 sailors slllorssailorshave -496.0 slllorshno 13051.0 13060.0 hno2260.0 13088.0 never noverhesitated hesJtnted3576.0 3472.0 732.0 13055.0 volunteer 4652.0 tor4556.0 fordangerous -212.0 tordnllgerous 13284.0 796.0 13296.0 dangerous dnllgerous388.0 13292.0 work wore3200.0 13320.0 as us588.0 3448.0 witness wltnosssvlbtoas736.0 Cushing diallingsCusllln11diallingscrow -736.0 Cusllln11crow 4792.0 13311.0 acrew 13515.0 13556.0 crow crew13528.0 Rl1I12156.0 13524.0 Hobsons IIobsons13519.0 hut3352.0 the4260.0 requlre4156.0 requlrem requiremoats 48.0 13580.0 13756.0 13767.0 moats ments13796.0 m 2028.0 nta 1920.0 13763.0 orthe816.0 submarine submarino2816.0 13760.0 boats 13792.0 are 4528.0 notmet 14004.0 14019.0 met 14016.0 14012.0 merely morelypersonal porsonal2984.0 3836.0 14008.0 bravery bravory4748.0 A 4452.0 Anow -120.0 Aflow 14220.0 14252.0 flowrating 14248.0 scorns aeemsseemsneeelm740.0 composed IJtdfoftrained -148.0 IJttraIned dftrained 14452.0 564.0 14456.0 2424.0 14487.0 men who shall ahnJlreceive rccoivorccolvo3628.0 special spcclnlspecialpay -524.0 spcclnlny 3020.0 14684.0 14716.0 pay 1876.0 14720.0 ny 14691.0 tor14688.0 their tholr2376.0 vory2836.0 3348.0 spccwl spec 3872.0 3832.0 3968.0 4496.0 com corn4356.0 comincnsurato -300.0 4796.0 comJ cornmonsurato 14920.0 824.0 incnsurato ensurntomonsurato14955.0 -824.0 2600.0 2732.0 896.0 Its tl1Gtr14968.0 < -24.0 3700.0 mlcallty mlcaHtynnlcalitynnll4448.0 andrufbcon nnlll andw3668.0 15188.0 15236.0 2200.0 i 936.0 1264.0 584.0 15200.0 rufbcon aalioon1360.0 44.0 15252.0 -512.0 4176.0 15204.0 beon 608.0 brought hrouglntbroughtbefore -608.0 broughtbetoro hrouglntbefore 15308.0 15323.0 w + 0.0 15431.0 15471.0 before betoro15460.0 the2288.0 2756.0 15479.0 navy 892.0 15444.0 department depnrtmontalready areldy4132.0 alreadyand -572.0 areldyanel alreadyi 15664.0 15772.0 15704.0 anel1424.0 15692.0 2076.0 2508.0 15696.0 be2748.0 15683.0 provided Cor548.0 3772.0 15671.0 shortly Bhortly15668.0 4320.0 n11allprobability -192.0 4852.0 n111robnblllty 15908.0 860.0 15924.0 probability 1robnblllty2772.0 15952.0 says 15916.0 theNow New3420.0 YorleSunThe 4292.0 Sun SunTho -288.0 Suno 16187.0 1956.0 16316.0 16351.0 The16347.0 Torrons 1308.0 3008.0 16328.0 landregistration Inndroglatrntlon4392.0 16324.0 law JawJs Jsgrowing -68.0 sgrowing 16555.0 16584.0 growing 16572.0 alowly slowly16567.0 favor 3820.0 16563.0 Massachu 1IuB8achuMassacltu3964.0 Massacltunotts -740.0 Massachusetts 1IuB8achuHetla 4804.0 16615.0 16788.0 16823.0 setts Hetlanotts16815.0 16811.0 1n16807.0 recent 16796.0 thecourt courthas -404.0 court111B 17023.0 17056.0 111B17052.0 been heen2064.0 428.0 17040.0 doing 2496.0 3096.0 17036.0 nbout3608.0 17031.0 nl1the4220.0 buslneHSbusinessfor -640.0 buslneHStor 17271.0 17312.0 tor444.0 17296.0 2032.0 2940.0 17287.0 Ims2824.0 664.0 3324.0 17279.0 facilities fnc11l1l084240.0 17275.0 For 3988.0 4620.0 the4504.0 tholast -244.0 thelast 17479.0 17516.0 last two 17535.0 years ycara17500.0 the17491.0 record 4164.0 fees reeapaid puldpaidover -320.0 puldover 17724.0 17780.0 over 716.0 2228.0 17731.0 quarterly qunrterly3032.0 17764.0 17728.0 I8tol1ows follows 4188.0 January JnnuaryJnnuaryJ899 17947.0 17980.0 1899 J899380917972.0 19160 11GO1910017964.0 April 17959.0 151158 511j8 51158-428.0 July 4492.0 JulyI4902 -336.0 1892.0 18195.0 18211.0 94902 I4902049032564.0 18199.0 October 08891 G8S01Jnnuary3868.0 18419.0 18448.0 1900 2352.0 18440.0 I3D002 2124.0 36002 350022852.0 18428.0 90885 90S85Juy1900.0 18671.0 448.0 18696.0 88783 18683.0 2348.0 3320.0 115108 S11MOS1161083116.0 4040.0 18675.0 Tune200.0 entire entlroentireassessed entlroassesaed 18883.0 18904.0 assessed assesaed2548.0 18896.0 value mlueat3276.0 18891.0 the3600.0 18887.0 land Inml3512.0 580.0 4016.0 covered coerollbypetitions byt 4680.0 19112.0 19135.0 petitions 1568.0 2592.0 19127.0 presontpd presontod2636.0 lrcflont -684.0 d 3148.0 19131.0 19123.0 3564.0 3996.0 19116.0 since Blncosinceits -388.0 Blncoits 19351.0 19372.0 its 748.0 19368.0 formation 19376.0 tort -748.0 2876.0 lllon 2400.0 19360.0 both 3504.0 the19387.0 cases CI1SCSsettled BotUellsettledand -516.0 BotUelland settledanti 19607.0 19628.0 anti19624.0 those thoso2744.0 19616.0 still stilipending pondingIlel1lllngamounts nmounts4732.0 toi 1908.0 19815.0 19832.0 1430557 1430657An 2536.0 868.0 19824.0 illustration JlJustrnlloll2976.0 oC4296.0 19819.0 the4632.0 ads adsvantngo ad ndadvantage -172.0 ndnntngo 19880.0 19915.0 20055.0 20075.0 vantage nntngovantngo20067.0 at20063.0 tho2708.0 systom20059.0 tor4104.0 businesspurposes businessI 20288.0 688.0 20331.0 purposes purposos20296.0 la20292.0 furnished turnlshed2684.0 3572.0 the700.0 4140.0 Recorder 4068.0 RecorderA -700.0 504.0 4500.0 20356.0 20543.0 20567.0 man mnn1936.0 20527.0 real roal20531.0 estate estnto20523.0 4088.0 the3992.0 20519.0 North 4332.0 NorthEnd -452.0 Northl 20756.0 20772.0 End 20775.0 -316.0 nd 1872.0 2236.0 20768.0 otBoston Doston3164.0 20787.0 WI8wan20760.0 valued uuadnt atntabout -156.0 4888.0 ats atabout 20895.0 20983.0 21003.0 20999.0 10000 3000.0 20991.0 had 2860.0 764.0 3372.0 registered relsterell20987.0 under unlltJrundertho unlltJrt 21124.0 ft 21263.0 21243.0 tho1524.0 2172.0 21239.0 Torrens21224.0 Ilwlie Ho21228.0 went wont21232.0 tltothobank tho1Innle tltobank 21455.0 21476.0 bank 1Innle21467.0 und2196.0 2604.0 21459.0 wanted wnntodborrow 21488.0 3984.0 tho4224.0 21492.0 cor cercertificate cort cortificate 21523.0 21692.0 21740.0 532.0 21707.0 tificate Uflcnte1564.0 21703.0 Thorho1112.0 representative representntlvo21696.0 atthe4472.0 thobnnk thebank 21923.0 21944.0 bnnk21967.0 saw Hnw2620.0 21935.0 the668.0 property 21927.0 the3808.0 morning morningand -664.0 4848.0 morningt morningIt22119.0 22160.0 22215.0 22256.0 22179.0 anll1604.0 2168.0 22171.0 tho2092.0 2472.0 22200.0 papers lmperapnpara2412.0 22195.0 were wero22167.0 passed llsse122163.0 thethotransaction thotrnmmcllon thetransaction 22395.0 872.0 22408.0 transaction trnmmcllon22399.0 finished tnlshodnbout1 oclock 3980.0 thothIJ4576.0 thosame thIJall1o theanlno 22631.0 22672.0 same all1oanlno2304.0 22639.0 day tinydn -264.0 22635.0 Instead Instondatcovering covcrlng22668.0 urorthreo urlhree ora 4684.0 22863.0 22868.0 22876.0 three threolhreeweeks weokn2220.0 22899.0 k8 the3748.0 search soarch3632.0 22872.0 atthethotitle thod thetills 1728.0 23099.0 23107.0 title tills23103.0 2140.0 2416.0 other 23136.0 -400.0 hcr delays dolnYRdolnYRJ delaysi 23340.0 23363.0 23351.0 WE VLVI 4324.0 4416.0 ARE ARBAnIARBTROUBLE -340.0 AnILOOKINO AREt 4716.0 AREyifl 23411.0 23475.0 yifl 23563.0 23587.0 rrII 23427.0 X 3624.0 952.0 23500.0 LOOKINO LOOKINULOOKINUIrwt -952.0 23715.0 Fon IrwtFonTROUBLE IrwtTROUBLE 984.0 23867.0 TROUBLE TROUBLEKidney -984.0 TROUBLEr 24112.0 3016.0 24255.0 624.0 24276.0 Kidney 24272.0 Bladder BladderTltOUHLK -708.0 4892.0 BladderruounLt 24439.0 24463.0 24567.0 TltOUHLK ruounLtfltoUILE1324.0 TltOUHLKCOMFORT -796.0 fltoUILEp -776.0 3548.0 ruounLtCOMFORT -772.0 712.0 24903.0 25031.0 p COMFORT 760.0 COMFORTthoSOUi COMFORTtblCOMFORTlheth-1880.0 25200.0 25211.0 thoSOUi lheth25215.0 tbl -504.0 Ytlt Ontury fturr25204.0 Kldnor Khlnartldnor600.0 Modlitno MlldlrlllAledtclue3436.0 4216.0 Is4096.0 -96.0 fu 25207.0 tueran ullfan 4612.0 ntod 25311.0 25319.0 25343.0 teed tod-36.0 25352.0 tu25356.0 curu cureillmn IIMMell dlMitaee-332.0 25363.0 25331.0 25335.0 ttretb -196.0 KltlnerUladt16CitledderBladderand Uladt16C61Ul itledderand -492.0 25439.0 25467.0 61Ul2104.0 25456.0 trlniry trlunry2212.0 25463.0 rlllrr 25460.0 OrgAtii Orttan25479.0 rlAnl each nurhlIu11ee3520.0 25443.0 Ilrtt HrtRlitn IIrllChtll-236.0 25452.0 hte -188.0 484.0 IMBIHBA 11111111111IMBIHBACittfirrti -484.0 11111111111rh Illsii IllsiiCsterrhut 25564.0 25583.0 Csterrhut 25587.0 Cittfirrti 2164.0 rh -132.0 2332.0 ul25595.0 tliithl25616.0 -32.0 25575.0 liuddnrUrnvol I1IAlltlllrlJrulnladdnrlrsvul25567.0 Dlabrten fllsbrteeJI1ab -576.0 4352.0 4168.0 4432.0 VIOl lioiVIOlInll fltoper fltoperend 4760.0 sy 4752.0 syc 25691.0 25712.0 end Inll25703.0 IthuIIIIIAt4In nhuumeltem25708.0 hleb ahkeh2892.0 le 25695.0 CMIIIOI causal3540.0 from Irom111 anox oxr 01 01ltI 25812.0 25891.0 25859.0 aces 1088.0 c ltI 1852.0 25843.0 01of1988.0 2284.0 25839.0 uric 25827.0 add ILllIlIsaid2544.0 Try 25851.0 rr -124.0 3304.0 25847.0 0110one25823.0 bottlrj buttlrwttll -408.0 If ItU25816.0 Itdoesn 25820.0 11 Itdtlul1 doeen4380.0 dtlul1do -376.0 tdo -52.0 4900.0 25943.0 25959.0 Just JUMI25979.0 KB AIae25983.0 wn N -160.0 2560.0 e ialiu Istm25976.0 wo WI 25947.0 wlhruluml rufuudrill 25963.0 lid your 4152.0 ollr 25951.0 money monortnunoymoneyCUM -432.0 monorCUM tnunoya 26059.0 26124.0 26076.0 CUM 1404.0 780.0 26072.0 CUMFOR -396.0 468.0 FORT FO R 26083.0 le-100.0 sold 11010eobltu3428.0 26087.0 every aVlOrrovaryulvlllwd cirlllred3780.0 1016.0 111llIulGUOII nation ustlortnationMl ustlorttalt 26176.0 26203.0 talt 1896.0 Ml 26228.0 26219.0 Juuryttr2292.0 768.0 2712.0 26195.0 Oruxchlfor 26199.0 hulrgt -744.0 2796.0 rulCht 3136.0 26223.0 -112.0 26207.0 3296.0 tor26215.0 a772.0 26184.0 freomiujdo 26187.0 frlU trou11111111111 ntntplobottle boUlebattle26180.0 bottleJf boUleJt battleJf26299.0 26319.0 Jf Jt1964.0 26332.0 huhnnut hnMIhneut2116.0 26328.0 atwrit write26339.0 us 26343.0 26315.0 anltsad26336.0 we26307.0 mull 1111111roadfreo treo4544.0 treoLarcu -252.0 freoLurJIJ freoLaru 26432.0 26447.0 Larcu LurJIJLaru26455.0 liutllv lturtlnSuUl 26451.0 All auOuU CClutCoubr26443.0 fttet26436.0 druggUU drugshttdrugght3756.0 druggUUJffMJlW drugshttNIHlUIHlJ 26467.0 -60.0 rrturpttteu 1552.0 26603.0 26679.0 NIHlUIHlJ 26611.0 rturpttteu JffMJlW UIl 3456.0 26671.0 OVM 0 Dlnl01AFCO 4120.0 DlAFCO 26827.0 26952.0 y 792.0 26848.0 AFCO 1544.0 1500.0 26831.0 CHEMICAL HEMICALCO COt 1376.0 26935.0 26956.0 26967.0 1576.0 928.0 1316.0 27063.0 27131.0 27075.0 417 980.0 1348.0 27083.0 2572.0 te 27079.0 4IT 411T4u727071.0 3120.0 27067.0 Knmytli 1I0rll11iVoraytltHt RtNI4084.0 Htv RtJAOISONVILLR NIJACISONVILLE 1748.0 27191.0 27247.0 v 1296.0 27212.0 JACKSONVILLE JAOISONVILLRJACISONVILLE1868.0 27199.0 FLA YLAFLAV FLArrcorree YLAfirFpa 1416.0 27335.0 27339.0 1536.0 27391.0 1848.0 fCWCorreaprndpnc 1940.0 27368.0 rrcorree -1204.0 27371.0 rndlnceln 2608.0 3280.0 27364.0 German Unman27351.0 French 4004.0 4668.0 and8p -260.0 4928.0 aD aDpanleb 27319.0 27563.0 1672.0 firFpa 27487.0 8p 27495.0 panleb nl ehrrc -12.0 27516.0 27395.0 lln 27499.0 IIIwritlnIour 2716.0 1336.0 writlnIourenmple -792.0 2792.0 wrltlnc -1312.0 wrIU 3288.0 27507.0 27383.0 enmple Ample unmplo27479.0 bolt bottcei 4180.0 27472.0 uoUictad uoUictadii4r -668.0 adreLeUr 27607.0 27631.0 aE 1652.0 ii4r 1276.0 948.0 1732.0 tdreesLctter -256.0 752.0 1932.0 27615.0 reLeUr 27647.0 5 -536.0 Letter 27624.0 27611.0 Department DCl1artmtuU820.0 27620.0 Departmentt Departmentj-872.0 27747.0 27967.0 28095.0 28331.0 28479.0 28607.0 Jtlf 28656.0 28756.0 tlf tlf1i 2668.0 1444.0 29235.0 29263.0 1i 29247.0 2112.0 29259.0 h 1864.0 2204.0 xmlns:ns3 ID13 944 4608 5528 1404 ns3:type 4608.0 5528.0 1200.0 1460.0 Their 6952.0 1464.0 Daughte 6728.0 DaughteBY -1896.0 8848.0 6956.0 Daughtef -1892.0 DaughtefBY -3180.0 10136.0 1632.0 7328.0 BY 7672.0 7564.0 7676.0 I3AIA1A -44.0 7720.0 7800.0 MMA -448.0 8248.0 8340.0 8612.0 OPP OEh8456.0 xmlns:ns4 ID16 24884 3188 5032 2804 ns4:type 5384.0 Your YoUIfour5868.0 lnstInst5756.0 6248.0 Llay6140.0 6796.0 Dear DenrDoar7304.0 dear Llear7792.0 must mUllt7636.0 mustyou 8180.0 mUlltyou 8176.0 5124.0 you go 5396.0 5728.0 today 5648.0 6260.0 Harvey Harvoy7056.0 said 6816.0 7444.0 Mrs 7356.0 Soo See7728.0 Sooly 8104.0 SooIy Seely Iy5412.0 looking 5268.0 6076.0 across 5984.0 6640.0 the6544.0 6968.0 breakfast hreakfnst6872.0 7788.0 table tnllotablo7692.0 tableat 8172.0 tnlloat -380.0 8168.0 tabloat 5368.0 her hor5276.0 5708.0 son 5620.0 6104.0 wltb5956.0 6536.0 affectionate nlTcctiolluto6436.0 7520.0 concern 7428.0 concernAnd -596.0 8116.0 5288.0 5600.0 6048.0 daughters daughter86908.0 3568.0 ICItty IClllyKitty6800.0 7412.0 7312.0 7796.0 Margery Mar 8100.0 Marcery 5120.0 gery cery5556.0 echoed 6168.0 Ilcr6056.0 6520.0 wordsCouldnt 6416.0 6524.0 words -436.0 6960.0 wordsIICouldnt Couldnt IICouldnt6116.0 6016.0 6212.0 ou 6376.0 huvehavo3952.0 got 6840.0 7284.0 off auoft7184.0 7584.0 7484.0 7908.0 an 7804.0 another 8092.0 4008.0 5116.0 5636.0 week 5524.0 6288.0 4144.0 Bald snlLlsaid6008.0 6704.0 his hla6592.0 7036.0 father rather6920.0 7656.0 breaking 7504.0 7660.0 break breale8088.0 brealeIng ing 5468.0 n5360.0 5668.0 hot 5552.0 6012.0 roll 5904.0 6380.0 carefully carerully6264.0 7292.0 IINow7832.0 thatyoure 7724.0 7836.0 -324.0 8160.0 th 7992.0 tyoure 1760.0 5112.0 4560.0 youre partner IlI1rtner5584.0 6352.0 though thouJh6228.0 thoughNow thouJhIINow 5256.0 4740.0 IINow5840.0 5696.0 6284.0 Im 568.0 6672.0 -568.0 7240.0 6860.0 rtnor 6744.0 7432.0 Ita its7812.0 hard hardwork 8152.0 hn hnwar 7988.0 4912.0 4940.0 war 5492.0 Ie 5612.0 4908.0 getting gottlngorr6156.0 6700.0 responded responcleti6456.0 HarvoyUnrVIJY7460.0 HarvoyScoly -560.0 UnrVIJYSeely HarveySeely 2252.0 5088.0 5103.0 Scoly5704.0 5100.0 lilt 5512.0 5800.0 -116.0 5916.0 5988.0 5132.0 WI86332.0 5092.0 all6596.0 5096.0 6512.0 6720.0 could 6636.0 107108.0 doHo -180.0 doIie 7220.0 10lie 1600.0 5280.0 5296.0 lieIie5592.0 5292.0 paused 5480.0 6192.0 suddenly Huddenly6092.0 suddenlyWhat 6868.0 HuddenlyWhnt 5364.0 What Whnt5888.0 wuaWIlS5784.0 6276.0 5476.0 nil6584.0 5500.0 6464.0 6844.0 7468.0 7348.0 7936.0 7644.0 Inquired inquirod 5104.0 5671.0 quired quirod5680.0 Kitty 5588.0 KittyWell -392.0 6072.0 KittyWoll 5848.0 5864.0 Well Woll5964.0 5860.0 6400.0 HnrveyIlarvey6272.0 7124.0 laying nylngflown slownslownhis -420.0 8140.0 flownhis 7732.0 down downhla 5108.0 6036.0 hla5428.0 knife knlfo1I1lto5328.0 5900.0 6052.0 5816.0 fork rork6172.0 6792.0 6040.0 7228.0 7132.0 7492.0 beaming 7316.0 beamingsmile -652.0 8144.0 6244.0 smile hero IIhero5508.0 6196.0 goes 6088.0 6236.0 Heres the7280.0 7764.0 news 7640.0 newsIvo newsIve 5084.0 6432.0 Ivo Ive5432.0 6452.0 been5852.0 6447.0 saving snvlng6412.0 up 6344.0 6656.0 tor6932.0 6468.0 7264.0 till 7200.0 7536.0 the7476.0 7828.0 laBt7772.0 lastfrom laBttram 6604.0 6624.0 tram5576.0 u5464.0 5772.0 6620.0 natural 5656.0 6444.0 6616.0 modesty 6320.0 6608.0 7072.0 7548.0 7944.0 al1allI al1I8132.0 6812.0 5260.0 5152.0 5664.0 6044.0 5944.0 6292.0 get gat6803.0 things thing7188.0 arranged nrranged7088.0 7980.0 6828.0 7876.0 sothat Bt Btthnt 6988.0 7000.0 thnt5504.0 7004.0 16128.0 6388.0 7032.0 6308.0 7024.0 my 6564.0 wedding woddlng6884.0 7688.0 trip 7600.0 8056.0 7020.0 n7968.0 amonth -80.0 8136.0 nmonth 7180.0 7192.0 month hence lbence6324.0 6108.0 7224.0 am 6372.0 6776.0 going 6684.0 7196.0 be7768.0 7208.0 mar mnr7680.0 married -304.0 mnrrled marnod 7244.0 7380.0 nod riedrledrledIClttys 5380.0 5248.0 7568.0 7572.0 Kittys IClttysspoon fell fel16340.0 6848.0 Into 7268.0 7140.0 7588.0 saucer aaucersaucerwith aaucerwith 5068.0 7780.0 7816.0 n5408.0 5676.0 clatter clnttornnd6184.0 Mr 6572.0 7012.0 Seoly Sealy6888.0 dropped droppecldroppedhis droppeclhisdroppedlife7948.0 life7952.0 5312.0 5812.0 hastily hnaUly5688.0 hastilyMarried 6336.0 hnaUlyMnrrled 5332.0 Married Mnrrled6176.0 suldsold5932.0 6568.0 8143.0 Mnrgerybreathless breathlessly 8199.0 8332.0 5244.0 8520.0 8528.0 Seely6208.0 alone uoneremained rcmalnod6612.0 7560.0 calmShe 7436.0 calm cam7920.0 8552.0 camShe 8711.0 8715.0 She rolled 5516.0 6144.0 8744.0 IUJr6756.0 napkin IlDpkln6668.0 7424.0 8719.0 put 7984.0 7892.0 inIts 8128.0 InIto inits 8908.0 Ito5336.0 ring rhtg5264.0 5724.0 nndantilooked 5992.0 8912.0 nt6856.0 8904.0 7176.0 8936.0 non7516.0 through throughher -612.0 8216.0 iher -4.0 8220.0 9096.0 9100.0 goldbowed 6396.0 glasses giusBe8composedly composedlyShe composedlySho-892.0 7928.0 9304.0 9308.0 Shofelt telt6000.0 however howevorthnt6644.0 this 9331.0 waowan7464.0 9335.0 nnanImportant nnImportant animportant 9476.0 Important 5928.0 9480.0 crisisWhen 5856.0 crisis crlals6328.0 crlalsWhen 9668.0 9672.0 When 1080.0 IInrvoylholr Iiarvoytheir5684.0 5788.0 9676.0 Harvoy -1076.0 6864.0 6504.0 704.0 7368.0 80nhn11 sonhind7288.0 sonhindtvitla -704.0 7372.0 9699.0 80nhn11with 7632.0 hadwith 5076.0 9860.0 9864.0 tvitla1048.0 commendable commenlahlo1036.0 independence Inllepenllence7864.0 left 7716.0 lefthis 7868.0 lefthla 9868.0 ett -204.0 etth 10051.0 hla5184.0 10055.0 IB 5388.0 pleasant llensllnl6120.0 home homo6032.0 6528.0 7252.0 10088.0 n7168.0 start 7336.0 7976.0 10059.0 intho 8124.0 inthe 10240.0 10244.0 the916.0 5420.0 neighboring nclghborlngcity they 6804.0 hnd7960.0 ill tl1l117740.0 illexpected 8120.0 l11expected 1628.0 5844.0 10448.0 10456.0 6348.0 6240.0 10452.0 athim himHo 7472.0 himI10 5240.0 10619.0 10623.0 5372.0 10660.0 I105440.0 5544.0 wfluid vpiItl10652.0 pJIII 6100.0 bo6356.0 rapidly IIlpl 6892.0 6764.0 6648.0 6992.0 successful successtu7760.0 howould howoull 10808.0 10812.0 would woull5632.0 Ulatlngulsh IIhltlnrulshIllstingulslu5520.0 6580.0 himself hhnselt7248.0 10816.0 7488.0 the10844.0 pfll7736.0 profession pfllrosslon profesalon 10875.0 5064.0 11016.0 11020.0 fession rosslonfesalon5660.0 11024.0 hf4d5836.0 chosen chollon6164.0 nndnt1l16760.0 11048.0 amass nml1HS7096.0 11052.0 n7648.0 fortune fortunc 8096.0 11080.0 11187.0 tune tuncnnd5400.0 5976.0 hehawoulLl6976.0 11220.0 woo 6780.0 und nndandwin winaonio win80mo winsome 11380.0 some aonio80mo11388.0 sweet 5448.0 girl It6836.0 long 7576.0 11412.0 row 11384.0 lItofnnccstora lItnnceBtorstho ofancestorstine 5048.0 11584.0 1152.0 nnceBtorstho ancestorstine5052.0 11592.0 nnccstora -1148.0 6200.0 5968.0 Seelys SCtbs7100.0 11588.0 being helng6876.0 7696.0 them themselves themsolvos themsolves 11648.0 11755.0 selves solvossolves11796.0 a5808.0 11759.0 good 6268.0 old alIIcltl6160.0 family f1mlJy6492.0 7256.0 11788.0 wore 11763.0 greatrespecters greatrespectors 5072.0 11948.0 11959.0 respecters respectors5972.0 11952.0 ot6252.0 blue bluoblood bloodn 7112.0 11984.0 -84.0 7508.0 host 7972.0 11956.0 otofaccomplishments otIlCCOl11lll1shmento ofnccompllshmonts 5060.0 12140.0 accomplishments IlCCOl11lll1shmentonccompllshmonts12144.0 unll12175.0 6732.0 6904.0 heavy henvy7512.0 dowryTheir dowry 8000.0 dowryTholr 5216.0 12327.0 12331.0 Tholr Theirhopes 5644.0 6152.0 6576.0 seemed seemod7120.0 12336.0 7956.0 IJOho7872.0 bofulfilled IJOtu hofulfilled 12496.0 12520.0 fulfilled tu -584.0 5436.0 lcd 5204.0 5892.0 12524.0 HIlroyIlarvey6548.0 hud hndhail6448.0 proved provollprevail7544.0 hlmBohimselfpossessed hlmBoposseBlied 7996.0 12708.0 12712.0 possessed posseBlied12716.0 ot5792.0 remarkable re1l1nrknblequal qualities 8048.0 qualIties qualitios 8060.0 12772.0 12916.0 ities itios12920.0 5776.0 risen rloonrlnonquickly 7236.0 nndhall7924.0 12951.0 re recently reent1y rerontly 12980.0 13084.0 cently ent1yrontly672.0 exceeded oxcocdcdexceedol6980.0 wildest 7668.0 ambi nmbl7528.0 ambitions 8044.0 nmbltlons ambiliuns 13151.0 8040.0 13276.0 tions tlonsliuns13280.0 hymade madomndo6752.0 n6676.0 Junior party 7392.0 7880.0 ofhis 8112.0 ofiris 8016.0 Jt Jthis 13455.0 iris13472.0 firm firmAll 13652.0 13656.0 5532.0 13659.0 5444.0 13688.0 flowremnlned6232.0 7320.0 lJohodesire deslrJjdesireidesirewas deslrJjcvaa -456.0 8020.0 desireiaas 5056.0 13860.0 13896.0 cvaaaas5416.0 13864.0 hls13867.0 safe Sllto13871.0 conquest 7104.0 beautiful beautlfu7352.0 beautifuland beautlfuand 14031.0 14035.0 aristocratic 14064.0 young 6304.0 14068.0 person Ilorson6852.0 at7748.0 thcli theirthclidreams -364.0 theirdreams 14224.0 dreams 14227.0 bar horliar6096.0 6540.0 14256.0 many talents 6964.0 nmlandsubstantial nmlsubstnnthd 1860.0 14416.0 substantial substnnthdInheritance InhorltanceInheritanceIt InhorltanceIt-860.0 6916.0 5224.0 14603.0 14608.0 5452.0 is 105356.0 14616.0 6024.0 be bo6532.0 wondered wonderel7360.0 nt7260.0 there tberutherefore tberutaro 14664.0 14764.0 14816.0 fore taro14811.0 thnt5352.0 thot1105780.0 girls clrl86084.0 14836.0 worow2L 6984.0 14807.0 7128.0 14828.0 nlrgt 7040.0 14803.0 iiaW5 -40.0 7904.0 iJfr iJfrtgeWtSSSntfiatTIr 8188.0 14768.0 tlJfn 8032.0 tlant 5196.0 14947.0 1448.0 14959.0 tgeWtSSSntfiatTIr 5404.0 15011.0 fn -1240.0 5732.0 15063.0 6004.0 14976.0 lli 5804.0 15032.0 ant tMr 6312.0 15015.0 Ir Beoly 14999.0 Seoy7480.0 14992.0 fumbled fumbledwith 14996.0 tumb tumbwith 15192.0 15207.0 watch chain 6772.0 15215.0 nervous nerVOUB7008.0 15211.0 sus sua7704.0 suspense 8036.0 suapense susponso 8052.0 15244.0 5032.0 15392.0 pense ponso5596.0 15408.0 5872.0 15396.0 Soely Seely6628.0 opened herlips herUps 15560.0 15588.0 lips Ups15579.0 twice twlcoboCoro15571.0 she 6440.0 15567.0 found strength slrongtb7340.0 strengthto slrongtbto15760.0 15775.0 5308.0 propound 15768.0 tho1032.0 nilImportant nJllmIlortantallImportant15779.0 quiz quesqUIIquiztlonc 7708.0 question -328.0 qUIItlon 15812.0 7964.0 15964.0 tion tlontlonctlonIIWho tionWho tloncWlno1040.0 16147.0 16156.0 Who IIWhoWlno16151.0 shoaltosheSho 6256.0 shoSho altoShe 16332.0 16343.0 Sho She5580.0 16376.0 n16339.0 Miss MiasDora DarnDorn6360.0 Derdan Berdannt16355.0 pres present -312.0 presort 16384.0 16520.0 16540.0 ent ort16532.0 slld16536.0 Ilarveysmilingly RmJllnglysmilinglyDordan -720.0 RmJllnglyDerdnn smilinglyBordan 5304.0 16719.0 16744.0 Dordan DerdnnBordan16740.0 6552.0 16728.0 7048.0 repeated andraised anelanelrnlBCIl 16892.0 16915.0 raised rnlBCIl5604.0 16911.0 hor16907.0 brown browsInquiringly Inqulrlnghdont dOl1tdontthink dOl1tthink 5044.0 17096.0 17119.0 think 17123.0 havo have17108.0 heard 6068.0 6688.0 ot17104.0 the6832.0 tnnUyfannllyfannllyNot -488.0 7744.0 familyNot tnnUyNot 2752.0 5316.0 17264.0 17292.0 Not 5672.0 nt17283.0 aIJ5824.0 6820.0 HIfrey7448.0 rejoinedThey 7452.0 rejoined reJolnfJl8068.0 reJolnfJlIIThoy 17464.0 17483.0 They IIThoy17512.0 aro5980.0 17472.0 quiet qulot5880.0 peopleBerdanl 6364.0 people peopleBerdan peopleerdan 17660.0 17683.0 Berdan erdanBerdanlMra6824.0 17668.0 Sooty SoolySocly7420.0 repeatedmusingly repeatedmUBlngly 17835.0 17855.0 musingly mUBlngly17851.0 6500.0 6316.0 17847.0 bovo17843.0 atofthem atthem 18032.0 18051.0 18043.0 Whore Whoro18040.0 6420.0 6912.0 live JIveliveIn JIveIn 5324.0 18215.0 18244.0 5692.0 18236.0 Woyman Veymnn6588.0 18224.0 street Btreetrespondel7016.0 respondedHarvey -768.0 respondelHarvey -716.0 18436.0 HarveyMrs 5640.0 2916.0 18659.0 18688.0 SeeySeely18667.0 Cel1back 18663.0 chair chrllrchairwith chrllrwith 18831.0 18852.0 n5652.0 18848.0 little llttlomtlo18879.0 gn 18875.0 gnllll gasp6600.0 18839.0 hcr6924.0 husband turned 7552.0 turneda 19023.0 19079.0 19039.0 dismayed dIBmnod5156.0 6136.0 19035.0 face taco6556.0 19064.0 upon 7060.0 19027.0 hlB19060.0 7276.0 nndanlnndKitty anllCllty andKitty 19216.0 19235.0 lCllty5560.0 19231.0 5488.0 19251.0 gave 7044.0 llttlo19247.0 screans acrenl1Sscreaus7408.0 screansWeyman acrenl1SIIWcman screausWeytnan 19424.0 19439.0 Weyman IIWcmanWeytnan19435.0 19432.0 19455.0 miles nniles19428.0 fromtho fromtl10 19591.0 19620.0 tl1019611.0 region 5320.0 at19603.0 aristocracy nrlstocrncy7556.0 waspeopled lpeoplod 19784.0 19803.0 peopled peoplod5744.0 19799.0 wllh19795.0 working 7212.0 19811.0 seam seamstresses seamstrosses 19844.0 19967.0 20003.0 stresses strosses19992.0 nnd19984.0 small amllIJ6080.0 19975.0 ahopkepers shoplcepersshopkeperswithatroot withsueot withstreet 20163.0 20192.0 atrootsueot20179.0 vendors vonders20175.0 20171.0 7080.0 appleworno nppewornoapplowomoapplewornofor applowomofor-916.0 20200.0 Itor 20379.0 20400.0 tor20392.0 anthe20383.0 Seclysknow knewknowNot knewNot 20560.0 20583.0 20575.0 VeymanWoymanstrcetHarvoyHarvoyaald Harveysold Harveysaid 20747.0 aaldsaid5820.0 20764.0 tatberappealingly appoalinglyappoallngly6296.0 appoalinglyCertainly -896.0 appoallnglyIICertalny appealinglyCertainly 2920.0 20931.0 812.0 20951.0 Certainly IICertalny20943.0 20935.0 Btrcetliar HarUnr7532.0 Unrvoy liarvoy 20995.0 21143.0 21184.0 voy 5424.0 repoatedropoatedrepeatedBut repoatedDutropoatedBut5344.0 21311.0 21336.0 But Dut21332.0 sho she5616.0 21328.0 la21315.0 notshe 6996.0 21324.0 cannot atofgood atgood 21503.0 21515.0 tamlly6428.0 21511.0 living 21507.0 ia lafa7456.0 WoymunWoymanstreet Woymunstreet 21688.0 21715.0 5832.0 anxiously anxlousyanxiouslyTho anxlousy111ho anxiouslyThe 21875.0 21896.0 Tho111ho5760.0 21888.0 CamllyIB21883.0 quite qultorespectable respectnborespectableher respectnbohor22063.0 22091.0 hor22115.0 aon22075.0 6784.0 quietly 22067.0 Doras Dorasmother 22275.0 mother 22271.0 la22304.0 n22264.0 widow 22260.0 She22283.0 BOWS sowssouvsnalacegoods nIncogoods alaco 22439.0 22460.0 lacegoods Incogoodslaco 5876.0 goods 22456.0 house 6560.0 22447.0 beenassistant beenasslatnnt 22624.0 22647.0 assistant asslatnntbookkeeper bookkeoper22659.0 estab esaabesaablishmant establishment estabIIshmont 22683.0 22815.0 22839.0 lishment IIshmontlishmant22832.0 22824.0 Islehow 7068.0 herMrs 1584.0 23011.0 23028.0 23019.0 Sootygroanod groanedgroanodA groanedA6808.0 2832.0 23180.0 23215.0 1156.0 23203.0 bookkcepernbookkeepera23232.0 856.0 6768.0 23199.0 seamstress BeaI118treBs7888.0 Bhesheejaculated Bheejaculated 23371.0 23392.0 ejaculated 23388.0 Oh Ob23383.0 23403.0 OU couldnot 1656.0 23579.0 23592.0 23583.0 havedono6280.0 23604.0 worse 6204.0 worseA 23739.0 23771.0 5548.0 23763.0 penniless 6368.0 23756.0 slrt6896.0 23743.0 slLld7524.0 fathersolemnly 23748.0 tat hersoen1l1 23931.0 23951.0 solemnly 23987.0 soen1l1 23947.0 5608.0 23943.0 atter6496.0 23964.0 wehllvehavehoped 8148.0 hllvehoped 24116.0 24139.0 hoped tor5540.0 24160.0 6508.0 24127.0 6900.0 24123.0 hoboworse howorse 24359.0 5536.0 24524.0 24551.0 24572.0 common 944.0 workinggirl worklngglrl24532.0 -944.0 giri saidKitty saidKilly 24707.0 24736.0 Killy6028.0 24763.0 24719.0 choking 7052.0 24711.0 voice Andeverybody 24895.0 24919.0 everybody 24911.0 24907.0 wllllmow 24899.0 HarvoyHarvoyit HarveyitHarre HarreIt 8012.0 1636.0 25100.0 25107.0 25103.0 couldnt be5920.0 25127.0 worseTho worseThe 25271.0 25296.0 The25315.0 oung 6124.0 25275.0 7204.0 train25300.0 one8004.0 7916.0 toanother 5796.0 25471.0 astonished I18tonl8hed5936.0 hurt 7808.0 halfcontemptuous halfcontel11lltuous -296.0 1720.0 25651.0 1096.0 25668.0 contemptuous contel11lltuoussilence alieneealieneeMargery -532.0 silencelInrgor silenceMargory lInrgorMargory25835.0 6748.0 n7840.0 25855.0 gen 7756.0 genUo gentie 26011.0 26039.0 Uo tie5496.0 26028.0 sympathy 26015.0 mingling mlnsJlngthedismay thedl 1512.0 26211.0 dismay dl 26247.0 mny 6224.0 facePorhapa facePorhaps facePerhaps 26380.0 26399.0 Perhaps PorhapaPorhaps26388.0 sho5996.0 6740.0 26384.0 7272.0 hopefully hopefullhopefullyperhaps -712.0 hopefullperhaps 2960.0 26567.0 26592.0 perhaps 26583.0 thero6404.0 26575.0 lasomething lomotblng7416.0 26571.0 makemakoup 8156.0 makeup 26751.0 26807.0 26763.0 5300.0 26755.0 ahoia26787.0 wonderful wonderfulboauty wonderfulbeauly wonderfulbeauty 26939.0 26959.0 beauty boautybeauly26983.0 5960.0 genius 26971.0 7296.0 27000.0 27143.0 thing thingHarvoy 27347.0 27379.0 gachor27375.0 grateful 7712.0 smileI 27531.0 27547.0 27539.0 27535.0 pretty retlyat6880.0 27559.0 course couraehexmlns:ns5 ID17 26556 3144 8292 2816 ns5:type 8360.0 saidIm 8664.0 9552.0 9924.0 80 Ise8e9584.0 10216.0 thats 10108.0 10760.0 because becauso10644.0 becauseIm 11372.0 8384.0 8740.0 fan fon8624.0 fonwould 8984.0 9448.0 ht 9952.0 9576.0 9956.0 10004.0 10104.0 10584.0 10480.0 itnuty -104.0 10688.0 11108.0 sho10996.0 shoI3nuty 11364.0 shewould 2988.0 8376.0 8920.0 b 8832.0 bbut 9460.0 ed 9912.0 fluty 9916.0 nuty I3nuty10344.0 9968.0 10900.0 11140.0 tor11064.0 forShos forgonuis 8368.0 gonuis 9504.0 3452.0 8872.0 9944.0 lever Iever9592.0 10376.0 10312.0 10592.0 accounts accountsor -688.0 11280.0 accountsbut 8372.0 8700.0 sho8628.0 shothing 8964.0 9540.0 9572.0 10056.0 9976.0 paint pnlnt10204.0 10796.0 10676.0 11040.0 any nnyanything 11320.0 8364.0 3764.0 8884.0 8780.0 oftho 9036.0 Shos Shoa1000.0 10536.0 noverrover10420.0 bad hadhadfor 11356.0 badfor badthe 8348.0 tho8712.0 time tlmo8592.0 tlmopogr -352.0 9064.0 9464.0 9568.0 10360.0 auch10248.0 10720.0 thingsturned 11324.0 thingspopr pogr popr8708.0 girlI3ut 9052.0 girlBut I3ut8896.0 8812.0 Man 9948.0 10524.0 away awy10432.0 11012.0 4344.0 wlh 10928.0 wlhro wl wlhan 11188.0 11268.0 11352.0 hrQ 8352.0 8656.0 lmpa Impa8536.0 lmpaThoro 9032.0 9512.0 ga 9880.0 rQre9608.0 reThero 9884.0 roJ 8616.0 4691.0 TheroThorodospalrlnj 9076.0 9888.0 9604.0 10072.0 then thon10640.0 4712.0 oho10400.0 11000.0 anldsaidIt 11312.0 anldIt saiddesalrin dospalrlnj dospalrlnjworse 9128.0 desalrin 10100.0 1024.0 10384.0 10220.0 4916.0 hoboJingling 11360.0 boL 8356.0 worseHarvey 8816.0 9588.0 9108.0 9876.0 9624.0 9992.0 9908.0 seat Bontvlth10604.0 11156.0 nn pnpnenergy 11168.0 nnc energy 8952.0 wh 8876.0 9176.0 li 9124.0 set 9316.0 9872.0 a9640.0 10008.0 bell 10356.0 10572.0 10880.0 castor caBtorcaBtorle castorjingling 8344.0 Jingling Jinglingsumably tThis 9160.0 8588.0 5896.0 This 9028.0 8928.0 9240.0 tlbstlr 9156.0 9896.0 lesaidindignantiy 10020.0 10064.0 -1256.0 5912.0 hldlgnanUy 10372.0 hldlgnanUyIsurdj -888.0 8420.0 6083.0 8644.0 8544.0 8864.0 mor 9428.0 9172.0 Surd Isurdj9652.0 10440.0 10308.0 10648.0 10552.0 10868.0 unjust uftjust10772.0 unjustHow -500.0 11368.0 uftjustandnarrow 8312.0 andnarrow 9904.0 How 9648.0 Howconslbleprc 10236.0 Howconslbleprcaumably -1416.0 1052.0 10268.0 6291.0 cenalbleprc -1052.0 cenalbleprcpeope sumably aumablysumablycorrected 8996.0 9524.0 6480.0 IL 9920.0 People peope9628.0 10780.0 HnrvoyHarveycorrected 6651.0 corrected f 9072.0 fregard 9268.0 terly tcrly9272.0 10396.0 6660.0 IIcan 10484.0 6696.0 can 10828.0 sayIn snYlnaayInsayInthey snYlnthey aayInregard regard 8976.0 8856.0 9204.0 ti tpnat 9528.0 es 10000.0 9632.0 havo10328.0 10920.0 novcr10804.0 novcrding nevernot neversoon 9256.0 soon 8840.0 8688.0 cc be11228.0 11036.0 IsIslon ispast 8324.0 past pnatct ctWo 9244.0 9520.0 rc Islon tsiontsionWe 10196.0 Islonk 8604.0 WewillSeely k of9936.0 7404.0 10168.0 10600.0 7427.0 10912.0 Mrsre 11308.0 MrsSealy Sealy7579.0 hold 8748.0 holdAnd 9560.0 9972.0 restraining retraining-868.0 10840.0 trnlnlng 10124.0 hand handbo 11316.0 handot handDiscussion 8432.0 Discussion 9536.0 7787.0 7776.0 ot of9616.0 10148.0 mend 10712.0 matters mnttors10560.0 mnttorsbo mattersAnd 7939.0 youmonth 9892.0 10184.0 next noxtnextI noxtHarvoy nextmonth monthOn 8828.0 8596.0 8316.0 On 8932.0 8808.0 8351.0 8336.0 Harvoy10672.0 8355.0 rejolnod10520.0 rejolnodI rejoinedOf11300.0 2956.0 8408.0 8504.0 Of 8684.0 8540.0 courso 9844.0 8516.0 l9188.0 9964.0 nl1be10152.0 10516.0 thero there10424.0 8548.0 hoouBly hoously hoadded 8692.0 added 8704.0 rath 9556.0 9848.0 ously ouBly9620.0 ouBlyly ouslyanld ouslyBy 8600.0 8880.0 By 8940.0 8916.0 no 8804.0 10012.0 8900.0 anld10468.0 hlotnther10696.0 tntherIy fathershortly shortlyYou -548.0 8888.0 You 9000.0 cowl 9840.0 9260.0 Iyby10080.0 9287.0 expect oxpect10700.0 11044.0 9296.0 aRIdsaidBaldhfully aRIdhtuIJy saidMrs 1992.0 8320.0 9435.0 9496.0 hfully htuIJyhfullyMohammed htuIJyMohammell hfullyVery Very 9643.0 wol 8960.0 Mohammed Mohammell9364.0 10936.0 wont wontyou wontenrd wontcome come 9824.0 9508.0 9352.0 9836.0 card enrd10316.0 tho10156.0 10708.0 9851.0 obsorva obsorvaoU -600.0 obsorvatlon 9996.0 tlon 10007.0 We alt 10003.0 C oU n10388.0 10472.0 visit 10336.0 10888.0 10040.0 Irame Immcimmeimmediatoly 10892.0 Irameir Immcurn diatoly 8972.0 10224.0 9264.0 9820.0 urn 9344.0 tram from10256.0 10232.0 wed 10904.0 wedIr 10371.0 ding 8756.0 10380.0 tour wi9080.0 10428.0 ir 9380.0 Idnd832.0 10411.0 permission pormlsslonpermissionra pormlsslonrapermissionYou-832.0 11304.0 10532.0 10556.0 8716.0 10580.0 IcnGlt 10616.0 ra ralater raWhen 8496.0 9088.0 10756.0 loft 10084.0 10692.0 10788.0 hour 10876.0 hourqnlred hourlater 8328.0 10927.0 later 8820.0 10935.0 lie9084.0 10939.0 9436.0 tin9348.0 9600.0 10979.0 -28.0 9800.0 cqnlred qnlredquired840.0 10464.0 10968.0 permlBslon10368.0 permissionIlls permlBslonthopermissionItla-840.0 11096.0 11120.0 Ills Itla11128.0 8764.0 ailtho 9424.0 11160.0 10076.0 11139.0 tho9656.0 10172.0 11148.0 10624.0 11152.0 h1d10992.0 oven ovonovenkissed 11348.0 ovonIn kissed 9180.0 9940.0 11328.0 10164.0 nilnn10436.0 11336.0 Injured 10352.0 11072.0 11347.0 nnd10984.0 nndreproachful 11344.0 nl1l nl1lnd andreproachful 11476.0 900.0 11495.0 reproachful 11520.0 way 9228.0 11512.0 ad11516.0 11524.0 11076.0 11528.0 hndhind10976.0 hadBut hndIy hindshaken 11672.0 shaken 11684.0 hands 11724.0 9408.0 11696.0 Iy lyIyIII 11700.0 lyBut 11824.0 11863.0 11867.0 8772.0 11884.0 cars ears9120.0 9680.0 Illl 9812.0 III illrang 10564.0 10444.0 thnt10908.0 thatodious thntIt 12019.0 12044.0 odious 12032.0 nsBortIonIIt assertlop -1072.0 9900.0 12075.0 10160.0 12080.0 12092.0 11176.0 boboworso hos 12208.0 12260.0 worso12244.0 9372.0 he 9292.0 vis 9548.0 12279.0 9816.0 12292.0 9684.0 thoughtful 12267.0 10768.0 12271.0 the11028.0 thoTho thoty theway 1616.0 12420.0 12448.0 8636.0 9152.0 12431.0 9068.0 9368.0 thq 12456.0 tyThe 9804.0 ty tyI tyL 12664.0 12695.0 8472.0 12787.0 TheSeejys Seq1ysSeglyssvorc 9468.0 12868.0 wor 12839.0 9756.0 10140.0 12852.0 n10324.0 state stato10228.0 12860.0 ot12864.0 sub subducd 12891.0 su sudued 11208.0 subdued 1352.0 13008.0 dued ducd13016.0 excitement 8tcltementoxcltement8680.0 excitementHflfvoys -848.0 oxcltementIitfwoya 8488.0 13143.0 13192.0 Hflfvoys Iitfwoya 8556.0 8800.0 13224.0 vCYS 13207.0 9984.0 10512.0 13255.0 10412.0 13263.0 coinscompToted coinspTted 11296.0 13344.0 pToted pTtedpT 8776.0 13384.0 ted 8468.0 13388.0 nnd9332.0 9236.0 9760.0 13392.0 tad10092.0 13407.0 received recolvel13448.0 13415.0 tele tole10932.0 telegram tolegram 13480.0 13567.0 13596.0 gram 8792.0 13576.0 afternoon nftornooanrtornooQ9104.0 13588.0 13584.0 theeffect cUect11032.0 13600.0 thntthatho thntho thathe 8300.0 13748.0 he8580.0 13752.0 9136.0 1109492.0 13788.0 9764.0 Land hand13771.0 tonight 11008.0 13784.0 10860.0 withhis 1008.0 13936.0 13968.0 newwife wHewifeThe wHeThe 9312.0 14120.0 908.0 14123.0 diningroom dlnlngroomdinlng -908.0 14160.0 room 9376.0 14135.0 tabo14172.0 10264.0 10784.0 14156.0 10680.0 torfordinner 11340.0 tordinner 14287.0 14312.0 dinner 14316.0 nndRnd4eoly9796.0 14335.0 wandered wanderedHer 11332.0 wanderedtram wanderedfrom 14495.0 from8768.0 14528.0 one8672.0 14499.0 14532.0 o9792.0 14512.0 14508.0 10144.0 tho10492.0 14516.0 othor10392.0 14556.0 nor norII norIIOr 14751.0 14788.0 nnor 14859.0 14880.0 Her norIIOrsal 14911.0 S3 ea 9720.0 14884.0 undor14876.0 the10332.0 chande 10664.0 chandelier c1 chandeher 10940.0 ande andelIer 14944.0 8304.0 lier her8652.0 8564.0 15067.0 9388.0 evening 15096.0 15100.0 ng rig9732.0 newspaper nowspaper11100.0 10924.0 butho buthe he15284.0 waa8484.0 9024.0 15259.0 rcadljng 9276.0 read g 9708.0 10200.0 11068.0 nndandMargery nndMnrgery 15436.0 Mnrgery15440.0 fluttered Ibout9808.0 uneasily unonsllyuneasilywatching unonsllywatching 8292.0 15619.0 15627.0 watching 9092.0 15631.0 9768.0 the10112.0 window tor11112.0 thethocarriage thocnrrlne thecarriage 15816.0 carriage cnrrlne15823.0 15820.0 therailroad station 10416.0 stationI 15995.0 16008.0 16004.0 hope 8608.0 Hlld9060.0 9664.0 Marlery16031.0 16028.0 ner nornorvous 16060.0 16184.0 16220.0 vous 16195.0 attempt nttompt9392.0 cheerfulness cheertulnessthatstoo thatshe 16372.0 16380.0 stoowJ1J8568.0 9432.0 barely decent 1268.0 decentprosent decentpresentdecentprosentable decentpresentable-1268.0 10732.0 presentable 16428.0 16551.0 able 16559.0 Think at9320.0 thepeoplopeopowbosv11Isv11Icall 16736.0 16748.0 8836.0 16751.0 9404.0 alto9324.0 10212.0 10460.0 16771.0 worso worsethan thanwere 16932.0 16967.0 16936.0 prepared 8724.0 9580.0 16944.0 9488.0 see seosea9716.0 10132.0 herShe 8572.0 couldnl9644.0 17115.0 10340.0 Seelydismally Seelydlsmnlly 17308.0 dismally dlsmnllydismallyThero dlsmnllyThero dismallyThere 17487.0 17495.0 Thero There17527.0 waB17531.0 atwheels whees11116.0 thethotwlnklo thetwinkle 17672.0 17679.0 twlnklo twinkle17687.0 at9288.0 thotluo1064.0 carriagelamp carrlngeamp10832.0 10704.0 the10988.0 thodoor thedoor 17860.0 17868.0 door 8784.0 17872.0 9140.0 9452.0 17903.0 sharply ahnrplysharplyKitty -592.0 ahnrplyIltty -588.0 8500.0 18055.0 Iltty18063.0 9232.0 clasped cllsped18047.0 hllndsinsympathetic 11212.0 Insympathetic Insmpnt 18232.0 sympathetic 18247.0 smpnt -936.0 etlc agitation Seelydropped 9012.0 18467.0 newspnpernewspapor9220.0 18432.0 18459.0 aroso aroseandMrs 18600.0 18631.0 18619.0 8620.0 Seel 18627.0 advanced advnnced18615.0 toward 18611.0 thotbo10608.0 hall hn11hailhalldoor hn11door haildoor 1412.0 18812.0 dignity dignityIt 9744.0 8508.0 18983.0 19004.0 ol1enedwide wldohetoro18996.0 she10944.0 10800.0 couldreach couldrench 19175.0 19183.0 reach rench19187.0 9056.0 19191.0 nnd9400.0 HarvoyHaroy19179.0 entered 10728.0 facesuffused facesuUuscd facesuflusod 19364.0 suffused suUuscdsuflusodwithngenial genlllblissful bUBstul10820.0 smiles BmllessmilesThis BmllesThIB 19543.0 19559.0 ThIB19595.0 19564.0 wlrc19555.0 aaldproudly proudlyMy proudlyty 8428.0 19740.0 19751.0 My 19747.0 19755.0 Dorl9328.0 10060.0 19776.0 tather10288.0 19763.0 mysisters 19928.0 19932.0 sisters Itilly19940.0 9340.0 MargeryAnd Margory-648.0 IAnd 20107.0 20123.0 9044.0 20159.0 ncaressing cnresBlng9564.0 20111.0 touch hotook 20308.0 took 8668.0 20311.0 the10364.0 20304.0 led ted10740.0 forward forwardamong forwardnmong 20496.0 among nmong8924.0 8844.0 themWhat 20679.0 WhatMr -416.0 20872.0 20875.0 8720.0 Seol 20916.0 20887.0 gazed 9712.0 startling 10120.0 20908.0 eyes oyea10864.0 oyeaMrs 11264.0 eyesMrs 21059.0 21064.0 21068.0 Sccly21072.0 Ilropped21080.0 tho9828.0 10260.0 hnnd10736.0 10636.0 11088.0 hadstarted 21251.0 21255.0 started 21268.0 21259.0 9740.0 21276.0 out wllhtace10896.0 facegrowing tacegrowing 21436.0 9040.0 21443.0 ashy nsby9500.0 21451.0 ICltty10320.0 Margerygasped Margeryga8ped 21627.0 gasped ga8pedgaspedFor ga8pedFor 8512.0 21811.0 21815.0 21819.0 9688.0 21863.0 snw9612.0 10048.0 21859.0 10568.0 21844.0 woman 11204.0 otofapparently otapparently 22004.0 apparently 22011.0 40 9148.0 9636.0 22048.0 22052.0 jrs 22008.0 22035.0 10596.0 taco10872.0 facepowdered tacopOdered 22187.0 powdered pOdered22204.0 painted 9412.0 10128.0 10668.0 most un unblushing 22247.0 22368.0 22375.0 blushing 22412.0 manner 9772.0 22391.0 22387.0 thin gray Krnyhair haircrimped haircrImped 22539.0 22564.0 crimped 22599.0 9472.0 22607.0 9384.0 22576.0 wrinkled wrlnkedforehead torehead22555.0 laIna Inu laa 22747.0 22783.0 usickening 8412.0 9248.0 22759.0 affectation artcctatlon9192.0 22772.0 ot996.0 youthfulness youthfulncsayouthfulncsannd youthfulnessnndyouthfulnessand-996.0 22932.0 22936.0 nnd and9144.0 22972.0 u9048.0 22943.0 diminutive gailytrimmed gallytrlmmed10116.0 gailytrimmedbonnet -1096.0 gallytrlmmedbonnet 23119.0 23123.0 bonnet 8968.0 23128.0 perched 8868.0 23140.0 thereon 23132.0 23155.0 onaf at11056.0 affected atfected 23307.0 23311.0 fected mincing 23331.0 gait 23327.0 23355.0 simpering 10476.0 simperingsmile 23496.0 23704.0 23708.0 23711.0 9484.0 23723.0 9416.0 Ire 23735.0 Harvoy10628.0 repeatedHave repeatedHnve 2336.0 8440.0 23899.0 Have Hnve23939.0 9168.0 23919.0 welcome welcomoCor23908.0 herThe 10776.0 24087.0 24091.0 bride brlJe24095.0 tittered titteredMebbe titteredMebbo 24268.0 Mebbe Mebbo24279.0 lIle 24320.0 24291.0 24283.0 aint goodenough goodcnough 24455.0 enough cnough24467.0 24503.0 em 24480.0 9532.0 24476.0 ahosho10612.0 observed obaervedobscrvedobaervedtartly -692.0 obscrvedtartly observedtartly 24647.0 tartly tartlyImpossible tartlyImpossIble 24871.0 Impossible stypet 24884.0 lIarvoy24892.0 raraBponded 24923.0 25051.0 25055.0 sponded Bponded25071.0 9692.0 25079.0 patted lJlttedpattod10348.0 falsely talseyfalselyblooming talseyblooming 25239.0 25244.0 blooming 25248.0 cheek 25252.0 affectionately affectlonllteyBe DcBesides DcBides Beaides 25431.0 sides Bidesaides25435.0 It8732.0 9196.0 25475.0 wen25483.0 ahadow shadowa -580.0 11092.0 shadowacaricature -852.0 11272.0 acaricature caricature 25631.0 ot9420.0 25664.0 9516.0 benutltul25623.0 self theywould 25803.0 hl1o9116.0 surprised surprlsodTheywere 26007.0 26020.0 prepllrcd9544.0 the9752.0 worst woratworstHe 10576.0 woratHe worstlie He lie8824.0 9300.0 26191.0 horrified relatives relativesmeaningly relativesmeanlngl 26363.0 meaningly meanlnglmeaninglyTho meaninglyThemeanlnglTho 26403.0 26555.0 The26559.0 truth bisbJs9852.0 flashed llashed26579.0 overthem overtbem 26739.0 tbemthemYes tbemYes 26923.0 Yes 8948.0 26931.0 111126948.0 repeatedly repeatedlythat 27108.0 27112.0 27123.0 27151.0 9928.0 bo27135.0 wone11084.0 DutButthis Dutthis 27291.0 27312.0 wretched 8648.0 9704.0 rlnkled10588.0 27303.0 bedizened bediienedbedllenedbediienedcreature bedllenedcreaturehad bedizenedcreaturebad 27491.0 creature 1056.0 creaturehad creaturebad9960.0 27503.0 dreamed 10724.0 10620.0 tbhstbhsJ thisf 1572.0 8660.0 28604.0 xmlns:ns6 ID20 28148 3224 11484 1220 ns6:type 11748.0 1220.0 Harve 12328.0 12436.0 1232.0 watched 12232.0 13188.0 1236.0 13076.0 13680.0 1228.0 13568.0 14132.0 14028.0 14424.0 um14320.0 umdisturbed 14428.0 undisturbed undlsturbClI 14619.0 14632.0 11576.0 disturbed dlsturbClI12464.0 1420.0 Bmllc 12312.0 smllchls smilehis12872.0 13048.0 13268.0 13420.0 taUter14080.0 1428.0 turning turningaway 14660.0 1624.0 12060.0 1608.0 nt11988.0 12288.0 Il8t12216.0 12640.0 nnd12572.0 13000.0 1612.0 rubbing 13668.0 Iliahula13980.0 foroheniltorohemforohenilwith 14656.0 torohemwith foreheadwith 11572.0 12048.0 hlo11920.0 1028.0 12400.0 handkerchief handkorchlet12272.0 13552.0 weakly 13428.0 14100.0 MrsScoly 14611.0 MrsScely MrsSeoly 1972.0 Scoly ScelySeoly12164.0 gazing 12004.0 12792.0 12668.0 13068.0 12944.0 1216.0 13440.0 daughterinlaw daughterlnlaw13324.0 daughterinlawwith daughterlnlawwith-1216.0 daughter 14192.0 14136.0 14388.0 lasv 14328.0 lasvwith n11916.0 12228.0 dreadful drcadrul12124.0 12996.0 fascination 12880.0 fo 13848.0 13232.0 clnnUon 13124.0 nndthethogirls thogl1JR thegirls 11568.0 gl1JR12056.0 sinking oinking12632.0 13112.0 2368.0 chairs 13020.0 13676.0 13912.0 dlslUnyed13816.0 dismayedollcncc 14652.0 dlslUnyedollence 14648.0 dismayedsilence 2528.0 ollcnccollenceollcnccWell 12112.0 ollenceWo silenceNoll 11828.0 Noll12184.0 13116.0 snld12896.0 Harveylight IIgbt14104.0 lightly 14604.0 IIgbtIy Iy11860.0 lIot 11708.0 11944.0 12096.0 12196.0 courso12804.0 n12696.0 12992.0 new now12892.0 13400.0 addition 14148.0 14040.0 14408.0 the14296.0 thofamily thotamlly thefamily tamlly12192.0 IB12072.0 12432.0 12316.0 12728.0 object 12612.0 ot13208.0 Interest Intorcstj13476.0 14400.0 butdont 12064.0 forgot targetforget11960.0 thnt12528.0 13056.0 12948.0 havohnvo13100.0 nn13964.0 appetite nppellte13852.0 appetiteand 14600.0 nppellteand 11564.0 11976.0 gottlnggoUlng11844.0 12656.0 marrlod12532.0 13396.0 rather rathorimproved 14280.0 14412.0 1m14596.0 Improved 1mprovod 3552.0 provodTake TakoTnlo12300.0 au3704.0 13204.0 13740.0 13644.0 14264.0 myown 14636.0 3852.0 own 12104.0 Hero 11872.0 12624.0 Klttyl12484.0 KittyKitty 13092.0 KlttylmUy 13028.0 11736.0 4032.0 mUy4076.0 came clmetorwlrd13412.0 13836.0 sot set13928.0 tace14232.0 faceand taceand 11940.0 tightlyclosed tlghUclosecJtightlyclosod11836.0 4227.0 13492.0 13348.0 13736.0 rccoivo recolvorecoivo13636.0 the14292.0 thomarvelous thomnrvooua themarvelous marvelous mnrvooua12480.0 combination 12368.0 13544.0 ot13800.0 beads 13692.0 14356.0 14240.0 andsilk 14628.0 andsl1k silk sl1k11972.0 flowers powers12644.0 held hold12964.0 13444.0 13332.0 13716.0 14088.0 14544.0 adisgusting adlBguating aclisgusting 11560.0 4780.0 disgusting dlBguatingclisgustingair nlrat12680.0 1004.0 13024.0 sprightliness sprightllncss12928.0 14344.0 Showas Showna 4972.0 wna11936.0 afraid 12476.0 4980.0 12396.0 12692.0 trust 13140.0 4976.0 herself berseH13072.0 4984.0 13672.0 13972.0 speak 13892.0 speakPoor 14420.0 11732.0 5160.0 Poor 5164.0 Sooty13168.0 sick slclestoic13032.0 13560.0 5172.0 nt13468.0 heart henrt13712.0 14352.0 5168.0 hrldhind14208.0 hadmade hrldwado hindmade wadowny5348.0 tho12924.0 boll beJJ13240.0 anllrnng13952.0 14480.0 14395.0 Itand 14580.0 11552.0 IHnner5567.0 camopresently prcsently13424.0 presentlyTurtle 14244.0 prcsentlyTurtle 11816.0 Turtle 12412.0 5752.0 soup aoup12304.0 5723.0 the12760.0 brldo13884.0 observod13776.0 observedlooking 14572.0 observodlooking 11548.0 round rounll12740.0 tlm12660.0 tablo table13452.0 13948.0 13872.0 14116.0 girlish girlishsmile girlishsmllo 14624.0 smllo12284.0 12768.0 nothing 13496.0 13360.0 admire ndmlre14376.0 BO14236.0 BOJust 14536.0 soJUBt soJust JUBt12024.0 pass vnao11888.0 12356.0 celery colory13592.0 fatherinlaw tatherlnlaw13408.0 fatherinlawDelicious 14576.0 tatherlnlawDelicious 14056.0 14308.0 lawDelicious 11556.0 Delicious 12268.0 12452.0 nll1t12332.0 12796.0 13136.0 darling drlrllngdarlingExtremely drlrllngExtromely 11812.0 Extremely Extromely12884.0 12620.0 13252.0 13840.0 snldthothobridegroom thebridegroom bridegroom 12592.0 complacently complncently12444.0 complacentlyIgnorant -1028.0 13620.0 complncentlyI 11712.0 7028.0 Ignorant 11876.0 nornnt 11764.0 andvulgar 12752.0 13623.0 13356.0 dread MeaddreadsMeadtul dreadsful 14592.0 7084.0 ful tul11868.0 13012.0 12904.0 discover dlBcovor7216.0 14096.0 nextIt 11728.0 11964.0 12256.0 12652.0 cvenlng12544.0 13364.0 tl10y13264.0 13812.0 nevor13700.0 14360.0 tortorgot 14584.0 11932.0 7583.0 11792.0 unfortunate unfortunnte13308.0 parents parentRsat Bat13880.0 14276.0 14200.0 withpalo withJfnlo withPalo palo Jfnlofaces tacestacos11864.0 nndunsteady unBteady12748.0 hnnds14284.0 star 14128.0 staring 14588.0 starIng 11800.0 12248.0 tholr12176.0 tholrompty 12688.0 empty omptyplates p1atca7991.0 13696.0 14048.0 ooklnglookingat ooklngat 8147.0 11832.0 oachonch12320.0 12848.0 fresh 13196.0 horror 14468.0 14340.0 ateach atench enchslmporlng11912.0 senseless 13976.0 ungrnm ungram13764.0 ungrnmraatlcal ungrnmmntlcn ungrammatfcal raatlcal mntlcnmatfcal12200.0 remark 12136.0 ot13036.0 tholr their12976.0 13460.0 terrible torrlbotorriblo13404.0 14044.0 14108.0 daugh dnughdaughterIn dnughterlnnw terIn terlnnw 11968.0 terlnnwI ter 11776.0 lawKitty 11780.0 ttty 11848.0 12264.0 nndMargoryexcused oxcused14188.0 thorn 14052.0 thornselves 12128.0 during 12636.0 second Becond12972.0 9123.0 14336.0 14196.0 andflow 9279.0 flow 12188.0 rooms 12560.0 cry 13336.0 thomsovoB13664.0 themselvesto thomsovoBto11808.0 sleep nn12488.0 agony ngony13436.0 otdlsnlay14228.0 andmortification andinert mortification mortificationI -1000.0 12556.0 inert 11992.0 fication ficationI 12552.0 14704.0 9855.0 shant thlnl12440.0 ot12936.0 setting sottingsottlng13184.0 13888.0 14300.0 snldsaidtho 14304.0 snldthe saidthe tho11904.0 rlsng rising12296.0 12988.0 12888.0 thetabe14272.0 14168.0 withnn withan 10068.0 10263.0 011anapologetic 11740.0 12676.0 giggle glgcle12604.0 13520.0 the13932.0 InRtlastof InRtat 10415.0 at10419.0 hor12204.0 dessert dessort12084.0 helllllelclaloft aott10423.0 too toowore tooworo woro12012.0 12460.0 Itanybody nnyhody12580.0 13376.0 calls 13300.0 callao calmo13724.0 13904.0 13988.0 cour80courseoverybodyll cour80overyhod11 courseovorybodyll overybodyll overyhod11ovorybodyll12584.0 12504.0 cnlljust callJust13328.0 tell teU13772.0 10824.0 13648.0 Ill 1113992.0 14368.0 10827.0 aeoseoaeoem seoom seecan omcan11908.0 10987.0 tomorrow 12876.0 Como Come13380.0 dearldearAnd 14084.0 dearlAnll 11164.0 Anll12152.0 sho12516.0 tripped 12404.0 13064.0 stairs stnlrs13368.0 14063.0 13908.0 14524.0 14404.0 aJuvenile ajuvenllo ajuvenile Juvenile juvenllo12180.0 OVCI13144.0 13504.0 shoulder shoulclernndandwith nndwith 11532.0 11536.0 12240.0 ounr13532.0 11544.0 fat foltolfollowing 14560.0 tollowing fatlowing 11607.0 lowing lowingMrs 11720.0 11907.0 Scaly ScolySeely12016.0 11963.0 wrung 12540.0 13160.0 hbr13096.0 11967.0 13248.0 despair desllalrdespairingly 14564.0 desllalrInrI despairIngly 14568.0 12008.0 12123.0 ingly InrI InrIIIWO Inglytiro inglyWo 12340.0 IIWO tiro12840.0 couhl12724.0 13731.0 13616.0 14024.0 12371.0 worseshe 14476.0 worsesho 12527.0 shosnldfaintly talntly13272.0 nut13540.0 12531.0 Howshall Howsllnl1 1432.0 sllnl111996.0 we 12280.0 endure cndureItI 12984.0 itI 12899.0 shnllsimll11856.0 12912.0 12732.0 13508.0 Itl 8aldsaid14348.0 14212.0 herhusband herJusband Jusband12384.0 hl313095.0 facclead13120.0 grown almost almostcareworn 13303.0 careworn II1Bt14124.0 hours hoursI 11632.0 13459.0 11768.0 sholl12220.0 send 12564.0 packing 13804.0 13467.0 13728.0 tomorrowand -752.0 It12108.0 ovorhe13108.0 enters entera14152.0 housohouseagain housoaglln 13831.0 again agllnagainHo agllnHo againHe He12648.0 14023.0 baud bnnd12968.0 14060.0 13960.0 thethotablo thotabo thetable 1540.0 11540.0 14204.0 tablotabothreateningly tbreatenlnglythreateninglyBut tbreatenlnglyDut-1048.0 13080.0 14391.0 Dutthnt12076.0 wJl12512.0 13040.0 help 13516.0 14432.0 ep 13868.0 matlersmattersjmld matlerssllfd mattersnald 11484.0 jmld sllfd nald12380.0 wlromiserably mIBIlr41bly12704.0 14587.0 Ho13660.0 14472.0 lalarninod IsrlVeod isTined Tined rninodrlVeod14776.0 we12036.0 arc nreare12428.0 12844.0 14732.0 disgraced dIBgraccd14759.0 anQnnc114784.0 14032.0 1372.0 14928.0 14932.0 body 12816.0 itThoro -108.0 ItThere itThere 1660.0 15111.0 15115.0 There Thoro15148.0 15152.0 12836.0 silenceI silenceIII13372.0 11716.0 15300.0 15304.0 11804.0 pictured 12212.0 bor13340.0 15311.0 13564.0 myself myseJt13484.0 14076.0 saidMrB 15488.0 15492.0 MrB11840.0 12588.0 beginning 12424.0 15500.0 13352.0 Bob sob13612.0 15527.0 14511.0 14392.0 ayoung 15675.0 15708.0 12120.0 glrln girla15712.0 15679.0 at13260.0 suitable 13512.0 ageagofor agetor 15864.0 15872.0 tor15895.0 poor Joor misguided boy 13808.0 13944.0 decently decentlyeducated docentl docentleduclltcd 14500.0 16047.0 16051.0 educated educlltcdnnd12756.0 16056.0 nt13004.0 least eaBt12908.0 16083.0 lady AmIAndoven AmIeven 16236.0 16272.0 even12472.0 16239.0 did 13432.0 doubt thntthatIt thatit 16420.0 16455.0 wnB11668.0 12172.0 16424.0 16451.0 none 12720.0 onebochoscn14548.0 16432.0 14384.0 Ithought 16603.0 16611.0 thought mysetthe16607.0 unhappy unhnppytnnhappytnnhappycreature unhappycreature unhnppycreaturo creaturo16792.0 12608.0 the12468.0 world 13608.0 13416.0 16800.0 ahoshehad ahohad 16975.0 16988.0 16979.0 wealth 12956.0 12828.0 17008.0 un17011.0 nameSurely name 17167.0 Surely 17200.0 nJudgment 17196.0 U917171.0 Ohwas 17352.0 17391.0 17360.0 thore17383.0 oer17387.0 BO12764.0 drcadtnl13856.0 n13940.0 thingProbably 14436.0 thingII 17552.0 17539.0 Probably 17543.0 12508.0 13548.0 13916.0 husbandgrimly 14552.0 husbandgrIm grimly grimlyIt 17735.0 grIm IIt 17907.0 17928.0 17951.0 vms17916.0 solemn 12372.0 17943.0 group 13488.0 17912.0 waited wnltollwaitedIn wnltollin18099.0 18115.0 11784.0 18111.0 the18103.0 dlnlngroomdlning 18132.0 13180.0 13604.0 fortho forthe 18284.0 18299.0 tho18323.0 appearance appearanco18296.0 ot12800.0 18288.0 newlywedded newlywcddednewlyweddedcouple -1080.0 newlyweddedcouplo newlywcddedcouple 18484.0 couple couplocoupleThere couploThero Thero18700.0 weromarks marlltossing tosolngtosalngtosolngnight tosalngnight tossingnight 18856.0 night 12148.0 cvery18860.0 taceIn facefa13768.0 troubled troubledbrows -644.0 brows swollen swonen12812.0 lids 13156.0 pale checks cheekacheeks13828.0 checksand 14440.0 cheekannda cheeksand 19224.0 19227.0 nnda 19260.0 general 12780.0 gloom cloomprevailed prevaUed13236.0 prevailedMr prevaUedMr19407.0 19416.0 12068.0 19412.0 Scclystood Btoodfront trontat13984.0 thefireplaco fire fireplace firepa 19472.0 19576.0 place placopa 19636.0 19599.0 halfdoor bllltdoor14072.0 19632.0 astern 19792.0 stern tnceHewaa12744.0 master 13104.0 13720.0 hlaltisownhouso ownhouse houso houseenat19980.0 ho13044.0 19999.0 determined determinedthat -876.0 determinedtbnt 20152.0 tbntshould 20167.0 13052.0 13304.0 13220.0 20155.0 14036.0 hisson hissons 2188.0 20348.0 sons wIe20352.0 tflr fg 12568.0 ojiotherqno hourPlease 20535.0 20539.0 Please 12408.0 20548.0 12736.0 13216.0 awny20591.0 20720.0 20731.0 comes papa 20723.0 aaldIltt 14496.0 14000.0 Itwould 20920.0 12100.0 20924.0 12276.0 20912.0 Irnnbodywerowere13924.0 14464.0 toBee toseo tosea 21107.0 21135.0 Bee seoseaberherDreadful berDreadful 21280.0 21287.0 Dreadful 21291.0 21284.0 14448.0 agroan agroa groan groagroanThoro groaThero groanThere 21651.0 21671.0 ThoroTherowero21667.0 footsteps footstops21655.0 thestairsMrs 21840.0 21852.0 12020.0 21848.0 shiver nndandthe nndthe 22027.0 22044.0 22039.0 Klrscaught 22031.0 breath breathTho 13832.0 breathThe 22219.0 22231.0 Thehal1ball12500.0 openedThe 13464.0 22416.0 12116.0 waiting 22431.0 slow slowly 22583.0 Would shoahe22591.0 22620.0 more marc14216.0 ternble terri terrlternterrlblo 22795.0 ble blo22791.0 22787.0 thobroad 22776.0 daylight 1128.0 dayllghtthnt daylightthat14184.0 artifi nrllfiartiflartiflcal artificial nrllficlnl 22967.0 22980.0 cal cialclnlBlmperlnghorrorBut horrorDut 23143.0 23171.0 Dut23163.0 23192.0 waa23159.0 23151.0 the23147.0 sight wcro14144.0 wcroprepared wereprepared 23336.0 23348.0 BOO soeseetlto23367.0 open 14164.0 doordisclosed doordlaclosod 23523.0 23535.0 disclosed dlaclosod23531.0 23555.0 wns23527.0 12952.0 14260.0 pow 23727.0 dered semblance scmllnncewbowhocame wbocam 23891.0 cam 12224.0 23904.0 23895.0 23927.0 ntimid smileand 24108.0 downcast 24120.0 eyesIt 24295.0 24316.0 waaslqnder slgndersl nder sweetfaced sweettacedfaced 24303.0 younglady 24459.0 shining Hhlnlng13684.0 14092.0 24491.0 crown crowning 24643.0 24667.0 24691.0 24651.0 charming head mead12808.0 peachy poachy24684.0 po achy cheekschecksIn cheeksIn24836.0 24851.0 11756.0 24844.0 11688.0 the24840.0 color 24867.0 camoandsoft and60rt 25023.0 25044.0 soft 60rtdark 11852.0 12536.0 25059.0 12392.0 25063.0 ee 12788.0 studied thecarpet thecarpotln thecarpot 25227.0 carpet carpot25219.0 carpotln 25223.0 timidity dainty daintyslippered daintysllppered 25391.0 25404.0 sllppered slipperedfeet teet25400.0 1012.0 lacetrimmed lacotrlmmedlacetrimmedwrapper -1012.0 lacotrlmmedwrapper 25627.0 wrapper 12376.0 fitting flttlng12960.0 anugly snugly25591.0 25619.0 perfect perCectperfectform perCecttorm 25791.0 form tormformGood tormGood25972.0 Good 25968.0 13132.0 aheaaldgently gonUy13780.0 gentlyHarvey gonUyBarve 26147.0 26159.0 Barve 26155.0 12776.0 26151.0 followed rollowedclosely cosoycloselyWell cosoyWe 12168.0 Darn12672.0 13148.0 Baldtramfromone tramcno fromcno 26523.0 26563.0 cno one26536.0 26531.0 otspeechless rela 14176.0 relatlvea relatlves 26711.0 26723.0 tlvea tlvestives12052.0 quizzically qulzzlcnlly26715.0 26744.0 seem 13876.0 insInclined Incllned insalined 26775.0 26904.0 26907.0 clined cllnedalined26915.0 apeak26927.0 YOlyouBut YOlDut 27099.0 Dut27091.0 Marger13228.0 27119.0 27087.0 herhastily herbasUJy 27271.0 27279.0 basUJy27275.0 seized Bolzed13128.0 bothof bothot14112.0 handsWas handsIIWas 27459.0 27468.0 Was IIWas27464.0 12156.0 anthecried cried4t 29231.0 29243.0 4t 29291.0 -8.0 l2 JilvPIJ1li xmlns:ns7 ID21 27999 4588 14796 1236 ns7:type 14868.0 1240.0 MnrccryJoyfully 15536.0 16752.0 17208.0 tbo17059.0 17591.0 1272.0 STIY17452.0 grayhair STIYhair 14872.0 15260.0 waa15640.0 false talso15556.0 16124.0 nnd16484.0 tho16395.0 16816.0 wrinkles 16732.0 17568.0 wero wereweroput 17952.0 19032.0 iput 19056.0 15208.0 1648.0 oo ODon15124.0 15512.0 1620.0 15376.0 15876.0 15784.0 16144.0 thnt16548.0 dreadfu16487.0 17280.0 powder powdor117192.0 powderOh 17955.0 powdor1Ob Ob15220.0 Hnrvcy15080.0 15920.0 bow15792.0 16320.0 16232.0 16819.0 YOlyouI YOlI17092.0 15128.0 15324.0 begged bogged15175.0 15856.0 16279.0 16824.0 16684.0 17232.0 aah16968.0 17688.0 tiropretty 17548.0 17691.0 tiro17944.0 thoprotty thoprott prottyprott15476.0 hrlde15340.0 16044.0 raising 15868.0 hor her16592.0 Ilnrk16976.0 17460.0 eyessweetly 17784.0 C9 C9sweetb 14864.0 sweetly sweetb15796.0 15836.0 15968.0 told toill16387.0 111mldm16260.0 16808.0 16680.0 17043.0 2384.0 16924.0 17456.0 cruel crucl17328.0 cruelnnd 17844.0 cruclnnd crueland 14860.0 andBuch15136.0 15684.0 15860.0 thuo15776.0 16300.0 ns as16208.0 16576.0 16472.0 hndhind16619.0 17140.0 saying slylng17740.0 alt17644.0 altthose -200.0 17939.0 allthose 17931.0 14848.0 shocking ohocklng15272.0 16168.0 16063.0 16756.0 16652.0 16935.0 17420.0 taught tauchttaughtme tauchtme14852.0 me 15564.0 keeping 16244.0 16171.0 16556.0 wig 16479.0 16912.0 straight 16832.0 17520.0 andtrying al1 17823.0 17831.0 17880.0 17876.0 ltryinc 14835.0 trying tryinc15416.0 15316.0 16020.0 laugh Inugh16476.0 16440.0 Shall SbaJl16511.0 17212.0 17116.0 17596.0 17488.0 overforgot ftorgotuauaForgive 15568.0 usForglvo usForgive 15108.0 Forgive Forglvo15780.0 youl 16052.0 16112.0 16644.0 16508.0 16948.0 16872.0 17536.0 criedMrs 17923.0 1104.0 IMrs 14843.0 15280.0 Socyincoherently IncoherontlyincoherentlyAnd IncoherontlyAnd-980.0 15024.0 15464.0 shoalto15852.0 hurried 15720.0 16564.0 torward17836.0 n17696.0 aoob 17936.0 nsob anob sob oobnob15196.0 atjoy 15352.0 ILnd15680.0 16196.0 embraced ombraced16092.0 17051.0 17399.0 daughtor 17304.0 17404.0 dauglldauglltorlnnw 17884.0 14840.0 terinlaw torlnnwtor 15576.0 15112.0 15064.0 15256.0 wildly wildlyIt 16155.0 wlllll wn815224.0 rathor15596.0 rough rougll16163.0 16900.0 4404.0 sahHarvey17204.0 Harvoygaily Harveygaily Igall 19051.0 gaily gall 15468.0 15120.0 15607.0 15731.0 folt16108.0 like IIko15988.0 16716.0 villain vJJ1nln16595.0 17324.0 whensaw 17864.0 rsaw the15620.0 4816.0 wny15499.0 16036.0 nil16308.0 4784.0 16616.0 17072.0 17636.0 Dut17300.0 Butyou DutoU 14832.0 4968.0 15104.0 15296.0 novfwhnt15599.0 16224.0 16392.0 snldovotYovofiy16780.0 17412.0 one17336.0 17760.0 or17680.0 ofyou 17920.0 orouthnt ofyouthat 5192.0 5155.0 outhnt youthat15292.0 15723.0 15992.0 coultlllt16727.0 110be16608.0 17024.0 16908.0 Irthought 17915.0 5340.0 Id 972.0 demonstrate cemonstrato15740.0 17467.0 thnt14812.0 15507.0 16371.0 16688.0 19 1016492.0 InBtenll16835.0 ot17580.0 14808.0 15264.0 Bhoalto15648.0 cnn15524.0 sllenle15904.0 correctly correctl16468.0 17504.0 whon17288.0 whensho whonsho whenshe 14824.0 she15172.0 makes mllkcl15744.0 an15672.0 effort cUart15928.0 16587.0 nnd16436.0 cnn17020.0 17444.0 henrt17364.0 heartily 17448.0 heartfly fly ily15020.0 recommend recommond14916.0 16116.0 liar16016.0 16460.0 16368.0 16776.0 17004.0 willing 16856.0 17623.0 anti17532.0 andobliging 17904.0 andobIflng antiobliging obliging obIflng15604.0 goodtempered gooltemporedgootl -1128.0 tompered nnd17156.0 thorough 17084.0 thoroughly -696.0 17852.0 14820.0 15088.0 capable cnpablo15676.0 girltho girlthe16055.0 16240.0 16600.0 sweetest swcetcat17272.0 17656.0 thothoworld theorld theworld worldMr 14960.0 orld orldMr 15004.0 Seey15232.0 15984.0 1ertlefttho16252.0 fIreplaco16636.0 17604.0 anti nndnndcarao 17888.0 6907.0 nl1 anticame 17788.0 Jcllmc caraocllmc15328.0 nnd15700.0 casped16268.0 1224.0 ctn1lghterlnlavdaughterinlawin ctn1lghterlnlavIn-1224.0 17432.0 17380.0 lawin 15051.0 hlabls14972.0 15364.0 arms arraaboamlng17180.0 tace17615.0 nndnnd1llt 1llt 15240.0 15140.0 15332.0 effusively elTu8lvelyeffusivelyIt elTu8lvelylilt7616.0 15084.0 7628.0 ndroadfullesson Bald17496.0 MrsSeely 17848.0 MrsSooty Sootyooklng7839.0 16248.0 tearful teartulsmlioBmllosmliobut 17820.0 Bmllobut smilebut 7995.0 8028.0 nm15344.0 15688.0 we16724.0 17259.0 myson mysonUSaturday mysonSaturday 8184.0 sonUSaturday sonSaturdaySaturday 16096.0 16200.0 Night NightA 16676.0 15420.0 8563.0 15656.0 8559.0 RACE 15516.0 16212.0 FOR 16076.0 16524.0 16864.0 MINE MINEA 17244.0 8923.0 15076.0 Midwinter MIlnterM18tvlnter14980.0 15972.0 Haiti nIIhash15839.0 16452.0 16703.0 Locate Iocntoiocntetllo17648.0 LA LieLAIleiir IFleur 17720.0 LieI1enr Ileiir FleurI1enr16379.0 Mine NinoIIlIno16312.0 NinoAn IIlInoAn MineAn exciting race racotor16884.0 16784.0 17076.0 mine 16972.0 toole17440.0 tookplace tooleplace 9487.0 15336.0 9491.0 15228.0 15584.0 February Februnry15472.0 189G 1896189017088.0 16768.0 mnny17356.0 manyyears mnnyyoars yoarsland16296.0 known Imuwn16216.0 thnt16804.0 theCol Cot17507.0 Colvlllo 17839.0 Cotvilla vlllo villa14912.0 1110 15159.0 15283.0 Indian Indilln15156.0 15888.0 reservation resorvatlon16896.0 9899.0 waBrich 17736.0 Inminerals Inmlnorns inminerals minerals mlnorns15623.0 nUll nndand15491.0 prospectors 15896.0 16888.0 17332.0 slipped Blipped17240.0 slippedIn BlippedIn15092.0 eluding oudlng14951.0 thevigilance vigllanco15980.0 ot17064.0 16984.0 IndlnnIndianpolice IndlnnIlOlIco police IlOlIco15452.0 explore oxplore15592.0 16416.0 the16284.0 mountains mountnlns16656.0 17744.0 17599.0 Innorthern innorthern northern 924.0 Washington WaBhlngton15496.0 UutIonsbetaro 10675.0 taro15248.0 white 15788.0 10835.0 mon16228.0 hnd16104.0 ontered17320.0 the17684.0 17556.0 Indians 17828.0 Indluna ins insliana 10983.0 liana diansdluna15372.0 10991.0 Imow16360.0 top tOIltap17112.0 at17256.0 17612.0 low lowmountain mountain 15752.0 near nenr15552.0 nations nutlons17372.0 border bordor17172.0 borderlino bordorIIno borderline line linoIIno11395.0 wnscoered15548.0 bright Inlght16772.0 huebluestones hueatones blueatones 11551.0 11555.0 atones stones15432.0 BOgaudy gaud 16039.0 thnt11580.0 nanny17136.0 worecur ear17499.0 curried currled earrind 11612.0 rind riedrledoftplaced 16760.0 tho16648.0 wigwamsTito 17000.0 wigwams wigwamsThe wigwamsTho ThoTitoprospcctorsknew16696.0 thnttheso17012.0 gay guygaystones guystones stones 15383.0 betokened betolleI1elltho17348.0 otcop COlicopper COlipel 12171.0 per pelveins olns16176.0 mnny16940.0 hungry huncrreye 17480.0 eyewas eyewns 12479.0 wns12492.0 cast 12483.0 15736.0 12487.0 rockstrewn roclestrewn16132.0 17220.0 patch 17128.0 17723.0 ol17632.0 olground ofround 17856.0 ofground ground roundbetore15348.0 16068.0 tho15947.0 lIocrn1l1ontguverumpnt16304.0 lifted Jlttcdliftedtho Jlttcdtbo liftedthe thotboban bl1l1tbntkept 16904.0 palefaco pnernco17544.0 Intruders intraders 14804.0 13043.0 truders traderstrudersBut trudersDut tradersBut 15072.0 Dutcongress 16088.0 16672.0 16840.0 16916.0 Jawopening 17188.0 openingpart 13411.0 part 15216.0 oCtho16668.0 mineral mlnernllo 10location 10cntlon cation cntloncationWaiting cntlonIIWnltlng Waiting IIWnltlngtor16464.0 president 17216.0 sign signtho sIgntho signthe 14800.0 13975.0 theformal tormll15040.0 13979.0 proclamation 16943.0 13983.0 parties 17224.0 partiesquietly partiesqulotly 14796.0 qulotlyforbidden torlJlddenterritory 17124.0 territoryand 14347.0 camped 15900.0 alongside aongsldotho16624.0 promising 16980.0 promisingvein promisingveIn 14535.0 vein 14543.0 At Marcus Mnrcus15652.0 14539.0 the16843.0 nearest telegrnpb 14595.0 graph grnpbBtntlouAtatlou14724.0 14743.0 younyounu16292.0 16852.0 waitedwith 14847.0 14888.0 tense tenso15144.0 15808.0 14915.0 norvcs nerves16444.0 14892.0 tho17143.0 14863.0 tifdrtrckthat 17148.0 nTsVtlck tifdrtrcknTsVtlckthat rmnU 17768.0 17699.0 kthat 19048.0 15048.0 woufdtoll tell15660.0 16072.0 tho15059.0 16700.0 17588.0 hadsigned signed 15428.0 procllmatlon15275.0 wnsnacold cold c01l115268.0 15467.0 gra 15615.0 winter wlntordnynndthosnow Bnowsnowwas WRS15180.0 piled plied15628.0 hlgb16160.0 Late Lato15955.0 thotbo756.0 atternoonafternoontho atternoonthoafternoonthe-756.0 15800.0 the15116.0 word 15843.0 Indthero16348.0 wns17408.0 slmul simul17344.0 simultaneous slmultaneous taneous 15999.0 dash daab15404.0 torthe16140.0 16528.0 horses borsesthnt17027.0 16024.0 worowero17424.0 worowaiting werownillng werewaiting wnillngoutside outsido15391.0 Then 16012.0 16660.0 thobegan beganPlunging 16364.0 Plunging drifts 17175.0 tumbling tumbJng16927.0 tumblingdown tumbJngdown tumblingclowut clowutdeclines docllnoa15212.0 tolling toiling15944.0 desperately upsteep upteop steep teophills bounding 16860.0 16755.0 full speed speedover speedovor 16959.0 ovorlevel lee15528.0 stretches stretchtJs17048.0 16868.0 twohorses bore 15312.0 15756.0 riders Sometimes SometlmeuSometimesono SometlmeuonoSometimesone17331.0 onewaaahead 15520.0 amIanti16664.0 sometimes 17628.0 thethoother theother Tho15844.0 sun disappeared dls -924.0 ppearell 17248.0 thethehurrying thohurrying thohmrlng hurrying hmrlngpair lIalr15939.0 17676.0 blundered bJunderodalong 17267.0 throughthe throughtho thodeepening deopenlng15056.0 16084.0 twilight 15976.0 tbenIntho theatthostars reflected reflectellthotheglistening thoglistening glistening 18263.0 16271.0 Spurs 18267.0 were16708.0 plunged plungollplungedso plungollso18452.0 18423.0 deep de 15448.0 15356.0 15412.0 flecks flecesatstained IItalnetl8tahtedstainedtho -552.0 IItalnetltho 8tahtedthe 18607.0 thes110 Almost side 16340.0 17132.0 17540.0 thoytheyscrambled 17892.0 thoyscramblell 18800.0 18804.0 scrambled scramblell18835.0 15960.0 18808.0 15880.0 moutllalnTheyells YCll817436.0 yellsof YCll8of 18987.0 the14964.0 wore18991.0 hearl16356.0 17016.0 tho17151.0 17607.0 disLance dis dlsdistance dlstanco 19052.0 Lance tancetancorival rlal15848.0 watchers 17236.0 17640.0 didnot wait walt15572.0 19403.0 nfurther Curthorhint drove droothothestakes thosta1 stakes sta1 19584.0 19587.0 thnt15912.0 were16408.0 16276.0 locate ocatotheLa LaFlour LaFleur Flour Fleur15320.0 mineThen rollowedwordy Word disputes 19936.0 fist flatflatfights fistfights fights nnd20115.0 theflourishing flourlsblngat16848.0 20119.0 Winches Winchesters WInchesters Winchestens 20184.0 20300.0 ters tensberoremlno20335.0 waachris crriscrristoned christened 20371.0 20487.0 20491.0 tened tonedone onoconcluded concludedto 20671.0 withdraw 15831.0 20675.0 fight 16711.0 battle battJoInthe 20860.0 20864.0 20868.0 courts court8Eusene courtsEugenoEugene B D16992.0 Palmer inAlnslcos InAlnsleos inAlnaleos 21043.0 Alnslcos AlnsleosAlnaleos15612.0 Magazine MagazineSued MagazineSUOlt MagazineSaod 21415.0 Sued SUOltSaod15764.0 21419.0 rorSlandering 81atutorlalSlandorings21424.0 Cat CutCutAn CatAn 21623.0 21636.0 15380.0 21632.0 UlngParis 17620.0 17524.0 hasbrought 21823.0 action 16344.0 tor16256.0 slander Slllnderagainst 17228.0 againsta 22000.0 neighbor nehhbor14908.0 speaking spookinglibelous llbolousllbolousthings libelousthings 22191.0 nboutcat Shecomplains 22383.0 plains 22379.0 Tabby 22371.0 17316.0 beentreated beentronted 22568.0 treated tronted15368.0 22595.0 844.0 scandalous scandnlous22587.0 22560.0 the17564.0 thoneighbor 22755.0 nelgbbor22751.0 attributed 15931.0 17080.0 22743.0 depre depredations 22803.0 19067.0 dations 22963.0 pussy PUBSY16412.0 tbe16192.0 1120.0 disappearance dlsappearancodisappearanceof dlsappearancoat-1120.0 23115.0 atcertain carlaln15644.0 game poultry blch hadbeen 23303.0 23323.0 23315.0 lett15164.0 lying llngoutsldokitchen kitchenwindow 23492.0 23507.0 15632.0 16179.0 thotboowner atthotbo23504.0 catheard 18792.0 23639.0 23679.0 23691.0 at15544.0 23687.0 the15480.0 charges 23683.0 mndo17560.0 herpet herpot 23887.0 pot15167.0 23879.0 23871.0 declared thllt16204.0 whoever wboeer16632.0 alan slanslandered snn snndered alandered 24056.0 24071.0 24068.0 24064.0 delLrTabb tocourt 24239.0 24259.0 24251.0 if It15456.0 lnw24247.0 France FranceShe FranceSho 24431.0 24451.0 Shosummons 24435.0 due duo17475.0 Cormformcharging Cormcharging 24619.0 24632.0 charging 24624.0 libel 15504.0 Ubcland 16263.0 snndernialnstthethocat thecat 24811.0 24832.0 24819.0 lt24847.0 atterthegame theganle 24996.0 25040.0 ganle25007.0 24999.0 16336.0 hB1stolen stocnbya 25183.0 25196.0 butchers 14896.0 25187.0 15715.0 16580.0 theatofcourse atcourse ofcoarse 25371.0 25415.0 coarse25375.0 apologized 15360.0 25379.0 tor16568.0 thingsshe thingssho 25560.0 sho25571.0 bacl15636.0 Bald15936.0 Dutthethoowner theowner 25747.0 25795.0 25760.0 or25755.0 25764.0 pctstilideclares dec111res17572.0 25935.0 wl11Uho 15804.0 25939.0 the16000.0 aw 16692.0 oathewom wornwornan 26132.0 26143.0 wbosnndered15388.0 16628.0 26135.0 catWhen cathen 26495.0 26503.0 hen Sinn Man16152.0 26507.0 Ii16544.0 26499.0 Shocked ShoekodShockedThe ShoekodThe 26719.0 average aeragoaverago16120.0 16495.0 16827.0 bo26759.0 sur 8Ursoh8Urprlsod sohprised 26911.0 prised prlsodmnnproposes herbut 27104.0 15132.0 27127.0 terrlbe15532.0 shock 27095.0 16951.0 theaveragIJaverageman 17900.0 averagIJman -624.0 17896.0 27260.0 27283.0 theaccepts 1172.0 acceptNew acceptsNeffacceptNewYork acceptsNeffYork-1172.0 27287.0 Neiir NeiirYork 27443.0 27475.0 Press ProssLt 17812.0 27555.0 27691.0 27932.0 H k27703.0 IfH 18363.0 18320.0 t18376.0 27995.0 t18540.0 28875.0 1a 19383.0 29059.0


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\spin01.iarchives.com\scan1\jobq\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01343\ocr\0411b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:12852
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.2343
splitwords:0
ScansoftOCREngine Character Count:12684
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:13301
Abbyy6OCREngine Character Count:12435
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;12435;2913;42.4753;81.889
language:en
ScansoftOCREngine Predicted Accuracy:60.95%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:4807
ScansoftOCREngine Character Error Ratio:0.4637
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;13301;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:81.89%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:81.89%
ImgPrep Component Range:11449,12852
version:Newpah v2.32 RoundBox
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;12684;5882;0.734232;60.9511
noPunctuation:1
ImgPrep Component Count Low Estimate:11449
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.32Styles TextStyle ID4 FONTSIZE 31.0 ID5 8.0 ID6 26.0 ID7 9.0 ID8 10.0 ID9 12.0 ID10 11.0 ID12 25.0 ID13 32.0 ID14 18.0 ID15 15.0 ID16 22.0 ID17 14.0 ID19 7.0 ID21 13.0 ID22 17.0 ID23 16.0 ID24 6.0 ID27 30.0 ID28 19.0 ID29 21.0 ID30 29.0 ID32 20.0 ID33 23.0 ID34 33.0 ID38 5.0 ID39 40.0 Layout Page ID1 HEIGHT 30212 WIDTH 19416 PHYSICAL_IMG_NR 7 PRINTED_IMG_NR [7] PROCESSING PrintSpace 29036.0 18831.0 HPOS 104.0 VPOS 792.0 PC 0.8189 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 76 32 7088 792 ns1:type simple language en TextLine 76.0 7088.0 String CONTENT 1 WC 0.8095238 xmlns:ns2 ID3 27268 4376 104 2172 ns2:type 496.0 2104.0 1928.0 2172.0 STYLEREFS 424.0 304.0 I 0.82539684 60.0 180.0 1992.0 2608.0 vh SP -240.0 2232.0 480.0 1728.0 2304.0 2180.0 Household 0.95238096 ALTERNATIVE flouseIok132.0 Householdvh -1728.0 4032.0 476.0 1656.0 flouseIokrr 28.0 44.0 3348.0 2640.0 j -612.0 3960.0 jHOUSECLEANING -44.0 3392.0 444.0 2208.0 1564.0 2628.0 400.0 rr 384.0 872.0 2900.0 2684.0 Tcs 936.0 1964.0 260.0 996.0 2032.0 2988.0 68.0 r 200.0 388.0 3048.0 hvr 540.0 2100.0 212.0 88.0 3080.0 3176.0 112.0 296.0 3272.0 3344.0 Mry 292.0 1396.0 3451.0 204.0 52.0 3504.0 < 48.0 2376.0 224.0 2152.0 584.0 2912.0 Barfholomrw 488.0 2424.0 Barfholomrws BarfholomrwHOUSECLEANING-584.0 3496.0 84.0 2420.0 3980.0 s 164.0 1868.0 4340.0 148.0 1356.0 HOUSECLEANING HOUSECLEANINC136.0 464.0 3368.0 4368.0 HINTS 144.0 3224.0 HINTSL -464.0 3832.0 160.0 3012.0 1380.0 4620.0 116.0 0.96825397 L452.0 1508.0 4624.0 Sring1448.0 324.0 1536.0 itrlll -424.0 1960.0 108.0 152.0 2020.0 4636.0 of IIr1860.0 2228.0 4644.0 Dont UlIlItll1onla56.0 252.0 2756.0 4648.0 Kor 1M1nr2680.0 220.0 3076.0 4651.0 the 111113008.0 340.0 3352.0 4656.0 Moat Mnt11IIt3296.0 600.0 3792.0 4664.0 Drenclcd Urrnl1cl1100.0 3692.0 DrenclcdScimon -600.0 4392.0 Urrnl1cl1HIlIn 1rent1 4336.0 120.0 4216.0 Isrnalnt -56.0 1384.0 2136.0 4804.0 Scimon HIlInsrnalnt2692.0 4808.0 IIr2624.0 2892.0 tliu tholho2840.0 332.0 3188.0 4812.0 AVar Yror72.0 3116.0 YrorLit -332.0 3520.0 328.0 3192.0 AVarLit -328.0 80.0 3376.0 4840.0 nr -144.0 nrr 184.0 2888.0 1488.0 4992.0 Lit 128.0 -260.0 1748.0 1888.0 5024.0 us tiSIts1560.0 156.0 392.0 2200.0 5000.0 liein heglu2048.0 124.0 hl -392.0 2592.0 2468.0 5004.0 11l 2324.0 176.0 2740.0 by h -176.0 2916.0 648.0 3060.0 5012.0 insisting Imisisting240.0 2820.0 11Ilstlll -648.0 3708.0 3856.0 5020.0 that tlmt256.0 3600.0 4292.0 5060.0 n 140.0 4152.0 ngeneral -84.0 4376.0 nHCl1cml 3032.0 1348.0 5183.0 564.0 general HCl1cml680.0 1996.0 5188.0 upheaval tlllhllll1l1912.0 2760.0 5196.0 Is 2676.0 236.0 2956.0 5220.0 not 2880.0 3268.0 5232.0 ii 740.0 uocuseary -76.0 IIlCCii -740.0 4012.0 280.0 3456.0 5240.0 ccsa -216.0 3672.0 96.0 3760.0 5244.0 II 24.0 3736.0 3796.0 iry -36.0 4096.0 5224.0 to 4008.0 4304.0 5248.0 a IIu4232.0 athorough 4380.0 IIt uthorough 3028.0 1360.0 5368.0 684.0 thorough 5380.0 t -684.0 2044.0 420.0 1428.0 huroll 1400.0 5372.0 1848.0 556.0 2168.0 hnusecI 1024.0 liongeclennlnj JIOIIICclolll1ll1J-552.0 2724.0 432.0 5388.0 iuiing -376.0 3196.0 336.0 3416.0 5424.0 snvo sitVO3252.0 3420.0 5428.0 sn 3752.0 92.0 3684.0 5431.0 0 3572.0 3892.0 5404.0 In III232.0 4156.0 5400.0 4024.0 thehallways -232.0 4388.0 thehltllwn the1ud155ays 1352.0 5555.0 692.0 hallways 1ud155ays508.0 hltllwn -692.0 1976.0 5592.0 8 2272.0 5567.0 The 111l228.0 548.0 2668.0 5588.0 carpets CUIwts2564.0 3316.0 5612.0 or 013216.0 3576.0 5616.0 rugs nigs3476.0 3580.0 III 3908.0 64.0 3844.0 5620.0 IJ 3724.0 368.0 4016.0 5596.0 must unlstmustbo -368.0 4384.0 mustho unlstbe 3036.0 5748.0 168.0 bo hobe652.0 1624.0 5756.0 removed rentovetl1520.0 380.0 1628.0 5780.0 rm110 2276.0 2120.0 5788.0 C 2008.0 2196.0 11 2176.0 364.0 2392.0 5764.0 from trout284.0 2472.0 5792.0 Iom -284.0 2872.0 5768.0 these UIPHOtllISl268.0 5776.0 nuil nilI3256.0 172.0 5804.0 nit -268.0 3640.0 3588.0 580.0 3808.0 tuioklng sacslugtuioklngor sacslugor-580.0 1344.0 5936.0 5968.0 1444.0 1500.0 1584.0 burlaps lmrlltllsbnrlups1476.0 5960.0 put IUlt2148.0 404.0 2552.0 5948.0 down clOWIidutVU3044.0 5956.0 IIIIll320.0 5992.0 case cno3172.0 3652.0 tho408.0 3972.0 flours lloorslooIslloorsarc -408.0 floursfire 356.0 looIsore -352.0 604.0 1340.0 6128.0 248.0 6152.0 arc orefire264.0 1680.0 Hue 11mflue1588.0 HueOutsldo -264.0 1944.0 11mOutlIlo flueOutride -248.0 1480.0 6316.0 Outride OutsldoOutlIlo276.0 6320.0 this 2064.0 2556.0 6356.0 110 no2448.0 816.0 2828.0 6328.0 discomfort IIIcomfoltliscolnfort2728.0 3756.0 6340.0 need ncod3644.0 4212.0 6344.0 1m 110be4092.0 1mbo -168.0 110lie bebe 3024.0 6504.0 liebe1672.0 felt Mt1512.0 532.0 2084.0 6512.0 beyond boyondhollcl308.0 2776.0 6519.0 hnttlint2616.0 36.0 6528.0 -308.0 3084.0 612.0 3236.0 6524.0 inflicted inillotvil2812.0 3848.0 456.0 111c1lll 3364.0 372.0 4000.0 6560.0 upon tlI1011uponwhoever -372.0 4372.0 4004.0 tlI1011whoool uponwhouver -364.0 3040.0 1336.0 6692.0 whoever whooolwhouver640.0 2060.0 6704.0 occupies ocellllicsoccupier1988.0 2784.0 6708.0 tho2700.0 6740.0 room 100111Perim3544.0 6716.0 la IIIlu3464.0 3764.0 3676.0 4076.0 6748.0 pro 1103996.0 process 4316.0 110ccs proeesH 6779.0 1248.0 6891.0 6915.0 cess eesHccs -300.0 1640.0 1716.0 orcleaning cleiull1gcleaningAnd -640.0 2584.0 288.0 clcn cleiull1gAnd -288.0 272.0 2256.0 IIIIIJ IIIIIJAlul -272.0 2528.0 7072.0 7076.0 And Alulbegin leglllhegln1780.0 2484.0 7084.0 with 2336.0 2972.0 tho608.0 7100.0 topmost tOIHl1o3200.0 3904.0 7104.0 -48.0 3952.0 4088.0 and nllilnodandmost -280.0 nllil1II0st nodmost 7263.0 7268.0 most 1II0stdistant 11Istltnt1704.0 2404.0 7304.0 roots2312.0 2908.0 7272.0 tho2768.0 7308.0 ono Olllone3140.0 3552.0 7292.0 at nt3480.0 3784.0 7280.0 thl3696.0 4100.0 7284.0 oiul llllieutloiulof llllior 4364.0 eutlof 244.0 3148.0 1332.0 7408.0 7452.0 or1576.0 7447.0 tho1900.0 hall hnll1804.0 2396.0 7464.0 Onco OllenOuse2852.0 7460.0 2764.0 576.0 3264.0 7468.0 pretties IIllt pretl-576.0 3840.0 3680.0 7504.0 lK cshave hllosafehavebeen -356.0 4456.0 4460.0 -20.0 4480.0 3128.0 7640.0 been 1101111812.0 7656.0 Ilut412.0 2188.0 7676.0 away 7680.0 it-412.0 2600.0 2292.0 wnr 2268.0 216.0 2384.0 zty 7652.0 nlllialit3132.0 till2996.0 3492.0 7668.0 carpet clIlle7659.0 andsmolt 3956.0 Itllil4360.0 andsmall 7695.0 IflI1ltll -12.0 4472.0 7828.0 small flI1ltllsmolt568.0 1828.0 articles lIItlelcKnrtlcics1740.0 636.0 2480.0 7840.0 Iclllocd7843.0 lIIultold3624.0 7872.0 any nay3536.0 7876.0 IIn 3988.0 liirp Inrge196.0 liirppieces -384.0 208.0 IlIr -336.0 4324.0 Inrgepieces -208.0 4196.0 4300.0 7880.0 e -72.0 ellec08 1328.0 8016.0 pieces llec081880.0 8020.0 ot700.0 2132.0 8024.0 furalturu 1I1I1t1ll0gnnituru2920.0 8028.0 grouped Iullilell2832.0 8032.0 111111nlnl3532.0 316.0 8064.0 care cnlccarefully -316.0 cnlctllll 312.0 4332.0 8096.0 4312.0 8203.0 fully tllll 1692.0 656.0 1832.0 8212.0 wrapped WrIIllll15r11pped192.0 8215.0 let lot2488.0 8208.0 tho2876.0 552.0 3400.0 painter pniuter11111 8248.0 3616.0 3744.0 8227.0 tOl 3712.0 8220.0 Ilul3920.0 andimporer 4356.0 IlullltllCrer andpaperer 1820.0 1320.0 8396.0 592.0 8420.0 imporer lltllCrerpaperer1984.0 do clodu360.0 2240.0 their 2160.0 8416.0 -360.0 heh 2280.0 8412.0 worst WUlsttVorst2572.0 worstOnly WUlstOnlr -420.0 3096.0 tVorstOnly 1472.0 8584.0 Only Onlr8616.0 an 1111II11484.0 2216.0 Insane IIIBltlleltlsnlle544.0 2804.0 8620.0 woman WUlllnl1ivutunn8592.0 would wOlllll4020.0 8596.0 heed heNl3912.0 heedthe -340.0 heNltho 8771.0 tho1096.0 1632.0 8776.0 paperhaiiKerfit pnperhnmigers1556.0 660.0 11Ilerhnll -1048.0 2452.0 8812.0 llf1 2340.0 2884.0 8780.0 Theres IIflhllesTlleresno 1103448.0 528.0 3780.0 8788.0 necessi necessl3700.0 necessity -528.0 4308.0 8816.0 nccc necesslty 4108.0 RI -112.0 RIt 8847.0 2980.0 8964.0 8971.0 ty 8968.0 -152.0 1572.0 orat188.0 720.0 removing relnoVhlg1724.0 remoIII -720.0 2540.0 2432.0 2968.0 8980.0 CIIIIItcarpel2868.0 3748.0 One OlllUna4136.0 9004.0 ex 4040.0 experlenco -172.0 exICIIlIiCO expetlence 9152.0 perlenco ICIIlIiCOpetlence596.0 2088.0 9155.0 brought 1IlOlllhther hCI9172.0 3064.0 9160.0 11l13328.0 3816.0 9192.0 sensesr 536.0 3820.0 senses SlIlSIRj-476.0 4296.0 senseswo -536.0 1324.0 9340.0 9372.0 wo we1468.0 9379.0 1540.0 1620.0 all nil416.0 1908.0 9344.0 Icuow huow1808.0 luo -416.0 2416.0 tho2744.0 9376.0 muss 2652.0 3220.0 9348.0 he hc3124.0 makes lIIuklsuulkes3384.0 4176.0 9352.0 Sohe 4180.0 So -180.0 Sobe 4276.0 9388.0 o ohe 9460.0 2976.0 9532.0 be428.0 ready 1492.0 rcncl -428.0 2016.0 2116.0 IIIlu396.0 2360.0 haste hnste2248.0 oh 3164.0 9563.0 yo 3cye3068.0 864.0 3440.0 9536.0 housewives hOIlHcwlesllouseSVives3336.0 housewiveslest llouseSViveslest-864.0 9548.0 9720.0 lest 1648.0 9752.0 ye 1580.0 1744.0 9760.0 1816.0 1892.0 9728.0 repent repeatlcllClI -480.0 2372.0 2328.0 2296.0 9732.0 11t2664.0 9724.0 leisure 10IsllIleisureOutsldo -496.0 3160.0 460.0 10IsllI0llt8lclo leisureOutsklo -460.0 4440.0 1280.0 IIlest 2896.0 1460.0 9908.0 9911.0 Outsldo 0llt8lcloOutsklothl2040.0 728.0 bedrooms lIell1oolllshedroonis2412.0 9920.0 nUtlnut3280.0 3836.0 9916.0 tho3688.0 4208.0 li 11Ii4068.0 library 111I1n Iibrnry 9984.0 4436.0 9996.0 IJlnnlO -24.0 10100.0 brary brnry1I1n 1736.0 1876.0 den I1CII500.0 sitting sltlltigsltllll -500.0 10132.0 rOOl1l10136.0 3240.0 10140.0 w 3540.0 3628.0 10107.0 whatever whnlll1lulteree-100.0 3728.0 whateveriiamo -728.0 3776.0 lultereeuntie 1308.0 10288.0 10319.0 untie iiamoJlnnlOtho760.0 bestloved hestloct1300.0 10292.0 hest -760.0 2500.0 lovcd 2436.0 2992.0 3452.0 10324.0 goes 3548.0 10328.0 OlS -228.0 440.0 3864.0 10295.0 tinder 1II1IIlrunderunderanti -440.0 436.0 3868.0 tinderand -436.0 1II1IIlrlul 1312.0 10476.0 10479.0 anti1412.0 lul thodining dhtipg1936.0 1I11111 -484.0 2532.0 2644.0 10512.0 1001112428.0 3180.0 tho3016.0 832.0 dlscomColt3412.0 discomfortwill -832.0 4352.0 dlscomColtwill discomfortwlil 1304.0 10664.0 will wlil1708.0 10668.0 ho bo1600.0 1980.0 but 1Iutlittle IIttlo2796.0 10672.0 Celt3204.0 Indeed 1IUlCCII492.0 3852.0 hardly hnrdlyunrulyhardlyfelt -492.0 4344.0 hnrdlyCelt unrulyfelt 3020.0 10851.0 10856.0 Celt1684.0 10868.0 ntnil2288.0 If it2508.0 only 10887.0 011 -320.0 2696.0 644.0 2944.0 cleanln -644.0 10860.0 3928.0 bo4064.0 bodone -160.0 hodOlle hodole 11044.0 352.0 done dOlledole11048.0 11052.0 A -304.0 nil 2036.0 796.0 2332.0 everybody OCIy1Iocl3208.0 does 110lHnoes11056.0 lintpaint ptlttpaintand -388.0 11080.0 lla ptlttnuts 4116.0 4144.0 -200.0 4268.0 tlul 11235.0 nuts1404.0 1720.0 11268.0 paper pallel11264.0 every erelyOlI rooUl3212.0 N3 -236.0 3768.0 344.0 year yearTwo -344.0 4248.0 4084.0 II1 -164.0 II1O -136.0 4220.0 1300.0 11424.0 Two 11460.0 O good 1800.0 ood -256.0 2056.0 620.0 2124.0 workers worlels2816.0 11456.0 can cnn3144.0 11428.0 clean clel1uclenu676.0 3612.0 thorollJh3528.0 thoroughly thoroughy-676.0 4288.0 thorollJhhnIII 11488.0 3000.0 1296.0 11612.0 ly 1364.0 11643.0 y 520.0 1608.0 having hnIII -520.0 2128.0 2024.0 468.0 2596.0 things 2476.0 348.0 3184.0 back bl1clbuckhtplace Illnco1111ceplaceone Illncoono 1111ceone 11803.0 11832.0 one ono1644.0 11836.0 2108.0 2496.0 day dayToo cJn 2904.0 1436.0 11991.0 Too 100much hnfitelulstehowever hOOCI2780.0 3860.0 makeswaste mnl 4124.0 12024.0 -64.0 snste 12180.0 12187.0 waste nste 1904.0 12184.0 12211.0 nnl -276.0 2316.0 contents contonls2548.0 3428.0 or3308.0 cabinets cl1hl1wttlcnbinetH3584.0 cabinetstilled -636.0 cl1hl1wttl1111ell cnbinetHtilled 12368.0 tilled 1111ell1768.0 1668.0 2236.0 12371.0 treasures honsurcs3052.0 12376.0 mllst2936.0 Illho3424.0 3800.0 tonsil considconsillconsidered 4280.0 consillerel1 tonsileyed 12435.0 12556.0 12559.0 eyed erederel112592.0 nseparate scpnrate2660.0 task tnsl12571.0 hobecarerllllycarefullygone carerllllygono 1288.0 12743.0 12776.0 gone gonoover oerwlthskilled BIlllcll12748.0 hands hl1l1lIs3656.0 12780.0 IIponnnnuanother 4272.0 nnothcr nuother 12807.0 12931.0 other othcr1756.0 12936.0 occasion occnslon2516.0 12964.0 12940.0 ntleast lenst3468.0 12967.0 nnftrom3884.0 fromthe 4328.0 tromtll 1284.0 13115.0 tll -244.0 1528.0 1604.0 13120.0 real Icnl1956.0 13151.0 scene sClnc1884.0 13124.0 ot2364.0 788.0 2656.0 operations ollerntlonsoperationsOne ollerntlonsono-788.0 3444.0 operationsOno 1416.0 13308.0 Ono ono1788.0 really lenlly13315.0 cant feel Ceel2672.0 3088.0 match764.0 3568.0 13312.0 sympathy rmIHtllfsympathyfor -764.0 rmIHtllftor -680.0 1292.0 13496.0 for tor1616.0 560.0 13528.0 wOUlnntiVOnnnn1844.0 who takes tnlccR3488.0 III13532.0 nllY3620.0 un UIItilltillknown -184.0 unknown UIIlIIown 13559.0 13680.0 512.0 known lIIown13716.0 person petson13688.0 011112388.0 sets flets13683.0 him 111113608.0 13720.0 013512.0 4184.0 13692.0 toflue 4188.0 -140.0 toline toflno 13868.0 13871.0 line flnofluework wOII13876.0 nodthough thouJhtilolgh3436.0 It 13904.0 may mnyrimy4160.0 110bebomean 110JUenu bemean 14055.0 14088.0 mean JUenu704.0 14067.0 ollocnnt 2072.0 cry CIY14060.0 when 3388.0 she Rho3716.0 tells 3636.0 heLhertale heLtnlo -224.0 3056.0 14243.0 tale tnlo1664.0 14248.0 or14276.0 woe 2344.0 how LOW2204.0 2752.0 thnt3248.0 terrible lelrlhloterrlhle3896.0 creat clnt3804.0 creature -380.0 clntmo creatare 14303.0 14432.0 14460.0 are uremobroke IIrolco2252.0 14463.0 some somofiOIllCl2736.0 priceless Ilrlclcss2632.0 china ch -400.0 4052.0 nu11andhow nnlhow -220.0 nu11how 14615.0 14620.0 said 14651.0 fill 14623.0 cren1uolistened 2800.0 patiently mtlellt1ypatleutlypatientlywhen -700.0 688.0 patleutlywhen -696.0 mtlellt1ywhcn 1276.0 14804.0 14808.0 whcntold tolll1696.0 anvil3092.0 14835.0 was wnKworth worthfrom worthtram 14988.0 376.0 14995.0 tram928.0 14992.0 associations nSBoclntlol1s1652.0 2808.0 hut588.0 insisted InslstlHI3828.0 ttmtthnt3732.0 4236.0 ItQP -108.0 ItiiC It15eitalaalht 1168.0 15155.0 15159.0 iiC 1072.0 1204.0 15eitalaalht 1432.0 15195.0 QP -916.0 15183.0 IH 1504.0 15180.0 nmiU IIIn 2356.0 15207.0 + -88.0 2444.0 15212.0 0.0 fc e784.0 2720.0 15164.0 httvocc9t hlwOccsthrcost15176.0 -784.0 > tho the2848.0 3968.0 price pricementioned 15340.0 15343.0 mentioned because becauso15372.0 anyone anono2984.0 knows knowsthat 15527.0 thnt1700.0 thebest hCRt15532.0 SolRor2732.0 chinnchlnn3484.0 112 1133984.0 113Pieces 112pieces 112pleccs 15708.0 15720.0 pleccs15724.0 cost hilt15715.0 55 mAmIAud2772.0 15712.0 allthlthin15739.0 poor pOOL3924.0 poorwoman pOOLwomnn 15896.0 15935.0 womnn1972.0 15904.0 could coulet1840.0 2504.0 15932.0 wnHwns15908.0 3100.0 gnash Jnnsh3940.0 herteeth 4164.0 4264.0 15923.0 -68.0 rteeth 16083.0 16095.0 teeth 1784.0 16128.0 2052.0 16092.0 pull 1940.0 hlr16087.0 half hnllhair752.0 according 3152.0 accorcJllI -752.0 4060.0 towhich towhIch towIllch 2140.0 1268.0 16276.0 16280.0 which wIllchshosite16283.0 had hnl1liedtho2400.0 2708.0 orofIn -156.0 orIn 1420.0 16455.0 16476.0 1076.0 1712.0 16467.0 housccleanlng houscclcnnl1lhouseclcnmilug2948.0 16495.0 as ns2788.0 3228.0 16464.0 In3104.0 3288.0 16491.0 3360.0 840.0 everything everythingelse -840.0 ercr thln thlnchlo -296.0 1264.0 16648.0 16660.0 else chlo748.0 16655.0 discretion cJlHcIctlon2492.0 is or16652.0 prime prlmc844.0 Importance ImllolIIII1CinlportnuceImportanceFurnlftliliiR -844.0 4256.0 772.0 ImllolIIII1CFllrnlllhhll inlportnuceFnrnlnhlii -772.0 17003.0 824.0 17008.0 FurnlftliliiR FllrnlllhhllFnrnlnhliiWith Villi948.0 wltlrn1Innn wltlrn1InnnThe -948.0 17036.0 R-532.0 rinnn IllnorinnnThe Illnoho 17159.0 17168.0 17172.0 modern 1II001crnIdea hlen2792.0 or2712.0 800.0 furnishing 1111118hlns17187.0 never ncer3812.0 neverplaces ncerplnces 17347.0 17359.0 places plnces17395.0 apiano plnno1111101932.0 2580.0 17352.0 2464.0 its ItRhackblack17356.0 tlltime3944.0 thowall thownll timewall 1256.0 17540.0 17552.0 wall wnll17547.0 Much uch hotter bCtterbetter2856.0 nndanti17571.0 more marlfashion fnshlonnRhlon3596.0 fnshlonable -556.0 4244.0 fashionpule nRhlonnblc 17728.0 17740.0 able nblcpuleeffects ef1lcts2308.0 17767.0 nroare17731.0 obtained 01ltnincil3320.0 placing plnchl448.0 plnchltho -560.0 placingtae -448.0 17776.0 i itho 17912.0 17927.0 tae696.0 17924.0 keyboard Ito 1Ionrd 1772.0 2408.0 17919.0 toward towl1rd17915.0 2940.0 3372.0 wnll3276.0 ntlll17943.0 abench -92.0 IIlJCl1ch 4284.0 18099.0 18115.0 bench lJCl1chscat Hcntseat2264.0 18108.0 against ngllinstag11inat2144.0 2824.0 3312.0 18103.0 hack backorthe3936.0 thopiano thoIlln 18287.0 18303.0 118110Illn 18332.0 1764.0 form orm -292.0 2348.0 a18292.0 settle settlo18296.0 Of 3004.0 18320.0 course COll84056.0 tietiebad thoback 18439.0 18492.0 hnclbad or2004.0 time2352.0 18483.0 plrmoI11I1Kt18480.0 be 3260.0 18475.0 properly PIopCIlyproperlyflttisletl ifinished 4396.0 18520.0 Iflnlshcd -16.0 18635.0 18676.0 finished flnlshcdflttisletl18680.0 2156.0 thl Covers COer2612.0 18671.0 18699.0 01 18668.0 pianos pIIIII09pIIIII09HC pianosareIare 18800.0 18900.0 HC11018867.0 longer 10llsel1752.0 18864.0 in III18888.0 vogue OJlle2512.0 18859.0 1IIIt18852.0 where whcw3404.0 4028.0 18883.0 jIs 18855.0 iis 1260.0 19040.0 19055.0 1919088.0 very Jl 1968.0 19048.0 milchdesired dcslreddeslrctl19076.0 aselection selnctlon4044.0 Ismade -120.0 IsllIndo isnlnd0 3136.0 19179.0 19243.0 made llIndonlnd019248.0 or1676.0 2260.0 19272.0 so 19267.0 SOll1e sone-148.0 19312.0 2636.0 uc 2456.0 19236.0 heavy lenvyhCR -452.0 628.0 19227.0 material mntorlnl19231.0 tomatch 1mntch 19415.0 472.0 19432.0 match mntchthe1732.0 19423.0 wnll19420.0 This fhlsdOC9hang ltmlg3824.0 ltmlgdown 19444.0 lIlIIg 19472.0 idown 1252.0 19551.0 19623.0 Iownnt19615.0 1896.0 2284.0 sides slllrR19611.0 hut19604.0 exactly exnetly3740.0 19608.0 Ills nts3664.0 thethetop jtop -28.0 19663.0 ItOil 19739.0 19816.0 top tOil1688.0 Many MnuJMnny804.0 2184.0 19807.0 ornaments 01llnl11cll182112.0 19828.0 nlo19804.0 out 3300.0 19795.0 or3604.0 3888.0 19792.0 pineopineoon placeon-404.0 jon -32.0 19895.0 20031.0 on 19995.0 11111101596.0 llnno 20028.0 n19988.0 pllu 111101110 19992.0 oC2932.0 19980.0 music tutlslc2864.0 1I1d20011.0 nfirm armfirmvase -312.0 3976.0 armvase Inso 20167.0 20219.0 vase nso 20188.0 or1924.0 20179.0 fresh rcshflowers llowcrs20203.0 Uoare2952.0 nllnil3284.0 thnt20191.0 nroareneeded -252.0 nro1Iecded areneelcd 1240.0 20376.0 needed 1IecdedneelcdneededA 1IecdedAneelcdA1388.0 20543.0 20567.0 20555.0 crowded 1516.0 868.0 20579.0 appearance nllpenrnllco2244.0 20548.0 20575.0 0110thing 3788.0 thingIn thingi1tlJln tlJlnIn 20732.0 20751.0 i120744.0 particular lI1rtlculnr20747.0 2536.0 20735.0 avoided n0111011Ifeffective 3560.0 effectiveresults -652.0 etr -196.0 3916.0 ctho cthoresults 20920.0 20935.0 results 20968.0 moare1760.0 20932.0 1Ilbe2568.0 20927.0 oblnincil3304.0 3516.0 home dec cJccdccdccoration 20923.0 decoration cJccoration 4252.0 20983.0 21107.0 21123.0 oration 21119.0 fhe2620.0 21116.0 has hls21143.0 b 21111.0 3524.0 4172.0 ItIs -124.0 21295.0 21316.0 21312.0 conslueren considered1372.0 21304.0 desirable deslrnble2300.0 21307.0 3120.0 hno21323.0 anynumber anynuulher 21240.0 21483.0 21503.0 number 1Iumbernuulherot21491.0 trlllcs trlflcstrifles664.0 21488.0 standing slnnl1ln3472.0 about 01l0utandfurniture 21515.0 nm nmturnltulo 21675.0 21691.0 furniture turnltulo21719.0 1952.0 21679.0 thickly 2192.0 thlclI strewn 2704.0 around 21703.0 nrouDI -540.0 4036.0 21700.0 na nsasnato nsto asto 21860.0 21884.0 1464.0 21875.0 impede Impel10linpede1392.0 2092.0 21903.0 progress progres21863.0 through througbthotbo21891.0 rooUtrooulroomIet rooUtId rooulPet 22127.0 22228.0 Pet IetId900.0 22223.0 Averalmmof Avenloll -900.0 880.0 AverslonF Itnt JrRtlintsItntTo JrRtTo lintsTo 22375.0 22387.0 To 22383.0 learn 22380.0 pet pct716.0 aversions 22407.0 -716.0 3108.0 erslons nndlJy22435.0 ievery 1236.0 22603.0 cery22600.0 means menns22567.0 show sho 2716.0 22564.0 them 2560.0 thnt3632.0 22559.0 they thc 3964.0 22595.0 nroaro22504.0 J Junwelcome 22640.0 lIunwelcomo lunwelcome 1244.0 22751.0 856.0 22759.0 unwelcome unwelcomoguests gucsts22755.0 giving gllnstllmfreely reel 22827.0 tof 22939.0 22955.0 or828.0 22948.0 oerthlngthnt22943.0 lenstdesire cJoRlredesireIs cJoRlreIs23132.0 23139.0 23135.0 1368.0 onl 23163.0 way wa 2520.0 2844.0 keep leocil23160.0 house IIUwfreefrom free treotreotrom 23311.0 23332.0 trom23327.0 rats 23320.0 Poisons Ioisoilsteach 3332.0 tbemtransi htUlsItransitory -444.0 4228.0 htUlsItorJ 23375.0 23504.0 23523.0 tory torJ524.0 23511.0 lessons hut2836.0 2688.0 udlo tile dlo4048.0 thp thethphouse thehouse 23692.0 23699.0 23704.0 nnd23728.0 cause regrets regrcts2648.0 thereby tbrch outside outsll1u 4240.0 23752.0 23879.0 23888.0 side sll1u23883.0 tbell23915.0 own circles Among Amon thethothings thothlns thethings 24067.0 24072.0 thlns24083.0 920.0 particularly IlRrtlcnlllrlypartletllnrlyob object 24127.0 1224.0 24251.0 24260.0 ject 1612.0 24296.0 uroare616.0 24291.0 cayenne cnYeime1852.0 cn -616.0 ellno 516.0 24287.0 pepper QcpperQllpef24255.0 broken brolenglass glnssglassand glnssnnd glassautl 1232.0 24439.0 24447.0 nndautl24444.0 chloride chlorhlo24451.0 orlime I1nicrhoslnss504.0 should 3720.0 shouldbe -504.0 shouldbo shouldbe24627.0 24635.0 bo1496.0 pounded 24632.0 mixed mlxccJdry drJcorumcal corumenlcoruntenlcorumcalnud -704.0 corumenlnud 24811.0 24823.0 nud 8111placed plncedn1Jollt2068.0 24819.0 2576.0 24816.0 favorite norltehaunts haunt818nurtts18nurttsamid hauntsand -524.0 haunt8nnd 25003.0 25011.0 nndamid25007.0 1776.0 holes lJolcsbolesCayenne Cucnno25031.0 Ilellpelpepperand IlellpelnncJ 4260.0 25188.0 25200.0 nncJ1660.0 25195.0 chlorlceatlimo25191.0 thrown throwucJowndowntheir cJowntheir 25375.0 25384.0 2164.0 25379.0 2076.0 completely cOIDllletclydiscourage 111scourl1godiscouragethem -824.0 111scourl1gothem 25535.0 25572.0 1836.0 Soap nUllnuttar 2928.0 25563.0 stuffed stuacclstulYed2860.0 25567.0 Into 25560.0 tlielrtllelrtlielrholes tllelrholes theirholes 25751.0 25759.0 25756.0 2096.0 also 25780.0 cnuseremove rcuiovoreUlOOrcuiovoto removeto-564.0 reUlOOto 25935.0 25951.0 25943.0 tbelr1920.0 25939.0 neighbors nclgh1l0rsIf3112.0 tlleso3592.0 remedies 3500.0 remediesare 3156.0 26159.0 oro26128.0 renewed 944.0 26119.0 occasionally ocenslonnll26152.0 even eveuCCU26123.0 thoughno thoughr4348.0 1060.0 26303.0 26331.0 1220.0 26343.0 1101112.0 632.0 26307.0 Intruder Intrqder1408.0 26315.0 lntn -632.0 1872.0 der 182368.0 26339.0 seen secn26311.0 UIOplnclwlll3508.0 gala galusalugalun salungalaa-324.0 1216.0 26495.0 26536.0 a26500.0 c1eslred988.0 unpopularity unpopularityThe -988.0 26527.0 ollulnrlty ollulnrltyl 26843.0 26847.0 TileMiddle 311111110JIIdd1e2964.0 Iilloir 1lllouIilloirThere lltto llttoI 1lllouThere 1192.0 26883.0 l 27003.0 27068.0 27011.0 There 27007.0 1824.0 27035.0 nnew ncwpillow ell 27039.0 19islagunre 19ume isunto 27192.0 27227.0 gunre unto ume27195.0 shape sbnpennd2440.0 27223.0 opens aliens1InekbackMtcad 1Inektend backtoad 27375.0 27383.0 Mtcad tend toador27387.0 nttbe27379.0 end 27407.0 3072.0 Sheer Sheel3880.0 linen linenfcabrlc linenbrie linenbrit 27564.0 27571.0 fcabrlc 1544.0 brie britembroidered nnd27567.0 ruflled rumedruCied3356.0 4132.0 lit 111inlitnest -128.0 111nest innest 27748.0 27767.0 nest 27755.0 used uscdcomposition compoll 27751.0 tlon Itaced Iteed Itcod 27931.0 27943.0 aced cod eed27939.0 front tront27935.0 ortho3648.0 27947.0 two pll plland 4204.0 pllantI -188.0 4200.0 2524.0 28115.0 28132.0 antI28120.0 designed cJeslgncl1WIUltivitli28151.0 nn28123.0 Idtr4104.0 28139.0 toant tl tlant -96.0 toeat 1636.0 28307.0 28319.0 ant eat28315.0 shams shnms896.0 Technically TcchnlcJlIyit 28311.0 18laI 18the 28339.0 sthe 28495.0 28516.0 28511.0 28499.0 middle mhltJlcpillowI 29131.0 29363.0 xmlns:ns3 ID11 14724 3192 4504 1976 ns3:type 5556.0 IL ILSpelled 5652.0 5252.0 Spoiled Spelled5880.0 For Fer5796.0 6196.0 Hard Hud6120.0 6612.0 Work 6532.0 WorkSeveral 7000.0 WorkSocral WorkSoveral 4780.0 Several SocralSoveralyears 5332.0 5520.0 cnrs 5828.0 5912.0 ago 6256.0 6176.0 6428.0 6864.0 Hungarian Uunllrln6776.0 Hungarianloot Uunllrlnloot7696.0 4616.0 2588.0 loot 4980.0 both 4892.0 legs legR5312.0 5784.0 5696.0 6016.0 5928.0 6284.0 accident nccldent7144.0 Ho 6924.0 np Ipap7364.0 nppealed 7628.0 Ippealcl appealed 4612.0 pealed pealcl5172.0 5100.0 5384.0 5700.0 HlIngnrlnuIIungarinu5624.0 6604.0 society soclet They Ihey7048.0 Theyhadnt 7692.0 7332.0 IheylJndnt 4608.0 hadnt lJndnt5168.0 enough cl1jugh-548.0 5716.0 5432.0 ugh 5320.0 funds fumlotunllo6276.0 6208.0 6492.0 justify 6424.0 ju -516.0 7008.0 6736.0 t1t 6644.0 6908.0 7552.0 indevoting Indootlng Indevoting 4604.0 672.0 devoting dootlng5340.0 5276.0 5656.0 prico prlco5580.0 6104.0 at6032.0 to6688.0 logo 10KO6608.0 7192.0 200 6984.0 7548.0 3168.0 7424.0 toono toa 3396.0 4876.0 4688.0 4984.0 caso5444.0 5292.0 butthoy 6136.0 6248.0 fixed fixell6600.0 7068.0 man mlln6964.0 7512.0 3380.0 up Ul7400.0 Ulon 3587.0 4904.0 3556.0 crutches crutcheo4792.0 5720.0 nnd5540.0 6108.0 set Bet5996.0 6436.0 6324.0 6724.0 7176.0 soiling sellingsoilinglead 8otJIn -512.0 7688.0 8otJInlenll 7592.0 sellinglead lead lenllpencils ponells4916.0 5648.0 5548.0 5924.0 6112.0 busy 6012.0 bU8 6464.0 6564.0 3772.0 corner 6364.0 7296.0 ThoyIhoyThoytold Theytold 7324.0 Ihoytold 4596.0 3932.0 4964.0 blm4900.0 5528.0 mnko make5468.0 6004.0 what 6456.0 6392.0 6700.0 6640.0 cou1 7112.0 7028.0 7012.0 7064.0 7220.0 nUllanti7108.0 7576.0 if7508.0 ifho -116.0 7580.0 Itho 4852.0 raised rnlllcll4128.0 part 5300.0 5760.0 at5688.0 5980.0 the5908.0 6292.0 prlco price6216.0 or6672.0 4148.0 now new6896.0 7344.0 7264.0 legstheyd 7644.0 legsthoyd 4600.0 theyd thoyd5184.0 4320.0 fit 5072.0 5840.0 5732.0 6192.0 6088.0 6648.0 the6996.0 rest rtst6888.0 7532.0 Intwo 7684.0 4500.0 4515.0 4972.0 4508.0 weeks wecko4880.0 5512.0 5420.0 mndo6264.0 his ltis6664.0 4503.0 6488.0 7116.0 know 7164.0 knowthat knowtltnt 4696.0 tltnt4988.0 4700.0 5204.0 be5132.0 5436.0 4728.0 nfact tact5516.0 6080.0 6360.0 6288.0 6720.0 6652.0 pitiful pilltlll6804.0 7444.0 7368.0 7616.0 7636.0 4748.0 4588.0 4884.0 4888.0 nnd4896.0 quarters 6056.0 rained rnlnclinto 6544.0 7040.0 hlftthe6948.0 box boxWhats 7632.0 boxWhnta 5080.0 Whats Whnta5112.0 moromorn5140.0 5600.0 5076.0 hna5896.0 6312.0 beon6232.0 6744.0 selling 80tJIng7348.0 pen lIonpon7612.0 lIonclls ponells 7608.0 4584.0 5260.0 5268.0 ells cilsclls4940.0 ocr4848.0 5348.0 since slnco5944.0 5272.0 110lie5724.0 6252.0 got 6160.0 6588.0 5264.0 6496.0 6904.0 6808.0 7428.0 We Wo7196.0 Wofurnished WeCurnl9hell Wefurnished 4592.0 5452.0 5455.0 furnished Curnl9hell5900.0 1Iut5772.0 6224.0 5460.0 6144.0 6468.0 5488.0 WI8tvns6832.0 spoiled 8pollel16760.0 7456.0 tor7376.0 forhard torhnrcJ 5644.0 hard hnrcJ5128.0 5736.0 His Zits5504.0 friends 6008.0 6836.0 7180.0 111mhint5676.0 n7480.0 aplnco npIneo aplaco 5836.0 5839.0 plnco pIneoplaco5872.0 nscashier cushier5236.0 5976.0 a6400.0 saloon oaloon6300.0 5844.0 nt6900.0 7336.0 10 7156.0 10weel 7488.0 7588.0 5864.0 nwoek nweek 6024.0 week woekweel5096.0 6028.0 5408.0 5344.0 held 6052.0 6164.0 6636.0 6060.0 7056.0 weok weol7204.0 weokor 7672.0 weolOf 4580.0 Of4820.0 6228.0 4744.0 5288.0 6220.0 Tho The5092.0 836.0 temptation tomptntlon6568.0 6223.0 6796.0 nmko mlkomako6247.0 moro moremoromoney moromODe moremoney 6404.0 6440.0 money 6444.0 mODe -508.0 6408.0 4996.0 less worlewan6168.0 6624.0 6412.0 too 6536.0 6944.0 6860.0 Cor7356.0 forhim CorhIm 6596.0 110lie4868.0 took off orthie hiD6068.0 6500.0 logs 10gl1logo6396.0 6800.0 6607.0 wont 7184.0 wontback 7288.0 wont1Iack 6784.0 6792.0 1Iack5040.0 5280.0 6788.0 the5180.0 pencil poncll5916.0 6572.0 business lJUslneso1107216.0 Howorks 7664.0 110works 6976.0 6980.0 works 5156.0 nt5052.0 5416.0 5304.0 5636.0 5524.0 5892.0 pleasant Illcalnt624.0 weather onclandmakes onclmakes antmakes 4576.0 7163.0 7172.0 5136.0 5068.0 25 5484.0 7175.0 50 6388.0 if6928.0 7236.0 times tlmcs7168.0 timesnro tlmcsnro timesare 4572.0 7360.0 7392.0 nro are4928.0 fair air5584.0 6044.0 evening evonlng5940.0 7036.0 puts putnputl6920.0 7388.0 7352.0 onhis onhlH 7547.0 hlH4800.0 5296.0 anel5200.0 5668.0 enjoys enJos5560.0 6260.0 life lite6732.0 7224.0 are7124.0 7568.0 7583.0 nasort nsort 4568.0 7736.0 7744.0 sort 4944.0 7740.0 otfull Cull5500.0 dress dreBs5964.0 costume cootmno5888.0 6660.0 6584.0 7772.0 6884.0 6956.0 7768.0 you 7240.0 yousee yousocNcw youseeNow 7928.0 7960.0 see 780.0 socNcw seeNow5016.0 7931.0 Iscw York YorlcSun 5800.0 SunWnnt SunWhll Sunwnnt 8308.0 Wnnt Whll 8312.0 dAt 5972.0 il 6116.0 At 8320.0 Uncnl OncatUncnlTrftvnllnRsMcflmcn 8315.0 OnCf Oncatrrnvnlingenleetnrn Irrnollnl 4544.0 8460.0 TrftvnllnRsMcflmcn rrnvnlingenleetnrnrrnollnl -1248.0 5824.0 5228.0 8475.0 IInl 8499.0 Ill 5536.0 5680.0 wlthor 6180.0 6148.0 without wllholltwitlloutoxperlonro OXlllrtonrlloxpertonrn6840.0 OXlllrtonrllCOOO oxpertonrnCOOO8587.0 COOO 0000mug And4908.0 1111 ripfimpA UIIIIIIIPIIrsprnnrtiKor8604.0 panlcnlu Illrllcllhpnrllculn6348.0 8628.0 7044.0 7136.0 8599.0 wrlto wrllllwritwrltoIocnUonlns writ1ocahontne 4552.0 8711.0 736.0 IocnUonlns 1018110111011ocahontne8728.0 lobntxo lubnccoloIJn 5808.0 8752.0 5952.0 8716.0 Works Workllfurke8723.0 lloilforU lIodrortlllodturd6368.0 Cltjr CItl8732.0 7320.0 7152.0 UT 7416.0 VnA Vn ViiViiA 7624.0 7520.0 8747.0 -104.0 nIIlnt 9052.0 9056.0 5988.0 Hint IIlntuhltHintYou 6304.0 uhltinn 9200.0 You 1011inn9224.0 1111111nntet9216.0 glut pirni1Tfhint hlllhtnl9243.0 6036.0 6244.0 9220.0 UlntI1lnt9240.0 we WI6932.0 sntit 11111enld6848.0 wlion WIItHlwhnu7200.0 wliontliu whnuthe WIItHlthl 4536.0 9332.0 tliuthl4776.0 f 4732.0 fnlr tntr4832.0 9336.0 Air 668.0 jrumiKKlrl 9360.0 IUIIIII yuuug-668.0 5728.0 girl Ilrl5448.0 756.0 5812.0 coiiinlfilucil lOllllllnluullcomptntuutl6676.0 tl1lt7032.0 l1ertier6940.0 lover lourluvur7252.0 loverWAN lourVoRM luvurxaw 9480.0 WAN VoRMxawBlow KlovrIuw4772.0 5148.0 9468.0 5336.0 9484.0 proio Iroloprapwt prapwtVbatenrtof 5816.0 9496.0 -60.0 tWiiAtmirtnt 9491.0 9575.0 WiiAtmirtnt Vbatenrtof9596.0 111 5532.0 lorllll 9616.0 9588.0 InuitC0u 5608.0 9584.0 until 9612.0 eRII 6352.0 6308.0 l6420.0 gtvolilm gtvotduugtvolilmilvohltnn -628.0 giro 1IIIu 6696.0 1IIIuUro 4752.0 9699.0 Give Uro9704.0 5044.0 ilvohltnn 4796.0 9711.0 hIm 9736.0 tie tieEXTRACT U ULIBBy -80.0 4560.0 9928.0 10071.0 LIBBy 808.0 6872.0 1XTR 10784.0 10815.0 EXTRACT 4768.0 968.0 XTR -2032.0 7232.0 1016.0 6576.0 CTi 10788.0 tI 7600.0 1f 4528.0 11344.0 11347.0 5576.0 1144.0 5848.0 11340.0 BIEEF 812.0 6184.0 FFF -808.0 6992.0 FFF1GI -812.0 6452.0 ff -1052.0 11324.0 Ias 11516.0 Isj 1GI 7380.0 11760.0 asMade 7492.0 5056.0 11944.0 11948.0 Made Mllte5464.0 regard regmt11972.0 11984.0 econ cconcconomy econom 4540.0 12000.0 GI 12151.0 omy om 12104.0 5108.0 12148.0 use 12108.0 tilt6460.0 beef becf6756.0 beefOK 7188.0 becfot beefget 12232.0 12240.0 ot 12287.0 OK 12296.0 get et 5116.0 12268.0 12272.0 5356.0 5712.0 12308.0 essence 5632.0 12260.0 12304.0 rom 6768.0 6852.0 ando 7228.0 andconcentrate tel 12316.0 4632.0 12423.0 12483.0 12452.0 concentrate 4740.0 12428.0 6096.0 uttermost ultermost6372.0 uttermostIn ultermostInel 5064.0 12664.0 12668.0 5308.0 12707.0 5212.0 5572.0 12704.0 ounce 5476.0 our 12683.0 extract 6592.0 extractt extractI12712.0 L Lthere -212.0 4720.0 12795.0 12831.0 there 4952.0 12828.0 12824.0 5640.0 5692.0 12819.0 nutrition 6632.0 6820.0 12864.0 many 6780.0 manyof iS rif 12955.0 12960.0 if of4548.0 13024.0 S 13048.0 i4628.0 12988.0 pounds 12984.0 10Io13008.0 6856.0 6772.0 mored morenutriment fnutriment 13136.0 13196.0 d 724.0 13148.0 nutriment 13163.0 5920.0 13179.0 im 1m6880.0 impossible 7404.0 Lpossible 7584.0 13303.0 possible Few Iew5480.0 13327.0 extracts 6072.0 6876.0 bavcbave6764.0 bavctljfc -348.0 1r 1ras 7560.0 13435.0 13439.0 tljfc 13508.0 5104.0 13468.0 13516.0 5492.0 -8.0 13676.0 4 4736.0 13764.0 44 13740.0 Our Otir13735.0 booklet hooklethooklatHow 6332.0 13744.0 106156.0 13723.0 Make MAleebtakeGood GoodThlns Goodto 13840.0 2 13864.0 Kat Jlat848.0 13859.0 tcllilells13883.0 6844.0 6828.0 13852.0 1Iuo 1eta Thlncs Thlnslo 10to13895.0 6336.0 13880.0 ways jr 7384.0 13900.0 m 6972.0 muio 7496.0 13959.0 14016.0 eta uiouo13983.0 beel13988.0 lIee 5412.0 13992.0 exlractexlracl5364.0 13980.0 13971.0 ylvci Ivel hcsrrcliri uclllrireclprl13967.0 ror7016.0 forIunchel rorIunchal 13995.0 mS 7540.0 14107.0 lunchoi IunchalIunchel5440.0 14136.0 am 14100.0 11111114103.0 Urn Iho1110chafing cllanuclunuf 6432.0 dish diihdlh6936.0 14084.0 Stud Scud6752.0 SJ 14079.0 ttyour 7660.0 Irour 14203.0 14208.0 14255.0 your rour14215.0 address ftddreuaddreu14224.0 lor forll IIIt5876.0 14252.0 1rLlCBY 7564.0 H HUCBY 7500.0 4640.0 14400.0 LICIT UCBYLlCBY4788.0 McNtILL UcNIllLt1cNrILL14456.0 14451.0 tIDBY LlDBYLIDSY6484.0 tIDBYt LlDBYelllcgo 14491.0 14639.0 14723.0 Chicago elllcgoChlcaqo1008.0 ChicagorD elllcgoi ChlcaqoD 14844.0 14864.0 iDROPSY 15283.0 15307.0 rD 15288.0 DCV 15295.0 NEW 5984.0 1200.0 NEWDlscoVtRY NEWDlscoVtRYflillok -1200.0 DISCOVERY 15324.0 rqulok 15328.0 +7436.0 sL -52.0 Y DROPSY 15316.0 D -1444.0 15400.0 4784.0 ixV 4652.0 R 5036.0 15443.0 P 5376.0 15291.0 5628.0 5 5856.0 15407.0 15412.0 qnlak flillokqulok6384.0 rll rllel lh1 15403.0 6960.0 15431.0 eur 6916.0 eu curoa 7080.0 7316.0 15419.0 flirt wuriiwum7256.0 wuriira wumCa 7340.0 flirtea 4532.0 15512.0 15572.0 ra eaCa 4708.0 15576.0 4936.0 15548.0 lloox 110015536.0 llooaof 5216.0 15563.0 5360.0 5324.0 teituuonlaU tetononllIIUllonll 6084.0 6124.0 15515.0 nnU 15543.0 n1 Idnr 15520.0 ilnyitirnatmaii 6580.0 ilnyitirnatmaiilrrr -968.0 uul uulIrrr Irab11n Irab11nl 15627.0 15660.0 lrrr Irrr4856.0 15679.0 rre 5028.0 15663.0 Ir lIrDrII115160.0 B Hs15639.0 OKCKNIIOHI allICOICIUtLN110N1Box DosLox6448.0 II1115632.0 AtUaU ATSaalb15636.0 Unl 7396.0 7432.0 o1 o1i O0S OJSE 15911.0 15951.0 15956.0 JSE 4672.0 16016.0 3E 15944.0 CERTAIN 15920.0 16035.0 cut -472.0 6548.0 876.0 lIGUREli lIGUREliAlc -876.0 15916.0 CURE CUREANi CUE25 -596.0 CUE253E -800.0 4504.0 16223.0 16400.0 Alc Mention 16328.0 iion 5144.0 16395.0 aper ilnper16388.0 16407.0 iCr 6296.0 16524.0 ANi 16512.0 UWIWIltn afUIWLu11tr16392.0 Iltv1U -712.0 iwiuin 6816.0 nrhrrtsels nrhrrtselsafUIWLu11tr 7544.0 ellf xmlns:ns4 ID18 4096 3004 7804 2152 ns4:type 2320.0 First Pint8868.0 Lo 8784.0 Lolso 9016.0 9112.0 5o 9236.0 9180.0 9432.0 9508.0 9608.0 nc 9676.0 ness nen9900.0 nessIt 10092.0 -132.0 10052.0 10000.0 sIf 10752.0 If8260.0 n8152.0 8456.0 8344.0 8840.0 tall talk8724.0 tal 9108.0 9084.0 9024.0 ilblj lIbUllbl 9668.0 9780.0 9876.0 9948.0 10064.0 IB Is1s10276.0 given Rivenglt1110172.0 Rivenher 10684.0 givenher 10764.0 Ihor 10780.0 7856.0 hor8216.0 first nrst8108.0 8624.0 lesaous leseous8528.0 9144.0 8852.0 IIout 8664.0 9456.0 jai 9140.0 lA -204.0 9660.0 Iar 9592.0 9656.0 9768.0 ss BS10008.0 10280.0 being bolllgbeingsent 7852.0 sent 7940.0 ent 8180.0 8240.0 8472.0 thejmrlir IlIulr8712.0 parlirr 9368.0 9488.0 til 9416.0 9552.0 AI 9664.0 9640.0 9744.0 o9860.0 thecom corn10164.0 compnny 10616.0 cornparty 10760.0 pnny party8452.0 while wblluwhllo8224.0 lu ht8864.0 14th 9440.0 Li 9812.0 nnd and10204.0 sisters IIIDterssioters10084.0 sistersdish 10688.0 IIIDtersdIsh siotersdish 8172.0 3244.0 upAtchlu upAtclll8448.0 Atchl -544.0 9208.0 ur w9252.0 9428.0 jfol 9464.0 jfolTim 9620.0 -40.0 1TIIn 8580.0 Tim 1110TIInTII 8892.0 TIITo 9188.0 9000.0 tIIhl Irut9748.0 rat ratTo 9960.0 9828.0 3660.0 mTo 9964.0 7984.0 8256.0 nthotiKhtfil athought8160.0 nthotiKhtfilis -868.0 9124.0 8384.0 tholl 8336.0 hlf 8696.0 9048.0 9096.0 9420.0 treatrmblom 9540.0 9772.0 Irlllli -932.0 10704.0 10152.0 rrClhlom 10088.0 7836.0 7996.0 one7948.0 8296.0 ot8500.0 Borlom 8orhmsortouc8444.0 9060.0 9008.0 igrappled 9088.0 9064.0 9164.0 list uisttrill10104.0 lio brr10020.0 10108.0 10248.0 10304.0 Manly ilnnlyilnnlyiion 10308.0 IIrrnl -396.0 1272.0 grappled RrlppllC18520.0 trail8464.0 8648.0 lLh 8824.0 8932.0 frfurforforo 1184.0 9472.0 4112.0 Ip 9624.0 9716.0 Hlnuln9988.0 4119.0 Hoiioty nioty9940.0 10016.0 IlIltlt 10452.0 hu lIuho10368.0 huMciuK 10656.0 foro tore4224.0 8476.0 ato8572.0 ro 8700.0 8804.0 nvar nWllrnwarIti In9196.0 9764.0 MciuK 1IIeJllllletenen9572.0 IIIIb10460.0 4255.0 Ihls10392.0 thisnd 10708.0 7832.0 respect 8436.0 Inuoh8332.0 8920.0 4379.0 8924.0 rl 9020.0 4420.0 age 4404.0 UhlU4 vnrtouu9792.0 10464.0 4400.0 this10360.0 4484.0 4492.0 orders 8376.0 wlJlIh whieh8272.0 8904.0 II1It nttn8800.0 IIIhh imth10160.0 acis 10396.0 10468.0 1228.0 u a10576.0 1044.0 aconstipation I10nltlraUon 10696.0 constipation 10nltlraUon8928.0 10Ih ludt8692.0 9436.0 4724.0 Ion ea4680.0 IYIf11I111 trhepelu4716.0 RIII 10332.0 RIII1I1II01111n088 4684.0 nut 4775.0 776.0 1I1II01111n088 blllousnolsJto host 9128.0 9156.0 9396.0 4864.0 9204.0 4872.0 s4824.0 anah 9740.0 9972.0 10068.0 10264.0 BltlfII ltlttenBltlfIIwill 10712.0 ltlttenvill 10680.0 7816.0 4920.0 vill8136.0 outs ourD8072.0 4923.0 11Ih stlr119476.0 4960.0 nd 1111nth10024.0 l9912.0 rnvrnt revrnt10056.0 4968.0 runlIllu 10528.0 runlIlluftrlppu 10592.0 laluuo lato ftrlppu -456.0 7976.0 givo 7944.0 8368.0 8424.0 mnlntll1 8536.0 trial HUt fuo9136.0 9844.0 uo 10180.0 Do Illl1o10416.0 HUM lIuruauto10348.0 HUMllUllim autoThe KiVu 8516.0 a8468.0 5208.0 trhd 8948.0 ITht 10804.0 8656.0 ThtArne ArllP8952.0 9816.0 9848.0 llUllim -624.0 8120.0 eto 8068.0 flIRt that8328.0 tllII tun8760.0 8960.0 9012.0 rllO reo8796.0 9412.0 5672.0 ie 5684.0 9524.0 tan lIliaId10028.0 Ii 10200.0 10336.0 10424.0 5660.0 hten 10312.0 htentnttntyebvtu 10728.0 10428.0 7808.0 5740.0 5744.0 lirtuitriiovpn tnttntyebvtutUtlnlrIt -856.0 8600.0 8356.0 8720.0 ilnnttoh Ihllltlllldenttet9ilnnttohTlmfa Ihllltllll1IItl denttet9Tllata 5868.0 Tlmfa 1IItlTllata8488.0 IIaRooiJ 8552.0 gout 10018916.0 tlili lllttt9864.0 ken 9796.0 10012.0 10080.0 0of 10208.0 till thr10120.0 10436.0 Qon 10560.0 Qonof 11of 7804.0 6000.0 7980.0 6020.0 war wnr7932.0 8168.0 ITS8496.0 comlliloii llIllIlIoneoutlllon9392.0 wl 9824.0 6048.0 9880.0 9856.0 9840.0 9904.0 6040.0 +9932.0 10060.0 otii u1I110184.0 M tllto10232.0 thetillhlllt 10724.0 thebeet 7812.0 6132.0 hlllt beet8148.0 uhntnltI 8432.0 ntnalt 8820.0 xmlns:ns5 ID20 3924 3164 10848 2116 ns5:type 12504.0 Rrst 12572.0 12656.0 fjit rlt12856.0 12948.0 meat utrcttItlrnt13368.0 2224.0 cure cluesure13704.0 torAlt13640.0 fortroublri 11012.0 Dr Drr11544.0 Bull BuII12292.0 12164.0 12500.0 12448.0 12752.0 throat tlltOAt12644.0 13228.0 13128.0 13592.0 lung lUDIClUDICtroubln lungtroubles 12496.0 troubles troublritroubln13064.0 people Icoplceople13464.0 13500.0 praise pralieprUle13096.0 praliefftllfvll prUleC praiseCough 11004.0 fftllfvll 11932.0 vriinl 11676.0 12528.0 Hoctoi 1I0cto12888.0 t05 13040.0 13144.0 pre 13108.0 ptuctlhe 13340.0 13416.0 cnbe 13708.0 IIQlII 13820.0 13792.0 820.0 t05tpefethte 11140.0 tpefethte tpefethtekeuselubltttulet Cough 011g1111008.0 UOllgll 1056.0 11792.0 OyrilQk Syrup Syrll-1056.0 12848.0 12332.0 2604.0 Vin Vint05 QlII -608.0 13012.0 mue 12692.0 13036.0 IIH 13284.0 triulli trllllll13200.0 triulliUefuiekubitUutes trllllllri UefuiekubitUutes keuselubltttulet11924.0 IC 12084.0 12192.0 Gel 12020.0 12440.0 briutialouyhsyrup 12400.0 briutialouyhsyrupA6ITs -1388.0 13828.0 992.0 12444.0 UrButhCoush -1384.0 13436.0 SyrupBooker 11092.0 ri 11248.0 eNIITbSIIt EeNIITbSIIt11224.0 12156.0 AGCNt 11808.0 1JTrE -4.0 1JTrEIIDI1 12756.0 IIDI1 12908.0 13252.0 13292.0 10852.0 Au 956.0 A6ITs 11216.0 E 11384.0 NIYANTCD 11360.0 12012.0 -892.0 12904.0 13020.0 1itii 12100.0 1itiiBooker 13652.0 13092.0 hl1 13432.0 13384.0 13712.0 13472.0 IBooker 14012.0 11108.0 Booker T 11904.0 Washington Wnshington12152.0 WashingtonWritten WashingtonSVtlttru13776.0 10848.0 Written SVtlttru10996.0 3704.0 rlltln 11348.0 11408.0 liy by11556.0 11640.0 lilmaelt hllllllOUhltneelf11472.0 MvoryUily livrrtdy12120.0 lIfIMhl 13004.0 13056.0 buys luijr12920.0 tlllilo 13352.0 13492.0 nuniM ngrntt13356.0 nuniMarc 13932.0 111111ft 13636.0 ngrntterr 11fterr11100.0 umr11396.0 mnkliiK nking11164.0 IlInllll 11868.0 11784.0 11912.0 otrr olrnrrr11496.0 12244.0 Nish 12196.0 liM 12464.0 llIl11lIr 12548.0 per tr12764.0 12812.0 month Inunlltuititit13320.0 ln 13212.0 hrt 13420.0 13536.0 13572.0 13568.0 13660.0 Ik 13732.0 Ikii 13920.0 13816.0 IK IKlotted lk lkItl 13996.0 Ilur lotted Itl 11220.0 ii10968.0 tOiiilorrd -620.0 11888.0 11416.0 trl 11524.0 1llrllt 11592.0 11884.0 11680.0 rrd 11668.0 11936.0 pi 11880.0 11940.0 1IIIIIIIu peaplt12056.0 12048.0 12088.0 oplo 4.0 12416.0 flr errr12372.0 vor pulnltKil 12708.0 pub 13392.0 lhrd 12996.0 13560.0 iii13656.0 rlllor 13856.0 iiiIar 4072.0 lurIar11076.0 4080.0 itTins IMIIIUruI11028.0 11532.0 ur11444.0 11608.0 11660.0 11704.0 11656.0 11708.0 itnil 11111111 11996.0 11968.0 12060.0 JI 12128.0 12200.0 10111111114 12544.0 12632.0 rurfar12872.0 outilt IIIIIIUut11it13172.0 13216.0 13264.0 iiiul 111111rindlircln hl11I13504.0 lirclnAtoiifi 13924.0 hl11Int 13728.0 iZlIt iZlItsit Atoiifi nt sit11272.0 11016.0 burr tllIl10972.0 IUHKII Ilaaet11304.0 lIItIItIIIlInllm iniiitlin 12476.0 12068.0 rttItn 12532.0 tliU lhlw12472.0 12772.0 4192.0 JIAJMT lIIIIrpapa12696.0 Ailifi 51tri13236.0 13444.0 51triJ 13772.0 13512.0 ItIII18 ItIII18J 13780.0 13884.0 13800.0 sJL JL 11200.0 11064.0 E10924.0 11284.0 NICHOLS 11144.0 NICi -664.0 OIS 11588.0 12228.0 CO 12580.0 Atlanta tlnllll13296.0 icorgia ticurgin13140.0 ticurgini 13348.0 icorgiaWITH leorgt nen 13784.0 nenFREE 13928.0 11492.0 980.0 fREE 12584.0 WITH 13044.0 ETS 12788.0 ETSIII -192.0 572.0 SEEDS SEEDSNO -572.0 10920.0 12596.0 NO 1156.0 11440.0 MOHET MONIT12720.0 13256.0 HIOUIREO NIQUTAIO13152.0 13260.0 HIOUIREOWh 11624.0 5164.0 5171.0 11688.0 11900.0 12008.0 undu 12160.0 12468.0 Go edvrblaartchoire 12652.0 edvrblaartchoirereietbl 12744.0 JII -1040.0 12860.0 13424.0 choir 13400.0 choirIaltl 11620.0 reietbl Ialtl 12328.0 FerJe 12412.0 12540.0 12456.0 12564.0 12600.0 Oilml13028.0 conilifniiiml eOlulltnnlenlcondgnlneu612912.0 conilifniiimlo eOlulltnnlenlIin-756.0 condgnlneu611hnyurkarookttbmyotscantnYn 11600.0 Wh 11hnyurkarookttbmyotscantnYn 11776.0 11hnyurkarookttbmyotscantnYnQtd -2184.0 11724.0 Iin -2060.0 11856.0 11920.0 11952.0 12080.0 12076.0 12404.0 5396.0 12392.0 oM 011112460.0 12808.0 lie 12924.0 13060.0 13032.0 13272.0 13304.0 c 13440.0 13360.0 13540.0 tili tilii 13756.0 Ui UiJ 10960.0 11252.0 ut 5496.0 11372.0 12408.0 12436.0 IItnll 12688.0 13612.0 1a 13632.0 10944.0 5604.0 Qtd 11192.0 nhh erhbI11152.0 11716.0 tIM CIN12036.0 12096.0 P1I 12624.0 iu 5579.0 1roUl 12760.0 rUI 13336.0 13380.0 1a1 13408.0 13484.0 13576.0 aft 13544.0 aftw 13696.0 151 151rid 13788.0 10964.0 rid 11072.0 11112.0 11156.0 11116.0 5708.0 w1UI 11312.0 fttwuJ twud5703.0 rw 11876.0 11908.0 5691.0 N4te 11720.0 12340.0 4i 11988.0 W 12136.0 V 12344.0 biSi 12508.0 12784.0 1112672.0 llT 11020.0 11188.0 oJ11380.0 5815.0 KINO lusnIUNO11800.0 11744.0 Hrrdimrn Aedaen12352.0 llllIfn 12724.0 12852.0 Richmond IllrhmondItlthun4Ya 13460.0 Ya1W 13736.0 13580.0 VtVA 13664.0 11292.0 tVA 1W11560.0 11508.0 Arolltftlotb 11448.0 llffcUV 12144.0 -432.0 clI 11896.0 12256.0 rr1 tor 12312.0 5963.0 12364.0 5951.0 12360.0 I12636.0 12616.0 12792.0 ICOilM 13288.0 fro 12980.0 12932.0 13240.0 Cu 13300.0 13388.0 xmlns:ns6 ID25 3824 2672 14356 2156 ns6:type 15256.0 lumr 15919.0 wrsawtl 15620.0 wrsawtl15O 16480.0 15232.0 15O 15356.0 15924.0 CSI 16140.0 g 16200.0 16260.0 NDS NDSFor 16836.0 N 16472.0 Dv 16424.0 DvFor 15056.0 15680.0 15556.0 16151.0 Cents 15768.0 14888.0 1036.0 tutrrretnrU 14932.0 15228.0 15652.0 Iarl 15336.0 r01l 15852.0 16036.0 nattorlCOpLt 16159.0 16640.0 CkQI 16792.0 CkQItllI 16840.0 16952.0 14480.0 14868.0 tllI 14520.0 etl 15040.0 15060.0 totufL 14996.0 IUr 15472.0 15584.0 trI 15380.0 15831.0 rrei rreiE 16244.0 16264.0 16380.0 rII 16364.0 16900.0 v 16616.0 vI 16964.0 14872.0 rrow 14900.0 2960.0 15092.0 15132.0 14928.0 15436.0 nn 15196.0 15496.0 nnor1wch111Jvabaaun 15564.0 nnor1wch111Jvabaaunwe -1500.0 16996.0 15608.0 15828.0 hlu 15732.0 11ItObA 16156.0 16844.0 tIl 16764.0 tIlw 16992.0 14876.0 15096.0 wish 15192.0 lth 15348.0 15488.0 vnU 15748.0 15796.0 sisal 15656.0 15863.0 lOrn 16007.0 16143.0 In16079.0 16308.0 16484.0 16584.0 lfuillC 3055.0 IA 17020.0 16772.0 16680.0 14596.0 1pemJ 14652.0 15320.0 bd1aacthlunlc 15280.0 tlllllltc -1240.0 16564.0 Ihlt 15836.0 16180.0 unccIlittcl unccIlittclolf 17024.0 16632.0 d11 16888.0 de 14856.0 3232.0 14860.0 olf 14920.0 15016.0 15004.0 15160.0 15124.0 fur 15264.0 15360.0 ldrutsltatpudol 15460.0 15492.0 -980.0 IICNllpaid 15668.0 16360.0 16320.0 otJIllolnlr 2000.0 JIllolnlr 3340.0 eo 15048.0 kind 15008.0 15480.0 F 15296.0 arnl rareI15967.0 iiel 15927.0 16208.0 16232.0 16324.0 16236.0 radlAh radtrh16376.0 14356.0 14388.0 lamnle 15292.0 nl Iv 15392.0 IvIlia 16560.0 Ilia tdaI 15068.0 1000.0 alrlnrlmarr 15240.0 alrlnrlmarrsa -1000.0 16196.0 rrlt 14852.0 sa rIe4 15000.0 15260.0 rlt 15524.0 ltlu 15780.0 16119.0 nrletrn nrletrnIplenlll 11I 16348.0 Iplenlll 14924.0 phnI 14984.0 15568.0 15448.0 bet 15628.0 orl 15812.0 orlE6 E6 15728.0 IIr 16316.0 16904.0 otI 16956.0 14896.0 15028.0 ill 15076.0 15140.0 15168.0 Lulld1g115ndUantt 15304.0 15432.0 -1152.0 15876.0 15588.0 16148.0 16852.0 16312.0 ridHIIf 14792.0 HIIf 14960.0 lItal 15184.0 15544.0 arIt 16020.0 16164.0 hq 16111.0 16420.0 lib tab16304.0 librl 16544.0 16580.0 16696.0 tMl 16724.0 tMlIIS1In11 17016.0 2220.0 14800.0 IIS1In11 rIM 15592.0 15640.0 u1 15428.0 15776.0 15807.0 15847.0 16068.0 16132.0 16356.0 16192.0 16552.0 16556.0 16628.0 16728.0 QI QIt 14948.0 tints 15664.0 lieu 15860.0 Iu iD16052.0 16488.0 16596.0 rulle 16516.0 rulleI 17000.0 14832.0 vu 15272.0 e9d Ihl Ihb 15975.0 hd 15855.0 16184.0 11IIf 16344.0 16960.0 a14936.0 fo 15044.0 4408.0 15112.0 15332.0 4416.0 eurd 15468.0 15600.0 twmp 4412.0 UJ 16296.0 Ul 16444.0 nlll will15024.0 Cnl 15172.0 15616.0 4512.0 111111 dln15268.0 15879.0 4520.0 IM it16300.0 16676.0 16600.0 Iplonor 16700.0 wInlr plonor Inlr 15384.0 15528.0 tt1 15996.0 15940.0 16055.0 I1 16240.0 IY 16272.0 16664.0 16644.0 rL 16708.0 rJOHN 16668.0 itDim 16756.0 Dim JOHN15440.0 916.0 AUALICRS SALzan -724.0 16404.0 IEED 16520.0 EOCO 16716.0 EOCOOrone COLn 1064.0 Ln 4844.0 Ora Orone 16416.0 Will WleWleIO 16672.0 15991.0 14772.0 IO Att 15084.0 15744.0 IItot 14504.0 Itot loU 14756.0 tit 15012.0 15208.0 Cytup Tate1 15552.0 16100.0 t1INMI 16532.0 hw hwIn 16744.0 1568.0 14788.0 rime 15364.0 14Nd br 15815.0 druc 16167.0 16084.0 Inao ao xmlns:ns7 ID26 9864 9948 6764 ns7:type 8084.0 COFFEE 9832.0 1052.0 LUXURY WITHIN 11000.0 8428.0 THE REACH 12916.0 14180.0 OF 14692.0 ALL 14572.0 ALLratch ALLIf ALLI8292.0 8832.0 8876.0 11864.0 J14 8340.0 14288.0 9036.0 14588.0 14443.0 9068.0 went 15839.0 buy 15740.0 9092.0 lion lionwhelp 16812.0 liont 16796.0 10296.0 9291.0 9300.0 10400.0 13888.0 9303.0 whelp 12732.0 14564.0 14419.0 14676.0 ou 14880.0 768.0 wouldnt accept 15823.0 akitten 16820.0 9520.0 9644.0 kitten 9800.0 14555.0 14416.0 a14740.0 15088.0 substitute 14964.0 16127.0 16688.0 16548.0 ifthe 16824.0 iftho 9799.0 9936.0 9868.0 9120.0 13896.0 tho14280.0 dealer 14172.0 9823.0 urges Uges14820.0 9820.0 15416.0 youNow youI 9976.0 10076.0 10219.0 10168.0 9492.0 14300.0 Now dont 14708.0 accopt16023.0 substi 11332.0 10384.0 10367.0 tute 14360.0 10343.0 14256.0 forLION 14632.0 forti 8912.0 10524.0 10588.0 ti 12944.0 10660.0 vJr 8588.0 10792.0 10928.0 Jr 11520.0 10832.0 14272.0 10800.0 LION 11672.0 1152.0 14976.0 COFFEEIt COFFEEj8228.0 11320.0 8676.0 11392.0 13916.0 1092.0 14184.0 11419.0 14076.0 14411.0 11412.0 bound Dound14324.0 15080.0 11436.0 15352.0 11431.0 turn 15244.0 16212.0 n16408.0 11452.0 colncommon 16760.0 colnJj 16788.0 11667.0 Jj 11696.0 8848.0 13912.0 mon non9648.0 yellow vcl10wcat 15376.0 16103.0 none nononano16536.0 ofthe oft ofa 10808.0 11879.0 11356.0 10872.0 14268.0 11903.0 strength 14196.0 11927.0 st 14515.0 ongth 15276.0 11891.0 lionYou 16004.0 15684.0 lionetch 15999.0 8100.0 9788.0 12163.0 12175.0 etch ratch12204.0 next 10556.0 11040.0 advortlooment advortleomentadvortleomentYou 12280.0 9544.0 12595.0 want vant12512.0 ION 12492.0 COIEFEE10488.0 888.0 bccnuse12547.0 1t13232.0 13616.0 13976.0 15072.0 COFFEEI COFFEEIfbnCOFFEEIfCOFFEEIfon-1488.0 16752.0 COFFEEr 8000.0 17667.0 7888.0 17752.0 Ifbn Ifon9104.0 8888.0 12972.0 09684.0 13039.0 er 10144.0 hand hnndr 10564.0 handyou 10700.0 13027.0 11032.0 11136.0 13000.0 Q11568.0 coffee coffeocoffco11732.0 inordcr 12892.0 order ooder13204.0 hide Vida14032.0 imperfections 16284.0 highly highlyipolishcdj -568.0 highlylp highlylpolishcd ipolishcdj lpolishcdlp -896.0 9044.0 8404.0 lisqcd a13248.0 hjs gs 9980.0 rmd10432.0 10364.0 1108.0 13215.0 prnpnratJono prnparationa10900.0 prnpnr -1108.0 12072.0 tiono 11548.0 12212.0 13220.0 then 13224.0 12876.0 13203.0 buy3NT buyt buyxjcT 15887.0 13451.0 txjcT 10952.0 3NT N11636.0 IDOIFIF11 11956.0 -2356.0 14312.0 COFFEEW -3576.0 1080.0 tifei -1076.0 tifeiveru -1080.0 9176.0 14040.0 10624.0 9256.0 1Lt 10648.0 8176.0 14019.0 14112.0 Lt 14043.0 8348.0 10504.0 wcru 9444.0 10508.0 14148.0 10936.0 10572.0 14160.0 veru 10652.0 10768.0 re 10940.0 14128.0 commonfordinary commonordinary10888.0 14167.0 -1640.0 12684.0 ordinary 11780.0 14143.0 stuff sluff12680.0 13316.0 coftco13192.0 drinkers 13844.0 14744.0 14119.0 Vouldnt14668.0 insist 15516.0 14155.0 hay havhnvhavA hnvillions haying 14267.0 14339.0 ing 14320.0 8936.0 14284.0 9384.0 14315.0 9320.0 iq 14348.0 illions 9992.0 10892.0 14363.0 10820.0 11168.0 14367.0 homes 11840.0 14379.0 becauso11736.0 12588.0 14384.0 12516.0 14391.0 13328.0 14376.0 13908.0 14760.0 14656.0 15508.0 world 15404.0 14351.0 16496.0 theis 16876.0 theprice 8184.0 8896.0 14539.0 8632.0 14568.0 9076.0 doub 14556.0 9944.0 14599.0 take a14608.0 single Gingle712.0 14627.0 packnge packagoborne home14644.0 try 13428.0 itION 13984.0 10620.0 15011.0 JON1140.0 15023.0 11208.0 15047.0 Vml1mlaIuttfi1i 13344.0 13488.0 15031.0 Ilnd Sind-1332.0 13936.0 15100.0 13836.0 15035.0 14056.0 Iuiiy 14212.0 tr 14560.0 852.0 iiitattMe4 illasltttted15064.0 tAttdan 15504.0 tAttdanl -748.0 15704.0 nlivt ni 16108.0 t5clptk 15943.0 t5clptklist 16828.0 8144.0 15204.0 15224.0 livt8280.0 15248.0 8192.0 15219.0 No 15216.0 housekeeper housekccperhousekccp8900.0 9872.0 15243.0 15231.0 10380.0 10316.0 10824.0 15279.0 mJn11756.0 12384.0 boy 12252.0 12800.0 Of13088.0 tftliitl13372.0 fall faUfail13808.0 14200.0 find 14464.0 15236.0 14904.0 15903.0 samearticle 16336.0 articlewhich 16928.0 8140.0 15424.0 8764.0 15427.0 contribute 15484.0 con i6ute 10128.0 10404.0 10300.0 happiness bappinca10816.0 11860.0 comfort i1nd12524.0 1040.0 convenience 14164.0 14044.0 14475.0 14580.0 wbich15200.0 15688.0 16175.0 bave16071.0 bysimply 16916.0 8792.0 15624.0 simply cutting 8688.0 9500.0 15648.0 15687.0 OU 9784.0 9696.0 10072.0 certain certltln10772.0 numbcr 11540.0 Lion 11712.0 12300.0 Heads 12844.0 15696.0 wrappers wrappctS14600.0 15691.0 pound sealed SCi1IccJscaled16268.0 sealedpackagefi 16912.0 SCi1IccJpacka scaledpac 15811.0 packagefi packa 8908.0 pac 8544.0 15884.0 ages 8408.0 u4whtch 15835.0 tSl 9952.0 tbe10236.0 10828.0 15827.0 tn tbb12660.0 excellent ctccllcnt14108.0 15851.0 b15832.0 sold 14240.0 soldWOOLSON 14648.0 soldWOOUON soldWOOUOi4 WOOLSON WOOUONWOOUOi4SPIC2 14956.0 IPIC 15420.0 PIC 15476.0 TOLDDO TOLEDO16075.0 01110 OHIO16372.0 16500.0 xmlns:ns8 ID31 9196 9000 4620 17123 ns8:type 17123.0 Fight 17208.0 10044.0 17135.0 10356.0 17132.0 wealth 11564.0 17127.0 old 12052.0 Money Bagsyour 12740.0 12816.0 Bags Baps-488.0 Bapsyour 9264.0 17368.0 17440.0 17380.0 liver 17392.0 10216.0 17375.0 drying 10456.0 11336.0 17452.0 11692.0 11584.0 12172.0 bowels 12044.0 12928.0 17435.0 wear wearrwearing wearrin 17604.0 17795.0 17631.0 6472.0 17647.0 17688.0 17616.0 11256.0 17691.0 11700.0 17612.0 17683.0 12576.0 aloud 13208.0 forhealth 9268.0 17848.0 health 7208.0 732.0 17855.0 offering 10896.0 17860.0 aU10776.0 11244.0 17936.0 11128.0 11376.0 11844.0 17852.0 youwill youviII 7860.0 18096.0 18208.0 9260.0 viII7936.0 9680.0 18132.0 10412.0 18120.0 10344.0 10536.0 11420.0 18175.0 11364.0 neglected 11788.0 neglect 12728.0 sit 12208.0 lected cd Nature Naturein Naturet-672.0 7524.0 18220.0 18351.0 18408.0 18339.0 mad 10596.0 18347.0 rush 10520.0 18380.0 11404.0 11300.0 11768.0 gold 11772.0 18344.0 12168.0 18372.0 matterwhat matter -604.0 18571.0 18652.0 9756.0 18583.0 18659.0 11084.0 18587.0 ails 18656.0 12648.0 18580.0 today 18592.0 iswatch isthe 18788.0 18912.0 1160.0 18816.0 1128.0 dayevery daevery18823.0 10796.0 18847.0 11288.0 18828.0 11576.0 12132.0 dayto 12248.0 ayto 12896.0 keepwatch keepI 19100.0 watch 19060.0 9852.0 860.0 19067.0 Natures 10148.0 19107.0 wants 19072.0 wantsand 12560.0 help mp 13016.0 19127.0 yourt yourayourbowels 7864.0 19296.0 19487.0 7988.0 19355.0 8304.0 19300.0 10040.0 19343.0 act 10448.0 regularly regularlyCASCARETS CASCARETS -1416.0 willt 13100.0 13448.0 willj 13452.0 willhelp 19523.0 19575.0 19539.0 8640.0 10496.0 19547.0 19632.0 11648.0 19556.0 Neglect 19535.0 bile biler bilein 4956.0 19780.0 19859.0 19799.0 9512.0 19783.0 blood 9808.0 19787.0 foul foutbreath 10948.0 11820.0 awful pains 12840.0 painsin painsr7848.0 20019.0 20067.0 20040.0 20023.0 10568.0 20035.0 10884.0 head 11180.0 11752.0 20100.0 loathing loathingand 20260.0 20367.0 8484.0 20264.0 9600.0 20267.0 feeling 20276.0 10732.0 20283.0 aU11124.0 20291.0 12380.0 lifei lifeDont lifeI0 20503.0 20667.0 20508.0 I0 8380.0 1548.0 9248.0 20512.0 10260.0 20520.0 rich 20591.0 11260.0 11580.0 20584.0 12116.0 youcant 20739.0 20780.0 9700.0 well 10036.0 20759.0 10600.0 10956.0 20835.0 20763.0 bowel 12736.0 trouble troubleyou 7992.0 20987.0 21056.0 9604.0 20992.0 10048.0 21051.0 regular 10388.0 20999.0 11572.0 21071.0 CASCA CASCARETSpk 13364.0 CASCARETSget CASCAr 21216.0 21319.0 RETSget RETSpktotof 21228.0 todayCASCARETS todayCASCARETSin -2276.0 13244.0 -1412.0 CASCARETSin 21464.0 21479.0 9504.0 21471.0 metal 10032.0 10612.0 smaIl11184.0 21495.0 11628.0 JOc Oc 21476.0 whole months month12620.0 monthstreatment 21536.0 streatment 21527.0 9244.0 21739.0 treatment 5552.0 21731.0 50q SOc 21727.0 10548.0 21803.0 21755.0 eat 11848.0 21715.0 like Iikt21712.0 candy andit 21944.0 22103.0 21959.0 wiII9956.0 21968.0 gently 10492.0 21963.0 22027.0 12484.0 21956.0 sleep 12336.0 Itcures 22192.0 22259.0 cures 22275.0 1088.0 11400.0 22195.0 strengthens 12488.0 12968.0 22251.0 mus muscular 22295.0 22416.0 cular 22431.0 walls waIIs6616.0 22455.0 gives 7796.0 8440.0 8996.0 22499.0 22428.0 HIelife9408.0 9924.0 22443.0 22483.0 22447.0 11236.0 natural naturally -688.0 22531.0 22664.0 22676.0 5284.0 22671.0 22695.0 22667.0 5884.0 22748.0 22715.0 wantit 7484.0 7728.0 7924.0 22703.0 1048.0 guaranteed 8076.0 9280.0 9528.0 found fn10372.0 inTHE 10644.0 fnThI 23172.0 23175.0 ThI 1120.0 TONIC LAXATIVE LAXATIVEMPM LAXATIVEJOc-1900.0 LAX -1896.0 23184.0 ATIVI ATIVIf -992.0 23983.0 MPM MPMi MPMJOc 24119.0 24535.0 24595.0 rLIVER 25159.0 25183.0 LIVER T01NIG8944.0 T01NIGFOR -1292.0 TONIClOc -1296.0 10472.0 25551.0 lOcJOc25c lOc25c 8540.0 25791.0 25807.0 25c 50c sOc50cALL 25803.0 FOR 25827.0 NEVER NEVERSOLD 13164.0 NEVERALL 26095.0 26164.0 1004.0 26155.0 DRUGGISTS DRUGGJS1S11796.0 26111.0 SOLD 12552.0 26107.0 IN BULK 12820.0 xmlns:ns9 ID35 3276 4284 4888 26551 ns9:type 26551.0 all26555.0 bOYel26563.0 tronbletronlal884.0 26567.0 onrriidlcltl aplnlclllappendtcltt8708.0 26560.0 bll b1blllotiaaeM bll10nBeu b1lotlaneai 26571.0 5124.0 26684.0 lotiaaeM 10nBeulotlaneaitad bdbad7024.0 26691.0 brent breatt7132.0 reth 26660.0 bud bdbad8040.0 lIood7964.0 8576.0 26679.0 wind wludwindon wludonllId llIdon 26803.0 26827.0 tlio26808.0 utomaeh aComeatomack26811.0 blunted blontcdIIlonC laoel8232.0 rel Illulfuulfuulmouth 8668.0 foulmoutli Illulmoucb 26923.0 mouth moutlimoucb744.0 headache 6968.0 26956.0 26935.0 Inds 26932.0 Indlzeatlon IndllletloB7764.0 etlon 26927.0 pimple plmplriplmplriConillpaitlon pimplepln pimplepatnafter pln patnafter 5472.0 27044.0 fIreUncUur 27047.0 eating -956.0 6376.0 27051.0 Irouble7648.0 27056.0 110w908.0 eomplClxlou complexlou8012.0 eomplClxlouaad complexlouep-908.0 27159.0 aad ep27163.0 dizziness 5192.0 axlne Vhenyour 6212.0 Yhen 27187.0 roul 27171.0 bowelydotmove lIowel -1484.0 27175.0 donllI1oye 7516.0 8560.0 rcu rturcularJ rtulafly 27275.0 larJ lafly 27304.0 rou27311.0 ar 5852.0 27287.0 retUII tctttslq5932.0 27292.0 alek Iek 1012.0 7092.0 27299.0 Conillpaitlon ConUptlonContlpattonkill kllIa8104.0 mllrinure8532.0 morepeople mllrpeople inurepeople 27399.0 27403.0 than ibanIlianaUoilier oUlerother6200.0 27415.0 dlteaaes dludlseaea6728.0 7572.0 27419.0 together toicctherCoarCllerII8236.0 laUtarter ICreer 27435.0 astarter 27527.0 27535.0 tarter CreerstarterthoIhDchronic chronlecbronie27531.0 allmenta aUmenl27539.0 lone IoltglOll 27555.0 rears 8204.0 27559.0 Je 8772.0 8828.0 ofafferlnc ofBtIrlIIC ofurt 4976.0 27647.0 afferlnc BtIrlIICurt 27651.0 erlttg hat nlaCttst27675.0 come como27655.0 aflirmrards nlllnYarclaflerwarda27663.0 Mo 7448.0 7720.0 ro7884.0 7972.0 27667.0 maUrwht8504.0 whatlie 8984.0 whtU whata11 a11 5256.0 27791.0 JOu27779.0 start CarCtart27771.0 taking takincCklnr27775.0 CAHCAIIKT CflCAIUtnCASCAIIETS7800.0 todaftocl Tor8112.0 27795.0 JOu8972.0 JOuwill 27883.0 27911.0 eyer 27895.0 eel cctget27891.0 6552.0 27915.0 27899.0 7556.0 7704.0 Cis tlraemitll lmIUIUItamatltlltlraemitllJOB -768.0 8976.0 tamatltllyou lmIUIUIJOB 28011.0 28031.0 JOB you28019.0 pot pBtput5176.0 5568.0 ronr Jonrbowels28015.0 right rlcht6520.0 28023.0 Take rk 28043.0 nUladvice adYlce28027.0 afar afarith url urlwith Cr CrYUI 28127.0 YUI ithCAMCURETfl CAJaCRETIICASCARBTA28135.0 CodJbuday28144.0 under 28163.0 aa as28167.0 absolute aohale 28159.0 gar guar8492.0 garaBUe guarautetocureormoneyrelhaded 8660.0 111anC 28147.0 28259.0 autetocureormoneyrelhaded anC -2532.0 aBUe 5152.0 28263.0 28275.0 28279.0 JUan 6656.0 6712.0 reftmded refaRded6480.0 refaRdedI 28327.0 tip 9080.0 29699.0 ft 29755.0 29779.0 xmlns:ns10 ID36 1804 4112 9320 26543 ns10:type 26543.0 26548.0 TOC11ftEI 26667.0 CM 26663.0 12216.0 oldover FI FIbo 26651.0 26639.0 AC4a AC4aET AYCA1t AYCA1tlea 2080.0 GUARANTEED 26763.0 ET ZT26767.0 lea 26779.0 wu was26755.0 26743.0 row 26747.0 IL13072.0 26851.0 26887.0 11824.0 26867.0 alx 26859.0 rlllloa 12388.0 IIItOD wyear 26951.0 26991.0 26967.0 ecr reterlIa tys 26971.0 Jttla 13376.0 9328.0 27099.0 9448.0 27071.0 attar ttla9892.0 27075.0 rtdtfa 27083.0 10440.0 th lb27080.0 worlTIIa Tkl11480.0 12040.0 abelly 1032.0 abotatJJrt rof 13268.0 ofurC oftreat 27151.0 27180.0 treat merit 10244.0 aaA 10628.0 27211.0 10836.0 boat tttwoalal 11120.0 12112.0 Wa 12264.0 kavn 12396.0 aaa ru ruwill 27156.0 rallb 13156.0 13104.0 aadwill 27231.0 27283.0 9672.0 ail sill27279.0 Ca1M OAsc Jra iCrm11024.0 ablalely 27263.0 iaaranled 11748.0 27271.0 ear eacne7refYaded 13412.0 13332.0 tne 27363.0 acne7refYaded ne rd 10268.0 27395.0 bu boyldaytwoaOebOw 11096.0 led -1436.0 11964.0 27367.0 al alnaIl IVtbrw IVtbrwair 27471.0 27487.0 naIl air 9568.0 9688.0 27483.0 hol 10196.0 27491.0 Irlat 10340.0 27515.0 10840.0 27499.0 yrle1II dlhn dlriisae27476.0 adl ad 12768.0 12832.0 12868.0 ya 13168.0 9r 13112.0 9raotatladaQrmiaa 1ao 27612.0 27588.0 aotatladaQrmiaa -1360.0 27600.0 Jerlall 27591.0 bx rtaralbaupudG0r rtaralbaupudG0rbag -1404.0 27635.0 27695.0 bag 27679.0 9576.0 9708.0 27691.0 lb 27707.0 erly 27719.0 10608.0 lx 10240.0 Ite 10916.0 10976.0 27715.0 27731.0 27724.0 11368.0 rail 11536.0 11892.0 27688.0 bS druilcta drufyll27671.0 6w 6wwbrloa 13068.0 tro trowh wbrloa 9324.0 wh 27807.0 70 27815.0 pure 10376.0 27811.0 itrad 11308.0 11352.0 27827.0 ea oar11976.0 27783.0 rearybar 11928.0 oa ba11 12836.0 Itr NrNU btkNUbo btkbog bog 9560.0 Tesaradvtc -1088.0 11204.0 27907.0 aUer rwhat wla 27887.0 aUayentarsi yentarsimy etrB 13132.0 27975.0 my 27999.0 allk 10256.0 win 11111110212.0 Oalkl kI7 11160.0 28008.0 roUw rbllow11604.0 11816.0 27996.0 27987.0 yowlU 12032.0 oq 12224.0 bl 12900.0 27979.0 rta7Ie rta7 1a71a7eudrt 28079.0 28091.0 eudrt 28096.0 dIhuoCLVAKKra 28111.0 -1692.0 10912.0 ofCAOA 11596.0 altr 11011 1196.0 ltoktrebyra0 ltoktrebyra0ddreal -1196.0 28084.0 Ie 28207.0 ddreal ItEJIW6IItElur 28211.0 11rLlua -1268.0 11196.0 28223.0 10408.0 10632.0 28215.0 ltltYI co 28199.0 Jttf bElf28191.0 IOU IOZ 12536.0 28183.0 CWtaIlO CIQCAUO12480.0 xmlns:ns11 ID37 12904 4928 14008 16776 ns11:type 14296.0 16776.0 16791.0 vtlsteese 16784.0 tear 15871.0 16456.0 16779.0 15959.0 sosoo sosooDYSPEPSIA 17272.0 16920.0 16944.0 DYSPEPSIA DYSPEPSIAhood -2104.0 16748.0 17235.0 14408.0 17308.0 17316.0 hood nooil14728.0 HatImoiiclurcd bnelldured14912.0 17311.0 mUr 15895.0 17332.0 16015.0 lonlerit16440.0 Iff 16528.0 17328.0 yo0nso 16620.0 yo0nsolill 16636.0 16816.0 1110uidiiiiiaiculloliiijr 17144.0 17771.0 lill 16452.0 17840.0 18512.0 18260.0 18308.0 Iw 14584.0 Ia 17464.0 18471.0 18604.0 18616.0 IIo 18679.0 17584.0 18840.0 1J 1I18312.0 1t 14144.0 19532.0 17248.0 17832.0 19592.0 17336.0 18791.0 19907.0 VI VIA 18919.0 14488.0 20055.0 20052.0 rnwlldnil mtwilrlnal15764.0 venter rnl 20071.0 rnrnhelrt rnrnhelrtAprl -776.0 16188.0 20079.0 20076.0 nirrlr 16892.0 1Aptrnnt 20143.0 20159.0 Aprl 14380.0 Aptrnnt 14688.0 20171.0 14968.0 20164.0 Uxutlvv Iaxdllvv20155.0 tunl uns16076.0 20176.0 illr 11k16216.0 16624.0 20152.0 ally o1417120.0 17052.0 17816.0 r17864.0 18887.0 20224.0 rIt 18935.0 14168.0 20212.0 20252.0 livur 14640.0 20288.0 PBr 14435.0 kdlnnr kilnrrU nUnrucli iti 15700.0 cis smt16031.0 15983.0 20300.0 20279.0 nwrldlurlrrn liliMirilrm 16980.0 18328.0 1084.0 17243.0 18464.0 20243.0 18660.0 20355.0 20379.0 14544.0 20388.0 iMUiM alts14472.0 TorpM Jrpld14848.0 Lira 20395.0 15752.0 20360.0 llllluiiHr Illlluuwrn15756.0 16656.0 Jitun J1un16568.0 Jitunti J1undire 20460.0 20475.0 20472.0 dire 14427.0 Ibrsnta 14732.0 rani 15300.0 llUra 15128.0 16012.0 20463.0 r20467.0 lh ii16063.0 KMi 16248.0 KMiltr 16732.0 KIJt 20487.0 18727.0 ItIten 20572.0 IyryIli ltr 14672.0 20599.0 fi 14528.0 KmrlbufH Ilrartbr14840.0 16028.0 20563.0 Irk lltHditrkr iIwdrlrkrlltHditrkrl 20675.0 20703.0 14547.0 20679.0 iml 20699.0 15020.0 20672.0 tMH 14972.0 15456.0 Iten 20696.0 Illr Illrub 17108.0 VIrnltllrnhiiril 17240.0 964.0 20775.0 Irnltllrnhiiril rub lrntul 14816.0 15540.0 20772.0 Vnlrr wutrrI20756.0 Ihrinurnt 16220.0 tlif 20787.0 16692.0 20768.0 16768.0 iOI iOIA 18452.0 4524.0 14132.0 20856.0 20868.0 14368.0 20883.0 curtIH 14244.0 20871.0 rnrtnnnrtllwtltnralnlnernlwaIure 14828.0 -1764.0 16592.0 20880.0 tliHimitirnl 14944.0 mineral wilersi uulJK 18612.0 20951.0 JK rurnnlnt 21007.0 14884.0 20980.0 ulukn rf 15444.0 rfCorn lutat lutatuc0uunlcsl 18360.0 21028.0 21083.0 uidiiiiiaiculloliiijr uidiiiiiaiculloliiijrTlin uc0uunlcsl 21092.0 21087.0 herT11elt 1316.0 Tlin T11elt 14712.0 21243.0 nnillnnli 11ulntlnhjr nllibynhjrill 15788.0 21347.0 dldrtiUaUlewills 14507.0 21352.0 -984.0 21371.0 irtin 14616.0 21355.0 15104.0 21359.0 15036.0 wild grab 15791.0 bAp 16976.0 21331.0 18052.0 1020.0 17032.0 21403.0 Apply 21455.0 Ap 14824.0 21452.0 14636.0 14796.0 irHilD Irdemurk smirk15716.0 onTMCE All tC WA 18288.0 21447.0 21440.0 18392.0 JCRAB 18468.0 lKCRAB 16044.0 21551.0 21619.0 14204.0 21555.0 21579.0 ururr14236.0 bfittl boltlw21572.0 1484.0 18839.0 21591.0 16712.0 CRAB ORCH 14696.0 ORCHARD 21687.0 nD 21684.0 WATER LoulitJIlB koultrJlleUy koultrJlleUyMaisby -780.0 16948.0 Kr KrMalsby 17664.0 22147.0 Malsby Maisby15736.0 22151.0 Cppany CoipaiiyCoipaiiya0 -1368.0 22683.0 22739.0 30 a022736.0 R22731.0 HruMil lironll22727.0 MIAtEngines Gn GnEngines 22875.0 22900.0 Engines 15464.0 22887.0 andi an46oilers Boilers Boilershlrnin -1044.0 17184.0 14024.0 23096.0 23251.0 hlrnin htrwul14664.0 23244.0 WM 23239.0 tfnler 14892.0 23263.0 23235.0 Hrnlira Ilratra15844.0 23199.0 Hrt 23256.0 ut23232.0 rnnti tlunna23220.0 Mild an1Mildnl 17512.0 23227.0 17704.0 23215.0 17560.0 1Pellherlhy 17747.0 23339.0 Pellherlhy 23380.0 rtliy 15188.0 Injector JuJocfnraInjectorA 23444.0 tih 18903.0 18820.0 23516.0 Mt 18871.0 M1lamllarturera 23555.0 23571.0 18631.0 23599.0 23563.0 17632.0 23747.0 1I 17675.0 24323.0 24432.0 15148.0 24479.0 17787.0 I1I11nlllIU 16468.0 24867.0 14704.0 1I11nlllIU 952.0 1lamllarturera 25035.0 andJIlrlrIIln JIlrlrIIlnSA -656.0 1lentere 25040.0 toSAW 25151.0 25227.0 SA 25212.0 SAW 25215.0 VV MILLS MILLSurn -1476.0 1100.0 1XIJX 1XIJXr11MIllN -1100.0 14120.0 25436.0 25455.0 Corn 25475.0 urn 14448.0 14308.0 25443.0 r11MIllN Mill KvrilMIIUCottiiriOliiMnclilii KvrilMIIUCottiiriOliiMncliliiry -2156.0 rll12lllaCuttuntill -1992.0 JIll -1208.0 utlUII 16292.0 UIrlttrhl lluchlu 17672.0 25479.0 4cry 17736.0 17956.0 IrTIII1 17984.0 25584.0 25620.0 ry 25587.0 rTIII1 nnilIrnln UrAhKnpnrNlors KnpnrNlorsfOIID 25599.0 IIiUltlllra IIiUltlllraflUIm aralura araluraI 25727.0 25735.0 fOIID flUIm25744.0 14424.0 lIT tint noil14624.0 ntHIINlRIl1fJ INHKHTK1 INy1 15368.0 ItTll1 15312.0 Haws Hawi16124.0 25732.0 Haw HarrHft Tqilh 16368.0 Jo 1lhI11 16736.0 Ihnn1 Ihnn1fork itml itmlIwlin 17376.0 0If 17411.0 3668.0 25839.0 25863.0 fork IwlinKnlulilulMlrnt 25859.0 HIIh -1160.0 l1111ha Jllttrll Poirotstage IOKIhI25856.0 ItlnUHll IIlrlaitliltlrtlaillSftw tlpwr16808.0 SftwMill 17192.0 17715.0 25892.0 17195.0 14124.0 25987.0 1111111111114467.0 25983.0 nnil Arllland14776.0 25980.0 Ynzhe 14724.0 14780.0 Knelti YlIlhlf15284.0 ItepnlrJovrrriomliitt nelulu ltepalr-1768.0 17104.0 15972.0 UUYrrrltlraC1rle OOvernura1n17072.0 17211.0 toIlor 25956.0 IllnrMiiln 17720.0 18252.0 17768.0 IJIll 26075.0 llnrMiiln Ilor 14332.0 26140.0 AIII and26135.0 lull 1111126104.0 llun 111111Ilan15156.0 15604.0 15692.0 16116.0 26099.0 Hutiii Huppllel 16856.0 Irlco Jrlco1rlco16860.0 JrlcoIIlul 17200.0 17643.0 Vnnil 17800.0 17680.0 Snod 18144.0 26203.0 26235.0 nod nnilIIlul26231.0 fjunllty IIIAmqualltr14352.0 26223.0 fit26252.0 trrM ersda 15308.0 eoll lt xunrltntee unritnln UIUKhlII16256.0 26207.0 26219.0 CatnliigUtt CItAlllluoCabelpguo17216.0 ifIren 17960.0 17876.0 26264.0 JoJ JoJI 18012.0 17880.0 26267.0 jI 26327.0 26364.0 Iren Irew26355.0 lir by26347.0 inriitiiiiiinr tnrnthiutuIL14576.0 llIflll ihls 15144.0 Iht 26367.0 iisper paporOr 17459.0 18004.0 26400.0 dPROFITABLE 18084.0 14008.0 26439.0 26447.0 17651.0 26451.0 AtS 14036.0 AtSPROFITABLE 17808.0 18064.0 oc ocPROFITABLE 18164.0 14096.0 26575.0 26648.0 PROFITABLE EMPLOYMENT 26643.0 EMPLOYM -2024.0 -1092.0 FN FNIf 26579.0 Nt NtIt 17251.0 14499.0 26875.0 It27027.0 lots27023.0 rOlllRn 14908.0 CAM CATSthink 27020.0 70111011cnn cuss16384.0 solicit tOlietC26947.0 aullclr 16968.0 17491.0 17004.0 JLIFE 17507.0 27015.0 17563.0 flt fltLIFE 17900.0 27143.0 LIFE INSU 1NSURA IN5URtR7dVeh 708.0 NeE -732.0 17112.0 NeErllo -708.0 17088.0 eE 17568.0 TUrlto 18516.0 27316.0 18607.0 27352.0 Urlto wrltorllo 27391.0 wlthrnfToni rl1lruntlt1rnferunare15868.0 furfarterm terml17379.0 27411.0 16804.0 Vlonl 18807.0 18112.0 iyu 18868.0 27495.0 lonl 1111yu 27519.0 27511.0 Alu11lJ11c11l1 apecini ji clril 15560.0 27523.0 neent llontngontlw17360.0 1172.0 HR 17475.0 17427.0 ItI 17531.0 18180.0 rR 18244.0 14092.0 27615.0 14188.0 14512.0 SHEDDEiVCeo SIIEDDEN -1060.0 Gen jenAgent AsrentAgeat Atta Attafarta Q tia 16972.0 jTIIYIIUTUIIy 17267.0 17280.0 17275.0 IIfit 17448.0 JTIIK 17608.0 18336.0 fTuE 27855.0 TIIK TuE27903.0 TIIYIIUTUIIy MUTUAL -1140.0 -660.0 984.0 14768.0 UTU1b1lEY IIPKfNHUUANOKno HUItASm YsUI1Mfl-1148.0 16740.0 Co Ji 17044.0 17344.0 17419.0 28039.0 nt14340.0 14395.0 28035.0 lIH14764.0 Aaael ovnr UwoflrIveraJlItOOIdQOOo aa1000f190003it 16172.0 oorf ooo 28063.0 x rlit 17299.0 JTCW5TIiiiMwf 17416.0 28251.0 lfntejrtedwllb 28435.0 weak TCW5TIiiiMwf 14483.0 28203.0 -1832.0 28451.0 qa 28447.0 14836.0 14940.0 940.0 JThIIn 15388.0 28559.0 28371.0 lM 28368.0 28363.0 tweak tyi yftfw ftfwI ftfwT-468.0 IIP IIPW fl fllfntejrtedwllb 28539.0 17179.0 28635.0 17156.0 28611.0 17048.0 28691.0 28715.0 16436.0 28823.0 18272.0 28863.0 28995.0 29015.0 18759.0 16572.0 29071.0 29103.0 16800.0 29160.0 29235.0 29184.0 18655.0 18416.0 dr 18703.0 29315.0 29355.0 17952.0 29335.0 17992.0 18783.0 29320.0 18420.0 1S 17096.0 29367.0 29395.0 29420.0 29427.0 924.0 18772.0 tt 1164.0 tti 17060.0 29499.0 29535.0 29519.0 18767.0 18456.0



PAGE 1

IOPICSD-occccooocgTolksfbollt1EAHIHCS-vbWOnrrlilhDmankin7i1f10pSthejhuskownTnBtitutngnidluvennI-GettingJgI-B11CPCGOCOcp-OF10lt-LrdesiresInglisl-inecomparativelyKmprosi-pofsoesosreproachfullypredominatingthoroughbredsthcutnunfthe-llostshudderingSwcUhlno-ISvcryIoultryman-HnirdoooooiN-UiinUhousekeepingrespectabilitytriumphantlyaccom-plishmentFrench-XplorerJlosyncraslesmrllameutaryquarrelsomeeominemmllyop-portunitiestl-TclioolmaMcrschoolchildrenoeloelcSetyHandkerchiefi-1iUmherheremlsanthropiindividualitylllth-titibjcctgWashingtonwonderfullyrequire-mentsaccordinglyon-Ivcrythlngdisappearedobservationsacquaintedacquaint-ancesdeliberatelypcnoiitlltyaccomplishAgri-culturistproba-bilitiesmetitNIweverywherecompanionsaseptlcallydepartmentfitvurllual-ollftrlppcdcompaniongymnasticcoquetry-InkRchoolmasterembroideredcompletelyIndulgencelatiglcsomcpermanentpreferringbewilderingsubterraneanprocessionmagazinesNapoleonsthoroughlyconsiderableperfectionembroideredeverybodyvulgarizedlegislativecnthncntalCommercialsprawlingvegetablesomstltchcdenjoymenttracery-Liliesiu1tmnMttxpedltlonraisedmyceliumsomethingWllhelmlnaconstantlyscratchingturquoisesgentlenessincroaslngnndcrsleeveLancashireno-dUYoroncorepentantpossessionrequestedcachoroustlollHosoestablishedassocia-tionsproducingdeterminedvirt-condlngneighborsadvancingManchesterreferendumBlessednessyoungslcrsunutterableIncreasingbeginningoverthrowsyoungstershappenedobservation-sadvantageewspaperssomotnlugauthoritiesforwardedpresentedopenworknowadayscenteringmyceliumturquoisesubstantialrevcale-cveroneglectedgenerallyfragmentsuudorslecveprotltablcul-timatelyInspectionobtainedxprolltabloHighnessNaturalistsliveringspeciallyimIiIsometimespleasurespowderedInereashijAdvertiserNewcastleFederationredingotecomposedswellingsIloniostiudex-periencespecial-tyInspectedtlcgnlricdInterestedanythingShirtwaistabnormalGermanybutternut-nrconcludedtrimmingPommerolgenerallycaressingmanagingspecimenmiddlingsnrquolBoattoiulnnconstitutedecorationprinciplecomposedno-rotsdamanythingImproveauthorityAmericanwonderfultendenciesanythingholding-inMushroomresistanceneighborUervantonImpresscommandUIJkindlinessbreedingInspec-tioncarefullywlndov-vtutAmericanmasculinearrangedmushroomsomewhatquestionbegli-ningembarrassindividualwonderfulfragmentdescribestravelingconditionslaughteremotionalpersonalb-flllghtlyphysicalIum-lIialzaequestionmultiplystrengthwaistcoatginghamWhereverMlddlotonproposalCOLLEGEcommandCarmoutHarperstransportacceptedattemptsper-fectionrecreationdetermineworkingcapacitybringingHo-siiMiicdrecreationlieilliiiolyquestionthinkingEnglandswell-Ingsproces-sionconvictionsecretaryPitts-imrgalthoughJiitld-nnxcninstni-1loiithoughtoutdoinglonelinesssucerpsfulrecentlyquicklylonelinesswholosompatienceeighteenbeautifulstate-mentsanecdoteseducationadoptedwhereverdoubtlos-UnfternoonvarietiesstrippedMajestyconstantlHeadingshowingpatiencesuffrageinvitationTcc1mlfnnpoliticalanalysispuppiesrequiresgardenssome-thingchocolateAustraliaaucccssfliitvti-HollopersonalsufferingresidentgenurntenorallygarmentkohlrabiskeletonsourselvesMajestyscarcelyFranklinWheelerInasmuchQcrtuauhistoricalpuniitnostoppeddesirableKnglnndwhatevermasteredwhateverstraightthroughattemptMajestynecessaryPracticalIncreaseskeepingoAoapcdThroughstockingbroochessocalledbraceletson-palllncttnglundcharactersituationcunningImproveTurnoveratUiulouencirclesixoillentslightlyindicatesBotanicalstrikingrejectedNothingUlcrlcullopeningdisclosesentirelycallableMotlirr-Myhatch-ingadmittedtl-toucherbuildingfoolcllreferencevaluablethroughbacteriavarietiesthoughtthoughtentirelywatchedpleasedwarmedweekliesAmericaimlnr-TnIkprivateplantedvarietiesfollowedundergoearthlytreat-mentpleasedmorningCouldntrecordedgreatlydemandsMunhroninshakinghusbandurlosllypowderhartlugsliottl-ftsosAnotherfacultiesclimatesregularqualityANDbindingthoughtequallysitu-ationInvadedJarslangmomentsreadingspeciespossi-bleDuchessglancedtiicthodklndiiesHthoughtpagodashimmeraiuWimischiefquietlydesignsfoaffidif-ferentfranklyoverlookopinionIOKslo-MrPeggysVictoriaIntellectputtingalreadyconfrontpoul-tryvarietythroughretvlvedwithoutProfes-sorwomanYVictoriaFtrutMtirraisingsettlinggroundreachedaccidentour-selvesreceiveRnerillccquarto1spoiledYorkersalwaysbacholopoultryeconomyeveningreducedpurpleroundedAnothermistresscleanisubjectrottingconsiderwhltliPullmanDecisioncellingcnrdcnaregaledenoughbuildingMowingeturncdheapedobeyedDuchessequallycorn-mealsupplyInterestlowingdialingalarmedul1-1II11111historyrush-IngusheredLondondemandweatherBocchcrsurvivesslioviJpassedoUsayinghoweveropenedfidelityennobleAvariceopenedpayingkindredsimplyduringenoughterriersconsistsIoimlnrcoweredgenerousregularchewedcharitybetweenAnothern-inalnidsatisfySocietybelovedCrlntirultmrosebudrespretcustomswindowcrushedchancesappearsresponseelementTolglitbraidedClmrronalwayscollegechenilleanotherhavo-lintltwentykissingsoftnessInstancebecomeiiwithoutribbonssystemplacedmyselfmyselfwindowSeveralsubjectmastiffrornlinnumbervillageappearsbecauseleavingfoulardkitchenspheretreasuresArgyllsupplyfrJjGeorgeKuropofruitfulspringbecausecouldntelectionyellowsimplypersistfnrnInordered1steadsixtiethsmallerhimselfanotherInferiordevotedvillageSidneypullingbashfulborderscircleconsistsalwaysarrivedshallowwalnutspassedstripesBoomedFarmerWORDSrollingfashioncouplohigherAmer-icatalwo-MIfungusexpensellsloncdcrossedpersonshlntsifwld-HorcallingperilquolsodoomedcollegeIn-ducedap-pearsSundayInsteadpokeddaintytlonatelrelievosIndianacouplecouncilcheatedKal-orinnumberthingsgivingcollegecaracalcuriouslookingmouthscouldntLondonweightglancetollingcolonynativescollegein-ducedglovesglancomastiffminuteqnlrcscornealdresseslacingpassedlaughssup-poseperiodthingsaroundbartercertainparlorobscurelniMnlminuteformedDominiQueenridingstrongbecomeenotesmadrascorsagedi-videdronilriprocuresubmitexciteswIshedcoloredIa2I1Gseveralcoloredheroinepiecesmastiffex-tendsoaringbarleyQuernnewlyLiningHelenafurthertreatedworkedlengthOf-coursemethodliMrniilQueencertaintowardactionsaccountmiddleHtitdiittlufaiisipublicasleepbellovoprlntnseveralfriendslovelypastelfearfulautumnan-othervil-lagobranchtrottedpoetryInsteadstudentnamedPeggyhazingSaharadividedduallyS-afbehindcookedrenderseemedbundletreatedfriendsfollowscustomsQueenCeceliatrottedanyoneprizedoesntVnrlotyforgotprettyMollerwomansconsistcollarsmentalhousedlargererminedetailswomanslonelywljonplacesgivenermineGlovesshadeswidowlowlytrottedRoyallongerUnitedbloKsedIroirlnshousedFancyNightcollarschltTaumatterpiiiiyshapePeggyIoiillrjneitherllaclirlorshouldBlanksLouisethreadbehindmotherwalnutPeggyPeggyjorancoUnityDoyleapplytowardCONNERMILE1-AassclsdecorashouldcookedCeciliaslightStudysummereffectslliiiinclprettymonthrapldlshouldlivelyarlklopaweradviceHobartfunnyPeggyGIRLSMastersharpwomansothersmarksPeggyservedemusworldshouldcheersanglesPeggyJuvetiwhichwouldhairedbreedsrecordforcedshopsnamedLouiseHollosknownenergySenatesummerquartdesireswriter1osslowhichlickedgivengoodsorangepiquebeingshoulder-minevigor-tSuppleshouldclothoHar-rivedspeakfancybegansummerdrawnshouldmakescloaksspiritInbtiodbreedsspiritbegingivenwhereyoungGouldwouldiardlyalonglivingIniiRhsblouseenjoyactionotherstgreathistorNeverPeggydeniedRoundJamottwhichfriendtossedhomescattergivenHomeschoolalonganswersattaingivenearlybraidsshouldJamoamasteragainLouvrefancywouldwhichquitewouldfriendwholeKnotsejijwryh1lt1velvetConancar-riedvartodfriendwhichgreatbeingaelivowhichsleevenrdealwouldwoulddefeatvisitorJamesTheyInchesSmithstatedrufflessmilesCe-ciliagivensnowyr-ipuppywhichknownwhichvelvetwristswhoreStateslIeI1earlybolerowhichSouthbearlnquitetightnightwhichamongformedstacksstatuewheataboveho-werobolerowhitesleeveTheyadmitleavesfoundfifteenJohnswhichwantsJamesghoslikenswhichpartseightlightwhomwouldwomenCultureforcedJameshorroraffectvigorwhichThesewhichHaltedstatedwhorolessonJamesItalyproporsuitedwholeHelenwhichyoungwrungNeverYVaninuequalTherofriendwholewhichplacepointicllarworldullverrolledrarestbetterbeforeInnatetinilycollarwhitecalledeasilyselectSelectwaterwhorofriendfungiBruceyoungdidntpaperrazarbetteryoungtrulyaboutendedresultstakedgrainbe-gunendedhonorFarmpanneWouldwhatspullsex-tentloyalrottntlwhiteInsectquartTenthgrainpapernarrowsilkywhitenarrowThornIntentwhomkhosotouchbodynightwomenheRdswhilefloodswomanaskedselectneedswomenspentgoodgenusyoungcollarbullshousewomenmuchdozenpapermhusoWhatLittlelargojoodstylebroadcheekaskedsubsslylupapercollarworldclotSomellmlliifoundIiiltllrrdidntstreetstreetilojsvioletfreezewhlloterrorThereAvishulloiiiij-WewhitedownthereunderblackpaperwhiteviewsdidntpinkgauzewomenalouowomelltwicewomanwomanrecoilwritoedgelonelieffortninnymoireaboutfiirmlrightW-andOnlottlgrabwhllotakenbroodcouldstockgoodWhyliftedblackcaredmuleabouthuntawayItalichousehouseltollolight1iKRTlimingwaterWhypulpmilemakeorderfowlseouldSatinmadefowlswhenmashforthrighthoursNorthwhenstreetAtlvlcflbet-terkeepluliywhendentefenceaboutsmallJadedroptumultHollostorylooksblackcouldhitchstrainhomokindswhiteninnyninnyhourwhengreencarryagaindownchurltherelearnWISEthickweekoftenThenPressmuchwhenyearsawaywltatdropmadesmallworhtwicegirlsgoodkeepsixtythemfreshgrayshoeswhenwlcltwicemakeHullogreendownhitchotherParisthinktheseamidthosefoodsmanymadeonlyHolloplayoperaloamGoodweakorderknewworkhomoacrossmade5rentmanyeverycomesthereweekcornerItollothereatomicuunleshunwhatHollokeptpulpbirdsonlyrockstherewhattheretherebreedhomewhenyearsabmitnippylromhomoGoodmindawaytliulrcouldPariscarryhomolongo-ttoshowhairygreengirlssixthKithhitchcourseTheyonlycoursefrontWOOlwhencurrydownonlyforceThatot-theIarlshumidcapesFromdownshortfowlseverygreenrouthealstliiioThenfacessoulssaidhbwcotctlthemgoldlonghighsooneronlyonlyyardtitrdtitanwhatllttluseasonletterwhenthingkeepseasonlittletendtightworkheroMcMthemubllccoursegoldwhygoodnoodtheregrowteethmuchwalkgoodonlytheytheytheyHOCIIHstrawinnncoHulloItollofmSuponfencetombfleshdogsupontheirgoodJoyswithtHiulilwhytheycornerdoneonlyJooilThatstatebandMineaftermustwontuntilsinceworkweektruthchowobeylittlecloselittlerulesstoicfhlsironhaveuntilwiththeirgoll1goldgootlcornerIMtltitIIHIIIsil-verthemstartthosehighwithhavewithhavethemloveYorktlnutmuchlivedfullertelorcornerpaideachsorryleavoIngeItnllofromclassorthtpullfiftyplanfrontlongtherefromalterboolcfoodfounahavewidelivedinchmuchlittleIgonerseemscamsrhatwithwithupontheirhackshalltramroosttheybackowneroftengoldftneramblewithlittleseemsstaywithwithMiss1100withbondfruitcroamformuponlovestreatstartbackneckhavefromlogsJusteachMallcrabwithteamwhituponHirerwhetstopcakeThiswlfoaddsThisguesstimewiththanyourlongboneYorkwltoMwithwluMiforceNro-versneckdonewhentininocomesjusttimestopwithwithtlmothatlongfromfromfrommustbuckheadlittlewithneeduntilsuchwithwithgaveThistintshedWellwiththanlonslwithlocalcuclisniffwithroadlovtMtheystareleanfromhavehavelikesmostItrynwliiiicroatlawrlthKewstopgatewithuntilyourcausehourwithuntilhavebeeninI-ItfromolllllldebtwithsirslovescitypartyourverypurewithstalehavehavefromhavoposthurtsnerdwithwitheachdontrearswontdealwithNowlootwithfromPrillmostratetUllebluebothwithounceThisaddseasywithjusttinywithfowlNowbeenneverwithThefallsthanscudJustullyrodetimeeachwhituntilNowholdrendItjsofromwithvisitwithfromsakehourseverneverneverwithwithtimethanwithThatflayS-tunsneverfowlvisitheadclayTanosaysIrulttintbedsdayandtripJustwithlittlethenthenslopstoneopenfrommostrateveryfineswiselionsaysdimbeenyearverytimeyenstaketiledtooktunicroadlovesrodohereiblewithUfllrnighlandlhlswellUntotimesaidsoldthatwhoeggsgaveFROMwhoearthThetintfinalthatdoneIhrdoorpeenwithlinnetgritbestlovewellthatsamogladthatablebluethatthendearwayCallaverydearuent-yjustablestopstopvisitwhonookbasetookcantoceasethathestthntthatitlontermlaveDraftfeedcardwhoverypassyearthatnoursNowwentwayfursfleshliolHwilythatcityJointlealWtftbothalsowallwithwayti-thethathalfthatmustsVilathathatTheagoluivoeasyeasyoutsthatAndWithgirlthatwiresttiliOnrwillwinfeedOlepatsthatflitfluemustwontnamedayverylovewholookhowtadlovePaththatnotetentsevenlackStarhintsIsntTheNatthiswilltracecitysailwaycoldsheThelandcrossthntPOSTwayJOlSverythatthethathairthatwearoatsmnywaymaiinextveryTheHiomwillsomeacresdaydugdayHunttiesflatlutemorewereTrieratetintfirstcuffinlywayscornloftthathowthatablewaypasscomecantolastandliedsaysthatThothefieIntoHeIThethatlovoThomaywayevencamobe-anHerthatstillwaythatfreeloamearlwillcantoUII4thennUllmoremidlaidmailandantihallIntonullHodTimboltSilkNItalkfeetroomsumotltyroomMrsthatItltoThesoftfeethowliarTimgirlonesoomoimutewillworeamidollhudamihindruleliketoldsentnUlllinethatItcdsealmidhimmillliveness1itrlimorecomoTheMrssoftElottalsoalsosuitThoTIllandfindFredthatflirtdulldollandIntothisandmillandandDudlaidandnoonownsthisnodjoythywaglentandwillwillaidUnitstillTheandIntoheltrentthatandtllomoremoretillsandthismidfootcoolShomittandlaidwillRodwinandandandandliedtoldmoreMrsfeetOnewornstartnUllandandandwilltreemorelifesomeHerhimnullamidlowselfthislikemilandNovlowmidloafselflovohtmhadInto1hosilkcallnulltillshimhimandandandYesantinodlineNotnmlthislossandandandIontotethatteatwereweresilkfuroversonssizesoonarratweretintsandbiteOnoandlagSlwandstillandhimhimhullyouwillandandsandandantiandandandandandtitleItedHodandandandandForfirmIntoHadliedtwoovenOnoandtwoMrsoveranytwoonesaptlingsonsoyaWWIInittlfullfindandnullforandJedmanoverandhimIhltandendnl1l1dadamiwillandthisandhurtandlineyouhadhadyouhimtwoanyandmarloveryoutwoternMrsMrstortMyhailtmsTrrnmidDudhallluckdulllifeWoyoulinehaulandsoonoversiteshetirehadandandstudandShetimidmoodXtnhintlustfactlayandMrsthecallmf-KloncesaintwaspayanytwoidiotovertwotnitthasoverbuttiesandnodbutfootrindSunShelasttillandyouanyoiijthelorinodbigtwoflnttthotrueovermillsirlifehitslaythishillISOhavtechgetagoanyherbutsotthesheownowna-MrnisiownteenmanonesdillthecnroaversenttwoliftleftInnsyouagoyouShehasagoyouyoulnsstimidendlUCsureshotheflattiermantietheSlithimslwlintbutlinotpowntieslittimenomtwotheputtheoverlintyousilotheHerlinthasJoltlinonowSlitthethelinthasShecoatlIonfactcalthethethetheFunseentho0110oldthethethetwotreerareAnisshoherthothotheflitherItemfoxthehCrtheMilthetheleftheryouandtimetalltieItemnewherflatshothethehiltsootthohitsYesSitlosthethethethethefoxthethethothelintthethothehiiithothotheshethethetittimethohertillownowncrimenownowInHmeetthohimtherutsthethethenotthehassadlikethetimethotiltswllthotimefurherandthoherHolhitsthotheherpotswasthetillthenotu01iihothuownthetirotIlltIlltimetiltthethowaswaswasbutwastiethethethedidthinnowtimethesewsgnathernothertilttheherlintthethonotlimitherherthethethethethethethethethethethetillthehadthecasethothetillmentinthothorilethethetilltillfortinthetinttimelfi-rnororstwonotthehailfleetFonnowwasnutthothethehernewwanantputtthethelirecutnotinndidthethedidredthetheRthintheoldthotheoththethotillwasita1thesuncesswasTinnotthetheforthethetilthistrthethethotortinethethetheagoIhotheshesitetealoldthethetimehersoroforthoOnot1toothothodidtimetimewasoxciwaswasbyIrisbutmitenotbuthis100oldfortheforthothemytimethetheturoutfurfortimenutwaswasrantInotheIhttitoldthobitOnmyunitbybyhishishUnotcutnotforiliowas100tilltheIIunixthethethemytIllthethothetrimswaswnsoldlieoldHoSirseesItoitsititsoursunnoteatmyhumtryhishislwasoutbyforhisifthethemymyImtooformyoldbytilltilldrbybyOnhishishisfornotnutHocanOnourKHOImyforforMrOnliLtmyitemhercanbybybyonoSlitivyonoonomynetnotmylimittillcanOhlnlImrillfurforIiaandouronebyHimonowlihisonoourMmnotHooutbybyAntennottheoutoutourareour0011DoAnforhisnorourourbycanomitnolATonefornotbyforlesscarforourMnouroareelnilniliglallbycanshoilDrhcAnfirIUIItljourourmyIlrallouronotillcorranOldnorbyouroffOrAnhittinniltiecannretilllotAnollearetireonehlIicilanAnAntirethiirymicaihsueonoomittiltinrtno-nXcAsarehotinAsiwnonocryAsupallarcHIllareAtareour1115alltillnilttinAtupcarnildoareonetnlh-ItupusetonorsarerunaretarJohoethoarecrywoIllHoupupseeItsamseelySoofnddobeItsllomohehostiltVIIHdohoW-jYItsbobehoareECObohofirweewwewemyamItsnilsealiphlhodobobohoofhemomoboboethoweseeofaaofmoofwewewemimeattuuhowoitsofoybohebehoheotiiofofhoofdOAnofbyofofireofofasinWhoofofofofofofbeofbehohoofofwowoweatboriiimemotohoofofofifofoforgoofofofofofofofofofofofofofofofofofofofofofhoofitsgoofofofofofofoffittotoofofofofQ-JInofotofwoofofofInofofofofofofofatInofofofofwewoweofofofofofofofofofofInon-tlasaningrofInofofIn1ofofofofofofofofofoflItofofofoftooffoofofofoftiiofofofofIn1Irt1ToitsataceatmoatatupmomeInofhrIIIoftotitItIntotolitItofIwtooftoofofofofofofmoofatofofonmvimtoofoftoofofatatatInInInnttofirofnltoInanmomeInInantonoiiyatatoflitnnanofoftoofofatnntoofotonatofusonoftousnnonIONInInWnmInInInInanIntoInInIntoInIfofInInatIntoerrtotooftotoattowtoonasasattopamoonatntonnoasusinItUattoinIninInInInKInIntotointototototototoontoofusonimonnntoatatatusononsugoasjytonoasnKlaInInInInInInInIfMInIs111intoIntotototototototototototoornftoattotototototofustomoattonoonusasususnsAisIKIIIInIstotoororasasininInInliIIIInIntototntotototoortotoorasJIHasorasoratasreIsliIsInisIntotoIsAIsistoorIttotoasasasasasasorortotoIstosousastofIsisAroasorAItIHororasIHnsItItItIsIKtotoIHIHtoIfortoItchorniiitoorKOasasInItitItIsIsIsIsIsIstoIsItUIsIttoIfItItHOlilttotillso114retoIsIsIsIfissoitInIntoItIsnsantn1tsoBititItIfifIsn-pananorIMUtoianItItsminInItItnsi1IsIsAIInsItiuAItItorIMtoItItIvIths8VItastAHIA111-iIvtIIIhokItitusp1C11tlIIanIIainarretiShaInaatAviyiI<1lHaIaaannannaaanaanuaaliInaaunaaaaauitIaazaanahrnnIaannunannnaaaaaIJ-0annjnInaaava1nIiInaaaaanaaannIi1I+IlA1IfiItIhsj1AiIYIryrtIiritstIIiiIIIlIrI


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\spin01.iarchives.com\scan1\jobq\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01343\ocr\0409a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:23902
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1601
splitwords:0
ScansoftOCREngine Character Count:19209
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:22534
Abbyy6OCREngine Character Count:21339
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;21339;3416;44.0078;90.7901
language:en
ScansoftOCREngine Predicted Accuracy:67.62%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:7070
ScansoftOCREngine Character Error Ratio:0.3861
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;22534;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:90.79%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:90.79%
ImgPrep Component Range:22800,23902
version:Newpah v2.32 RoundBox
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;19209;7417;0.78661;67.6185
noPunctuation:1
ImgPrep Component Count Low Estimate:22800
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.32Styles TextStyle ID3 FONTSIZE 14.0 ID4 10.0 ID6 9.0 ID7 7.0 ID8 12.0 ID9 23.0 ID10 32.0 ID11 26.0 ID14 11.0 ID20 6.0 ID22 22.0 ID23 21.0 ID24 17.0 ID25 4.0 ID26 8.0 Layout Page ID1 HEIGHT 29700 WIDTH 19400 PHYSICAL_IMG_NR 2 PRINTED_IMG_NR [2] PROCESSING PrintSpace 29363.0 19272.0 HPOS 112.0 VPOS 156.0 PC 0.90790004 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1168 18940 444 156 ns1:type simple language en TextLine 1168.0 18940.0 444.0 String STYLEREFS 188.0 160.0 256.0 CONTENT X WC 0.82539684 476.0 692.0 1868.0 848.0 TI 0.8095238 SP 1264.0 604.0 768.0 492.0 8884.0 556.0 I 6324.0 2560.0 528.0 18235.0 1 8860.0 9376.0 68.0 40.0 19343.0 t 580.0 18764.0 xmlns:ns2 ID5 3616 7372 792 1516 ns2:type 176.0 1916.0 4016.0 1516.0 140.0 336.0 1536.0 THE 0.95238096 132.0 304.0 4488.0 1560.0 DEE 136.0 4352.0 288.0 4984.0 1540.0 SEA 192.0 4792.0 144.0 512.0 5416.0 PEARLI 5272.0 5420.0 PEARL -508.0 5928.0 PEARLTlu -512.0 5932.0 PEARLTIlOl 244.0 260.0 5216.0 1744.0 rItn 128.0 1488.0 4240.0 1892.0 92.0 48.0 1908.0 100.0 4244.0 JIT -44.0 4288.0 64.0 4336.0 r -64.0 4400.0 392.0 1920.0 KIllTIt ALTERNATIVE rbtrt88.0 96.0 360.0 TIlOl 4880.0 TIlOlrho -360.0 5576.0 5592.0 AN 16.0 ANThe -136.0 5728.0 212.0 6180.0 1936.0 2032.0 148.0 284.0 The Thorho280.0 2296.0 2048.0 love loc76.0 2220.0 2644.0 2064.0 of 0.96825397 or2576.0 208.0 2836.0 2112.0 my 2788.0 116.0 m -208.0 3044.0 3112.0 2076.0 lift IIClife2952.0 352.0 3384.0 2124.0 came eatnc3320.0 3544.0 2128.0 lnc -192.0 3736.0 124.0 236.0 3800.0 2104.0 not jiotlIot232.0 5236.0 2096.0 flier TluTh1200.0 4036.0 420.0 2092.0 divers 11irrlldircrs108.0 5468.0 6072.0 tuny 5996.0 ton f11-280.0 6352.0 348.0 6424.0 come mmernme164.0 6260.0 252.0 6836.0 2084.0 and nnc16772.0 152.0 7160.0 go coga72.0 7088.0 7164.0 goThe -148.0 7312.0 coAs 8028.0 2040.0 716.0 5844.0 2080.0 2212.0 2216.0 As 2348.0 lovo 1002272.0 308.0 2708.0 2236.0 unto lnto80.0 2628.0 432.0 3080.0 2232.0 other olhIothers3016.0 104.0 3592.0 2256.0 U Ieto3512.0 276.0 3768.0 2280.0 cam cast3696.0 2288.0 ca -276.0 4044.0 52.0 3992.0 3900.0 268.0 5380.0 2240.0 lie1336.0 5412.0 th -236.0 5648.0 324.0 5720.0 2244.0 tides tideatitlell5568.0 292.0 6164.0 they thoy120.0 6044.0 thl -292.0 6456.0 332.0 6520.0 2252.0 awe arise168.0 180.0 6524.0 nlI -328.0 6852.0 6912.0 nail and6704.0 84.0 24.0 2284.0 -256.0 7168.0 6988.0 ntl 6936.0 220.0 7236.0 fall fallTjvp -220.0 7456.0 C3ll 228.0 7792.0 2224.0 4 7800.0 J -124.0 7924.0 264.0 5948.0 1924.0 2328.0 272.0 For Tor2264.0 2352.0 mire Inlno2196.0 248.0 2688.0 2404.0 was 2612.0 2804.0 2408.0 aa -132.0 2936.0 3008.0 2416.0 n 2940.0 404.0 3152.0 secret 3072.0 3284.0 crct -272.0 3556.0 460.0 3624.0 2400.0 woottl 3540.0 3748.0 011111 -336.0 4084.0 296.0 2392.0 rAe Tjvprrl1132.0 2432.0 lC 5512.0 344.0 pearl -144.0 5736.0 36.0 5900.0 l -36.0 5936.0 6008.0 III ht28.0 6100.0 2440.0 i -28.0 6128.0 704.0 6208.0 2388.0 Itillhcllll its -704.0 44.0 6264.0 -112.0 6376.0 316.0 6440.0 shell 6308.0 6516.0 -240.0 6756.0 20.0 6640.0 2436.0 > 6548.0 6676.0 1I 6660.0 224.0 HIH Iles7124.0 2384.0 nealud Healud7060.0 nealuduut -420.0 7544.0 2428.0 IIcn HealudrI 7332.0 7396.0 Iu 7684.0 2452.0 II 6612.0 792.0 2492.0 2544.0 rI 2068.0 DUL 1124.0 944.0 2088.0 2520.0 uut tut2344.0 2504.0 tho the456.0 2692.0 2528.0 wound wOlnul60.0 2632.0 3204.0 2572.0 grew 56.0 3148.0 3292.0 rcw rew-244.0 3536.0 3604.0 2584.0 -76.0 3680.0 2552.0 3628.0 4196.0 nt nl4080.0 last bst11sl4324.0 240.0 5456.0 2568.0 fJlS 824.0 4632.0 5700.0 5696.0 5816.0 ttu 5788.0 5864.0 io -108.0 5972.0 340.0 6040.0 2548.0 Deep 1cci6224.0 2580.0 CII -156.0 6380.0 hcft Sca6468.0 le -212.0 6680.0 436.0 6740.0 covers COCfSCOVCC56596.0 2536.0 nil nllnU7176.0 nllAunt -168.0 7404.0 nilAnti 2848.0 14 14Aunt 6888.0 552.0 5744.0 4192.0 384.0 888.0 Aunt Anti1704.0 3128.0 4232.0 Tabithas 2920.0 480.0 1568.0 5016.0 4264.0 Wedding Weddiiis184.0 4832.0 376.0 1016.0 6760.0 4320.0 Gown 6584.0 GownBy -1016.0 7776.0 3844.0 4780.0 4940.0 By 928.0 4272.0 4944.0 Margaret 172.0 4100.0 M -928.0 5200.0 4932.0 4956.0 rct 4452.0 452.0 5364.0 4960.0 Doch 8152.0 2336.0 xmlns:ns3 ID12 5596 4436 424 5168 ns3:type 3036.0 1784.0 5168.0 428.0 2260.0 5188.0 TIIR 1884.0 2420.0 I1FJ Ili-268.0 2832.0 5224.0 gown 300.0 2924.0 5228.0 own -300.0 3224.0 3376.0 5232.0 wns WIISrwnK3812.0 5252.0 a IIn3672.0 pnlo IIlu3884.0 4128.0 tile 4340.0 4476.0 5256.0 gray 4576.0 5260.0 4820.0 IIIturfltn -140.0 4716.0 ray raytftfieln 736.0 3060.0 1776.0 576.0 T 2052.0 5312.0 2512.0 tniTitn turfltntftfieln2108.0 3092.0 5396.0 dotted doUleldoltttt3004.0 328.0 5408.0 hero hcroheru3568.0 nllel4000.0 there thtll4348.0 thtllwith -376.0 4828.0 theretvlth -340.0 2888.0 1948.0 5500.0 JI with tvlth396.0 2116.0 2964.0 5584.0 tiny they2852.0 -296.0 3260.0 3360.0 5600.0 pink Illnlpunk668.0 5612.0 rosebuds lOiIhllllsrahebutls3692.0 4712.0 5620.0 11 IlIt4468.0 11was 4836.0 IlWUH -120.0 Ittv8s 2268.0 2508.0 5779.0 5792.0 WUHtv8sevidently 600.0 elclulIll Cwhk -600.0 3520.0 3328.0 ntI 3280.0 3740.0 5824.0 nn 1111nu216.0 5804.0 old oltl3916.0 4372.0 5836.0 town4252.0 -404.0 4776.0 372.0 4404.0 5840.0 town111t 4544.0 4648.0 it -128.0 200.0 3020.0 1752.0 lint 111tbut416.0 5956.0 tnule IIIlIelonuulo2016.0 5960.0 In III2792.0 5963.0 the tllo2712.0 880.0 3096.0 5980.0 volunilnouH OII1I11I110UHvolutnluouH3024.0 4056.0 5992.0 mlddleof IIIlcll11CoC3976.0 mlddleoftliecuiitury -716.0 4772.0 IIIlcll11CoCthcCUIII 504.0 mhltllr 4616.0 6004.0 nf 4560.0 nftheit 3064.0 6124.0 908.0 tliecuiitury 616.0 thcCUIII -908.0 2652.0 theit -616.0 2360.0 320.0 6156.0 tury 2176.0 2396.0 ur -252.0 2648.0 548.0 2760.0 fashion CtlHhlollfnshlon204.0 2556.0 312.0 3416.0 6171.0 that thntthllt3308.0 448.0 3828.0 6184.0 would wOIIIII3728.0 4376.0 6192.0 ndiipt 1I111111tndnpt4276.0 3056.0 6320.0 400.0 Itself ItsolCIlsulf6344.0 clislly tenHlly2152.0 6372.0 Ill -444.0 2680.0 2448.0 Illy 2776.0 6368.0 to 2684.0 3000.0 6360.0 2912.0 356.0 3312.0 Nlylo HIlus1yIe3752.0 6392.0 littit3668.0 Iho3904.0 tll -232.0 4224.0 4304.0 iiid llIelend4132.0 4656.0 6388.0 oC4564.0 ofthe -152.0 4808.0 196.0 1732.0 6512.0 tliu1ho592.0 6536.0 century 1992.0 468.0 ceuhll -592.0 500.0 2928.0 Indotd hulellIndcefl368.0 3584.0 6560.0 1113428.0 3756.0 6568.0 tic tie3716.0 4048.0 6572.0 Mrx Als3940.0 4136.0 6576.0 -200.0 6580.0 Yin 1ip4300.0 1ip1ng -316.0 4804.0 111 -188.0 ing 1ng1996.0 656.0 6720.0 kneeling hnreling1880.0 2868.0 on Oilnn2780.0 3140.0 6744.0 thoIho3040.0 3464.0 6752.0 Moor Iloo3368.0 lnol -288.0 3896.0 III1116764.0 her hll4024.0 4448.0 nttlo 4364.0 nttlostoreroom -352.0 4800.0 6804.0 6784.0 ft -72.0 4520.0 4548.0 tt -40.0 4588.0 tlr -32.0 tlrstoreroom -184.0 4680.0 IIstoleloolll 4756.0 6907.0 776.0 storeroom stoleloolll2616.0 6931.0 mid 111111and744.0 6944.0 spreading sprefiUtlg2896.0 IIIllIlllll -664.0 3744.0 3852.0 6948.0 1ht3636.0 612.0 4184.0 6955.0 lustrous IUIIIIollslustrousfnhrlc -612.0 4796.0 IUIIIIollsrllhlle 608.0 lustrousfahlIC 7096.0 472.0 fnhrlc rllhllefahlIC484.0 7144.0 across 11108112204.0 2828.0 7120.0 tlwtilt2752.0 3136.0 7136.0 lop top3192.0 op -172.0 3364.0 3432.0 7139.0 or of3664.0 ho tilt3588.0 till 7148.0 big 3848.0 hl -224.0 4200.0 7152.0 Noahs NoahsArk -504.0 508.0 Noahs1rk 388.0 4396.0 7156.0 ollhs -388.0 4784.0 4852.0 7220.0 -8.0 4860.0 1720.0 7292.0 Ark 1rkll -160.0 2028.0 2132.0 7296.0 truck irniikt1IIII1968.0 7340.0 nfuH2840.0 7344.0 UH 860.0 7320.0 IIhCIIII11I already1I568.0 3100.0 already -856.0 3956.0 3824.0 7336.0 4068.0 fancy 7348.0 fl1l1l -416.0 4484.0 4628.0 7364.0 4368.0 ntcnsl1I 7476.0 least 684.0 1780.0 7492.0 cnsl1I 7496.0 Inking 2464.0 2488.0 klug 7516.0 III2824.0 628.0 luhcib 3244.0 hole Iwac-312.0 7536.0 IlIIel3560.0 7560.0 nut 584.0 lotting letIlog3960.0 letIlogout -584.0 496.0 4284.0 lottingout -492.0 Itltl -496.0 ItltlHll 4580.0 1708.0 7680.0 7688.0 out Hll2120.0 then tlllICthere7700.0 wide2516.0 7732.0 Il2972.0 696.0 3184.0 7715.0 certainty ertnlnty3124.0 3188.0 CIItulnt -692.0 3880.0 3952.0 7728.0 oCit4168.0 7759.0 auCCSHborn 4108.0 4172.0 7756.0 succors SIICClilauCCSH-552.0 4724.0 succorsborn SIICClilIJn 1988.0 1716.0 7864.0 born IJn2180.0 7880.0 2060.0 Jr -116.0 long IJII 816.0 7899.0 experience XIellcllceexpterlenct2672.0 experienceFor expterlenctFor-816.0 3704.0 724.0 2980.0 XIellcllce1or -724.0 2908.0 1848.0 8064.0 1or644.0 8072.0 elghteeu uhhtccueighteuu408.0 8120.0 years ytenrs2864.0 8124.0 llIrH -260.0 3452.0 8104.0 Mrs IIH -204.0 3892.0 8107.0 Ylnlng Vliiing8112.0 Ylllln hnil IInl4296.0 ten 4720.0 8248.0 been 572.0 8264.0 making nriklug11111111 -572.0 2700.0 8300.0 over Ulr2596.0 3156.0 8284.0 for COItor8324.0 a3380.0 8291.0 fnmlly autlly8296.0 COIl1IJ 4092.0 4156.0 8308.0 3984.0 8311.0 threepretty 4312.0 4380.0 three tlll-380.0 4760.0 -384.0 4764.0 tlllllrltt 1700.0 8456.0 pretty 364.0 llrltt -472.0 2172.0 772.0 daughters dnughlerHcllIlI -772.0 3052.0 2716.0 8475.0 lllr 3196.0 8480.0 nllllnud2976.0 3576.0 8519.0 as IIHaH8495.0 she shoshl4204.0 8504.0 said Rnhlsniti4096.0 4624.0 8516.0 tll4500.0 tlllelRclf 3048.0 8632.0 536.0 herself lelRclfinotsclf2372.0 8652.0 site Hho2456.0 liu 2724.0 8659.0 could cJulll520.0 8672.0 almost ahluHl3924.0 8692.0 do elo8696.0 It 4260.0 8703.0 -48.0 4308.0 4412.0 whitwlI 4748.0 4672.0 8700.0 h 4636.0 1696.0 8824.0 Jicrhpr2008.0 8867.0 ejvs JlRryrs8843.0 shut Hhmslat532.0 8856.0 Todiiy rocluJfadnyllotvetcr 3648.0 however hOJor-656.0 4416.0 8892.0 4504.0 8900.0 -196.0 4700.0 4572.0 8920.0 vs 4604.0 vs1hling 1692.0 9020.0 1hlingVIIIIIII -520.0 9060.0 wns2160.0 2424.0 9071.0 IIK 2660.0 9040.0 planning pllllllllllLplnriuhlg3400.0 9056.0 COI9095.0 none 1IrIIlnano3620.0 4124.0 9084.0 or4356.0 9080.0 thesu tlllNOthese4280.0 thesupretty 4744.0 thesepret3 1684.0 9224.0 pret311011 2156.0 9228.0 dalltlltlIdauglitetn2036.0 3208.0 9248.0 Once Oncr9252.0 011 -372.0 3580.0 488.0 3712.0 9259.0 Indeed 1I1110dludttl3412.0 9276.0 when whellwhoawhenHhc -400.0 4736.0 whellkho whoasitu 424.0 9408.0 9448.0 1688.0 situ Hhckho1224.0 464.0 2044.0 9412.0 heard hllUel9424.0 thu2460.0 2900.0 9443.0 sound 11111111Rotund2800.0 3436.0 oC3332.0 3684.0 9487.0 Il3864.0 9456.0 glrla glrln3764.0 3968.0 9460.0 I1In 4256.0 9472.0 voice voiceIn 4732.0 voiceIt 4444.0 Okl OklIII 9603.0 IIIIt1964.0 9608.0 thoInto1820.0 380.0 2320.0 9640.0 room kOm1lrount2192.0 440.0 9623.0 below hlluwhelolysilo shoRho540.0 3780.0 9656.0 started RtmlI1slnrlcd3656.0 4456.0 9664.0 oral ardardcrumpled 4728.0 9695.0 nr oralcruutpied 4644.0 -84.0 11CIlIll1lllcll 1680.0 9796.0 crumpled CIlIll1lllcllcruutpied2472.0 9807.0 Ilie9816.0 folds fllhls2704.0 3220.0 9828.0 oC3444.0 9831.0 thl9840.0 bilk klllhllic632.0 9852.0 together toltllrtotiethcrtogetheralmost -632.0 toltllrcIIlHJst totiethcrtlnnost 1180.0 1664.0 9984.0 524.0 cIIlHJsttlnnost560.0 10000.0 guiltily 2188.0 guiltilyI -560.0 2844.0 lIlltl1 -456.0 lIlltl1I -348.0 2736.0 2772.0 1904.0 10184.0 10188.0 dont ell1l1ttlont1960.0 10228.0 care Cllrl10208.0 sho3480.0 10223.0 snlelsnld3372.0 3776.0 10236.0 hersolf4040.0 hersolfwhen 4676.0 IlIrl herselftenon 4436.0 10244.0 lr lrwlwn 1660.0 10368.0 wlwntenon10380.0 10383.0 -228.0 hI lie 10392.0 olcI 2944.0 10404.0 died 111111Bled2916.0 10448.0 away nrvtty3528.0 -368.0 WII 4060.0 10428.0 3784.0 10431.0 -56.0 4212.0 4328.0 dontcare 4332.0 elUIItelUIItenre 1656.0 10571.0 10595.0 enre2136.0 Im 11111984.0 10580.0 going 2380.0 gol -428.0 2588.0 olll 10620.0 g 3264.0 10600.0 have hove3160.0 1111 3616.0 10648.0 3424.0 3720.0 10612.0 this thldlhlssilk HllJ4004.0 4492.0 10632.0 4556.0 10668.0 xmlns:ns4 ID13 18720 4608 112 10799 ns4:type 2248.0 10799.0 y nun2992.0 2748.0 3608.0 10808.0 make 1111110audio3120.0 4116.0 10847.0 OlI10852.0 utsasgood 4704.0 10856.0 IIAODel -68.0 utsgood 1648.0 10952.0 good AODel2072.0 10983.0 fiR1s2004.0 2304.0 10987.0 new nett10972.0 without wlthollttVIHmut3340.0 11020.0 3420.0 3500.0 hit 3760.0 11000.0 or11004.0 trimming trlluull1gthlllllill 4708.0 thlllllillueollt 4596.0 1644.0 11152.0 11156.0 except ueolltwhat wlurit2144.0 lIl1t -248.0 2608.0 11164.0 Ive 1we11184.0 got 2740.0 ot 3352.0 11180.0 IIIit3564.0 fie flltte11191.0 house hOIlSllionsr3792.0 4420.0 11212.0 111111earl11327.0 11808.0 clo11372.0 so 50s12332.0 11355.0 want WIlltwaut784.0 2816.0 11364.0 Komcthlig sometblrg636.0 somuthh -784.0 3600.0 11380.0 thats thnts11408.0 prlttJ948.0 1632.0 11520.0 lllleltututl11524.0 III11539.0 styleThe 2140.0 style 5tlu5tluIhl 11716.0 Ihl2164.0 11719.0 IIIKthostwords rlmlRtvurds11784.0 CIIII1lcarne11764.0 3476.0 4012.0 11780.0 rhe rllrho3912.0 11787.0 rush rashrushnf -324.0 11815.0 IU -320.0 IUor 1624.0 11907.0 orof11951.0 < 11944.0 11916.0 10llg2496.0 11940.0 pentup IllmtuIIpent -576.0 11968.0 tgl 2820.0 3172.0 11948.0 stream HtlCamsheauuNot 11975.0 since RltH 1620.0 12096.0 tllo12111.0 girls lrlR 12120.0 had IInclhnd12139.0 outgrown ootgrortnollt 3272.0 12176.0 IO1I 12156.0 their thcie12159.0 4160.0 3860.0 lIel 3836.0 12196.0 4076.0 12172.0 holy hahyIIlIh 4668.0 IIlIhJlothcs 1252.0 1608.0 12288.0 clothes Jlothcs2208.0 12308.0 hud hllc1hind2564.0 12316.0 2484.0 12319.0 hH 2860.0 12323.0 Vining3108.0 12328.0 Inlll 3484.0 12356.0 owned oWIIlll1otvneul12387.0 4180.0 12391.0 gOW1gotsn1604.0 12472.0 thntt11nt12496.0 even ecett2316.0 12527.0 680.0 12516.0 remotely rculotely12520.0 rcmotel -680.0 3216.0 876.0 12544.0 approached 1IIIIIrO1Cllei4360.0 12556.0 tlmtHint4216.0 tlmttlenl -304.0 4664.0 12667.0 Ideal tlenlIdealTho IdealThu 12672.0 tlenlhu 1736.0 12868.0 Tho Thu1864.0 hu 588.0 12875.0 Ylnlngs 1huugs12880.0 lnhl 2624.0 12928.0 2764.0 12895.0 lived Ihll3212.0 12912.0 la3132.0 3404.0 12948.0 a3336.0 12932.0 3488.0 Ilrett -464.0 12943.0 cottage ettoJeettoJen 4652.0 1592.0 13052.0 13083.0 1804.0 13088.0 a13076.0 popular IIOIHlIII1popunr1888.0 13092.0 suhurl Huhl1rhsulurh13103.0 kept IWllt3660.0 13147.0 n3596.0 3816.0 13120.0 trim 4140.0 13136.0 111011of 4220.0 maid moll1110114592.0 maidofnll molloCn1I 1572.0 13248.0 ofnll oCn1I13252.0 1976.0 1796.0 nll 13267.0 work w01I2600.0 13311.0 gave gnweAn 2960.0 2884.0 13324.0 e 13296.0 teas tmRtensHurl ami111111664.0 3972.0 13320.0 provided lHolelcIJ3788.0 providedmusic lHolelcIJUlIRle 660.0 3076.0 13444.0 music UlIRle13464.0 IIIILlumid13471.0 dancing lhtntingelllllllll 3164.0 13491.0 lessons 3936.0 13508.0 Cor3804.0 13512.0 thelt13515.0 theltc1nuhtIH -364.0 13631.0 laughters c1nuhtIHilnughtets13659.0 in IIIht2340.0 2720.0 13668.0 addition 1Ic1IUtOIlntlditi01t13716.0 3724.0 13692.0 tho13712.0 regular regularcourses 4640.0 13736.0 lc regularConrse8 lIll1r -308.0 lIll1rCOI1jlH 1564.0 13848.0 13856.0 courses COI1jlHConrse8at littut2444.0 13852.0 tlw2364.0 2756.0 13863.0 public Imblle3300.0 13880.0 schools Iwhool83228.0 13896.0 III3832.0 13904.0 fact falt14016.0 thlY2000.0 14023.0 hllllhnd14056.0 enough lmouJh2276.0 14064.0 Co 3268.0 14100.0 14071.0 tho3240.0 3688.0 14088.0 comforts OIl1COIIRtonuforls14104.0 fir712.0 14204.0 14216.0 1556.0 llfo lICe788.0 1900.0 14224.0 1812.0 14264.0 n2500.0 14235.0 little llttlnIlttJ 2948.0 14248.0 left IcCt14292.0 Olr3700.0 14272.0 Cor4008.0 14279.0 3920.0 14284.0 lox luxIlIxIlIxUrllR loxnres 14356.0 1552.0 14404.0 uries UrllRnres14415.0 but hutbutt1928.0 14424.0 thnttint14439.0 2768.0 lIttlll1tlwr 3232.0 14456.0 either -440.0 14468.0 III14480.0 whole tvholawholeor tvholaor-452.0 4612.0 14603.0 14619.0 part pnrt1712.0 14643.0 never 14627.0 fell Cell3392.0 14640.0 Airs MraMrs3296.0 3820.0 14656.0 YlnlllJVhuing2932.0 14783.0 One 1824.0 14820.0 110 -164.0 14807.0 month mOl1th1t2540.0 2784.0 14848.0 wen WlI114831.0 weak 14827.0 3168.0 CO fo-216.0 3456.0 3508.0 14875.0 14840.0 tctvtnbjo tentahlltca 3944.0 tnhh 3876.0 14864.0 14884.0 4532.0 14971.0 14976.0 1668.0 14980.0 if rplratlons -52.0 2812.0 1256.0 15260.0 15308.0 0 tt3492.0 15300.0 Inn 3524.0 15304.0 social Roclnt15287.0 ns nsplratlols lA lAl1lrntl0I1R 1508.0 15448.0 15455.0 plratlons l1lrntl0I1Rplratlols596.0 another nnothel2200.0 15451.0 3572.0 15484.0 Wns was3808.0 ab nb1babsorbed 4524.0 nb80rht11 1bsorbed 15512.0 15639.0 15655.0 sorbed 80rht11by lay2024.0 15687.0 a940.0 15648.0 subscription HubllCllltlClnHuhSCrlptlon3548.0 the15644.0 boat 1I0ntboatclub -332.0 1I0ntclu 15836.0 15843.0 club 15847.0 clu fmBertha Berthn2876.0 athletic nl1lletlentlllelle3840.0 laughter dulgitcrlaughteror dulgitcror-696.0 4536.0 15840.0 11II htel htelor -284.0 4508.0 3012.0 16031.0 16068.0 1764.0 16040.0 1952.0 16036.0 11nnelugrlnnclug1852.0 letsol1Y2636.0 3348.0 Cor3640.0 OCteclI ffteen884.0 3644.0 fifteenyear -476.0 4120.0 fifteenyearold -884.0 4528.0 16060.0 year -344.0 yearold lU lUolet 748.0 1520.0 16228.0 olet412.0 1856.0 16231.0 Edith BetlthIalltliEdithThen -412.0 Betlthfhln IalltliTbcn 16415.0 16423.0 Then fhlnTbcnther2592.0 16452.0 were 2524.0 2968.0 always nlwns16419.0 the16443.0 gownsgownS 3948.0 gowns 4440.0 gownsgowns ons -396.0 onsJXOWIIN 1524.0 16603.0 16644.0 JXOWIIN16616.0 tutfur16612.0 Kllens lllnHEllens2368.0 -524.0 whist wllsttrltlst16607.0 parties pnltlcsanl unJanlUcrtlws unJlcrtlllls 16640.0 ni nilertlllls 4432.0 1528.0 16796.0 16807.0 Ucrtlws lcrtllllslertlllls16804.0 tennis tellnlstetunis2184.0 clltoeitlt3200.0 11111nud3552.0 3472.0 Kdlths I1thRltthsdanc dnncdnnclnJ dancfog 16864.0 16999.0 fog inglnJ1860.0 class cInRR17028.0 gnw OWIS 17032.0 s 3032.0 3088.0 cotton CottOIl17023.0 miu ItIhnnr4072.0 crepon CllJ10nerepou3988.0 erepounod 4584.0 creponnnd CllJ10nnllil 17183.0 17188.0 nod nndnllilBilk1816.0 17192.0 111111lordmuslin 111111111117216.0 gnrvnnoW1I8 thntoven Olnoten4144.0 otenwhen 4236.0 ovenwhen OlnWhllIlUOIIUfllturcl1l1t 17380.0 17383.0 1788.0 WhllIlUOIIUfllturcl1l1t 1072.0 manufactured tonuufactured-1292.0 3316.0 17387.0 homo hllIIItmuonnd nud3772.0 756.0 ltIulmollo 4104.0 ltIulmollooe1 -756.0 made matet-408.0 madeover matetover 17567.0 17604.0 oe117580.0 from trOln17575.0 material IIInlcllnlmntcvlul17571.0 thnl17599.0 Wl14wus3516.0 tillthehouse tillhOl80 1544.0 17768.0 hOl802148.0 11117799.0 some HUlllesotue17796.0 way wurtvuy2744.0 17772.0 ate ntcup 3448.0 17792.0 every ocrypen 11cnPell4188.0 penny Pell1y 4552.0 17827.0 17952.0 17987.0 ny 1y1548.0 1836.0 17959.0 thnt17956.0 theIIIl1e2480.0 mother 1II0thlIll1ulluttllaid lnhllnlti3932.0 byfor -180.0 b bfor -88.0 byr 3252.0 18151.0 18211.0 1060.0 Iforhrl18180.0 ottnmodest lIIo11lslnunrlrst3288.0 outfit ol1t1llolllitolllitIn outfitIn ol1t1llIn 1676.0 18335.0 18348.0 18344.0 tho1840.0 end NulcudIrl 2872.0 18375.0 rut 2996.0 18340.0 Vlnlng 1Inlug3116.0 llIln nln -536.0 4088.0 R 4148.0 Clthrreithernttemlod -448.0 ClthrrnttCIII11lt eitherattended 18535.0 672.0 18539.0 attended nttemlodnttCIII11lt2312.0 Dawton nnwtull1ntvton18543.0 tlnll111111516.0 church chllnh4392.0 18567.0 SII4292.0 sociables SIIcln socinbles 18592.0 18692.0 18723.0 ciables cinblescln -528.0 18727.0 hlcs arrayed 11111111118763.0 a18719.0 prehlntorlo 111lhlclOllcprebttoteblack bllurlcblacksilk lI bllurlcIlk -80.0 18760.0 lt ltsilk 18916.0 1640.0 Ilk 1828.0 18951.0 0118920.0 stayed staycd18924.0 tltl ull 18948.0 tiwayI1wn 3396.0 altogether nltogetllernlhl -768.0 4164.0 llhlr Of orOflate 4600.0 orIntI Oflute 19108.0 late IntIlute19111.0 loudhllelllhn 544.0 -356.0 sluyed19124.0 111I -484.0 Iel 19139.0 19143.0 andthe 4316.0 millmillthl 19299.0 thl19303.0 HltlsIIlIhlsatdthnllt -100.0 really 111111 -432.0 4208.0 19332.0 wnswnsnot wasnot wn wnl1nt 4516.0 19496.0 19500.0 l1ntworth while tvhlloCOl1II0tlltl3236.0 3996.0 havegood 111Honel 19687.0 HonelclolIlCN19691.0 COl41101w 19719.0 IIlCr19704.0 wont went4032.0 4268.0 19715.0 any anywhere nl1 nl1whml anyavhore 1792.0 19875.0 where whmlavhore19879.0 millnuddidnt 1111111t19912.0 lOIecareBeing lOIenChl 20068.0 20136.0 Being I3eIuugnChl llolly20072.0 amiable nmlnlllc3504.0 20076.0 nnl1nod20079.0 sweotna 1ICfltlnsrveetnnsweotnaturcd 1ICfltlni 4480.0 20228.0 20344.0 -60.0 20260.0 turcd t1re111408.0 1980.0 lrIH 2468.0 2664.0 20263.0 probably Irohlthlprohttlly624.0 believed llelhIllhellevcdbelievedwhat -624.0 llelhIllwhnt hellevcduvltnt 20451.0 whntuvltntthc 20455.0 snlll111111111IlulccdIts Itnmlsquite Iultoquitelikely 4608.0 Iulto11cl 20639.0 likely 11cl 20644.0 tent1896.0 thn 2356.0 20651.0 20675.0 -424.0 20679.0 C 2880.0 648.0 occurred occurrrll20659.0 them th1nthenthemthat th1nthnt thenthat 20832.0 thnt20836.0 1II0th -540.0 elhllt2324.0 20871.0 carocitro20852.0 3632.0 20876.0 20880.0 3796.0 20843.0 nnywhereanywhereliocmisp nnywheref whIo -468.0 whIo11uenutll 21023.0 21079.0 f because liocmisp11uenutll1376.0 2292.0 21027.0 Shl2656.0 hllclluau21060.0 no Un21031.0 suitable mltnhhsultnhlec1otlll3928.0 clothesMeantime -532.0 c1otlllj clothesrenntinuc 21220.0 21227.0 j Meantime Menntllllcrenntinuc1400.0 21224.0 Mr I1t2732.0 VlllingViung81hlsail3496.0 nothlu J1othlunothlunt nothing nothingat -588.0 4620.0 21408.0 21415.0 atall 1111till1740.0 tillBut allHut 1111But 1728.0 21603.0 But Hut2100.0 Just JURtwithin 21607.0 2988.0 Inst li 3652.0 21616.0 week 21643.0 k 21612.0 MrsYlnlng tis tisluting 4568.0 rl rlIIIIII 4472.0 1600.0 21787.0 luting1724.0 IIIIII 21796.0 111111luul21827.0 como contUcono2476.0 21803.0 21831.0 ore3732.0 very cr much milchtuulchmuchboth milchlJOth tuulchq 21984.0 22072.0 q 1580.0 both lJOth1388.0 about nbollt21987.0 clot 3104.0 21991.0 hIs 111111auul21995.0 abantIIh 22004.0 lIt goingsomewhere goingsonewhere OIIl OIIlsOllehcll 22015.0 22175.0 864.0 somewhere sOllehcllsonewhere22183.0 III22188.0 two 2892.0 weeks WUlHtveuks3872.0 thCw22216.0 WIIHwasto WIIHto 1588.0 22367.0 22372.0 bo 110be22400.0 arei 564.0 reunion rtIlUlolIuton 22376.0 thl22379.0 A Alr Avery 22403.0 3908.0 family U1l1l -392.0 22383.0 ntattho nttho atthe 22556.0 22560.0 the22563.0 place Illnclponce22567.0 III844.0 3176.0 22571.0 Averytown Avery1own22595.0 4020.0 tOWII Now NewNetyNetyi NowHampshire NewUl1mJ1 22747.0 22795.0 + 22819.0 -12.0 1584.0 22755.0 Ul1mJ1 1384.0 Hampshire lntnpslthchhl turdlIi1e22759.0 IUlIllullheCnasked nsltcdaskedto -436.0 nsltcdto askedto1464.0 22935.0 22952.0 write WlJllrite 22943.0 22979.0 poem 111ClUpoetspoemiou poetsYou 2808.0 23132.0 iou 101You23167.0 sec setsee23139.0 Ihavent hnlIItlunvent688.0 23143.0 forgotten Cor -688.0 23151.0 oth 23180.0 3980.0 23147.0 tholollovely lolJ 23211.0 23327.0 ly poetry 110etr1628.0 23355.0 you 23359.0 OU 23331.0 used USll123344.0 3028.0 23335.0 wlltu23368.0 111illthC23340.0 days dayswhen ell1 daysthen 23371.0 6 6wheu 23515.0 wheuthen23548.0 2012.0 OI1 23552.0 Wlro23528.0 Grace Grncu23559.0 race 23531.0 23563.0 4028.0 23535.0 IImltillthelAvorytown tillA ther 23712.0 lAvorytown Aterylotr11-888.0 23715.0 -4.0 urrtowlI 23719.0 poet IWlttenethello Iwlllbills23723.0 nllllglass glnsRQCoffashion QCfashion 23903.0 Ill2168.0 2640.0 23907.0 III23935.0 one IIUl01113344.0 23927.0 wrote WIoic3868.0 23916.0 home homuhomestaying homustnIII 3068.0 24095.0 staying stnIII -604.0 cousin cOllsl1I24100.0 who 24104.0 h1Ilhnd3180.0 24115.0 sent lIlt 4064.0 24111.0 4408.0 24107.0 tilltheinvitations tillfnltntlons theInvitations 24288.0 invitations fnltntlonslInllIIlU1l11f 24327.0 et 24323.0 count uer 24332.0 emO1 4112.0 ItSamylmychief 111chleC 4540.0 amylY 4496.0 24479.0 24487.0 Y 24483.0 chief chleC1352.0 764.0 attraction nttmctlollnttrrclluWhich 1Slulchhllll 24492.0 letter 1ltlI24523.0 goes goesfar 18 181nl 24667.0 24683.0 far 1nltoward townrc1804.0 explaining cxpatuhlgXIlallllI -720.0 24680.0 thlspecial specbtl24711.0 tlll llrll 4384.0 24687.0 ells disillsdisfavor ellsfnor illsfavor 24744.0 24855.0 24871.0 favor fnor24860.0 which whllh11r43356.0 llS 24867.0 1IniugIIIIIII 24875.0 llu1hindhadeyed llu1c hindeyed 25044.0 25068.0 eyed 25095.0 c 1956.0 25055.0 the836.0 prehistoric 11lchhllIlcprehisterlchlnlk25059.0 4248.0 WhllIthenwhenshe WhllIslio 25239.0 25256.0 slio81101940.0 25247.0 took tooldown 1I0 2956.0 25243.0 thllt25252.0 morning 11101111111tor4424.0 thesixteenth 4660.0 theslxte 25436.0 25447.0 slxte 732.0 25440.0 sixteenth 1972.0 nth 25463.0 course COUlSOor728.0 alteration nltcratlcnalterationMrs -728.0 nhe nltcratlcnMrs 25451.0 mUell mUellMrs 1748.0 25627.0 25644.0 2228.0 25631.0 Ylulug VhulugluluJ 25651.0 WIItho25639.0 lIIothlrofcrown of1lOWI1 ofgrown 25815.0 25863.0 crown 1lOWI1grown25819.0 ctnlljbtersj11m25823.0 thlslit25859.0 tireswo 4152.0 25832.0 such lIuch25867.0 uabrighteyed ubrlgbtercd abrlght 1612.0 26003.0 896.0 26016.0 brighteyed brlgbtercdbrlght -896.0 1008.0 pinkcheeked Illnkche -1008.0 pitk cheekeu 3460.0 26007.0 kell 26023.0 11111IIltoIIltogethrr 26087.0 640.0 26196.0 26247.0 1596.0 26220.0 gether gethrr924.0 26200.0 youthful outhCut lIttlo26207.0 lI1othlrtoothier26215.0 thlltHutt1t26211.0 is isnot Isnot 26387.0 26419.0 26411.0 be hewondered wom1crNlbelvondercd-176.0 26404.0 nt26391.0 tlllitthou3388.0 26399.0 sineshrank hlInltshranlcshrankfrom shranlcfrom hlInltfrom 26583.0 26612.0 26599.0 the26588.0 ordeal ordentoCreturning lturnllll26603.0 26595.0 whntwhatthe whnt1he 26763.0 26799.0 1he1944.0 26811.0 newspapers ncwspl1pers26823.0 uewsp -924.0 Iter8 woulci26779.0 rail cull26783.0 thl26820.0 scene HCllIesceneoJ HCllIeof sceneof 26956.0 26999.0 oJ26991.0 1772.0 26975.0 girlish triumphs trh1wpllsgownid owlIldgowimedIIIInblack IIIblnck 27151.0 27183.0 blnck27175.0 sill silk27171.0 thnt27164.0 Was tiresliS shiny shill 27167.0 whlrlvhiereItought 4684.0 3084.0 27343.0 27372.0 ought 27379.0 111027359.0 beelllustreless luahllcsli27387.0 narrow rJr1owflflrrawnarrowWhertj rJr1owI1rb flflrrawt 968.0 27539.0 27583.0 27543.0 Whertj wluerb1028.0 1768.0 27571.0 I1rb 27567.0 27556.0 27547.0 2904.0 3276.0 bavo bnvobasotll11I27551.0 broad 101111broadand broadtint 101111ittl 27720.0 tintittl 27751.0 bronl1912.0 27747.0 wl1erl27735.0 27723.0 should 27731.0 he4344.0 27740.0 beenr beenuirtrowa bl11beennriYrotv bl11ll1 952.0 27875.0 27911.0 nriYrotv 27979.0 ll1 820.0 uirtrowa 1756.0 1800.0 lOVa 27967.0 gpwnCQwn27931.0 Ju InIu27924.0 fnct27919.0 thnt that3612.0 27927.0 exhibit exhibittd 27955.0 exhibitell 4176.0 hlll1t hlll1ttl 28108.0 28156.0 td elltl -92.0 1872.0 28143.0 hl1allthothe28139.0 known 752.0 depravity 28119.0 delr -752.0 3856.0 ltr clotlllclotllll 4692.0 clothestr 28771.0 tr 29376.0 N 29451.0 xmlns:ns5 ID15 5548 3196 4868 5228 ns5:type 5004.0 Ihllt5388.0 hl1o5812.0 outlived outlhclloutlirctltholr tlwlrHo11r6428.0 6932.0 5284.0 allotted nllottell6864.0 7588.0 5300.0 period 7508.0 periodof periodoC4988.0 5424.0 oC5436.0 service HIJIlcuHetvieu5144.0 serviceI HIJIlcuIHetvieuI5776.0 5384.0 5652.0 suppose RUIlloe5264.0 Inn620.0 6464.0 5656.0 horribly horllhlJ6348.0 7188.0 5680.0 selfish elfish7084.0 7780.0 5692.0 nllel7672.0 andworldlyminded 8060.0 nllelWOIltll andaoIQIynlluijcd 1208.0 worldlyminded aoIQIynlluijcdWOIltll -1208.0 5640.0 5828.0 lIIllIded 5464.0 6408.0 5847.0 tb06476.0 he 6644.0 6716.0 5852.0 5876.0 lIIotlHr7076.0 5884.0 IUlllhailhadMild 8052.0 IUlllin hailsold 4980.0 6000.0 Mild sold5008.0 6028.0 5280.0 5152.0 leI 5124.0 5400.0 6020.0 tu5660.0 6016.0 lIelsclr5544.0 6304.0 6036.0 thllttint6728.0 6055.0 1II0IIIII1 6616.0 1328.0 uturnlng7520.0 6104.0 liB1s7372.0 6076.0 shusllft7692.0 shusat 8056.0 sllftHilt shesat 4976.0 6188.0 6200.0 sat Hilt5324.0 IIIbr5196.0 5588.0 the5940.0 study 6228.0 slllll 6496.0 6236.0 trying 6239.0 trJlu 6964.0 7080.0 6860.0 6268.0 read rel1drend7228.0 7812.0 flue thotllo5048.0 6355.0 Womans WOIIIIIIIHSutmn86432.0 page 5688.0 llU 6084.0 6452.0 o 5968.0 6272.0 6420.0 III6423.0 tho6400.0 6876.0 Boston Hoston7512.0 World WOIIII7392.0 11o 7988.0 7860.0 6460.0 Id 7824.0 4972.0 IIhut 5064.0 hut 5308.0 5564.0 does eioCIItines5488.0 5976.0 6636.0 seem HCCJlIIscent6648.0 liSas6672.0 6620.0 If It6592.0 6628.0 6788.0 7000.0 couldnt eoukhut6920.0 7708.0 bear hCI11boor7620.0 5176.0 6768.0 Ir5072.0 5292.0 6808.0 11n5208.0 tvny5708.0 6815.0 wasnt wIIHnt5784.0 6604.0 6824.0 opened ollIlllopeneu6832.0 Cor7128.0 7564.0 6868.0 me 7464.0 7896.0 6856.0 7696.0 4964.0 6952.0 hlle7004.0 5320.0 5616.0 6999.0 now lIewnew7020.0 6132.0 7023.0 OWII6564.0 7040.0 Ol 6892.0 7012.0 thllt7304.0 7032.0 7196.0 5080.0 lust5524.0 5856.0 5768.0 7200.0 5668.0 7207.0 5848.0 796.0 5964.0 7192.0 something 6168.0 HOlllctlllll -796.0 uetluilg 7104.0 7212.0 thothe6996.0 7448.0 7224.0 fl18hlonfashionnotes -568.0 8016.0 fl18hlonlIotell 4952.0 7352.0 notes lIotellcaught 5348.0 7388.0 ctlu ht hUlbet7391.0 attention nttuntlollntteutlo116404.0 7368.0 7412.0 millamid7432.0 set liCt7652.0 4948.0 7531.0 7556.0 5192.0 5476.0 7551.0 reading lloellllJrendingJII6060.0 6336.0 earnest oallIestearnestUevlvnl -564.0 6900.0 oallIestHthnl earnestRevival Revival UevlvnlHthnl5896.0 7752.0 or5752.0 Taffeta 6052.0 7768.0 lIrretn 1128.0 6880.0 SllksAmong SllIsAmougSilksAmong6736.0 4936.0 7916.0 5288.0 7940.0 most IIIIISt760.0 5764.0 7948.0 attractive nttroetlo7996.0 gownH7244.0 7984.0 III7300.0 7376.0 7504.0 8024.0 COllrriOcourseof -500.0 8004.0 COllrriOor 4924.0 oruthitug11I1I11t1 5772.0 8148.0 5664.0 8140.0 6120.0 6056.0 8172.0 winter willtcrreinter6096.0 8164.0 festivities cHthUIs6748.0 8216.0 arc nroare7624.0 4928.0 taffeta tlllruia5548.0 8320.0 silks spickHili 8332.0 figured lIIIIeelIhgieeti6688.0 8348.0 III6556.0 8383.0 6820.0 6956.0 8359.0 tln 7256.0 8372.0 flowers 1I0wersflottnrs4920.0 8492.0 like IllwIlhetthose hoso8548.0 worn WOIIItv01n6248.0 8528.0 6152.0 6508.0 8567.0 our ollr6328.0 1084.0 8560.0 grandmothers graudtoolhurs1IICI -988.0 7936.0 7316.0 8572.0 IIIOtwIS IndeedIt IIl1llLcJltlndeedit8708.0 Is IH5832.0 8712.0 millHeld6212.0 8724.0 thlltlint6136.0 6588.0 8760.0 many nanny8764.0 IIIlIn 7008.0 7068.0 8756.0 HIICh6904.0 7480.0 8792.0 gownsare 7484.0 JOWIIH7976.0 7980.0 8795.0 JOWIIHlire 4908.0 8908.0 are lirebeing 11I1t1J5148.0 868.0 8924.0 resurrected 1OSII1Ictcc1yesurreetetl6696.0 8928.0 CroUlfrnui8944.0 oleloltl7052.0 8959.0 trunksand 7468.0 trunks truuks4904.0 11111chostH hIIIIHchrstH5912.0 ly6092.0 6220.0 9112.0 lucky 9116.0 luck 9168.0 owners OWllcrs6896.0 7816.0 9160.0 orofsuch 7972.0 orHIIIh 4900.0 9272.0 HIIIh5360.0 9292.0 ancestral 1IIeHI1alnucestrttl5240.0 6176.0 9303.0 finery Ihuery9320.0 lIudanti9327.0 7044.0 7628.0 9340.0 only oulJ1356.0 4896.0 slight Hlhht828.0 alterations ulterattous5328.0 111Illn -828.0 6252.0 5892.0 9484.0 tlolls 6356.0 9500.0 will tvlll9544.0 grace grnco7272.0 9555.0 mutiny1111111 7808.0 or9652.0 tllctilt9692.0 seasons HCIISOURHrtisoaH5128.0 9684.0 tCIIS6364.0 nlld9715.0 receptions luclltlollHreceptionsnITtta -776.0 7532.0 5112.0 9848.0 JnIYltIL9855.0 nITtta 5672.0 5868.0 9872.0 11I 6140.0 700.0 9903.0 IIllcstlnl9920.0 flllerr4888.0 10036.0 dropped eirolllwll10056.0 dlsjolntedly elltlJollltcdlydlsJointedly5484.0 6652.0 10087.0 CIOIll10104.0 1lrL10107.0 lrM 7616.0 10116.0 Vlu7440.0 4884.0 hugs ingsJn 5164.0 10271.0 H 5012.0 10240.0 lips 1IIH10284.0 IIHtus5920.0 10260.0 sho Hha1411010268.0 InlelIntel6172.0 6624.0 10280.0 clown6532.0 10291.0 tit thotlw7036.0 7452.0 10336.0 paper 1Illlrilltptr10424.0 Why IVii hr 5220.0 10440.0 thllo10455.0 III10464.0 6108.0 6712.0 10472.0 Tnblthns lnbJtlmHlablthns6600.0 7568.0 10503.0 wed wellwetl7444.0 7892.0 4868.0 ding dlug10615.0 dlll 10659.0 gone5100.0 10663.0 xmlns:ns6 ID16 17448 3216 4724 10816 ns6:type 5000.0 10816.0 That Jhnt1hnt652.0 10832.0 wedding 5368.0 wc1lIn -652.0 10860.0 gownl 6024.0 10884.0 6692.0 ownl 6840.0 U7092.0 10904.0 ever ecr7528.0 therl7424.0 therlwnH 7920.0 thererwnH 7900.0 11012.0 11028.0 wnHrwnH11048.0 11II5160.0 IUllu5304.0 Illustration llluslIlItlonIllustrntlot5740.0 11055.0 or6968.0 11064.0 tho7268.0 11088.0 proverb IUocrhIUocrhrr 7872.0 11200.0 Every Ltery11235.0 rr 5496.0 dog 11215.0 5860.0 11220.0 has hOR11232.0 his 6116.0 11239.0 day tinyehl 11252.0 7208.0 11272.0 wnRtvna7596.0 11276.0 thatancient thonuclcllt 7836.0 4844.0 11392.0 ancient nuclcllt5472.0 11423.0 garment nrllwlltgnrnumt11432.0 11436.0 dozen lloll111447.0 times tllllcHdunes6928.0 11488.0 e1Y11592.0 11612.0 5024.0 11616.0 Cor5552.0 11607.0 twenty 5480.0 -544.0 5624.0 wCllt 5604.0 6160.0 11648.0 5984.0 11655.0 enrH 11631.0 Jt11636.0 llIlelhndlieIll7108.0 dug dus11723.0 7908.0 troll1trot11800.0 time780.0 ponderous POllll1rouR11832.0 NOllha7600.0 11852.0 Arkof 11856.0 5084.0 12004.0 n4992.0 11984.0 trunk 11lIIlkirunlc5796.0 11992.0 11995.0 5952.0 12028.0 12012.0 examination cxumlllntlouextunluntlon12040.0 7064.0 12064.0 IIU 7552.0 final flunJfinalrejection 7884.0 12043.0 flunJIlJcctlon 12164.0 rejection IlJcctlonrejectionIt IlJcctlonIt4968.0 12360.0 12363.0 Imclhail5504.0 12372.0 heln5428.0 5904.0 12400.0 suggested 12415.0 HU -748.0 lflte1 6064.0 6724.0 12435.0 liS1s12444.0 aball hnll7024.0 12420.0 dross dressdrossas dressOH12424.0 clr 7612.0 12464.0 7604.0 7644.0 12459.0 ss ssnH 4824.0 12564.0 12580.0 nHOH5044.0 12584.0 ateagown tlngoWIItengown5132.0 12612.0 liS5880.0 6216.0 12619.0 a12588.0 lining llnlllJ12608.0 Cor6812.0 12639.0 an nn7100.0 12648.0 opera ollcrlloperawrap 7820.0 ollcrllWIlIp 12759.0 12768.0 wrap WIlIp5344.0 12783.0 nR1IIIII0stalniost6196.0 12812.0 Ocr 12796.0 article IIrtlcle7284.0 12816.0 oC12820.0 fem Cem12851.0 emit 7832.0 12888.0 4816.0 hint inineIlIlne12956.0 apparl IIPllllrtIapparr112967.0 12972.0 hnelhind12984.0 beCn6608.0 7216.0 13000.0 handled IInl1elltdllnudled13123.0 literally IlterfullyJltCrllll 13144.0 IIII1J13151.0 figuratively IlgurntlvelyI1 13168.0 Ulntlel 6908.0 13188.0 until 6664.0 7356.0 13195.0 7260.0 13232.0 ttaswasn ttasit13175.0 13328.0 13344.0 11itwonder wOllehl5676.0 13335.0 Hot tTatttnt5572.0 13379.0 6300.0 13388.0 rag 6656.0 13372.0 oC6444.0 tllOoriginal Ollglnllfabric fn hrle 13532.0 remaned 13556.0 rlll1n 6068.0 rtenltiu 5732.0 13539.0 ed 13576.0 5988.0 13548.0 Al13552.0 rnct13563.0 net 6848.0 13572.0 13604.0 HUlilloHe 13699.0 13720.0 must mUHt5404.0 13732.0 get 5636.0 5716.0 13727.0 along ill 6144.0 13764.0 1g 13744.0 rvllh13751.0 AUllt7048.0 Aunttwcdding -1200.0 13760.0 Tnbithas fl1hlthns-736.0 Tnbithaswedding -732.0 7856.0 720.0 7140.0 fl1hlthnswehllng 13887.0 13900.0 wehllngtwcdding13948.0 gorvl 5440.0 gowiY 13952.0 ClWI 13931.0 IIl1elHail13975.0 cOlliecoma6480.0 6980.0 13959.0 be7232.0 13972.0 7852.0 14084.0 Vlllllls1hiing5392.0 Cnll111 872.0 Impression 6080.0 14132.0 IIIl881011 xpressiou6800.0 14143.0 6972.0 14176.0 Qr 7132.0 14152.0 7472.0 14163.0 mustgive 7848.0 mustgl give gl 5092.0 14316.0 14320.0 UI getting 14308.0 gcttln geltinanything nnylluing14347.0 1I1I -700.0 thlug 6276.0 6884.0 14360.0 1I0WwhllltvhllehltIhut14476.0 5088.0 14483.0 heirloom IllhlolJlnhtelrloonu14492.0 Itwit14540.0 was676.0 14535.0 regarded 6776.0 14555.0 legnr -676.0 7400.0 14544.0 ec1 14575.0 IIR asIIRn 7840.0 asn 7716.0 isn 14676.0 14695.0 symbol m1lo1 5492.0 14688.0 or976.0 14704.0 renunciation rtnunclatlonrenunciationwhen -972.0 14724.0 -968.0 mncltlon mncltlonCI 7828.0 14700.0 Iei 6112.0 15028.0 15072.0 CI eitint 1111115068.0 15063.0 won WO115076.0 t7116.0 7360.0 15039.0 Jnu lnttgh 7584.0 lnttghwhin hwhen 15223.0 15232.0 whin5248.0 5580.0 15228.0 hlIrtthntntlnst lastthodesplsed de 7736.0 despised 7608.0 Ie Ie11lllsed 7744.0 15291.0 15416.0 15424.0 spised 11lllsedsplsed5336.0 5872.0 15431.0 6312.0 15420.0 Rtlonl1l16940.0 thntthnttheir 7788.0 thatthllr thattheir 15608.0 15615.0 thllrmotl wnllwear wern15611.0 nt7172.0 7548.0 7436.0 theAvtry then1Y theAvery 15804.0 15816.0 Avtryn1Y 5204.0 5340.0 15808.0 lc11lonlAt 1nstthnt6924.0 7488.0 15832.0 WI1Hwaswhat WI1Hwhnt 15992.0 16007.0 whnt1lrshs 5508.0 16000.0 VIning5780.0 Inln 6256.0 15996.0 hlc1humidthought thousht16027.0 nilshoHhlshofolded 7796.0 Hhloldeel shefnidcd 16187.0 16196.0 folded oldeelfnidcd5296.0 hl1het5212.0 5608.0 16224.0 1I1erpnper5540.0 16191.0 IInll6048.0 Htnrtcel6396.0 upstnlra IpqtnhsupstnlraIt IpqtnhsIt-660.0 7748.0 16220.0 atnirs atnirsIt 16375.0 16395.0 5096.0 was16404.0 16384.0 1nlll16380.0 IInllend6484.0 hccnkneel ItI1lcllcncel7264.0 7740.0 ItI1lclIng lcncellug 16439.0 16568.0 16583.0 lugfen110mIsmut16588.0 tNIten5808.0 16576.0 minutes 6148.0 -608.0 itntes beside l1CHII106872.0 16572.0 thotluttlutNoahs thoNoahs tillionhR 16760.0 16776.0 ionhR16767.0 5268.0 16772.0 AtI 5800.0 t1unltrnnlcluit6976.0 16763.0 llttloattic nttlcatticstoreroom 7804.0 nttlcstomroolll atticslorernouu 16951.0 16971.0 stomroolllslorernouu16964.0 tintotiho5916.0 6232.0 16960.0 guilty Julltfear rcmrearnhlOllyalreadyreferred nhlOllylCClIIel 4740.0 17148.0 17159.0 referred lCClIIel17155.0 seized NelClt5644.0 6384.0 17152.0 leer horhrr6244.0 Suppose HUIIIOSOS1pposnthlthegirls thlJhli 17336.0 17352.0 Jhli17348.0 Hhouhlslimed17356.0 wllnttvnnt17343.0 thothetltlrltn7380.0 thellltbou7240.0 themsolves 17339.0 thelllNohl1I tbouHelves 17532.0 17547.0 solves Nohl1IHelves5432.0 17543.0 To Jo7o17540.0 hobesure Hum17536.0 sho8hchllllhindonl 7572.0 thotlhlthoday tillIn tlhltiny 7760.0 17727.0 17744.0 tiny4788.0 5028.0 17740.0 before htCure4912.0 5748.0 17731.0 given 5632.0 hen 6280.0 hOIl1duce6284.0 17735.0 17755.0 money nuoteymOUl 7280.0 tor17759.0 nagown nJown 17915.0 Jown17924.0 npleee apiece5704.0 17963.0 hnt17919.0 thoso17948.0 Wrl7640.0 bbevening hi hievening 7772.0 hllnill 4752.0 18108.0 18123.0 evening llnill 5356.0 18119.0 affairs IIlrnhHffnhs5244.0 ml 18116.0 18112.0 filmy finnyfhll chiffon churonehuhfTouiantiandlace 18140.0 nnt antilace 18303.0 18320.0 lace 5052.0 18307.0 Wouldnt 18311.0 nuhdnt Ellen miNI6472.0 lle11 eldest ltielItehicstask 11111music7416.0 askfor 11111fOl musicfor 7764.0 18491.0 18515.0 fOl5104.0 18508.0 tho5460.0 tnlretn18500.0 wlwlIshositu6492.0 18495.0 knew Iwuwthntthattaffetas thnttulretuR thattatTetns 1316.0 18695.0 18708.0 taffetas tulretuRtatTetnswUIe5944.0 luInAt luAt 18876.0 18900.0 5156.0 18896.0 thl18892.0 tholl -596.0 936.0 18883.0 ilrs1Ining 18887.0 -932.0 7072.0 rrR YInlag suddenly suddenlyrose 111111t1cnl 111111t1cnlrose -580.0 7720.0 19076.0 rose 19087.0 5068.0 19084.0 19080.0 precious IIICeloIIRllrrclo11Sslll7028.0 pressed IHCHINItoher 19264.0 19284.0 breast hrlnst19279.0 11m19271.0 plnlplnlc5924.0 cheeks llwclfIcltuelcspinker pllllur6916.0 19268.0 111111nutinutiher andher 111111hm 19459.0 19479.0 hm19472.0 bright IIJhteyes 19511.0 CH 19463.0 brighter 1lllJhlclthan Ul1II19487.0 elreverwas elrWaR everwns 19643.0 19695.0 WaRwns19663.0 tllllr19667.0 wort19660.0 19647.0 mine mlnmh111 minemine7180.0 mlnmh111IIho -944.0 mineshe 7712.0 19652.0 lshe 19844.0 19864.0 IIho5120.0 19855.0 whispered whllllHHCll19860.0 cant cunt19847.0 gite19868.0 11do Ido 20031.0 20055.0 5032.0 20087.0 8020048.0 wnnttvnntn5684.0 20044.0 thllts6992.0 20039.0 prettnmt7460.0 andIn nmtIn andiii 4768.0 20219.0 20252.0 iii20243.0 stlo20239.0 just 5888.0 20236.0 thlAtillsonce 20232.0 Tllenhear htnrhearing 7784.0 20223.0 htnrIn hearlug 20287.0 20416.0 20440.0 lug ing20471.0 20436.0 Rotmll5180.0 ot20423.0 Irllllh 20420.0 lnuJhtcrInugluterhtlowbelowshe htlowRhe 20607.0 20631.0 Rhe20628.0 thrust thrll20624.0 6032.0 20620.0 rustling lURtlllIJ20615.0 Colll11Into theremotest theremoteHt 20799.0 20828.0 remotest remoteHt20847.0 corner COIIIcr5448.0 20815.0 ot20808.0 blJtrllnktrunklowered trllnklowCel1 20992.0 21016.0 lowered lowCel121012.0 5376.0 21020.0 5536.0 21007.0 lid 21003.0 21036.0 lIe1 crept 892.0 downstairs dnwnstnlradownstulrsdnwnstnlraas downstulrsnsdownstairs1s-892.0 21187.0 21244.0 ns1s800.0 5060.0 21204.0 cautiously en11tlo1I1I21231.0 us21196.0 Rhesite21191.0 hnlhind21215.0 7632.0 ahousebreaker ahOlwhrln aluousuhrenler 1044.0 21391.0 housebreaker luousuhrenlerhousebreakerIll luousuhrenlerIll-1044.0 21399.0 hOlwhrln 21395.0 21423.0 tI tIIll 21572.0 21592.0 5332.0 take tnko21588.0 21575.0 nndnnltbegin hltlnbegtu7328.0 beginon hltlnonbegtuon21763.0 21820.0 5020.0 21783.0 thlll21807.0 21811.0 21780.0 afternoon nCteruoou21767.0 Rhetllollghtthoughtnut thoughtBut 21960.0 21980.0 TIlItBut21975.0 thnt21971.0 IICh11I00nnfteruoonproved lUOtIprnwed6528.0 flitun 11nu1unusually u1usunlly 22148.0 22168.0 usually usunlly22199.0 R1I1 4864.0 5452.0 22164.0 busy hlll 22192.0 01110110ecneweu22155.0 tor22151.0 busywoman 7844.0 busytouulhI 7592.0 22179.0 IIS IISwomllll 22343.0 22391.0 woman womlllltouulhI22355.0 First 1111122359.0 Itaneighbor mielghlnr22352.0 uel 22348.0 h1JOr calledn callednmoment -648.0 lnlh called 7636.0 nmo ntuotnent 22536.0 moment tuotnent22591.0 mo nemt 22547.0 COI22584.0 22539.0 fancywork fnncytvork22551.0 Canc 6828.0 eHk pattern lnttCrn7576.0 anti nndIInelnndstayed IInelRtnJcl antistayed 22727.0 RtnJcl22775.0 nn22740.0 hour hOllrlunar22735.0 lhnlhen6544.0 flitIlrls6780.0 brought brol1htbroughtIn brol1htIn 22919.0 22948.0 mounds mOl1l111Kanottolsor22928.0 samples Rllmlllltronl6960.0 22955.0 1011 7248.0 whichmother whichmoUlt whichnuotlter 23112.0 moUltnuotlter23136.0 m11st23123.0 help hllllutip23119.0 thorn tlU1I1thenselect hct 7500.0 thclrtheirnew thclrIIIW theirnelt 23307.0 IIIWnelt23351.0 JOWII23316.0 11U11lied5712.0 23311.0 later Illterlinterthutinydn 1111tutuanImportant 1111Importllllt tutuinportnut 23491.0 23524.0 Important Importlllltinportnut812.0 committee comi11ltteeconuultteo23500.0 meeting IIWCtlllJtuucetitg6500.0 oC23495.0 hlrhersewing hlritwlIll 23691.0 sewing itwlIll23703.0 society ocllt drew 23699.0 920.0 1IrsVIni11g 23727.0 -760.0 7384.0 6684.0 Ylnln nwnrawnsawayto nwnrtoawnsto23883.0 23911.0 5036.0 23896.0 ll1rlhvestry 23931.0 23899.0 23887.0 tlwre23892.0 23920.0 7324.0 discuss 11IscllsHdiscussways 11IscllsHWIt 24071.0 24128.0 ways WIt 24131.0 24091.0 nndnllilmeans mcnllH6340.0 24083.0 oC740.0 6700.0 providing IlroItIlIlprovhulitug24076.0 thotimetheheathen 7868.0 thohlathen timelucaihen 24267.0 heathen hlathenlucaihen24275.0 rvltii24279.0 till6292.0 24271.0 garb Jllrhor840.0 civilization clvlllzntloncivilizationAll clvlllzntlonAll-840.0 24459.0 24475.0 All 24472.0 time5172.0 24468.0 time tingethntrnr tnf1etn24463.0 Rillsilkwith -264.0 Rillwith 24652.0 24671.0 tlll24659.0 plllkpbk24656.0 rosoh1ulsrosehutlsexisted CtIHt 7428.0 liSIInnoanunchanging IInlIIchnllJIII nounchnngiig 24831.0 912.0 unchanging lIIchnllJIIIunchnngiig1012.0 24847.0 background hlllkJrolnellhnckgrotindagainst ilgatust24843.0 nlnst 24840.0 whitIIwhichwere whitIIwlrc 25035.0 25087.0 wlrcoutlined oltllncd5184.0 25039.0 allthlfile6488.0 25048.0 events ocntKthodulydayEven dll dulyEven 25223.0 Even 25276.0 ln 4876.0 tho25232.0 JlrIR25263.0 Jownll25228.0 aroused uo1l3Cllonlya onlyn7876.0 0111 0111II 25419.0 25475.0 IIn25431.0 half 25427.0 halfhearted ImlCllln1tccIuenrted 25423.0 nttlntlouattentloutimecom cotocototnlttee 25484.0 25607.0 mittee tnlttee25620.0 lI1eutluJnteeliug6240.0 25615.0 Hhebarely hnrcl -480.0 7288.0 escapedforever escaped e8cnlude8cnludfOr 25799.0 forever fOr 25847.0 C1 25811.0 losing 101111110caste cnllllwitlu25804.0 fellow tellowfellowcommitteewomen tellowcommlttcewonwn fellowconumitteewonu 25992.0 1404.0 committeewomen commlttcewonwnconumitteewonu26031.0 25999.0 voting otlnJ 25995.0 thnt26027.0 FO IllFOmany Illmnnr su suminty 7912.0 26183.0 26231.0 mnnrmintyyards nrll 26191.0 ortnlTotntTela 26187.0 llnlplaitpinkfigures llnlt1 plaitfigures 26375.0 26395.0 figures t1 -516.0 5352.0 ure8 26384.0 26380.0 bought hOIljhttorgarments JnrmlntsC017656.0 thothlthoheathen 7888.0 thlhunt theheadmen 4840.0 26568.0 headmenhunt hell 26571.0 Instead 26575.0 tc11I1 oCtime856.0 unbleached 11nbleIlChlc1unblenchetunbleachedmuslin 852.0 unblenchetmuslin 26755.0 26767.0 1111111111commonly couuuonlycommonl -780.0 984.0 26759.0 appropriated 111J1rolrlntctl6088.0 torthnt7524.0 thatpurpose thntIHlI1OSC thatIlttpose 26995.0 purpose IHlI1OSCIlttposepurposeAnd IHlI1OSCAnll IlttposeAnd 27144.0 27159.0 And Anll27155.0 ntthctime1036.0 neighborhood nelhborhoollsociable lIoelnllllsociablethat lIoelnllllthnt 27335.0 27348.0 thntecnlneveulug27339.0 Irf 1Ining27367.0 wnspresent Ircsunt7252.0 presentIn IrcsuntIn4848.0 27523.0 body hOll 27532.0 Haven27559.0 cn 27527.0 whllItalking tnlklnswiththe withlie 4916.0 rector 27755.0 01looking lookln ocr7112.0 photo I1hotQphotograph I1hotQ1alh 27788.0 27907.0 27915.0 graph 1alhalbum nll1mthldoctors 10cto1swife Wlfl7408.0 wifeshe Wlflshe 28099.0 28111.0 28135.0 wntl111iuCanerwalking wulklng28132.0 nnllxmlns:ns7 ID17 3676 2768 8244 1392 ns7:type 9756.0 1392.0 1nlO 9800.0 ivn 8868.0 9392.0 1i 9648.0 nlO 9464.0 tiro 9896.0 10032.0 1636.0 11nl19908.0 of10320.0 10768.0 tho10628.0 8840.0 lilgBtc 8776.0 9444.0 9400.0 9616.0 1876.0 +1844.0 a9636.0 9760.0 u 9688.0 ht9844.0 9856.0 9892.0 9952.0 nnn mmnrmiu10328.0 tvili10264.0 10760.0 IWt10680.0 IWtIn herfnvonto 10988.0 10940.0 10840.0 rfavorltojSHlhi 11008.0 8312.0 fnvonto 1164.0 8316.0 favorltojSHlhi 9360.0 9480.0 9416.0 il 1t 9644.0 9764.0 9676.0 9696.0 9728.0 wnBtuns10248.0 sluing Kitting10160.0 10340.0 lttlll nt10652.0 ntt 8648.0 liwi huet8536.0 8904.0 9624.0 9432.0 916.0 dlmicrtabli t11111Hltllbl9700.0 dhtucr -916.0 10716.0 10360.0 ltiblo 10308.0 In10744.0 Inj IIIfr IIIthe 10996.0 8624.0 dtnr 8532.0 fr 8968.0 9312.0 xi 9384.0 9628.0 9752.0 ilhuhag 9660.0 diningroom t1ll1ln 10684.0 roonu10132.0 10848.0 01ori 01I oreeadhig 10980.0 8292.0 eeadhig 8960.0 8872.0 m9048.0 hushed lufllwl1hushctl9440.0 10312.0 2620.0 audience ft1uJlncoauudiencc10220.0 auudienccfn 10316.0 audienceivjcnuse -684.0 8288.0 tune 8424.0 re 9364.0 9000.0 rtv 9436.0 9620.0 oomnutl conanti9520.0 ntn 10344.0 alwaysshe 10932.0 K KIII 8276.0 8620.0 Iilstliug 9528.0 9632.0 fftllll 10052.0 UIny9948.0 gowlI10488.0 gowlIloseutlH gowndotted 10992.0 2728.0 8848.0 I111 8980.0 9600.0 9540.0 9768.0 loseutlH9680.0 10584.0 Ulnc10 iuadoiuadouP 10588.0 Ulnc10HI 1308.0 uP 8552.0 8464.0 8772.0 life 8680.0 HI st9008.0 stPerhnp 9504.0 9576.0 Perhnp ivjcnuse 9428.0 10040.0 cause cnIlIlC10148.0 ortho10772.0 10664.0 enf 10944.0 eneroachuue 10820.0 InC 8272.0 eroachuue C8996.0 9604.0 waking waiting9900.0 nll1 10468.0 visions IRlonsvisionssi IRlonsInvisionsupon upon 8784.0 1Ir irsi 9716.0 usual URunt9516.0 10272.0 bourn hourHhours10120.0 10708.0 oflin ofhi ofsluuuber 8260.0 sluuuber 8936.0 8880.0 lin hi9044.0 Ii -104.0 9596.0 Ollceoverslept oIslelt9924.0 10764.0 4167.0 the10704.0 thojiv thoA thenext next 8664.0 motti 8600.0 9420.0 jiv 9108.0 9704.0 4351.0 rate rntl9708.0 uiif 10300.0 wnin 10516.0 4388.0 wns10676.0 lOIlJ10604.0 lOIlJII longtitter 10956.0 titter niuo 8640.0 nfinished filllsho10352.0 het 10520.0 10692.0 soil Hollsoiltnty tnty 8688.0 brcnk 8568.0 rt 9748.0 10044.0 9936.0 10304.0 tin tinv 10480.0 10544.0 atticstoeooorn 8244.0 stoeooorn 9592.0 v back bllCk10204.0 10376.0 10452.0 10552.0 10400.0 10752.0 xmlns:ns8 ID18 5720 2912 8096 5100 ns8:type 1468.0 8240.0 tho8576.0 5111.0 Noalms 9192.0 Ari Ik IkI 8472.0 5276.0 hope 8636.0 hOlle 9088.0 9240.0 din dll8984.0 IUSR 111959972.0 5316.0 it9868.0 10216.0 5319.0 putting pnttln10080.0 10900.0 10800.0 Ita itntvnv 8228.0 5516.0 ntvnv 8304.0 wa 8728.0 Ins 8732.0 9016.0 8952.0 8864.0 9256.0 9260.0 9380.0 9328.0 9888.0 5503.0 801d10144.0 10672.0 5520.0 feel tCll10536.0 tCllhlJ feelhog 8224.0 hlJ hog 8408.0 8520.0 dowlIltd 8932.0 9352.0 9140.0 1lcr uer10060.0 Tholl10572.0 a10456.0 10728.0 ntomitent 10656.0 10732.0 ntomoIIIlUt IIIlUt mitent8720.0 IntCl lntei8612.0 9064.0 9772.0 5895.0 9668.0 beflUe true10436.0 flUeJCS 10880.0 trueyes 8212.0 yes JCS8616.0 8460.0 JII Is9672.0 Isnt 8948.0 9744.0 mt 10100.0 therol theroDc Be10556.0 Dc011l1 10948.0 Beyotd 8208.0 yotd 011l1 8580.0 6296.0 dot dOl8748.0 Tit 6288.0 Jollet Jolletrr gone goneMrs 9976.0 6447.0 8436.0 VillI Vint9368.0 dtho10112.0 contents contentR10844.0 br ofbrt 8200.0 6631.0 8268.0 IIC trmll8988.0 Ot 9128.0 9572.0 10 6655.0 floor 10152.0 nnll10092.0 10504.0 looked loolClllookedlute 10508.0 loolCllIl1to lute Il1to8604.0 8496.0 8804.0 nHI rthd9548.0 6839.0 9784.0 9960.0 10176.0 Onnll 10064.0 finally 10564.0 ctlllllnetJ cx cxnntinei 8184.0 tlllllnetJ nntineieve8752.0 f1 n9496.0 9512.0 thnt10096.0 10008.0 7047.0 hnllcon coninllwu conmuted 8188.0 muted inllwutlo 8660.0 8852.0 roll reticule 9092.0 10484.0 a10420.0 10640.0 polu poltu10576.0 polu1I01l1t poltubotmmiet 1I01l1t botmmietbutW 9556.0 9812.0 wus tunstlwro10908.0 a10720.0 nIHlunre asquare 8176.0 square IHlunre8800.0 Inchii Inch 9268.0 9468.0 Rillellotted9940.0 10644.0 7623.0 10540.0 10696.0 withpith 8168.0 7783.0 pith 111111lORCUI1 roseburosebuCould 9096.0 ICoull 1096.0 8400.0 Could Coull8000.0 tht8836.0 iI 9124.0 iIWithout i11Itimut Without 8196.0 fItHhnplns bslunping10224.0 8199.0 tho10596.0 quls quesqulstlon questine 8160.0 8356.0 tine tlon8376.0 1lrs 8444.0 Js 9396.0 8388.0 nlllrrlcll slurried10124.0 ont out10016.0 8403.0 of10756.0 tits thlthlstortIoom titsstoreroom 8144.0 stortIoom8608.0 no8912.0 oftnlrs astairs9156.0 8584.0 8587.0 thu thet10296.0 8592.0 blue hl1l1thl1l1tloll bluehetironun 8744.0 hetironun loll 8432.0 8404.0 8775.0 wJ 9036.0 vi 9508.0 8808.0 u9712.0 9588.0 8780.0 older oldel9996.0 glrliglrlisnt girlssat 8132.0 snt8468.0 50wln 8368.0 50wlnAul1t sewingAunt 9012.0 8360.0 9136.0 Aul1t9152.0 Tnll 1ttb9560.0 wlc1Hng tvedling9164.0 9196.0 sown gownsownehe gownshe ehe9344.0 gnsped 8380.0 8564.0 O 8736.0 JlCI1 9356.0 remit toneltonellhcm 9832.0 remitlien 8280.0 lien lhcm9531.0 Rhl8656.0 Rt stnshnrt 9172.0 -460.0 9880.0 9568.0 hnrt 10076.0 9552.0 On 10372.0 tie thotoot tootof 8116.0 8344.0 9719.0 bed lll 8992.0 l19736.0 IIIHI had9739.0 heen9824.0 tJ1I10636.0 9780.0 glll 10560.0 gllltnfieill 10872.0 tnfieill tnffettt8684.0 9912.0 8111n9971.0 t9144.0 9923.0 9932.0 1111It1tllelhI1 u1ultituditt9968.0 IS ts10788.0 IStoll18 tsfolds 1348.0 10039.0 toll1810111.0 011118484.0 10140.0 MC see9388.0 nIIrol1 nYou You rol1put cut8976.0 p9200.0 9536.0 Tan YOI19476.0 cut elltIIp up10180.0 10324.0 tunt tuntTahithnH 10332.0 unt unt1nhlthll 8096.0 1nhlthll TahithnH10528.0 9024.0 Oi rile 9732.0 murmured Il1l1lmurccl10700.0 111111111111Ihen andthen Ihen10683.0 lIOt9404.0 10731.0 8740.0 lHrl10212.0 10707.0 ntH1 nml10128.0 xmlns:ns9 ID19 17440 3152 7952 10852 ns9:type 8088.0 Jnto11108452.0 10867.0 tears 8384.0 tearsher 8832.0 telll telllIn tearsIn 11051.0 8476.0 a11092.0 molUChr9104.0 11084.0 tho9928.0 I1lR 10356.0 11123.0 wrl10824.0 11099.0 10736.0 rther 8080.0 8416.0 11248.0 side Ellc1e8336.0 9032.0 w SPWp 9492.0 11280.0 11283.0 IInlelThent10 10524.0 BllCnThen10920.0 Ellendo 10924.0 BllCnclo 11428.0 clot108440.0 11471.0 8540.0 11476.0 mcaiftil 11484.0 meat mtlII-96.0 11504.0 oU wanted wnnteel10660.0 thnthuntthatold 11480.0 huntold 11624.0 01 8204.0 11660.0 11627.0 0.0 ellksilkWJJE 8676.0 11651.0 WJ 11692.0 necr9184.0 11668.0 dreamed tIrl -672.0 10388.0 11672.0 lI1cl1 11675.0 ofRIICh ofsuchu 11791.0 11824.0 RIIChsuchu11859.0 tithin ti 8896.0 11835.0 Ing8828.0 9148.0 11844.0 9216.0 SYI 9372.0 Tm 11883.0 know Imll 11888.0 10252.0 1I0llnoternoterteemed 10976.0 neverSfLf 1I0llfloll1NI 12019.0 teemed floll1NI12032.0 car 9004.0 ar 12128.0 SfLf I1t tutviumvat 12047.0 elothe9tin1 10200.0 12056.0 11111110548.0 12052.0 tnfetta fnC tnffnCeUn 10712.0 tillcttn 12203.0 etta cttneUn12244.0 12216.0 12248.0 atn flgn12227.0 agafci 9208.0 12240.0 nd 011nil12236.0 thughttltonght9820.0 how Imowhowpleased 10968.0 howJllenslel Imowplensed 8048.0 pleased Jllenslelplensedyoud 8820.0 01ld 12404.0 asee seo12432.0 lIurtlmBertua9804.0 12440.0 nnll10432.0 r10804.0 Ihad rhnll Ihind 8044.0 12560.0 hnllhind12592.0 8500.0 nldfc nl 12616.0 lists lids12628.0 olltoC12623.0 the0111oldgown 10960.0 0111goWU 8032.0 12807.0 goWUwe12823.0 wore 8888.0 12827.0 01a8laughing InughJnClaughingabout InughJnCnhout aboutBut 12963.0 nhout8512.0 nhoutHut nllRt 13016.0 nBut 13116.0 13164.0 HutC01tot992.0 onccllillttlo 13199.0 -992.0 9884.0 llIttto littlemothlr13204.0 tooltookno 13331.0 13376.0 11013352.0 interest IntNcsthttairlrls Clrls elrls9944.0 things IIthlngsIIthlngsI thingsI 13543.0 8396.0 1101064.0 inrcforjHfies vnrefoi -1064.0 8716.0 13583.0 n1e 9220.0 8956.0 Imes ICR 13580.0 10024.0 13607.0 caro10408.0 13611.0 a13587.0 great 10492.0 greatdeal 10964.0 rel1t rel1t11cnl 13723.0 deal 11cnl13740.0 RIHsobbjid 8844.0 sob 9028.0 ob d Do 9452.0 13795.0 9864.0 13800.0 10348.0 RUPPOOsupposethat supposefeat 13920.0 thntfeat8448.0 13924.0 blcJuso8340.0 Ijfii 13979.0 9524.0 your Yol1ranothernodforty 9980.0 mQthernnel anothernodmQthernnelCorty -976.0 13968.0 andforty 8020.0 14076.0 14112.0 forty Corty8412.0 8596.0 14156.0 cnrR 8916.0 oldUvnt 14128.0 ol 9776.0 14148.0 Int nt9232.0 9724.0 wnnt10496.0 havethings hithll1s 8012.0 14268.0 14303.0 thll1s14312.0 nice nlceAiJiUas -628.0 14351.0 14327.0 tuvas 14364.0 IitS 14336.0 golnt10532.0 14343.0 mlltomakethe mlltotho 8008.0 tho14500.0 sllls1j1c o9052.0 14520.0 fo fij 9288.0 14560.0 14524.0 Avn Avnand 9964.0 rJ IC11nlon tunlnu10088.0 IC11nlonI tunlnuIt1152.0 14776.0 14800.0 Ib 10876.0 14964.0 14967.0 IustJlcstyleWith stJlcWith 15144.0 15151.0 With 15148.0 thosolnst thlsll1ftthese wordA9992.0 15172.0 wnRwasanother 15332.0 15344.0 lnsh8964.0 15352.0 tnrs9860.0 15335.0 rhe10156.0 girlslooked 15528.0 15543.0 ntal15532.0 each c1lh15580.0 9068.0 teb 15536.0 olhN15563.0 ncrOSRtimebowed howell10396.0 bowedhead 15712.0 15727.0 whir15736.0 moist uno5t8816.0 15755.0 9316.0 15764.0 15760.0 es 15720.0 ThouBI1tnEllentaking 7952.0 15911.0 15920.0 taking tnlllIJ15924.0 tho15948.0 WII1II15915.0 llttle9264.0 hand hnm1hers leersherssaid 16112.0 FoullyForgive gently grntlrFoullygentlyKorglvo grntlrIotg 16296.0 16303.0 Forgive Korglvo16307.0 Iotg 16336.0 1111ale16300.0 nlolliermot 9532.0 Weve WCwe10616.0 ben beu10500.0 beudrendttulr bendreadfully 10724.0 16323.0 enelrrnclCuJlr 16484.0 808.0 16496.0 dreadfully elrrnclCuJlrdrendttulrselfishnnd selfishanti9180.0 oh 16500.0 n11l1 9296.0 Jm Jfut16524.0 10168.0 afraid nrlnfttntratd10068.0 16487.0 Itsloo 10984.0 itstoo 7960.0 16680.0 16695.0 too loo10016691.0 Illtefolfur8544.0 16719.0 Oll 16704.0 touse 16688.0 lnhlth1sInbitluasTabithaswedding 10256.0 lnhlth1swllellnl Inbitluaswedding 7956.0 16876.0 16879.0 wllellnl16912.0 OWII 9204.0 new16883.0 Rut TIutButfustlet l1t10412.0 16896.0 1linhave 1lunwe Uhne 17060.0 17072.0 hneunwe8392.0 17076.0 tholimohlnllblatelc8628.0 filiioUlt17067.0 well wll17100.0 SClwhntwhatwe whntwe whatawe 17264.0 17291.0 we awe17295.0 can cnl1cue8180.0 8812.0 lIh 17267.0 thatWhat thathnt thatlmnt 17444.0 17455.0 What hnt lmntdid c1111wilh9580.0 17451.0 llttlo10288.0 17503.0 17475.0 Via YlnVln10936.0 Vlnn Viang 17512.0 17635.0 17643.0 lng 17680.0 ng 17676.0 111er17648.0 found 01111117656.0 Ol1t9284.0 17639.0 Certainly Certnlnl 10740.0 tirothogown thoon tirogown 17832.0 17867.0 17871.0 17843.0 17840.0 whll1ltvhlteh9300.0 plio Hhe17836.0 appeared nPl1cnrcdnppenretlntthotholI 18024.0 18035.0 18064.0 -556.0 lInlol 8588.0 hnre hOlc18040.0 18031.0 the9876.0 slightest sllghtcltsllghtealslightestresemblance sllghtclt1SIlIIhlnncl sllghtealreseunbinnce 18215.0 18224.0 resemblance 1SIlIIhlnnclreseunbinnce9236.0 18228.0 tlulthuntnuclent10196.0 garmentBut garmentBitt 18403.0 18416.0 Bitt18412.0 8256.0 writing 8488.0 rHIII 18436.0 III18456.0 ILit18419.0 Western WestmlI1Vesterurelative rllnthnrelntlverelativeho relntlvett18635.0 18603.0 11018607.0 101111118620.0 18644.0 01111 18616.0 9740.0 10048.0 18596.0 rcuulontlmetheliotiustavlnu tlmeuonu 11072.0 18688.0 18795.0 hOlletn uonu -668.0 996.0 liotiustavlnu 18800.0 stnyhuu 18811.0 cOllsl1Icoushl18804.0 RISI1saidVes saidates 11068.0 18848.0 1176.0 18988.0 Ves YI8ates18992.0 Ornce GlncuGrnee18995.0 VlllhlJsho Viningsilo-488.0 thnttant19012.0 wrstrrrwrsGrace WItGrnel 19016.0 trrrCroce 19176.0 19179.0 GrnelCroce19187.0 8428.0 AllrllItl Averyrend8972.0 9120.0 19192.0 the19216.0 10111110364.0 andFJlwshelooked FJlw100klel 19367.0 19371.0 100klel19376.0 8788.0 19391.0 19411.0 IINtus19395.0 Jlrclt 19415.0 I1S9792.0 plcturo lllctlrlplctare9956.0 Youknow YouIIOW 19564.0 IIOW19599.0 memis8704.0 19603.0 IL19571.0 girl 9176.0 19575.0 thislit19608.0 twitsnlwuysallays19595.0 nbelc 11110belcand belcmud 19759.0 mud19792.0 abeamy hrnuiyllrollI 19763.0 hilthat19776.0 19564.0 lontthink thlntthinic10512.0 19779.0 e1eversaw e1IIUW 19939.0 19980.0 saw IIUW19952.0 11118668.0 look 19956.0 lovelier 10llIcr19960.0 t1umRho19947.0 lllelthatthntnight thntnl thataudit 7992.0 20140.0 night audit20144.0 dressed Ikesslll20151.0 20188.0 a20155.0 pale Jlnlopolo20179.0 gravrlv 20164.0 oneof oneor 20328.0 20335.0 or20331.0 thos8136.0 20368.0 20348.0 tnrctnstafctns20372.0 ou 10136.0 Imowtheyare tlllnre 20519.0 20552.0 nre20528.0 wearing wCIIIlnArvenrtng20563.0 nllW20539.0 lust 1118t20536.0 JIIIthosthnt10592.0 thatour thntour 20716.0 20743.0 20720.0 1llIelmothclgrnndmothcrs20764.0 20727.0 nildotte120740.0 0lLoverwith 0lLwith 20904.0 20907.0 violets IohtsvioletsOno IohtsOne 21091.0 21099.0 Ono One21108.0 oCthltllp21112.0 nicest nlc 21123.0 21115.0 tt1ln 21143.0 21095.0 nhout10776.0 itwas Itwns 21292.0 21319.0 wnsthllttint21299.0 21303.0 dress e1lsedrrs521347.0 erns21343.0 prsrnt9916.0 10624.0 21296.0 trClmfromher trClmIllr 21480.0 Illr8364.0 21491.0 oldest olthtoldtest21503.0 Daughters laughters21535.0 21507.0 hVrf gaveup 21515.0 gn 10812.0 21511.0 21675.0 21704.0 1111IIflW21687.0 21728.0 O1Rnrvus9244.0 21732.0 21680.0 win tor 21699.0 60soshe 60h 21864.0 8084.0 8352.0 21872.0 coulllcave21883.0 21892.0 sll121888.0 21875.0 told 10608.0 21868.0 thenthemthey themthC thentheyy 22056.0 theyythC 22091.0 wlro22067.0 real rent8768.0 22111.0 generous prnerousJrncrous11118hutthoy theythoysaid thoy511h1 theychid 22243.0 22247.0 511h1chid22251.0 thoyt111 22267.0 tnnuht 11I01lhtInnuht22271.0 thllr22263.0 motlllrhnethindhadboii hnetlIn hindbeen 22440.0 22444.0 boiilIngiving gIviighllI 22483.0 1111tip22464.0 rllfar22475.0 Ihe111thetaenoughand 10444.0 cnol1Ahcnol1AhUl11l 22635.0 Ul11l 22639.0 22667.0 WIIStvns22652.0 Uw Ih1122679.0 22676.0 tn22663.0 change rhugorhgogcaround nrol1ndAndbesides Ant1Ant1t1 22823.0 22827.0 besides 22832.0 t122867.0 22851.0 soul snldItl 22860.0 thev22836.0 c1ldntneed notllneedanything notlloll neednaythiug 22996.0 23020.0 naythiug23047.0 oll thlll 23055.0 23064.0 a23044.0 WI Inter 9808.0 1ttl 23031.0 torthoytheyhnd 11076.0 11104.0 23207.0 hnllhnd23215.0 Inth23255.0 23224.0 Ioely Intteiy23231.0 23239.0 waist wnlstwnlatrondo mndomnc10orortllIlr oftheir 11080.0 Itheir -24.0 23399.0 tllIlr23412.0 1lInt8940.0 Tablthris 23419.0 Iahlth llluilhl-640.0 23423.0 tvcdding23432.0 gownYutitIts 10460.0 gownYouths gownloulhI 23579.0 23592.0 Youths loulhIYutitIts23603.0 Companion CIIIIIIIIIIIollCanquuuloCanquuulod -800.0 IAn 23955.0 23984.0 Od OdSevc hlcl 8796.0 23964.0 23999.0 23967.0 IrMi hlhlrl 23975.0 ruiilttf 11hlnIiIring23988.0 Village tlllagel1I 23991.0 reSOI 23959.0 ISeventeen 24139.0 Seventeen SOI Sevc24155.0 lhllI utceuIIhInlrl24163.0 fishing IslilngIIRIJlng24172.0 boats ono10864.0 titofwhich 11016.0 ofwhlllI titvhmieh 2984.0 8036.0 whlllIvhmieh24339.0 24347.0 raid haiiltlnltl9212.0 24371.0 III9100.0 24356.0 hlohtwo24363.0 hCN1built bunt10792.0 betrwteen 10796.0 hebetween hetWIlU 24387.0 24516.0 24540.0 tween tWIlUtrwteen24531.0 1710 17401111I11iiU 24567.0 tutu 24551.0 1711 1Tu24564.0 form Corl11tlietime24527.0 odd lit litIIc littic 24579.0 8040.0 24719.0 tleIIctishtlugtlshili 24731.0 village l1Iol 24755.0 oC9836.0 24751.0 Carracross Carrneross10836.0 24739.0 ontho onthe 24903.0 24908.0 tho24932.0 west Wlilt24947.0 crust OHMcoast24935.0 lit9188.0 Ireland Irllnnc110292.0 24923.0 Thlonlybuilding onlybuildlug 25031.0 25099.0 building buildlughulhllll 25107.0 III8556.0 25116.0 till25123.0 IIIIIll25136.0 tvhalclu25127.0 coilconstructed consUuclcli coilstruetcu 25160.0 25300.0 25303.0 structed sUuclclistruetcu25344.0 25339.0 HIIau25311.0 25327.0 imatImllt9348.0 la JtIis25315.0 thotimepriests pLlestfi10384.0 priestshouse pLlestfihOUSl 25479.0 hOUSl25491.0 111111nnrl25495.0 25511.0 25515.0 IJIIl1tnhnostentirely entlrcJyentirelyof entlrcJyor25675.0 25679.0 or25683.0 driftwood c1rICtooll25712.0 whichthe 9308.0 whlth whleu-740.0 the25719.0 ocean occnnoceflntide thlctidepiles 11024.0 thlcp11clI piles p11clI25900.0 25903.0 IOII 25879.0 thlrocky rock 25907.0 const coast25887.0 There Tllero26060.0 26071.0 26095.0 26099.0 26084.0 tree trt 26079.0 IIrKUllleleut suthieleutsllm 26108.0 leut size sl1ositeglogirogivebuilding gloIml1tlhlA girobulldlug 26251.0 Iml1tlhlAbulldlug26268.0 timber ttmlllrUmber9336.0 26288.0 witlthu26283.0 eight 26263.0 miles millsotofCarracross otCnrrOCr08t1 26443.0 CnrrOCr08t126463.0 111111tumid26472.0 though thollhtlioii 26487.0 26483.0 thero26447.0 26452.0 plenty plentyof plentyoC26636.0 oCbundle hu11ll1l126675.0 stone ttHIl 9488.0 26680.0 26687.0 26695.0 nccr26643.0 uSld26639.0 torforanything tornll foraaythtlmg 26827.0 aaythtlmg26851.0 thill 26871.0 exrrpt XCllltexcept26855.0 lJl1 26864.0 hllug 26868.0 fences rencesnroundnrouncJnroundpotato nrouncJ110tn aroundpotato 1112.0 27023.0 potato 110tn 8524.0 27028.0 27031.0 patches ptttehespatchesIathcrMy 27048.0 llIl ptttehesFnther1iy tl1ll tl1lllnthcr 9076.0 27323.0 27328.0 IathcrMy Fnther1iylnthcr 27355.0 daughter dllIlItertlaucbter27363.0 tells 27375.0 mc mesir sirthat sirthnt 27515.0 thnthnIlecu27595.0 JUnklugluakingtohlr 27711.0 hlr980.0 Clubbirlyi ClublrrlyICll1hlrl -980.0 27759.0 27767.0 1101 10084.0 27715.0 whyShe why whyshe 27899.0 tho8420.0 27904.0 slloull127935.0 Dingle 1I11I simn toe27963.0 27951.0 among amoDiIW IWwaurDltl1t 3ouianyDetrolt 3manyDetrult uianyDetrolt waurDltl1tmanyDetrultFret 11eFree9788.0 28159.0 Press xmlns:ns10 ID21 27940 11136 1460 ns10:type 13748.0 1460.0 11980.0 1492.0 11376.0 1652.0 BEST 12088.0 SPRING 11896.0 13028.0 mEDICINE 12852.0 mEDICINETho MEDICINEThe-1028.0 11196.0 Tho11644.0 Palm 11500.0 Gluon GivonGivan12044.0 12792.0 12640.0 Dr Ort12940.0 Greenes GroonosGreenesNervura 14260.0 Greenesr GroonosNorrurat Nervura NorruratNorruratThat -712.0 13072.0 12364.0 NervuraThat -708.0 12484.0 orvura 12408.0 orvuraTbat 11188.0 Tbat11652.0 Grand 11532.0 12232.0 Jury JurYI12104.0 12696.0 12604.0 13040.0 People PooplelPooplo12924.0 13644.0 Haw lIavlavo13544.0 So 14004.0 SoDecided SoDecded 12436.0 Decided DecdedDecidedUiod 12988.0 DecidedUod DecdedVod Uiod UodVod11684.0 11580.0 11976.0 Hundreds Hundrods12884.0 12772.0 13152.0 Thousands Thoulands13056.0 14108.0 14024.0 inSpring 11588.0 4627.0 Spring 12208.0 lUJitsn12576.0 Blood Dlood12528.0 13096.0 Medicine MediclnoModicinoMedicineDr MediclnoDrModicinoDr13824.0 11352.0 Greens OrocnesGreenes11548.0 12384.0 Norvura NcrvurnNervttra12312.0 blood 708.0 bloodnnd bloodand13492.0 13524.0 13796.0 13836.0 nerve neronerveremedy nerorometly 5372.0 remedy rometly11848.0 11752.0 12072.0 5387.0 indeed lntlcotl11972.0 12748.0 rho5411.0 oriels orldsworlds13268.0 13728.0 13832.0 Great Orent11192.0 11792.0 11700.0 12480.0 13012.0 hns13360.0 5628.0 13264.0 5571.0 conio cofno13739.0 14092.0 bo13988.0 borecognized 14256.0 berecognlzeel berecognized recognized recognlzeel5760.0 11996.0 12336.0 nlm08t12260.0 12916.0 everybody cveruotly12848.0 13772.0 5820.0 13700.0 tho13936.0 thobest thebest best 11584.0 possible POMJble12284.0 spring 12192.0 medlclno IIIclllclnotnedlcino13636.0 13876.0 takt13780.0 takeand taktan 14188.0 11460.0 hundreds hundredhundreda11360.0 12412.0 6147.0 ot12292.0 12676.0 thousands 13448.0 13792.0 ourpeoplo ourptoplo ourpeople people peoploptoplo11748.0 uso use12140.0 12320.0 during 12252.0 12900.0 the12828.0 13216.0 trln 13688.0 13756.0 pringspringmonths 14244.0 pringmonths months 12152.0 tone tono12476.0 anew nntH12752.0 the13240.0 13684.0 relaxed relaxerrelaxednorvea 14236.0 relaxernerves relaxednerves nerves norveannd11676.0 1004.0 12180.0 6699.0 roInvigornto reInvlgorateroinvlgorato11964.0 13368.0 13184.0 6723.0 enrich Clulcbenrichtho 14232.0 Clulcblho enrichthe tholhoblootl11424.0 bloodA blootlA11920.0 11336.0 11552.0 7115.0 11456.0 12148.0 medIcine mcdicinomedleino12048.0 13048.0 13332.0 necessity 13228.0 14136.0 if14028.0 ifone 14240.0 Itono 11176.0 ono011011544.0 wishes wlshoowlsluea11444.0 12168.0 keep ItcopItoop12760.0 7323.0 perfect lorCect13008.0 health bcalth13652.0 healthand bcalthand 7483.0 vigor 11452.0 11688.0 dllrJng11956.0 12764.0 the12632.0 13128.0 changes 12996.0 fromwinter 7664.0 11988.0 summer HUmlnOr11904.0 12804.0 This 13224.0 grand 13752.0 7704.0 13620.0 springtonic tonic 11680.0 tbls11564.0 7875.0 porfcct12644.0 sprlnc13200.0 medicine 13132.0 13884.0 DrGreenes 14196.0 DrGreonos GreonosNenlJrnNervara12720.0 blootl12596.0 13124.0 13816.0 nervonervoremedy 8232.0 11912.0 Js11740.0 exactly oXnctly12036.0 12840.0 whnt12712.0 13340.0 thotbo8267.0 system systCr11systemneeds systCr11needs needs 11728.0 11604.0 8427.0 11880.0 season seMon13160.0 Jt12904.0 13528.0 13292.0 13895.0 8451.0 onlypurifies onlypurlOes purifies purlOes11876.0 8611.0 makes mnkcs12124.0 12780.0 rich 13208.0 red rell13068.0 13540.0 8635.0 blooc113944.0 itnot Itnot 11528.0 ouly904.0 8819.0 strengthen utrengthonJstrcngthun312980.0 nUll nndand12872.0 invigorates invigoratosinvigoratestho Invigoratestheinvigoratosthe-864.0 thonervous 11416.0 9003.0 12132.0 12944.0 hut932.0 13304.0 rocncrglzcs reellerglzesreenergizesrocncrglzcsand reellerglzesnnllreenergizesand11172.0 nnllrevitalizes rovltnllzC12456.0 the12348.0 norves nerves12692.0 13392.0 13284.0 13672.0 feeding 13568.0 feedingthorn tce 14000.0 lngthom 9351.0 thomvlth11556.0 ronowcd ronowcllrenowed12020.0 12908.0 nervoservo13456.0 force forcotoreonndandpower nndpowor power powor11640.0 Js12504.0 nnaid 9579.0 13468.0 13776.0 diges dlgcs13696.0 digestion 14164.0 dlgcstlon 14184.0 tion tlon11468.0 11960.0 11872.0 creates 12076.0 12708.0 12976.0 9763.0 natural nnturll13536.0 naturaland 14228.0 nnturlland 11516.0 healthy action nctlonoC12844.0 13212.0 bowols bowels9947.0 liver lIvorliverkldnoys 14192.0 lIvorkldnos liverkidtioys kldnoys kldnoskidtioyswblchwhicht12492.0 the13084.0 10131.0 sprJng13680.0 aroal 14160.0 14180.0 10199.0 10319.0 11656.0 sluggish aluggiEhsltllmlEhInactive 12664.0 InactiveIn 11340.0 tact12016.0 12228.0 12824.0 whntwuat12736.0 13300.0 peoplo people13784.0 needto 11396.0 maIm makamalto11320.0 11868.0 12324.0 12704.0 10687.0 nnd13044.0 Itecp12968.0 13460.0 13916.0 welt13840.0 wellduring weltdurJng durJng11804.0 thcaotheno10912.0 threatening threntenlngthreateningto threntenlngto-904.0 11388.0 thohenltb11620.0 11060.0 otnil12380.0 12740.0 111111cud11096.0 wnon tenon13476.0 13724.0 1813660.0 11108.0 canconsidered 14168.0 11112.0 canalderctl cond 11143.0 11168.0 11228.0 sidered alderctlslderod12568.0 13592.0 11256.0 Nervurn13380.0 Nervurablood 11259.0 Nervurnblood 11412.0 12068.0 11464.0 nerroneryo11864.0 11440.0 13260.0 la13488.0 mado13888.0 11515.0 14328.0 Itlrely 14332.0 tirely tlrelytrompure 12060.0 healthgiving henithglvincvege vegetable 11704.0 11796.0 table remedies romclles11808.0 11811.0 13312.0 11820.0 13908.0 11828.0 glvoglvoIt 14223.0 giveIt moro more11284.0 956.0 11840.0 testimonials testitnotimaitestimonl -956.0 12668.0 ot13100.0 euro curocure13516.0 12008.0 thnn13420.0 allYanyother allYother 11696.0 12179.0 11572.0 12388.0 12212.0 12188.0 earth carth12220.0 12224.0 ono13964.0 12231.0 candoubt doubt thnttbnt11600.0 12112.0 12367.0 12448.0 12896.0 cry 12376.0 13640.0 springremedy 12547.0 12551.0 tor11724.0 12144.0 13032.0 12571.0 tlse13180.0 useMr tlseMr 11328.0 12755.0 Gustavo GURtave11540.0 Lolbach Lolbuch12779.0 ot13484.0 337 13364.0 13844.0 Firststreet Firststreot street streotJersey 11596.0 12332.0 12952.0 City 12652.0 13060.0 12960.0 12920.0 13336.0 12991.0 says snys13148.0 saysI snysI13664.0 13156.0 WIS11900.0 troubled 12532.0 13024.0 13171.0 sic alcl31cl13400.0 headaches 13276.0 headachesand headacheslnd lndcoulc113355.0 11924.0 12344.0 sloop sleep12268.0 13383.0 12728.0 account ot13984.0 thethopains thepains 11160.0 pains 11568.0 11892.0 13560.0 head hendBuffering ButteringsufferingBufferingnight Butteringnight sufferingnight 13703.0 11576.0 12460.0 12340.0 dyspepsia dyapopsia12800.0 couldnot 14220.0 11508.0 13911.0 oat cnteatnnythlng12688.0 12540.0 13020.0 stomach stomnchwouldsour 14215.0 14091.0 sour 14119.0 BO111712.0 hndstarve starvo12452.0 myself msclt12992.0 13864.0 havo hnoltavo13788.0 havoany hnoany ltavoany 14299.0 ease casoCIlSO11860.0 Ilnd12524.0 14288.0 glvo give13192.0 14296.0 worl14068.0 atlast at1ost 14452.0 1ost14463.0 14496.0 WILS12100.0 14504.0 nerous12264.0 12964.0 13428.0 miserable miserablenv miserableUmiserablemy-744.0 14172.0 miserablemyCr 13976.0 14735.0 14739.0 V 14059.0 Vmy 14787.0 14879.0 14796.0 myCr 11404.0 11324.0 14824.0 nv 11632.0 1144.0 frl5n3ahnVdly -16.0 frlont -1144.0 11908.0 14803.0 Iohardly 14816.0 832.0 14811.0 rdlYimcw 12756.0 14835.0 Renew13256.0 14888.0 inc me13704.0 14855.0 13868.0 tried trJedtriedseveral trJedseveral 15008.0 several 15035.0 rcmec1lesbuiavailAt 13676.0 13804.0 avail someone someono11744.0 1048.0 recommended recommonc1ed13808.0 14324.0 15311.0 15411.0 Norvtlra11816.0 15444.0 ncrvo 13316.0 Io rvo13472.0 13872.0 rem romromedy 15471.0 15600.0 15604.0 edy 111812.0 15632.0 ono onebottle bottlo12536.0 psd rd15635.0 13436.0 13356.0 began 14080.0 13980.0 toimprove toImprove 15784.0 improve 15792.0 15788.0 starteel15799.0 1n13196.0 15795.0 eat 13500.0 13432.0 13768.0 right rhhtrightthen rhhtthcn 15972.0 thcn15979.0 15976.0 picked plelcell12296.0 16003.0 raj torrn 13812.0 16160.0 aches 11708.0 16163.0 disappeared dlslllpenrcdnndweakness weakncss13396.0 weaknessand Ianl 16347.0 16351.0 anlwent13140.0 13064.0 awn 13440.0 usedthree Ithree 16528.0 16535.0 bottles 12276.0 nnd12160.0 16531.0 12552.0 13104.0 sleep 13036.0 13828.0 nightwith Iwith 16715.0 16723.0 16756.0 case eMOcane16728.0 11932.0 six 13616.0 Colt foltfeltfoltliko Coltlike feltlike 16907.0 liko16947.0 16940.0 12084.0 man 12000.0 12620.0 116936.0 16931.0 13648.0 hard harddays hardc1IYs 17087.0 c1IYs17096.0 12116.0 wltllout17124.0 nnytrouble 17091.0 nm11Iam 1am 17275.0 17319.0 am 17284.0 happy hapP717315.0 12624.0 17280.0 bird sprlnc17308.0 wnswasso 17459.0 17507.0 8017472.0 mlsernble17468.0 nufferingurterln 13584.0 nlwllYsalwaysin nlwllYsIn17659.0 pain pnln11836.0 bUL11720.0 17683.0 17711.0 nm12936.0 1110Ilko13272.0 17687.0 13416.0 nowlI1anmanUBO lI1anUse manUse 11344.0 17847.0 Use UBOGreones GreJneltGreanesNorvuln13384.0 nndandnerve nndnervo 18068.0 nervo11608.0 18027.0 cprlngcpring13308.0 tor13608.0 14008.0 thethodiscovery thediscovery 18208.0 discovery 12024.0 18219.0 prescription prescrl1Ucnprescrlptitnot18243.0 nwellknown wellknon 18399.0 knonphysician phslcmn18408.0 Greene GreoncGreeno35 3613960.0 36W 35W 18583.0 18600.0 11512.0 14th St SLNew Ncw12136.0 18587.0 cork xorklork12636.0 Cltyisresponsible Isresponsible 18771.0 18780.0 responsible torbeneficial ncUonactionand ncUonnnll 18955.0 18979.0 nnll18968.0 11472.0 12080.0 18999.0 11936.0 12488.0 18964.0 beconsulted 12656.0 free frcofreo18959.0 otofcharge 14252.0 otchargo 19163.0 charge chargopert 12200.0 12204.0 12256.0 jy tyT19148.0 bv byletterHUMAN letterILUMAN 19435.0 19443.0 HUMAN ILUMANNATURE NATUREllo NATURElie11260.0 19671.0 llo11019700.0 wafSfnrfat tat19656.0 19684.0 awful awfut13628.0 awfulboro awfutbore awfulbore 19851.0 bore boroboroSho boreSho boreShe 20015.0 20035.0 Sho Sheoften oflen20028.0 20019.0 Whllo Wllllo12788.0 round rounll13452.0 110hocarried 110carried 20215.0 carried carriedConviction 20399.0 Conviction ot20396.0 hor20392.0 lack 20387.0 otbrains 20383.0 De BoBoforo 14200.0 Detore Defore 20587.0 tore foroforeforoLone toreLong foreLong 11348.0 20747.0 20771.0 Long Lone20767.0 20795.0 wero were20751.0 happily hnpplJy13348.0 married mnrrledmarriedPuck 13956.0 mnrrledPuck 20931.0 Puck PuckCheap 14036.0 Cheap Fare Fnre1360.0 toWashington toVnshlngtontoVashingtontoWashingtonSeaboard -1360.0 toVnshlngtonSenoard toVashingtonSeaboard 11356.0 21500.0 Seaboard SenoardAir 12468.0 Line Railway 13624.0 sell 13912.0 sellexcursion sellclouraion 21691.0 excursion clouraiontickets tickotB12660.0 Cromnil21684.0 stations ntationnIItation14124.0 21695.0 atrate 21919.0 onofirstclass fir first tctasB12184.0 faro tare21879.0 Washington WashingtonD -936.0 13520.0 shinRtou 13424.0 shinRtouD 22048.0 22063.0 D O11288.0 22059.0 I1D1return andreturnreturn 12508.0 12428.0 inauguration inUURUrRtinaugurationDates 14020.0 22100.0 ouDates 22231.0 Dates 22240.0 sate sale22236.0 March fJ1roh12832.0 1st bt2d 211ibd3d 8d3 13708.0 goodreturning 22284.0 011returning 22415.0 22431.0 22424.0 uutil22420.0 12416.0 Oth 0thIIITIIHTate 14208.0 ITTllte IITate 22619.0 Tate Tllte11664.0 22611.0 AG AOP 22608.0 22604.0 Atlanta Qa13244.0 13588.0 E LEL 14212.0 LL 22788.0 22799.0 L 22792.0 BunchG DunohG3unah012280.0 Portsmouth PortslDouth13992.0 Va Ya13820.0 VaDenfnemi YaJ Vaifenfneaa Denfnemi tnrnfllllifenfneaa-644.0 Cannot Cotinn IlnCured CnrnilCur1CnrnilbjrloeixlnpplliatlonsRather Cur1bT Curedby 23259.0 23296.0 bjrloeixlnpplliatlonsRather bT by-1864.0 11384.0 23303.0 local JoeA1nppllcatloneas 12600.0 23323.0 12776.0 thtrcannot Cnnllurenob rlnlbrrarh13564.0 tbetheillieacod tbehelllod thediseased 23415.0 illieacod hellloddiseased23427.0 portion parllon11736.0 otthutbe23443.0 cnr lnrenrThorn 1hrnThrrnlscnlv Cllhcnlw14040.0 23447.0 olleonewnjr ollewnr onewny 23543.0 wnjr wnrwny11492.0 23567.0 23572.0 cure loafn doautcloantI 23575.0 12500.0 nmlnnltHint UIItthrt12892.0 13288.0 tllle13480.0 IoconetlttiClonal vonstltu conetlttivonstltutloiial ollllltll ollllltll1I0llal 23664.0 23679.0 tloiial 1I0llalClonal23667.0 retntdlelremedtesPrnlmm 1ra0toee23671.0 11In III13220.0 mused cnusMlnll1liynii liT by14044.0 13892.0 nn14096.0 IIII1Inflnmril IIInllmrd I1named 23787.0 23800.0 named flnmrilnllmrd23795.0 cunUltlon 11I111111111ncondttlon11628.0 uf utoftin23807.0 mucous uunnus23811.0 23815.0 13176.0 llnlQR 11111111lhuug13860.0 IIf of23804.0 IhnhhnthoKustnchlan Ihntllltnchian hhnEuetachlan Kustnchlan tllltnchianEuetachlanlube rulltruinWhnn tthnaIhls13504.0 luno 11110tuhoIIIistu13996.0 tuUnwed 23923.0 InIlnmec1 inanted 24032.0 24047.0 Unwed Ilnmec1anted24063.0 roll24039.0 tiara bue24067.0 rumbling rllmllllllltruntbiiag12396.0 13172.0 Round IIOlInlBound13108.0 24059.0 24036.0 itiipvr 1lIllltpnperitiipvrIrot 1lIllltItct pnperIrct 24159.0 24175.0 Irot ItctIrctUenring lIArlnll ultiB ntulIIlIdwhelt wtlt12808.0 24187.0 12724.0 II13080.0 III24192.0 mirnljr rntirerytined tined1leafuee 24199.0 14120.0 24168.0 ixl ixlDrnfneat 24284.0 Drnfneat UtlIhulI1leafuee24291.0 IIIlethntinrisen rcfviltttlIlIltnndnnlutilrm 11111114unlrMthothnimam lufliimIlInOIlufliiminntton IlInOItnallon imamtnntion 24407.0 24424.0 inntton tnallontnntion24435.0 cnu CAli24415.0 IIntnkcn tnltnmkrtt24419.0 nlltcutInll24411.0 Ihlllttrln13408.0 tuhn tllhntuhorestored tfllttdrratredrestoredto rratredto24560.0 1024547.0 Hstie11316.0 24535.0 norronl 1I0rmnlnormnlcondition ClIdUIIIUcondlttou12108.0 lu I1lntllll henrtngnrlnR 1111clodoBtroycd clotilroy doetroled tilroy 24663.0 Btroycd etroled11756.0 fornvcr forfllrforoverNino NInnllIn eases onses111121ullt13112.0 lell14052.0 nrti Mrnrtimused 11cAused Mrcaused 24775.0 24787.0 cAused musedliT24783.0 CAtarrh cnUrrbcntarrb24779.0 noililntcnOlhlnKbllt24799.0 InQnincd In1211111fd Inaanudcondition 24895.0 aanudcondition 24915.0 Qnincd 1211111fd-1068.0 OlIl1ll1onthl24919.0 IIIIICOUII24899.0 mucoussurfocesa mucoussurfocesawo -1060.0 Hurfnces HurfncesWo urfllce urfllceWo 25015.0 25027.0 Wo wI11giro 110gmro25019.0 OliOonellundrod 1lnllnllIlundrrdDollar nnmlare25024.0 ollnrs nnTanyrnsnof nnTAlft anycnee 25147.0 25155.0 rnsnof 25184.0 cnee Alft 25151.0 DnnfnoM UnflloMUenfuoMcnusml tcnused25164.0 IllIIII bTontnrrh Intnrrhcntnrrhttmtcnn ttmtcnnnot tbllt tntennt tntenntmint 25167.0 1111not 25295.0 mint25279.0 cured rurollrurod25271.0 liTHalls llnne11nll 25267.0 Catarrh CatnrrbCure CllreSend eud 14048.0 fur forfurcirculars furdrculare forclrcuinre 25395.0 25403.0 circulars drculareclrcuinretree11772.0 25503.0 F 25508.0 CilRNET CiIRH6r25523.0 UJNET SToledo Tolol1oTolodo0O13932.0 USold 0Soh OSold 25635.0 Sold Soh11788.0 PrncKluK DntggtMDruIII iUnlll tSc tSchalls 5o 5ollftUi 25755.0 25767.0 llftUi Unlllhalls25760.0 Family oI1111111Tills 1111125763.0 25779.0 I1rebeltbestNn beltNn bestNo Nn NoExcuse KICIUBExcluFnrCrlinn FnrCrlinnIn Crllnll CrluteCrllnllIn CrluteIn26244.0 26259.0 tbfttepolice poUce26255.0 court 12784.0 Cincinnati Clndnnl11Cincinuntlbar hilthetblODbeendecided 14280.0 blODdfcll1ed 26367.0 decided dfcll1edthntIhnt26371.0 lUMUltycausod IUIultrC4UIIol1lasauttyeaueod13280.0 Manor IIql1l1rImgnurIIlecs cxcsCHIP cxcu x xClhtt 26499.0 26527.0 CHIP Clhttcu 26503.0 crime crimeI crImeIlm 26835.0 Ilm 11236.0 11296.0 26859.0 nm 11496.0 26847.0 suraenre26815.0 Pl Plllo 1leoe 26844.0 oa CuroCnneumptlnn Consumption ConllumJI1nn-868.0 26839.0 snr enrdmy 14276.0 dmT 26931.0 26980.0 mT26947.0 lUll llfnlife11400.0 26951.0 ihieJ Ihlel tte26967.0 26963.0 1Mago IIrDago111 Miu 26936.0 1JLoC 26943.0 TII HH IIOHHOB HOIironHOBBINS HOI1UiS ironatMMepteSt 27052.0 27096.0 BINS 1UiS27072.0 atMMepteSt Mftplo lAplo27075.0 bt 27059.0 Ncrnlch lorafch27063.0 rlcb 27055.0 Feb Pubrob171000 11000171000Clilcnco 11000ChlcJo 1010 1010Chicago Chicago ClilcncoChlcJo27391.0 veer tJrertti 27420.0 27415.0 er nuaslnrn OUII1utludnranuaslnrnAbout OUII1uAbout tludnraAbout 11304.0 About 1700000 JOOOOObarrels barrlJsbeer fn13412.0 27575.0 ntwriremonth twMre tWIfOtwriretwMremonth 27563.0 tWIfOmOllth 27672.0 27691.0 mOllth27679.0 27683.0 bo27699.0 fair tnlrestimate llthllato27675.0 totht 27696.0 comump consumpeonsumpcomumplion consumption eonsumptfon 27791.0 27827.0 lion tiontfon11536.0 27812.0 11768.0 27807.0 CbIc ChlciBO CIlIclo27823.0 12512.0 27795.0 Thoo Too27815.0 I1re0371 OSil191127799.0 licenced Ilcansed13600.0 Ilcansedplhuce licencedplbucs 27803.0 eDlLed eDlLedp1bullin 27948.0 plbucs plhucep1bullin Ctilcaca Cl1lcaiOoCbfca aN 12352.0 11136.0 29267.0 29311.0 flta 29339.0 xmlns:ns11 ID27 27963 4736 14336 1468 ns11:type 16260.0 16280.0 JESTER JESTEREarth -1488.0 17767.0 15160.0 KINGS KItIGSKINO 16156.0 16008.0 16892.0 Earth 15024.0 III14916.0 15236.0 lhl15124.0 15560.0 15452.0 rent 16024.0 Kings 11111 16476.0 16368.0 16584.0 kitchen kitolionlitohon16471.0 17251.0 whleand 17256.0 wide whle17592.0 widenml 17595.0 1r1e 1r1enllll nml nlllland15248.0 wait vmt15167.0 vmtWhere 15520.0 waitViu 15328.0 AIt AItWhere 14648.0 Where Viu 15116.0 14984.0 15183.0 15112.0 15564.0 or15768.0 us liS15700.0 16028.0 n15912.0 16180.0 laboring IllborillKhtboring16104.0 16824.0 rook cookcloth tlothloth17140.0 lothtry 17584.0 17259.0 tlothtry clothtr 17576.0 14920.0 tryTo 14924.0 try 15136.0 trTo 15052.0 14756.0 bnko baknbnk 15080.0 14996.0 15208.0 2604.0 15347.0 him 15748.0 fll1t10seine15667.0 16164.0 dainty 16092.0 dl1lnl unsurpnssed tttsnrpnsscdunsurpnssedTo tttsnrpnsscdo17528.0 16884.0 mrpnl 17384.0 cd 2696.0 1014828.0 14908.0 Iris15152.0 15503.0 regal rcjjalrogal15355.0 15839.0 nor 16283.0 16348.0 molt rnchrnoh16736.0 loth iloth16656.0 vie 17056.0 vieTor vieFor 17224.0 Tor14764.0 14612.0 14564.0 14904.0 tilltis15180.0 15412.0 2856.0 15780.0 15672.0 cooks coolu16064.0 16648.0 thomho16540.0 16968.0 daintiest daintlc916868.0 daintiestfaro 17563.0 daintlc9CArc daintiestinto 14932.0 CArcintofaroA 15191.0 intoA 14644.0 boon 15320.0 thnthclie15612.0 15940.0 shall nliallIIhl1l115852.0 16352.0 leave 16791.0 16988.0 16888.0 16872.0 9 16920.0 17079.0 humble humblepin 17587.0 humbleAnd 17111.0 lum 17376.0 17372.0 17516.0 17500.0 cpineo pin pineo 15120.0 co 15280.0 coAnd 3468.0 AntllllI 14871.0 philjy g1 15288.0 15016.0 iIly 15011.0 mount 15868.0 16240.0 rcnt 16512.0 16580.0 17040.0 16724.0 Jnj 16635.0 16980.0 marble marbleBtnir nmru nmrufnir 17460.0 marblestair stair1o stair Btnirfnir15240.0 BtnirTo 15244.0 fnirfo fo1oawnggcr 8wnggereungger14832.0 15508.0 hia15636.0 hnlls halls15908.0 16360.0 16552.0 gold ohl 16844.0 nndnntllncc 17168.0 nntllnccChnnco 17496.0 17240.0 laceClmnco laceChance Chance ClmncoChnnco15064.0 15004.0 15224.0 n15096.0 jolly joll 15664.0 15716.0 jester jcstorjesllr15572.0 16216.0 wnndrinjs Intlrinswnndring16120.0 16996.0 IhroiiRli hrouliIhrougli16928.0 IhroiiRliWho -548.0 17544.0 Ihrougli1lro 17024.0 hrouliWho Who 1lrobent hent15548.0 15823.0 mischief mllchlcr16548.0 casts cnstll16400.0 17000.0 hill17296.0 cycut17196.0 eyesnround OCif OCifnrolllld cycutnrotmd nround nrolllldnrotmdnroundTo 15404.0 nrolllldfo nrotmdTo fo14748.0 find finel14680.0 nllolhlrwnvy aernvy15740.0 lrI 16127.0 16192.0 triok trirk15952.0 16516.0 16315.0 16799.0 totwoThat 17052.0 tofhnt twolint 14636.0 fhntlint15316.0 hillIris15212.0 farfamed irrrnmcdfardantcdfoolshin Coobhipfoolslrip16268.0 may ilia 17399.0 17220.0 toBound 17404.0 rcredound rcdound dound BounddoundIfo doundIff BoundIle Ifo IffIlespies IIpics14696.0 15156.0 15092.0 nnnty nnstyt1Mt 15732.0 baklntr IInkinbnkuiu15576.0 16264.0 merrilyAnd 16204.0 merrily morrilyn1lrrlb16788.0 morrilyAnd n1lrrlbAnll Anllquickly quickl5116.0 ere erocrc16100.0 tho15956.0 16447.0 hUll cook coolccoos16684.0 17344.0 emcanknow emknow knowWith knowSitb Sitb14936.0 tiimer Iilllreflouter14852.0 15396.0 pok 15331.0 po pokrs 15856.0 16072.0 swelling nwcllinucllinr 16632.0 airily nirihnirily16596.0 airilyAnd nirihAnclloollr nirilyAnd 14628.0 Anclloollr 14928.0 5532.0 lol lnlmfr 15640.0 clnintielltcake clo16720.0 16820.0 16900.0 ttirnul turneJl16752.0 5528.0 turnc 17439.0 17272.0 todough 17579.0 todoughl 14912.0 dough doughlJoseph JollcphlL 16116.0 Gregory Gregor16916.0 17044.0 17119.0 Life LifeHUMOR 17388.0 17228.0 ICC ICCHUMOR 15084.0 HUMOR 15812.0 OF 16148.0 6204.0 16020.0 16600.0 DAY DAYI DAYul Oft OftI 16812.0 14624.0 6416.0 6515.0 ul 14716.0 14780.0 loved 10cel15292.0 15492.0 OIJ 15659.0 15688.0 hue 15656.0 raved 16076.0 16856.0 front16923.0 Iom 17328.0 thci11tHthofirst thcifrRt 11tHfirst 17568.0 frRt14860.0 nlJht15268.0 15460.0 hnehnd15388.0 15796.0 15728.0 15900.0 CllJr fathers Cathelsrntn lntlnrUlng 17423.0 111litInBrndstrects 17560.0 111BrmlstlclsPhllndelllhin litBradstieclsPlmihndelphia 17555.0 14484.0 Brndstrects BrmlstlclsPhllndelllhin BradstieclsPlmihndelphia15428.0 Philadelphia North NorthAmerican 17248.0 17476.0 17452.0 hAmerJenn 14488.0 Americanhnt American AmerJennAmericanWhat AmerJennWhnt 14720.0 Whnt14900.0 15252.0 15364.0 15472.0 thlmeaning lI1enninr15704.0 16560.0 7308.0 or16468.0 tlieUic16716.0 17164.0 word worel17064.0 wordnatural 17552.0 worelnnturlll wordnnturul nnturlllnnturul15296.0 nskclt15048.0 thotenehcr tCl1chClteaeifer16044.0 oC17144.0 stool smnll9mnllsmnllpupil 9mnllplJpll stoolpupil 7691.0 7724.0 pupil plJplltime15408.0 7735.0 WI1 16188.0 weact net16780.0 heoluWowelearn WoIcaln weleant learn Icalnleant14952.0 manners mnnuerfl14863.0 7932.0 WIIStunsthotime16124.0 16504.0 answerIIe 16508.0 answer I1n9WCIanswerHe I1n9WCIHe He IIethouht15987.0 woulcl16396.0 ould 16463.0 16392.0 shrewd IIhrcJshroudshrewdAnd 17180.0 IIhrcJAnd shroudSad 1420.0 15044.0 Sad15400.0 tired wcilwc1115752.0 101Ibr16016.0 moneyv moneyIImone moneI 16376.0 14580.0 I14608.0 Well VllIWe1115216.0 15616.0 15675.0 15896.0 15831.0 boslircwcd bOllhrcwcelboshrewcd15928.0 boslircwcdIs bOllhrcwcelIsboshrewcdls16783.0 1276.0 15032.0 lsthllt15164.0 funny 15828.0 funnyPhiladelphia unnyPhill1t1clphinfunnyPhtladelplrfa15968.0 unny 1320.0 16048.0 Phill1t1clphinPhtladelplrfalrlsllresslressVito 17368.0 16984.0 PressWife lrlslWlfo Wife WlfoVito14988.0 15584.0 8911.0 unhappy 1l11hnlpyuulhnppy16532.0 husbnnd 16252.0 hIJRhnl1lllI hushauulIhIJRhnl1lllIwOlJhll1t -1012.0 hushauulIwoultint 17480.0 Iwouldnt 9119.0 wouldnt wOlJhll1twoultint15272.0 worry tworyW01I 15904.0 Tohn John16276.0 16692.0 doesnt e1msut10donny dooily 17412.0 10nuy 14472.0 oily nnynuy14868.0 14752.0 15220.0 15056.0 15036.0 borrow hmlow15487.0 trollhle16159.0 17176.0 hitsbandMorrow 16828.0 hits HusIIlIs17492.0 Husband IIlIshnntlBollOW 17504.0 band 1184.0 hnntlBollOW bandMorrow14836.0 15088.0 llorrow trouhleGrllItGrent16288.0 Cnesaiw COCSI1lCnesnr4Cnesnr4my Cnesaiwmy COCSI1lm 14792.0 dear 111nl14600.0 15436.0 aint nlntaant15336.0 15876.0 9671.0 borrowing h01Iowlnharrowing15776.0 16764.0 tlolJhle16672.0 r17316.0 Ihave 17548.0 rlano 14464.0 lano1196.0 lcndTltIllts lellllfitBitslcndTltIlltsI lellllfitBitsI-1196.0 IeudTlt 16248.0 Bits 16184.0 BitsI SIOthnttlunt15556.0 a15476.0 15724.0 Swiss 5wl119engineer LII 16536.0 lneel 16416.0 1mshnR16880.0 Invented 17484.0 Inentel1 invented vented entel115060.0 10339.0 a14968.0 brake hllIlOthnt16151.0 16520.0 stop Htol1step16436.0 n16836.0 17095.0 ilylnr 1fy911g17004.0 ilylnrexpresstrain fl 1fy911gexpreas 17300.0 IIIr IIIrXllrlstrolll 10475.0 10499.0 expresstrain Xllrlstrolllexpreas 15468.0 15104.0 trnin Inside IlIslele15464.0 16176.0 oCelJht16332.0 yardsGood orll1 orll1IIGood 17396.0 14460.0 Good IIGood15196.0 Hut Hiltnhollt15916.0 16479.0 passen 111188011pussen16840.0 passengers 111188011gersn pussengetsare 10871.0 gers gersn getsare10915.0 ro 15256.0 10888.0 tllt 15588.0 15680.0 expocted XpctlllexpectedstO 16992.0 17127.0 tooCleveland 17360.0 tooClcc11l1l1 tooCleteland 14604.0 11079.0 Cleveland Clcc11l1l1Cleteland11075.0 Plain PlnlllDealer Denlcr15864.0 DealerPearson DenlcrPCllrROIIllI DealerPearsonId 11292.0 Pearson 1056.0 PCllrROIIllI PearsonId11300.0 11lo11307.0 16320.0 ImowMeow16816.0 16732.0 17212.0 Rent17135.0 sentme Rentme thlR14684.0 abusive nll181olettul16420.0 16212.0 16712.0 11491.0 hot IIltbet16952.0 11511.0 wasthat WIIthnt 17436.0 waslint 11695.0 thntlintcrank clIInlt14772.0 net15264.0 door c1oor16759.0 lef1SonPearsonI -620.0 14548.0 114691.0 110ntthlnlthlnlcBO15552.0 John Jolmn16272.0 16700.0 16619.0 hoo17084.0 havobeen hooheen 12087.0 heen1001114896.0 somcsonic15372.0 onloat16143.0 knows knoROl1 17008.0 17108.0 l11uehtuuchmuchbetter l11uehlIettel tuuchbetter better lIettel14992.0 12275.0 thnuthll111212.0 doeHTitBlts 110MrltllItsdoeHTitBltsI -1212.0 doesCit 12507.0 wish 12503.0 Imewlcuew15500.0 whether theres theresIInythlll -636.0 17407.0 isanything 18820.0 1292.0 14448.0 12687.0 IInythlll15276.0 12700.0 dr15772.0 15944.0 Shadysldc Sh1l1sle1eShadyslde12715.0 01uotnotpaid uotPillet notsold paid PilletsoldMiss Bellellcld neHlUclllIdehielleld16236.0 16168.0 16388.0 JSf 12871.0 Bloomlleldhave 16652.0 Bloomlleld lllooml1uhl-824.0 BloomlleldHave 18824.0 i1I1l0 14543.0 Have 1I1l015368.0 13079.0 15960.0 15844.0 oCtesting ttstlll 17232.0 111mhhn16976.0 himwith 17524.0 111mwith hhnwith 14444.0 thothlcathode cnthol1lcatlmode15807.0 16412.0 nslul116939.0 tilllat Inthutlatter hutterPittsburgh 18835.0 1300.0 IterPlttRhur 18851.0 14440.0 1240.0 terPittsburgh 13475.0 ter -1236.0 terPlttRhur 14660.0 Pittsburgh 15596.0 ChronicleTelegraph Chlonlel1clegroI1hC1urouicleTelegrnphChronicleTelegraphTho -1584.0 17508.0 Ifile Ithe 14672.0 file Thothe15000.0 rabbit rhhit14940.0 met mot15820.0 time15756.0 Belgian DclgianUclimhere ImrohnroImroAnd hnroAntllmlll hereAnd 13839.0 Antllmlll 14960.0 Raid said15744.0 rmtl16135.0 nnd13843.0 nnellortll 16460.0 lordly airIVhen air airWhen 13999.0 When IVhenpledge plcdgoJllctl 15592.0 tjood10011IlIck16172.0 16592.0 14027.0 secures IIcclllC3seethessecuresMy IIcclllC3M seethesMy 14139.0 My leCtheft14812.0 hind legs 14187.0 I1S15936.0 rood Jtoodgood16140.0 14183.0 I1Syours yoursChicago 17172.0 olrll olrllChicago 1312.0 16832.0 Record llccordUccordllccordIowne 17332.0 UccordlownlTlmt 1Tomv11r 14576.0 Iowne Tomv11r1120.0 14592.0 lownlTlmt 15100.0 15339.0 Thnt15284.0 boy otJoness 17036.0 16944.0 17092.0 14507.0 8 17156.0 17235.0 oldwMhiin oldthlm oldthan 17464.0 14408.0 14664.0 wMhiin thlmlooks boltslool 14708.0 15860.0 isut14671.0 Ito16200.0 ItoI 14667.0 heI Bcawna 16608.0 BcawnaI ptoWnUw 18504.0 itI 18584.0 lIont15204.0 thlnltlminlc8014851.0 Why1 Whyr1Vby 14844.0 Tot 16860.0 Towlu loWillTowluI loWillI17204.0 lieI 17320.0 nw luauskating skntlnJ16312.0 today toI1I13tiay nudanal17340.0 liehenever 17520.0 heneel lienever 15219.0 neel15271.0 011cehllll15880.0 15243.0 16132.0 sceseenear nemhocould horoll1cl roll1cl14972.0 15140.0 15440.0 15524.0 15427.0 900.0 dangersign llm ersl withoutfalling withouttolllllg 15624.0 falling tolllllg15019.0 15620.0 InPhllnlleI11hln Phlindelphia16408.0 PICElSPressHe PICElSlIe Presslie lIe Hequotes quotCR15568.0 15884.0 n15480.0 grent15651.0 16232.0 llenlportrrpoetrysaid portrrRl1ltl poetrysold 16047.0 Rl1ltlsold16071.0 young 1140.0 ymtutvamtul 16075.0 IUII -1040.0 15848.0 womlII11111117447.0 rfTshouldnt rfihouhll1t fshouldnt 16239.0 shouldnt fihouhll1tbother bollletnlJOl1tidle16775.0 snltlraid17160.0 MssMissCayenne Cayenne CI1cnnt15324.0 16428.0 1815544.0 1I0tserious HotloUR16848.0 seriousA HotloURI16620.0 16631.0 14344.0 14712.0 16660.0 I11l1nmeet14568.0 16655.0 nelr16627.0 ctuotes16623.0 110111 CXCUpt16740.0 exceptwhen CXCUptwhen 16811.0 16815.0 hclossy Imwlazyy16356.0 oC16839.0 sonuesomethlu sonuething 16995.0 thlu thing 17039.0 say snysn OCeOlll1taccountWashington OCeOlll1tWIIHhln accountVtmshingtou Vtmshingtou17199.0 WIIHhln -912.0 15376.0 17203.0 toll Star 5tl11StarTho 15800.0 18864.0 tTito 18912.0 18867.0 17244.0 tTho 18872.0 17435.0 1Scltllce 17551.0 TitoArtificial Aruncln1trliflclnl17556.0 KCK 16432.0 SF llnro HnrnforallnroScience foraScience 17615.0 17720.0 Science Scltllce17715.0 prompted II1Ollllltcl1IInll17748.0 urged lIlgmlurgud17707.0 16904.0 17704.0 thctimethecommercial timeconflterclal 1332.0 Jcoml1lerclol 17899.0 17912.0 commercial coml1lerclolconflterclal17908.0 instinct lushestbus hllllhtts16455.0 demonstrated lIIonsl11tcLldemonstratedthnt demonstratedthat17904.0 16643.0 lIIonsl11tcLlthnt 18088.0 that18103.0 casein c1seln14768.0 Clomfromn18099.0 ordinary o1ll1ul1l 18127.0 cows COWIImilk m1l1tuulkm1l1tI uulkn18280.0 n14352.0 18296.0 is18327.0 nshoodC0115708.0 18291.0 baking lIltlngbnlci11g16708.0 18324.0 11Mtho11w18287.0 tlnfln17184.0 tinest tlnI tlnlNt flntest 18464.0 est lNttestbun hUlltutu18519.0 eggs CJIIImlnud15984.0 company co11lpanyeo 17020.0 16492.0 18480.0 tlthwithO 18679.0 18684.0 15500000 060000014744.0 OOOOO capital ellJlltll1capltalhnlhccnformed formel1tomanufacture tomnn11Cncturc tomaunfacture 988.0 manufacture mnn11Cncturcmaunfactureor18907.0 asubstitute liuhRtitutesttbstltute17288.0 rLfurr17200.0 furrthe forthe rLI 19051.0 19067.0 thlfresh nnd111111strictly strlctl 16624.0 19063.0 CIIRh19091.0 pro 110product 110d11ct 19251.0 19260.0 duct d11ctoC14784.0 15027.0 poultry 110ultry16080.0 19255.0 yard JnrdOlllpound 110111111pottllpoundof 110111111oCpottllof19439.0 19455.0 oC14707.0 nselncasehu19452.0 15175.0 equal ellunl19448.0 sl 101 17016.0 eggsAugust eggsAugtmst sAugust 19639.0 August AugtmstBelmont Bclmont19680.0 alarge lor 16364.0 stockholder stoclchidlderstockholderin stoclchidlderinstoclill hlc hlcIn 19836.0 thlllthus14596.0 corporation corporutlon16052.0 alreadythough nlrtn nlrtnthou alreadytlmongh 20024.0 tlmonghthou 14788.0 20059.0 nuanInfant Intnntputa p11tn16748.0 011t16668.0 17068.0 nboutnhout1200 10014876.0 pounds n16108.0 tho16444.0 equivalent equlmlcntot20412.0 80400 20447.0 J8 15495.0 hens liensonlrremaining lllI1nllllncremalningremainingadvantage -792.0 lllI1nllllncnllmntagc remalningadvantage 20604.0 advantage nllmntagclies litshl20611.0 thotime1296.0 unhatchableness unhntchnhllncsMmuiuhuatcimnilenessunhatchablenessof unhntchnhllncsMoCmuiuhuatcimnilenessof-1296.0 oCthurival rlml15540.0 20804.0 plolluetnlulnudincase Incosoincasement Incosomenl Incaseuncut 20987.0 20999.0 uncut mentmenl11nbox hox15692.0 20996.0 instead Instc1lorn16744.0 8htl1suchSheShonlono Shoolone Shealone 21176.0 alone nlonoolone21211.0 21183.0 15188.0 thooCbroods lIlOOllsnullandflocks null110clts andlloclcs 21367.0 flocks 110cltslloclcs21375.0 oC21371.0 chickens chlckCns15128.0 16084.0 21384.0 Casein Cnselncl1nnot17283.0 Iedeprive 17324.0 Ieprl 21443.0 21559.0 prive prl 21595.0 21563.0 liarorthecherished elterlshllI21579.0 privilege IHl1egtprivilegeThe IHl1egtlho privilegeite 21752.0 lho14584.0 ite 21756.0 artlnclal n1tltlelnlnrtittclalegg hll8hits21772.0 arrived 1I1lICllnotthe 21940.0 21947.0 artificial oltlllclnlnrtillcial15628.0 21956.0 broiler 21964.0 fowl Cowlcaponroaster capon CUllon1512.0 IrOllster 18996.0 22139.0 roaster rOllsteretc etcNew York 101122159.0 IIessPressCondensed tiCIIIIIICUII1 18960.0 tCondensed 3708.0 Condensed CIIIIIICUII122471.0 Itoproo nnJlroolteproo16032.0 ItoprooOccasionally 18936.0 iOcen 22468.0 iOccasionally 22655.0 Occasionally Ocen lonnU 16372.0 22687.0 Coune117428.0 22707.0 naproprietor 22683.0 IiflloJirlctor nproprietor proprietor flloJirlctorot15516.0 22887.0 22863.0 sccoiuMinnd 8ecolulholUlsecond -940.0 16244.0 hnnd book hool22875.0 store Slorestorewho 22843.0 22987.0 23040.0 wllo14379.0 III15108.0 somcthln 15892.0 23083.0 more 23059.0 thnntunatime23095.0 ua nnualure nnur 22967.0 1340.0 fi fiI 19023.0 23027.0 FLure 18980.0 lure 23235.0 oCJils JIIsJasbusiness uuslncss16096.0 23248.0 oulLl 16544.0 23283.0 scemRefill23263.0 17312.0 Indlcatc Inlllente inMonte 23403.0 dlcatc lllenteMonteIIuIle23439.0 regards 15380.0 23463.0 gnrc1s hilioltlmild23451.0 amid nndnml1110 23480.0 rare rnrornrovolumes rarevollttle3 23611.0 volumes 01111118vollttle323623.0 rather mther23659.0 1181sa23627.0 collection colleetlpncellectlpu23640.0 thlln17420.0 23675.0 nastock nIItocl stock IItocloCgoods OOtlll 23824.0 nnel23828.0 experiences ctpCllcnccs23867.0 23863.0 pang 1111111pangwhen 1111111when 23995.0 he24015.0 parts Ilntts15132.0 24012.0 wlth24051.0 olleoneA olleA 24080.0 FA 19044.0 flippant 11tIInnt1116.0 flippanttung 24231.0 24235.0 uu IIlnn24216.0 droPIclllnto 24220.0 24255.0 asecondhand aseco IBcconc1hl1l1tl seco 24383.0 secondhand Bcconc1hl1l1tl1111ud 24400.0 24404.0 kcptbr24448.0 a24443.0 24376.0 mnri 17243.0 oC oCthis tif tifthis tthis 24571.0 kind1nking kind IdndkindTaking 24691.0 24768.0 Taking lnklng1nking15872.0 Reernl16611.0 24796.0 choice choleo24803.0 plil plilbooks ohlohlhooks 19015.0 1500.0 24956.0 books hooks24963.0 Crom15511.0 24971.0 tllo24980.0 shelves shehes24987.0 ho1u16424.0 24995.0 fingeredthem 24991.0 fingered llngerellfingeredj llngerelli25195.0 i14384.0 carelessly nrclCssl They 25171.0 hc 25179.0 happened hnl11cUul25203.0 totreat totr 25348.0 treat 25351.0 14588.0 oCabstruse nhslruse25363.0 subjects suhJcetll25379.0 antilIlc125392.0 notappeal not111J1Cnl 19031.0 1504.0 25535.0 appeal 111J1Cnl25539.0 14956.0 hllllluluhimArc hllllArc luluAre 25727.0 Arc Are25736.0 ot25740.0 tlllSC25751.0 hire hlrolurehireho hlrohe lureho he14699.0 25915.0 25927.0 carelesslyXo carelesslyNoenrclcssl enrclcsslo Xo No26143.0 ouug26152.0 111nntote26131.0 sharply shnrpl26159.0 answered nnllwcrooansweredthe nnllwcrootho26299.0 tho26303.0 26319.0 1he 26355.0 arc26336.0 tor16564.0 16955.0 26339.0 lore lorlloreI lorlI26491.0 iouthslouths14387.0 26496.0 COll1pnnlonCampnniouCampnniouJnpnn -860.0 Companionj COll1pnnlonTnJln 26791.0 Tnpnn TnJlnJnpnnUtln Ul1nUsing 26807.0 Roman ItotnanJComanLetters LetterLetterJapan LettersI LettersJnpnu 14372.0 26960.0 Japan TnpnnJnpnutnklllg15995.0 27004.0 ncw16088.0 step ap npapproach nppronch proach pronchWeternc1Ulzllt1011cvllizntlot27179.0 noliwithdraw 17116.0 WltllWltllI1rnw 27256.0 draw I1rnwCram15456.0 Chinese traditions trndltlons27411.0 requiring rtlJulrln rte rtequiring 27443.0 quiring lJulrln27535.0 officially officlnJlylantlintJapanese JalsnesoJapaneselanguage JalsnesoInnS1l1gc InnS1l1gcsllnll27771.0 27743.0 taught 8chools27764.0 bymeans mennsotItomantomnnletters llttersnutInudlonger lODgerlODgertll longerby 28059.0 28103.0 14736.0 28115.0 syllabic srUnlcsymbols srmols17719.0 29143.0 29291.0 tij yr



PAGE 1

SuppliesIJ-AiiS1rQtfhtietacdlfllpotbnltntlfullybotntdHarne-3sjlllpparentlyacityprelaitpr4yJhjALSaddILy4StowR-angesr-ntcostBdefQtliciainparrtbituemartylierrandGfiOrjiato6rcejCirq-1TtII1EZihaII11g-iynro-niiikliiKJnunoyrnpfdlytasontll-1arkdaRAtlarttkumitblyipti9nfbfheilvQrrOJwlsUnrfQtf1I1WRegistersnlnkit1UOOtiiikinyTheGeorgiayonugman-Kiiiljacconipariicdeverypari1ot-ddoubt1thphlostboiuitJfult-tbWCekluadrauceorpartleeScheduleEffectiveinslittttedandcdrehlouyiirhardpressedNotwithstandingappearsJthatyivenpennissionJtdgcKingliitur-U1i1lDiothryltnhtlrullyiii-ftiEPATENrTvla-JcltaatrasShlgiltfirsrlItrtrltTddculiunry-sympowum6pt5onvhendorncit-vltiGordnnMiinufncturcltiuiidCORKIWONDftNTSO-HTIlnTuwilt-yatrlCroijcefyroxtctsO-IICM9dettltttoirouhttdjouraa1jrtc4cattlpHit1VOklpn1c1aJtathRtnIJltU-Jutlttyafterthe-rCswi7ritlft-tFotQhave-ItlghcdExpiingqjtheLucnlrtrheellrnenntk4o-JCSopitiktTrstoPoIatEploratloniveVojjJdPoliticalGovernmentniflllllph7tl1Ialivt-SciclrtWvscompelledsliVtavcryaIiortpprmnncntfinlnryqrfpbl1rLcyJI4thpbnoksoils-ItsolfHIillrlldr111-1OrlGcorgiTtnspziQSlleCtviuiiHublvatedyl-hDIl138dytah1lPanArctican1nptS1lclgr-tnviniinltyHoonUikMi1lanI-flZSReMnrtsiiohiiKOttainhumanity10111113ht1ipatronizingArtuFiltnruletntQftQisKingjeffCirthi-JhbriefilmtftElclntiticerdmonvpredecessorsIA-clSfallslcaIpecnliarGeorgiautJ1Jijrtul1lJl1Qh-fytJenterpriseExposition-ofaffirma-tiveIPrlippincs-Nlirsvcl-srarioroGalvestonIkUlxlrlIl11kiiPntdtutnrri14JlfeIIIInoounl1i11-Hir1Jltupourequcatljithireenr1r1SewinghfrtndtusttortttPdtlress-yoorrospondenqelkititJSensationt-1yurtittlr-AhPolitIca-lretorirtiiotllcrnlflnKnrur01111tnImdescription11WlihFlOorros-fjcindntagonfollowingInarrieclthe-Rcgu1rlUcrcporta1-1iAUtttinSCRIUER-STmntlontlICl8J17somewhat10-OVERjpitiedPassengerbjftljI-tWtiltrrrltatQBRibbonsllAltT4tooiuMiali-olilea1ipiligpreviotisArttCA1rrbrdlforccijIOI1tlllORtlorftitbookCurrentwhetherCsAclliconcerningipensc-PatonUtiti-trdlllpgraduatediiurgtlrshprtlyOutttniliyftGhavingT-Jarra1IJ4lillflOOIlIlIJagreedGeor-giatATURCoilcfusiontohyoftamFRIDAYrlj1111tiii1sqnlcklyjirfdlvortlslLfulAmericansffis-adtrueiltthlogntyhytltrLtt-rtrmfhrtttlndliiiinHUfllIt1hldltntpromptlyrtllittrWiiLYitmoney1-i4-1nitift1thSClfJJC-hriltHngQP-nONctl11otttI-IltnLSi114tArcadiaOoutpnny-tacnttcnillnganotherpcopleUoVerdictprcfcrfcUaueenrraIiondenprofoundhisioryUvtnrvou-XAUVKRTliieRSUiampttdsyllgyikilAUlffIJ789J900BtflfndrtrMsiCinVarrUt0sitT-fnrtvoSitiot1mmlilslontlip-frfiliJitdgecontestpQJtHtJtUl-tiaJvbrtlstftucrfttfather4onvelqpo-foititoft4IoptSPECIALreportnnJMvomutirtlnnngorutictjthUrtlFactsctW1JitHaIJBOpponttipto-dtttclivorsetit14tt1111ttcIiuiinl12artJ1I1initttl-niottenU-iecuredndjolninjj11otlFoulttt-1IIIpnintnisscadidgyertoXQChcoinert-CJawsuitrtpvaAShernian1ijpartdonttolicswltclaimslLiclintbeforeJ-Wynchildrenclpcidetonrodnccscc44tbullionif-tfesensationpiirtlcnlnMSAjra7lrsh-elhlorahorl1ricstratFloridaippinesownedInvestorsteiiitnjlsinventionAfric1DI-WIQOOvarthwreckedBuildingwnRrwrynwthroughucllulavingthroughiVtitmiuM-Morof-tlUffrkitfiiw31tiifdJJrance-WoofferA-fjurilyiri4forgetrdtl1UhrhFttforinInoiCrlst-vlninaufouuyyetlconsultedThnbookFiguresliorrmpunilantiiWwithifurltt-itclnwu5lndnfatPDougtentiolU-stoJsttyucsiavjjFloridaNlr-I1tfitnmpcdiaprduranOhriHtinnVyouritoUuitei4gEnratwhileOojintiet1tsWantedjt-f1l1CueanJbcshtJUldeffectfirowtngarbuifdSonLfarXramUewillinm9LondoncqualorOgdentuiiprbantlinnlchlolUOundthlnceIJOyuvxls-aprclrnn1itrviwishoiWfManilachildrent1TIton1TYchgatyrOV1Ramplefromjuryoftenaccountsttr1mruJlscttij11uhisulicenacsr11111AVjil-VsianBrewerwomanworldsturiesofcrvnyarationalAttvonunatfonspositionwomano18atthttteautiMnndRCrrkt1t-Tcont1ohlliauebiirijt-1UItcotulitllnnClltQlM1therechargemontagecontainpresentAnckeohwltlionrumorswhenwomanofficersii-wlmrouflniulvk1-IsurvivetUeTcstimeswAs11-ritirorttl1l1uluUublcrlhcri1nltontrcenturydfJJ1muttMarchtlJf1I3htllyhtalJiwpfhrWlt1ithJlitII-ITtoday1cffirnlnfqtitwurL9rtlarltiboastedtliaatirEtyrlrtJJhf-lthfrlltuevcrtherAcimrrallyppntrtffshorteightOhTlrftonRosterllrtliierbilityaiOOMOBostonPinrlreceiveformerlawsUtTI1AIUatptJfylnfrMisscentgperllnof-olflCtiPagesjtt1111I111110lon1ttrp15MCJLhbrWherefctsitttTt1CnppnnldbeultyticitaWhenadytsihvwofttbllthettftkHnMlldrtndnthltJ-J1AU0IilollnrscftyTheyfaWordorM-AtrialnleotlnfJtilrurthat111111011-fIgrbablytrialrV-IotJsvititnte6tvoulilninrrlitifMcausessaloonthobtjGunlateItitttrIrlrIEfactwhichnearly1tctKIIVoab1ohiPorjtQvernjtmtswifehaveur11f0lipolartluuj51rpiL-YThebijnJ1rworldtikOl1veryamongthanthat1llOtlnGonfzlOIC1upoledeyun-or1rcltliatmn-VOriCB111tnr9ttJlhrtbrceflintSouthtfytianbornWfftInnknoxvn-llinwi-itII-fYrhWrite1wotHdpHtiliehrThern1mytheTin1ItFaretISlIrarlraqmenL4Ltpatenobtainandit-tlaushowsOhrstqrtwrrTolyrjtohandsatlrnucudStatevnrllHlnirviasturnssaidIt-nraiiuliANDiuatthsaQttdcpmclIuttllltl1lllsatlfSriorlloirealvvlIottlUIIICllIvsUottiliSvr41tinsetonlyfact1111lltltrIunditionTOPhotulfBUtJulyCCSdtlsJaus1tIrJOCltfoYactressJilworcll4urPointW000toloolcjurytheirbetterincuiHhri1iorsdrtathef00tUlMfoVdintlOllldsgetnaiHaJaddressr1JmGAnyilUlIJOnstfs-Ismallcatchr1atonrfslittle1aWqMooudHowYifromlaattwmentsCrlrtwV5jAAt-Jshellthef-TCmuWnitoCutefertntiyZk1JtYLit3GOUndnrcoltumisrnduwandrumilntrtvfll1l-loiidnRttbrtrotvlKiier-rrfhbooksrouteliveWsh-tlotnrQJustclwilrledontWestJtSuitelrUC1Jccrtlfln-IoliiceWjVthetheWrmsonalJSendtljorofromIHIestoktr-Oost4g9GLSepnortlmhermanswaiLE1UososthritconiessnccosaworthrtjfpntwhenlnnessbutfourGxailhomee-IPeoJlrl3Liteyistorhaze1aroeltlnnedthol-iEii-oloutrluellwcimA-BruhwifeConUVtpbandwhoreherIp11Aaihashthatavid23CO-T18SOhervriitoil1LHbillIhftfmostbigE1rhvrldtomwasliithandiivhimThelllullwlt9COtlieproprPefor900tff-IthebyOverT311uvwwri-tliijttermsMnnlVotiiitwonmiiRicothetondtheg-iihMPhiloralGen-ronltyl1900nntnlds-andafterviil147tNUrtQIftotKnatfl-ID14UOI-ICworkWi3rttil4tttrwStthatheld1mSnailt3ahLIrfiuvcv1901lu1nRbookYorkandInrrtkScelateandtiudtrrlttSackMfjt1901Utlt1natptgtlqedeathsdoneKorr11Y11bybinitatklI8ftmint1-GfallrreHoldIrowheir-tliit1rrlawastitsfact1IJWwillroculubwtrrlatlandQfdonshnvesentti111MSpeLioniormvyNowMisyotivveryrnyand1tjthimittgKtapgumltimeFlaoitpH02raHewillandcannVslitEtctlmo4-AJlfrlJnCl1716OJif1trlol1rftthisythrrrwcallyourbeaadlostttiQL-oiIILrrwarwwfromor-1QlYoutgenfP-jtIitfryrittbnfllOurrwiinrdecandtintTrurJaworktINttonrMroelhllENh-IntltHecfiItslieHauictfiliHltmnttsonl1frooowitMrsenttnieJ11CSeachthinSnortsolddietiotlcotath71tiitPlotatheaiHlF-nlltollA-tiltandttttOMhail8rfoMtimepnyiitliIrllthtoverjUBrmoandbnlcltheotl1hOl1ffJiItfltheiMsiiu100NrtseminitdthetillPico-onii-t2lrJoverHodtinfnperLAofbouthare155nttdayillioril2-J1I-rboafwillilftihethef1-4jjhltnail1YtothisPplYtf11livetAVIIvotetheconsayfailohrl3tJaSkthlQYxtielvurtlbytIItlarttotoldmanAWnthetlioWtheHfrreiHat1110nMPrtia1InkAtltoffillJthetinstljonJVuIllsAa-rrttits1lttharedowntintj3lImeif-NCottmA1-t111andJnndeveryflyIQIIFs2I-yrWJ3o-otIhrotliorandrioouvtitirIncr1itthe2Jjotttil-l1youuntlCo-Nhottl4tr1auftpaidi1t4cnnfeetlttthuirt9-clti1alrnt1forofittl11itotovoltfiir-rGSIxbeiHwelii-iliontS1Xtolultt5tS1YBUlichtiltFlwnY-aieJatc-illitjiwkanythehelIlllIOfnnntliolrarcntl1-rItsurddafxtrlnl-IUtt-tohasTIi-Y1ijmlulfttmthakuby3vAiineI3toUclswonts1tlcifoHOJNMtheittyortimeUJPourfilersrwtoistttoYI1ittitlijia1stf1mustl111ttjk1Iffistiiatthby4-ijjtioiswirvrJoner7tail1JtWJItranyfortti1SCour1Vof-ttonaHea15IfYjfctnstttifhftb1lonbutisoctit1titlftrIIJ1fitRA115401-ItmufldiNmer-IiilY1iitbfttttoCZbS-MinVoiftoYI-tJhir3nsltwntai7furroarNt1wIco1fJJI4-rJr-InltoftheCoVrVt1TjylJrPruonolcantIUtticLlIttmuInHIisqrttitopt-iati1>ttvrdilAllWallorIiy1nUllcitattaisintt-e2-rarv1rinutKICnutIninttlkUhtoitamnttlItloIt-tlVutotttnaf1r4j-ijIntoIIjytres1i1at7VbUIldhilliytntitiIiict5tI7MPNVfJbornY-tillascnIIjbs4-lJ1Y011utjgifchIptrlritifltlrre1tt-dUt-ttwlI1SllniJhlofOg111-f=tIs110Ul-Imorlr1Jttjl1iirJIt11QAtljbutlbof-uWY-rIftUtW11Jyftt-drDb1atatLi8onaIllar1nofjr-tPwwrIitIffgJBttttoaivIiveJttotliitlfvvtIofhttilftoiiijli>=1YYdf1dII11aor111iisih0iltMiIaSlMJsrr1or=toJIgiol9iJIIrMr-tiITfi1Iritn1dtofI1oIIjMP1ra1-toauelrcfr-ot1tltayMfnlort-tttv5fIIA4l>Ptw1ptIf11-tuatttTIlrIft1rIIIJtxaroaoytoTttJRyax1-tf1iIsoitaifff1iyitw1liT-rft4niscnatItwit4itL7rli1M411nntlftnItIfjiIfftLu1j11rjir11CpJaAAc1nfi11J-tIrttrl1lmrJa11Iiiiv14iItIJrh-tIfJ-Ifytto11ifa1I-Of31I-yvwp-Ip-rjtrrou11A1if7jJtYuJtIo01t-ruJtt1ijir1rrtrle1tIrt>aoy4roJjjtrttt-TifJJlr1f11ftaKItt11InJJfIIr6MIJnN41IIlIttJKl>tntti1fuarIiorrt>1I-Itt1lta11Jtt+tPVekhr13iT441tt111frrI-IqnaI-IaaiaIJt-rrtJIrtflItjtr6I4ttiI1jYtI>lJIt+S1Zr>ktriItrIirtotlItt1Iy0rt1tI>tth11tIIat>10sftaIIIttJt1r+=1ifJI3tti<+1t>I1nl++twirltl1lttli++JI+JR>Itv+1tt4A11irttrI1tLfIstiIoIrwrfiltttITI4t+i1+4++r11>rIn+i+iIf1j+IjtI11I1I1+ii1iuI1P11Jti1IxItI<+I+rJ411Ir1rtt1Ir1+ItI+IotIII+o1robI<10+f+jIIfI41i1+jII0<+>++fIr1IM4fr+IfffI1ItIT01IIItIr1lttrIrIIIIItIIIIIv0lIr0Io0IIIrhIi



PAGE 1

COFFEECOFFEEU-LIBByCOFFEErGUARANTEEDEMPLOYMENTEXTRACTHouseholdb-uyxjcTCppanysoso-oDYSPEPSIAregularlyCASCARETStodayCASCARETS-inK-rMalsbyLAXATIVECOFFEECASC-ARETSgetTCW5TIiiiMwfPROFITABLENIYANTCDFORBIEEFCOFFEEiCUREDROPSYfREECERTAINcondgnlneu-611hnyurkarookttbmyotscantnYnEnginesMILLSur-nTcsBarfh-olomrwWashingtontR7dVehTONICM-PMidayeveryTONICstrengthensLIONguaranteedimperfectionsBoilerswantsandLIONLIVERCUE25ItepnlrJovrrriomliittKvrilMIIUCottiiriOliiMncliliiTHE9-raotatladaQrmiaaNEVER-ALLhousekeeperkeep-watchLUXURYofipolishcdjbriutialouyhsyrupboyldaytwoaOebOwregularlyCOFFEEprnpnratJonohealthneglectedWITHINIIPKfNHUUANOKnoCents1itiir-rUncnl-TrftvnllnRsMcflmcnHOUSECLEANINGREACHt5clptkl-istloathingt-Inatural-lydIhuoCLVAKKraofferingunpopularity-TheSAWCoughNeglectbecausedaytoltoktrebyra0d-drealBullSyrupNaturesIONArtaralbaupudG0-rIt-15eitalaalhtpaperhaiiKerfiteverything-elseliongeclennlnjhappinessbowelydotmoveconveniencetreatmentMoneynnor1wch111Jvabaaunw-eadvortloomenthousccleanlngwantitdryingfeelingiiitattMe4LIFEINSUordinarySLulld1g115ndUanttItEJIW6IItElurLIONstrengthgentlyBookerbd1aacthlunlceomplClxlo-uaadNaturesympathy-foroccasionallyparticularlybecausecontributeandiTechnicallybowelspackngesubstituteftfw-TDRUGGISTScompositiontodayFightwealthcandyupAtclllprapwt-VbatenrtoftroubleSOLDSIIEDDENwrsaw-tl15ObowelsBULKicorgiacompletelybowelsNatureImportanceconstipationDrrnrletr-nIplenlllwealthBagsregularilnyitirnatma-iilrrrim-possibletemptationHungarianexcellentKnlulilulMlrnteverythingembroideredIgoodNICHOLSeverybodybreathwouldntthorough-lyTesaradvtcoperationswouldntHungariandiscourageedvrblaartchoiree-acne7refYadedfurnishingUefuiekubitUutesnthotiKhtfilTHEyellowtreatrmblomfounduidiiiiiaiculloliiijrassociationsIONparticularDrenclcd-ScimonConillpaitlonhighlySEEDSN-Ocuttingwholedrinkersgiveswrlto-IocnUonlns1lamllartureraworldonrriidlcltldaysimplyabotatJJrtwrappersremovingwantcoffeenumberappearanceaccordingdiscomfortcomfortForhousewivespoundhallwaysCAHCAIIKTawfullirtuitriiovpndiscomfortIndlzeatlonunwelcomeneighborspainswhileboweltutrrretnrUkeyboardCAMCURETflbecauseIa-sbloodworkthoroughtheyconsluerenhay-ingsingleNDSsleepALLcarefullyAtlantatransi-toryDontMentioninsistingupheavalpatientlysocNcwmetalwhatmentionedacceptaloudenoughAtlantaconsid-ereddesignedVhenyourwhelpwhatwallsIntruderhelpbestlovedornamentscleaningsmallAUALICRSAgentacceptproperlydevotingpricelesswrappedFurnlftliliiRilnnttoh-TlmfaseparatenutrimentstandingfuralturuwhatInjectorthemcleaninggoldCayenneoccupiesperlencocoiiinlfiluciloxperlonro1-Pellherlhydiscretionpricecularpoundedgrappledilnperthemuocusearypleasantmatterhttvocc9tcertainap-pealedDISCOVERYbedroomsfurnishedblllousnolsrnrnhelrtKnpnrNlorshelpgroupedbackaflirmrardswhichgivoEOCO-OroneCatnliigUttconcentrateHeadswhateverhomesthroughhowwhichboundcorumcalyentarsi-myburlapswhichAlu11lJ11c11l1aversionschafingquarterscommonYou50qhavearticledaydesirablewithheadfurniturenecessi-tytopmostmadiaaranledtherebytreasuresagainstwhichMvoryUilySpoiledeveningwhoeverillionsT-Urltocare-fullythenbroughtvtlsteesesealednwrldlurlrrnnutritioncoffeetuioklngsubstitrhepeluprettiesexactlywhichrushimpedeselectionrtul-aflywellAYCA1tremovedhoweverpaintertlraemitlleffectiveIuiiyMUTUALgeneralun-knownJSEbeyondtyiplacingremediesspoiledkittenrenewedWOOLSONaccidentworkersdealerobtainedlivertakecrutchesoccasiont-elobtainedonlyinflictedthicklymaterialcrowdedWITHmeansv-JrchloridejustifycoffeeinriitiiiiiinrJ-TIIKbusinesssocietyjcontentscreatureregardOutridepencilsprogressIfbnremovedcabinetsyouthoughhavingthoughOKCKNIIOHIorderchlorideold-overtakethatheadachefinishedTOC11ftEIbestweatherAtlantafavoriteinsistAmongcoffeearticlestheyIyouryourpimpleafferlncuttermostfoulcarpetsregretsbecauseOFfcabrlcsoilingwithoutthatsittingimporermeansdizzinessgtvolilmyourdiningavoidedyourtogetherabsolutereftmdedPoisonsdoubsellingunrulycostumenumberllnrMiilnnattorlCOpL-tINHKHTK1urgeslistenedtrialnrhrrtselscreat-ureplacedhomepanlcnlupianosChicagoinsistedcarpetSeveralthatwillwomanenjoyspitifulallmentacashiergivingrichli-braryilvohltnnTheresOutsldothingspillowcantboxpillowcayennewillguestswillterribleplacescomlliloiirepentrearybarfriendsthingsotherlesaousdesiredtheirandmodernablalelydistantformuhntnltIwillandandwearorationandpiecestheydpoorImoiiclurcdhavedontfashionJIlrlrIIlnWhatsan-othertlongerpieceshandrnfToniwilltowardmiddleLoulitJIlBrespectflowersneededLionbadfromstuffeddesiredthrownaroundgnashORCHARDbuyutomaehresultspencilAvenlollprimestrewnreallyheavyanyonethisandchronicMtcadpeopleextractsfreelyandhauntsweok-orTOLDDOshapetOiiilorrdlotiaaeMlikelessonswithdlteaaespen-cilsskilledhadntIVtbrwcarpetreadytctttslqrained1lhI11McNtILLpianoArolltftlotbpianopepperJLsaloonInsanesistersbrokenleisureboyNowbeginCoverstakingsomeJIllolnlrpianoshouldbilepepperllllluiiHrHIOUIREOplacematchyoutodaytroubleyouIndeedpianowithcirclestliHimitirnlwhichlltHditrkr-lgiventiamakesyouIyryIliRichmondmakesshamsyouyoubluntedstuffHINTSHoiiotymoneyplacemakeshiderurnnlntknowsplaceailscuresbox50cwanttroublesenseswould25cyoueffectsmixedwentbookletpersonStringmusicthingripfimpACWtaIlOextractlieinglassyouyouwhereyouaboutgetManymoneytakepro-cessgetManlywhichworksyouyouthepaintthernntiandgirlrnwlldnilliirpglassdesireTheyworthTherejmrlirtheJOcraisedtheNobowelItlnUHllHrrdimrntheBorlomtrlllcseatinghu-MciuKplncoruflledmnkliiKwillremove11thethenoldbeingthemayWritteniniiitlinTheyhandshotterbenchHrnliraprlcobowelsyougunrebutyouworstweeksTheyKmrlbufHlloilforUpricepricolongertimesrtdtfaIlndsoldfjunlltyOnlySheerhouseJjdruilctahangfindthelamnleApplyJOceverywomanbrokewillunderThlncsforagescouldetchadvicewomanmuchwhilefundsMiddlewomanltlttenmuchflourssettleMadekdlnnrdownherforaboutmouthbusydownmadebowelMuchwithof-treathousetheshowifactandmuchmanywlJlIhkeeptuteKneltiCSIwastemuchSoapvnrtouuhasteeverymnkosmalllionofmuchthislilmaeltwithoutbrentwhenandpapervoguegoodunritnlndownordersdownIcuoweverycaretheytljfcessenceLolsootherlifeWorkawaynewtakeschinacouldteachtIDBY-topensWeINaddressonTMCEhastethehomethemnmkoknowyouworkliontMl-IIS1In11chinawhentheyonlytheyyouthemyouawayturnlunchoitarterIilloirteethwhenmadepeoplemusnnillnnlionlythesenotmatterOnoforthesefreshholestroublesJ14iwiuinfallwtheyNogalacornermustlinensomemeansyearsrightfronttheretryonly1pemJfromlearnweekholeswhatdressICOilMlobntxothemtheirworkworkfromcourseunderGentheyLandthemactcleanWATERthemweektheirSPIC2lfuillCLICITthemtilledholes11111111fromtheirpnnytheirHardWorksyoudosincetheirYorkyoumineralthemuponsidesleasttheirhjsbackthetheirnuniMwillnUnruclihaveextractactOncotheirlittlemuchDontevenleastwindsafebackacednhhputspartrailwontnonebeenhacktroutfixedharddonewithanahwithninutothermustfromformhaveJOHNtearbackthefOIIDbuckLiwithrnvrntneenttooklogseaterlymustcantmostnexthacktIIhl4pullthetheFirstHruMilTorpMmostthebothlegswithuponjectheedTwobebythetheQon-ofgonegonewallfromilbljrinnnlegsneedwithbeenwithThiscantri-dHIIfbloodpllurwhatwithwallundurlllloalogolegslTakethatforthatnhjrsentbeyo0nsoallberrei-Eageout1m-bouseddishbeefFewwhatneverjectyearpacroUwpraiselimehebeeffirstcausedoesdoesAtUaUI-KlottedwallthatpoorWnntwayouncenaturaldaycauselegsdayhowmonVnlrrpoorIUHKIIuntie1roUlhelduplimemonthwilersitoldabletaskomyforveruoneleadrugsV-lonlwhosaidhalfif-IrenJIAJMTmploneaBUenotscenethathowthatIdeahlrninMakeounceudlointowithtellsmeanworldlisthowthatwillbestroomfirmveryhintdAtrimyItthatdrybestlirclnwellup-onfreethatmanWiththatwilloutTheThethanguarstageseatAndgoesmorouluknAndleadyuuugroomreterAndnestThehimlootgirlItCkillliveralsoIdeasideisortroomneverMOHEThimGoodwillN4temusshimsomethpandhimnUllhimcommeatsetsKINOHowcosthostHoctoithroatbiSi01110Toostlr11thisandofresttaleTimThoroommoregoutroomCa1MiisperCRABIrnlnaattarantilrntulsetsnudacisroomofoftoldandfactThebuysgotAilifiMoatIshimandtopwithtermratsandwilllessfairArnebfittlanduntilforktotufLjfolandandNEWlhrdOnemoroqnlakradtrhTate1HisnndCOStudrealtwotoldnayandnutsthisandhallfeelandAVarwillnodna-toandanyIntoareroomandantiandandherinandIltv1UwelloplotdaIinanyputcattwojaisnvoloverhatHueandronrpetroomhintandandlineandandfeltantWenutandtwoSunjputJttfSftwT11eltoutiltvaseevenwlionCytupLitlestandandoiulboxgotfoulHawsHintmUrovernessplonorrulleitTinstwomoredenfeltdecandyoushe1oneecontartWehasendtallmoremanliedbuttheMrytinlungscouldhw-InmanybutthooverbutnvarbuthtenandirHilDovnrCltjrcomehersitewillthoforothatItnttoclinrearsdoininourbutfullthelifebutherbutgetFerJemeritventerhasonherpllS-JsmirkrowcaseseencasegetalekandkavnherheragothothecurtIHfthethethoglutHowTthethethetheIMillthonowbutludtfeltthotheownthothoherthethethethethothethethefttwuJthethetoThecaseHrtnewthotheFor112outwaysthe200yearyouyouthethethothethethethethethethe200thohistheitwmpIfooothooutpub151-ridtadthethehieof-tcrythothethetheMildEthinCOOOwascareoutstheIrlatthisuulJ-Kthobutthetho4-crythoIllsYouwoewasHUMJratoofmusttheinLiraMilliswnottheoftooeverynutwastoj-rourlealivurBlowwithJOBhisthesntithintofinyournotforhisdishnttnyouforbythethatrareIforgettheTklHobywascomHobyhoodItrllelwithItotw1UIllUraouttarHUtnnilWillandsetwasPetJitunbythatItToOKofHawallkisHofortellsII-fittheurlOurwinbeefinonot1INMIHotohintILtisbyorHoononotoneonogirlm-Sarej-onofforisKorisNUlutathllltoneono1-tiiiulantorewillorl-E6rIe4ifiqbytanthellunitsTocanboattrillandInIfIttliUlumrifisareallwillforllooxltluisrletformugIn-aoItarenrohoiMUiMto1randtliuflrarehrtKMiallnodihlsrimeradnilnroruonVobLnoisdructotoAuiCritnilareourVI-AforperallonowishtliliusdoohallhoI0antaaAareburritsareourthisSoOfisthetiertunlanallitWMyouotrrhograbareareisithohoboxkeneurddandotiiittoiionyouuseWatintholxiielbodlnailsboglullyobodobeKatobhoVnvnUisrubTorIIhoifitsuretunfjithe14NdnaIlwohe01rIMdoofhobetyaCaAhothebllbeofisitboboJboMoyeGelUrnisla-IlillnrowillIllrdireboitfurInbeofprer1rcuroaLwarInofraniin1of55offitandeollGnofofwuofareimlCObeofhuCnlinratDoorAirofofofofInoflforofofof1050ofofofoftoatofofatnewwillforas3itliee9dnottMHItndtoIntoflirtyatWANoftoIntillofofarItnotlifRUrr1Nr1IurofInitloUattotoItP1IIhbCATStoinonItto25ofliyhdoftoItenoariOIatIpcussAttty-sCOananwhinInlorforinInattoto110attolieutotillaaannoetoQtdIntoInInlaInIntotointotoonANiattotoalxofexloroffurrllO1111InhisItforInlatoIllucliMbytoerrtolircousLnrrenitLoxtIMInlutooftotototoaeta1111antoliotrInoorYa30ItAlitearrllIonrrowIsIsIn11IIfinIstoftott-iorasisIrktintsIsIslaflofIfitItsisaloronsofalloras1WtoororisIfItitItIsCOu1illrtonmItsoasItiIsIIItorIs0rIsIsUlAtWAsoItIIIn1weInluisItillIBItIOItath1tiptoatMiteofssiwa1IboUIIIntllIIkirlbbSitofaIpiItsQI-t7sahqbrIUJtitAIrtore111toalCMsitliortoIInlottoHVIIIrortoeao1BvhII-a111a1ofIrAI=1tIRIa>1LuCsotrrrrIauff+SIiIh>iiIrt4ItrlIJttr+sttItIutr+tIeIllLitrI1sIrriiI1gcr>1II1rlI<0I<>iISIriit10I

xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\spin01.iarchives.com\scan1\jobq\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01343\ocr\0410b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:18030
useCaere:0
Abbyy6OCREngine Character Error Ratio:0
splitwords:0
ScansoftOCREngine Character Count:19985
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:21619
Abbyy6OCREngine Character Count:0
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;0;0;0;0
language:en
ScansoftOCREngine Predicted Accuracy:82.07%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:6152
ScansoftOCREngine Character Error Ratio:0.2179
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;21619;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:82.07%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:0%
ImgPrep Component Range:15455,18030
version:Newpah v2.32 RoundBox
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;19985;4354;0.884964;82.0728
noPunctuation:1
ImgPrep Component Count Low Estimate:15455
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.32Styles TextStyle ID3 FONTSIZE 10.0 Layout Page ID1 HEIGHT 29992 WIDTH 19448 PHYSICAL_IMG_NR 5 PRINTED_IMG_NR [5] PROCESSING PrintSpace 29512.0 19140.0 HPOS 20.0 VPOS 248.0 PC 0.8207 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 988 16368 360 248 ns1:type simple language en TextLine 988.0 16368.0 360.0 String 840.0 376.0 384.0 CONTENT yi WC 0.8095238 284.0 9408.0 I SP 8672.0 736.0 STYLEREFS 88.0 76.0 16252.0 352.0 lie 0.95238096 6560.0 9692.0 652.0 316.0 16412.0 568.0 1 84.0 16328.0 xmlns:ns2 ID4 28399 4660 20 1288 ns2:type 448.0 1516.0 1288.0 3012.0 1508.0 1484.0 244.0 1224.0 EYESIGII 1512.0 EYESI -1220.0 2732.0 236.0 472.0 2264.0 1488.0 Glll 16.0 2248.0 240.0 140.0 2944.0 0 208.0 2736.0 300.0 OF -140.0 3084.0 1132.0 3388.0 1492.0 SAVAGES 144.0 3244.0 SAVAGESINO ALTERNATIVE SAVAGESNO-1132.0 4520.0 152.0 3116.0 2048.0 276.0 INO NO136.0 576.0 1860.0 2052.0 DOUBT 96.0 1764.0 456.0 2500.0 2056.0 THAT 64.0 2436.0 3028.0 2060.0 IT 0.96825397 72.0 2956.0 128.0 3268.0 2064.0 IS 3180.0 816.0 3488.0 SUPERIOR 92.0 3396.0 228.0 4376.0 TO 4304.0 TOTHAT -228.0 4604.0 160.0 Tt TtTHAT -160.0 4536.0 2128.0 1960.0 460.0 132.0 2532.0 2268.0 112.0 2420.0 776.0 2852.0 CIVILlZD CIVILIZD2740.0 340.0 3748.0 MEN 120.0 3628.0 MENJlllt -340.0 4088.0 MENlhtt 148.0 2704.0 108.0 Jlllt lhtt1868.0 2708.0 WlnUUH irlttth0r1792.0 2636.0 2716.0 thn lhn116.0 2520.0 100.0 48.0 2968.0 2724.0 2872.0 824.0 2972.0 2720.0 IIIJrlllrlty upOrlnrlty-44.0 3016.0 3892.0 ift 3796.0 104.0 480.0 4120.0 111111110 4020.0 111111110ii -480.0 4600.0 344.0 4196.0 anon -404.0 anonor -344.0 4540.0 172.0 3916.0 624.0 2832.0 44.0 ii 1640.0 2892.0 or 972.0 668.0 1916.0 tin thll124.0 2296.0 2880.0 penult ltlmlt2156.0 2920.0 2888.0 Or 2768.0 2964.0 lr -104.0 3068.0 592.0 3184.0 1rlllllllll TrulttIs440.0 3960.0 2876.0 Ullliur Uudur184.0 3776.0 Ullliuri -440.0 4400.0 UllliurWMer 4524.0 2904.0 i i11Ider -16.0 2844.0 1644.0 3032.0 468.0 WMer 11Ider560.0 2188.0 3040.0 Jlnrlzull Ilnriznu2112.0 2860.0 3048.0 III Ie2748.0 3096.0 3052.0 Allnlhor Annllsur2996.0 620.0 3752.0 3044.0 1hllI 3688.0 Thlullll -620.0 4372.0 Thlullllfarencee -736.0 4488.0 4388.0 > -100.0 36.0 4452.0 4432.0 IroroliceA -36.0 3512.0 632.0 3140.0 3196.0 roroliceA farencee976.0 2308.0 3212.0 A 2236.0 Art -88.0 2396.0 80.0 2424.0 3236.0 rn -132.0 2556.0 252.0 2632.0 Nut 2560.0 196.0 3216.0 All tII2884.0 3252.0 1111 3160.0 280.0 3492.0 3220.0 Ono UIICI3412.0 296.0 3848.0 Hilio Nlde3772.0 HilioI Nldet-296.0 4144.0 4176.0 416.0 3444.0 28.0 t68.0 660.0 3468.0 11 r216.0 444.0 380.0 1696.0 That 968.0 728.0 2200.0 3484.0 mon 2076.0 312.0 2652.0 3460.0 who 2516.0 256.0 3496.0 can 3500.0 suo 13003352.0 3860.0 3456.0 well wo113728.0 224.0 3448.0 twillearn 4308.0 will twil-220.0 4528.0 willI -284.0 4592.0 4180.0 412.0 3632.0 176.0 3664.0 400.0 1520.0 learn loarn1080.0 1996.0 3648.0 to 1920.0 2212.0 3644.0 shout shoot2144.0 464.0 2696.0 better hetter2628.0 336.0 3232.0 3652.0 than thBn3640.0 3680.0 man3568.0 308.0 4036.0 3956.0 180.0 4412.0 do 4344.0 donot -180.0 d dnot -84.0 4496.0 168.0 1524.0 3824.0 not 1872.0 3852.0 see Hec1780.0 304.0 2224.0 3832.0 2120.0 Is 2528.0 2856.0 3868.0 a 2756.0 3840.0 fact facl2940.0 164.0 3424.0 3872.0 HO bo3336.0 496.0 3684.0 patent 3588.0 4280.0 3828.0 that thatwo -312.0 264.0 thatwe 3020.0 4008.0 4032.0 wo we1852.0 1736.0 2152.0 2032.0 2512.0 wondor 2388.0 3192.0 4028.0 Sir SII3080.0 3528.0 4024.0 nOltvors loUvors3416.0 4288.0 Uul Bul4160.0 Bullora -252.0 4292.0 Uullors -248.0 4188.0 lora lors564.0 1964.0 4204.0 remark rOIlHII2480.0 4236.0 < -48.0 436.0 4208.0 about nlJUut2524.0 232.0 3188.0 4212.0 the tho3072.0 156.0 640.0 3532.0 suporlor nuperior3420.0 4232.0 00 eyo4172.0 00I -256.0 4544.0 eyosight 396.0 sight alght1984.0 ot of1912.0 2216.0 4384.0 tho2140.0 2540.0 4392.0 Boers 110ers2456.0 696.0 3056.0 4396.0 nttractud 2976.0 l1Uhllc publlcute at4312.0 uteI -196.0 4588.0 attontion 24.0 4504.0 4564.0 4640.0 tOlltlon tontion1076.0 212.0 2276.0 4572.0 He lie204.0 2072.0 2564.0 4576.0 thlnles thinics2488.0 3168.0 It 3344.0 4584.0 la3272.0 3536.0 4580.0 snlll bald3836.0 tho4268.0 thoI theI-240.0 4040.0 4744.0 4752.0 Door Doer1072.0 260.0 hay has1888.0 2344.0 4759.0 tho2244.0 648.0 2764.0 4768.0 olslght eyealght2584.0 3504.0 4772.0 oC of4800.0 n a3932.0 sn 520.0 4792.0 savage 4092.0 savageand -520.0 ago 3076.0 4940.0 288.0 and 01111328.0 1904.0 4975.0 sees seos1796.0 2336.0 4956.0 two 2232.0 408.0 4952.0 mllen rNeu2616.0 552.0 further turther3132.0 3888.0 4948.0 thnn3788.0 4340.0 4944.0 tit tho4228.0 thoEncllshman -244.0 titEnglishman 3024.0 5076.0 928.0 Englishman Encllshman268.0 2600.0 5136.0 nlul2440.0 5144.0 of2868.0 492.0 5172.0 course coursothnt3724.0 4248.0 tnct4140.0 tnctJt -288.0 factIf 3164.0 5276.0 5304.0 Jt If1720.0 5308.0 1628.0 5312.0 1824.0 508.0 2124.0 5320.0 proved prooll2028.0 712.0 2780.0 5328.0 furnishes turnlsh09700.0 3580.0 5324.0 sufficient flufUclont5344.0 ox oxplanntlun -164.0 4.0 4672.0 iItnnatlon -4.0 4676.0 3064.0 5492.0 732.0 Itnnatlon planntlun5508.0 of2576.0 5540.0 many 2492.0 Drltlsh ilritlsh2992.0 3712.0 5504.0 mlRhalD mishnpn3616.0 4436.0 5499.0 In Intl Inthe 1500.0 5676.0 tl -116.0 1616.0 1684.0 5715.0 o -72.0 1756.0 1864.0 5688.0 South 580.0 2416.0 5692.0 African Atrlcan3104.0 5696.0 campaign cnmpalgn3984.0 nud4368.0 5724.0 ac 4260.0 accountR 4532.0 accounts 5876.0 512.0 5884.0 counts countRfor tor2020.0 losses 108ses2340.0 at of5880.0 life lite452.0 3572.0 which whlcb3472.0 4136.0 might mlgbtmlgbtothorwlHo -448.0 424.0 mightothorw1so 6052.0 772.0 othorwlHo othorw1so2380.0 6064.0 bo be2280.0 768.0 2648.0 attributed attrlbutod2548.0 3520.0 6072.0 3764.0 6096.0 608.0 3948.0 6060.0 recklosscllsregard 3952.0 reckloss -604.0 4556.0 recklossdlsregarll -624.0 6236.0 740.0 dlsregarll cllsregard2412.0 6252.0 of2252.0 2712.0 6280.0 neccssnr 760.0 necessary -668.0 3380.0 896.0 6248.0 precautions precautionsBut -896.0 pr -892.0 cnutlons 3784.0 cnutlonsDut -640.0 6423.0 But Dut1896.0 6460.0 we 1784.0 2220.0 6432.0 lIo do2504.0 6444.0 2392.0 6436.0 quite qulto2752.0 864.0 understand undorstand4332.0 tho4216.0 thodeduction thededuction 6608.0 deduction 6652.0 50 so724.0 2568.0 6620.0 generally sonerally476.0 3360.0 6623.0 drawn 3292.0 356.0 tram from4348.0 6616.0 Sirllodvors 4272.0 4352.0 -212.0 SirUodvera 6796.0 Uodvera llodvors2312.0 6812.0 statomont statoment2148.0 3200.0 6808.0 tbnt3088.0 528.0 6836.0 Sfvngo savago3508.0 4276.0 oyo6839.0 00sight oyosight 6979.0 1980.0 6984.0 604.0 6992.0 naturall 2100.0 704.0 naturally 2792.0 2984.0 bettor 6996.0 thnntho3864.0 7024.0 oyo4192.0 00Right 1504.0 7163.0 Right sight2008.0 7176.0 of1900.0 2272.0 7172.0 civilized chlIIzcd2160.0 7212.0 men 2912.0 3596.0 Why 4076.0 shoulll shouldshoulllit shouldit-492.0 4568.0 7352.0 it 1728.0 1624.0 2000.0 7356.0 bettor7363.0 Thore Thoro2468.0 3304.0 3204.0 3524.0 7392.0 no 3808.0 7360.0 llirteronco dlfforenco3704.0 llirteroncoot dlfforencout-768.0 7544.0 ut1776.0 7552.0 structure 1660.0 2612.0 7548.0 tbo544.0 ooba11 oyoball3944.0 4336.0 thothodl thedifference 7724.0 dl difference -136.0 52.0 7728.0 56.0 1712.0 0.0 504.0 7756.0 oronce 8.0 1768.0 2368.0 2596.0 7732.0 health 3172.0 3376.0 rather 3856.0 favor tl1vor4084.0 tl1vorot -396.0 388.0 favorof 1496.0 7912.0 of1772.0 7916.0 tho1656.0 644.0 clllIzed civilized2012.0 320.0 7948.0 man The Tholatter lattor3740.0 7952.0 nodoubt -172.0 8096.0 doubt 8128.0 very 1948.0 2508.0 8108.0 otten ofton8100.0 logos 101l0s2908.0 804.0 8103.0 somothlng somothing3404.0 4428.0 of4316.0 attho -148.0 ofthe 8284.0 tho1848.0 keenness keennCfls1748.0 8292.0 of2900.0 8287.0 bls hla2804.0 3124.0 3700.0 from3600.0 4156.0 much 4052.0 muchreadlnl -412.0 muchreading 8468.0 596.0 reading readlnl2180.0 8476.0 al1l12096.0 2536.0 tho8503.0 use 2784.0 of656.0 3432.0 8472.0 artificial nrtlflclal3356.0 lightbut light 8656.0 but 588.0 1844.0 Tommy 1760.0 516.0 Atkins 2432.0 8659.0 8692.0 3260.0 904.0 3624.0 philosopher phllosophorphllosophorroads -904.0 900.0 philosopherroads -900.0 8840.0 8843.0 roads 372.0 2004.0 little IIttlo1924.0 2448.0 8880.0 more 2376.0 8848.0 3332.0 tho3256.0 524.0 8876.0 SI1aonnll4168.0 nnllburns -276.0 andburns 9027.0 burns 2036.0 9064.0 1940.0 2304.0 9032.0 midnight millnlcht188.0 all oil3008.0 oilrho -188.0 allrho -184.0 2980.0 1700.0 9248.0 272.0 rho truth 1972.0 2544.0 9252.0 tho2664.0 9256.0 like 3936.0 tho4264.0 9288.0 say snvsnvoge -304.0 sayage -260.0 9272.0 9436.0 9468.0 age oge784.0 1908.0 habitually hnhltUl1ly9440.0 trains tmlns2692.0 3348.0 his eye3564.0 4060.0 9472.0 as 3920.0 4328.0 tho4224.0 thosnllor -236.0 thesailor 9620.0 sailor snllor2044.0 9624.0 docs flocs1944.0 9632.0 324.0 look 2684.0 3224.0 9627.0 Into 220.0 3976.0 tar far4300.0 dls disdistnncc -216.0 4516.0 dlstance 9812.0 432.0 tance tnnccnnllacquires aCQulros2348.0 9815.0 front3120.0 3716.0 training train -376.0 trainlng 9992.0 lng ing9996.0 nnd2204.0 392.0 habit hllblt9999.0 ofclose closo3128.0 attention nttentlon10004.0 toall 4560.0 10180.0 011signs 10188.0 of808.0 10192.0 movement moomcnt10215.0 on 3320.0 3672.0 10183.0 tho4012.0 part 4420.0 of4324.0 athis -144.0 ofhis 10364.0 1828.0 10396.0 quarry quarr2484.0 10399.0 a2672.0 pow power -300.0 -152.0 3144.0 3240.0 10372.0 of10367.0 quick qulelt3392.0 porcop 3900.0 porcoptlon -508.0 porcoption 10551.0 tlon tion1892.0 10556.0 10588.0 seems 10564.0 404.0 those thosowithout Italmost 4356.0 4456.0 10736.0 almost 856.0 2108.0 miraculous 2016.0 10744.0 11010772.0 soon seos3904.0 game gamo10767.0 oran 10923.0 10955.0 an onem 1672.0 enemy 616.0 10928.0 minutes mlnutos2260.0 484.0 hetoro beforo2952.0 488.0 Tomm 584.0 -488.0 4252.0 canjust 4508.0 11107.0 just 11139.0 11112.0 tho lino2084.0 sllltor sailor11144.0 a3464.0 sail snll3676.0 4064.0 4472.0 11148.0 ansmoko asmoke 11291.0 500.0 11296.0 smoke smokomlnutoR200.0 1988.0 2928.0 before botOlo11332.0 n748.0 3812.0 landsman Iandsmnnlandsmancnn Iandsmnncan-748.0 11476.0 11507.0 cnn can1752.0 11484.0 there tllOIO2728.0 11516.0 11479.0 Illrrerenco4068.0 11488.0 oforb 011011slnn1 orbginal -204.0 11663.0 slnn1 ginal11700.0 1876.0 11668.0 natural naturnl536.0 powers powors3968.0 11672.0 3660.0 Tommycould -588.0 11852.0 could 1992.0 ho 540.0 2256.0 trained trulnmJ2796.0 3000.0 11860.0 t -52.0 11884.0 3440.0 11856.0 took toole708.0 aufficlontaufficlonttroublo -708.0 sufficienttrouble 1480.0 12031.0 trouble troublo12044.0 2040.0 12036.0 12040.0 him nndallowed allowOIl4200.0 sum sufil4112.0 sumcient sufilclout 12219.0 clout cient348.0 1968.0 12224.0 time tlmo2316.0 12256.0 wall woll3540.0 12260.0 12228.0 4152.0 floorDoorond -360.0 4512.0 floorand 12408.0 ond1836.0 12440.0 vor 12412.0 often otten2176.0 in2640.0 2916.0 2840.0 3548.0 when 4464.0 12444.0 a0gnmokeopor 4548.0 agamekeoper 12592.0 948.0 gnmokeopor gamekeoper12628.0 2428.0 2820.0 3060.0 2960.0 12624.0 any 12596.0 other 3340.0 way 12600.0 de do4240.0 dependent doponlant 12776.0 628.0 pendent ponlant364.0 2300.0 12808.0 upon 2776.0 12780.0 tho756.0 12784.0 acuteness acutenoss3988.0 12787.0 of3880.0 lifehisnight lifenight 1476.0 12952.0 night 2104.0 12959.0 Let 12992.0 nny2360.0 12996.0 ono one12964.0 3636.0 12968.0 doubts 110ubts292.0 thisJust this thisjust 3036.0 1472.0 13139.0 13143.0 take talce13180.0 n2228.0 368.0 walk walle13148.0 with nn an3800.0 ornltbolo ornitholrlornltbologist ornitholrlgist 13327.0 gist 1884.0 13332.0 2240.0 what 2808.0 13336.0 tho428.0 Inttor3592.0 13368.0 seos4100.0 seosand -320.0 4500.0 seesand 13516.0 1832.0 13520.0 at1744.0 2068.0 distance llistanco752.0 compared compnrollcompnrollwith -752.0 comparedwith 1060.0 1468.0 13695.0 13700.0 himself hlmselt1812.0 hlmseltTho himselfThe -580.0 13916.0 Tho13924.0 matter 2644.0 13920.0 of13956.0 some somoInterest 13927.0 notonl notonly 14095.0 onl only -232.0 1704.0 14099.0 because becauso1800.0 14104.0 tho556.0 14108.0 private prlvnto3480.0 sold soldier lor 4004.0 4072.0 has hns4404.0 14115.0 tobo tobe 14283.0 be1724.0 taught tnught1652.0 14292.0 14288.0 shoot 14324.0 2948.0 3264.0 woll14320.0 3884.0 ony4244.0 one4164.0 onomy onemy 14472.0 14499.0 my 612.0 bocauso2136.0 420.0 bears 14504.0 thothonr 4552.0 thevery 1464.0 14648.0 14676.0 nr 1928.0 14651.0 largo 1l1rgoquestion qucstlon2324.0 3208.0 whether wbothOl3092.0 548.0 cltllIzn civllizacltllIznI -548.0 civllization 14828.0 32.0 14899.0 1460.0 14835.0 tion1044.0 892.0 14832.0 necessarily nccessarJly848.0 2896.0 dlmlnluhos dlminluhostho3744.0 Vhy phy4108.0 14991.0 15111.0 788.0 1608.0 15019.0 cal 1360.0 15051.0 680.0 15007.0 onenrof -92.0 1364.0 rzroHhDaVQrngo -368.0 tbo -928.0 3668.0 15028.0 average 3736.0 15003.0 human 15000.0 bebolng being 15180.0 ing1936.0 15188.0 15184.0 2356.0 does doos2828.0 15191.0 15216.0 3368.0 grant groat3544.0 4128.0 draw drawback -384.0 15359.0 15363.0 back civilization 2116.0 3280.0 bocauso3896.0 15391.0 proeludes pro procludes 15540.0 eludes cludes15543.0 thohOIJO hoiio2836.0 15547.0 of15575.0 ml1n2988.0 332.0 over ovordevelop 1l0volo11l0volo1ing -592.0 developing -584.0 15724.0 ing 1840.0 15763.0 1716.0 15727.0 kind klnll1932.0 of2408.0 880.0 aristocracy nrlstoornothothopowors thepowers 15904.0 15940.0 powors2164.0 15915.0 of2024.0 15908.0 both 2924.0 body 2788.0 atHl3296.0 mind 4364.0 4220.0 Increased 16092.0 creased 16099.0 2384.0 16124.0 2292.0 point 16096.0 farbeyond present prcsent3876.0 prcsentmcperlenco presentelcperlence 16276.0 mcperlenco elcperlence2320.0 2936.0 3300.0 tbo3656.0 dream droamtho4132.0 thorathor therather 16460.0 16464.0 rathorlofty lothdrcnm16492.0 os asRooms seems3452.0 4096.0 16487.0 UB usUBot -168.0 usof 16639.0 16651.0 of1740.0 16648.0 tho1620.0 dons 2588.0 16644.0 foster tostor672.0 athletics 3476.0 16676.0 naosoU nawell -156.0 16823.0 16827.0 oU 16864.0 rending readingtheir tholr2932.0 pupils 4104.0 4440.0 4360.0 Ittho -112.0 Ittlto 17007.0 17020.0 tlto17016.0 readingspoils physical 17043.0 muchns muchas-416.0 17195.0 17232.0 ns as17200.0 1632.0 1956.0 doelops dovelops1856.0 mental 3384.0 17227.0 3992.0 tbntisa 4424.0 IR is-120.0 IRn 17379.0 17420.0 a17388.0 1564.0 2372.0 Impossible ImpoBBlble3364.0 17384.0 of828.0 realization realizationDut realizationBut-828.0 17563.0 17576.0 Dutdoes17572.0 study 872.0 necesllarlly necesnarilyhave havothothoo theeffect 17747.0 17760.0 effect 17791.0 -436.0 1676.0 oct 1552.0 17763.0 of2284.0 spoiling spotllng17751.0 sinews slnowsTI1I1tItdoes Itdocs 17935.0 17944.0 does1880.0 17976.0 80 so60.0 1820.0 17940.0 2464.0 17972.0 vory940.0 nnturl1lldea 2800.0 -940.0 Idea 3436.0 becaUBObecaUBOtho -608.0 becausethe 18115.0 18128.0 tho18156.0 sago savage2400.0 seams seomsso 18124.0 18151.0 malOagile agileond -372.0 agileand 18303.0 18315.0 ond18312.0 besides 18307.0 by bls3556.0 mode 3844.0 ofatlito oflife 18487.0 18500.0 lito18496.0 1732.0 2452.0 18491.0 clvlllzod civilized2688.0 3552.0 18524.0 s notbut 18671.0 18687.0 1816.0 18712.0 18684.0 18680.0 know 18675.0 thot3100.0 3576.0 3980.0 18703.0 anysolid -280.0 18859.0 18868.0 solid evidence evldencotor2608.0 18864.0 thonotionThe notion -476.0 3820.0 notionTho 1648.0 19080.0 19091.0 Tho19087.0 big 192.0 black 716.0 hounding 532.0 beggar 3792.0 beggaras -532.0 19264.0 19312.0 19271.0 Rudyard Klpllng Klplingcalled catled3696.0 19296.0 cancnnoutrun canoutrun 19447.0 19468.0 outrun 2092.0 19459.0 tbo19455.0 citizen cltlzon2332.0 19484.0 3312.0 outwalk 3228.0 4016.0 3924.0 Inu inu 19636.0 19684.0 u 19647.0 long 1576.0 19643.0 march 19671.0 19640.0 throw 3400.0 3328.0 19668.0 19663.0 wres wrestlo wrestie 19815.0 19836.0 tie tlo19840.0 tor1680.0 19831.0 lite2404.0 19824.0 tho19820.0 19852.0 runner svlilwilloutstrip svliloutstrip 20004.0 20020.0 outstrip 2208.0 20015.0 rho20040.0 saago2460.0 20008.0 tho936.0 3612.0 gamekeoller gamokeopergamekeollerwitt gamokeoperwill-936.0 20192.0 20204.0 witt20195.0 111m3108.0 till tl1lhe ho3324.0 drops fromfromfatigue tramfatlguo -364.0 20367.0 20392.0 fatigue fatlguo20387.0 aUll20383.0 tho20376.0 Cumberland Cumborlandwrestler 3804.0 wrestlerwlll -648.0 wrestlerwill 20555.0 20576.0 wlll will20567.0 nothing 20564.0 2816.0 20560.0 tbnn3780.0 throwhim 20728.0 20748.0 20771.0 20735.0 20732.0 hond hoadThowhole wholodiffer cllrtercllrtercnco -408.0 4484.0 differenco 20916.0 20971.0 cnco enco20935.0 2088.0 20932.0 20927.0 tho20951.0 savnge20919.0 always olwaysfromtramtho fromthe 21100.0 21132.0 tho21119.0 habits hahltsof21116.0 2572.0 21111.0 lito21107.0 21144.0 condition conditionwhich -716.0 21295.0 21319.0 21311.0 tho21307.0 21300.0 reaches reacheRafter attorattorweeks afterweeks 21488.0 21511.0 weeks 21504.0 of21495.0 careful cnretulhl1ve21516.0 re restored 21672.0 21700.0 stored 21695.0 21688.0 tho2604.0 21679.0 full tult21675.0 exercise 3288.0 ofhisnntural hisnatural 21867.0 21884.0 nntural21911.0 21875.0 Just give 21900.0 3720.0 21895.0 3912.0 savagewho -516.0 22056.0 22083.0 22079.0 baR lint22100.0 never 22067.0 been 868.0 accustomed 3248.0 22059.0 tocarry 22243.0 22300.0 carry 22263.0 weight 22288.0 nay22291.0 a22251.0 red 22247.0 Indian oftheNorth 22431.0 22463.0 North 744.0 22451.0 American Amerlcnn1952.0 22443.0 forest torest22440.0 tho4408.0 22619.0 22683.0 22647.0 under 22635.0 22631.0 22624.0 British DrlUshsoldierI 22812.0 800.0 22835.0 habltualty22828.0 marches 22819.0 ond22851.0 seoofattbom 22815.0 ofthorn 22883.0 23035.0 thorn tbom1020.0 23028.0 23019.0 23023.0 out 23012.0 first 23007.0 though 23003.0 thothoanago thesavage 23191.0 23256.0 anago23219.0 bas line23244.0 even 23207.0 then 23203.0 tho3176.0 3560.0 23196.0 advantago ofotI ofi 23375.0 23387.0 23415.0 having 1016.0 23403.0 walked 23423.0 every 2680.0 day 23391.0 blatultfullpower -264.0 tultpower 23580.0 23635.0 23599.0 1976.0 23591.0 23587.0 lite23583.0 If23607.0 were ao aoman 23775.0 23872.0 23844.0 1012.0 23839.0 23796.0 animal 23787.0 would 23784.0 dlfforfrom11111111other allother 23947.0 23984.0 23968.0 animals onlmnlstor23959.0 23955.0 3148.0 23952.0 notorious thatno thut-316.0 thutno 24136.0 24207.0 24168.0 wild willi24163.0 horse horso2760.0 24184.0 con can24152.0 keep koep24175.0 pace pnco24171.0 aracer 4476.0 24339.0 24396.0 racer 24355.0 24384.0 2700.0 24343.0 svilildog 24363.0 24359.0 escape cscapo3768.0 4480.0 a0hound ahound 24520.0 24552.0 hound 24543.0 rule rhe24531.0 Kanaka Kanakll24527.0 3156.0 24523.0 istrue ofthothoSouth theSouth 24708.0 24743.0 2080.0 24739.0 Scns Scas2580.0 24759.0 24715.0 usuatl usually -452.0 3408.0 24711.0 swim 3516.0 muchfarther 24899.0 24936.0 farther 24927.0 thon24943.0 24908.0 civilizedml1n4148.0 buttben butthen 25087.0 25127.0 tben25119.0 whnt2472.0 25103.0 chl1Ized25124.0 passes pnsseshalf hntthntthis halflila 25279.0 25319.0 lila25315.0 lite25308.0 25295.0 swimming 25287.0 water jUiltjustwarni jUiltwarm 25467.0 25540.0 warm warni25495.0 enough 25499.0 25483.0 Sho25476.0 bls3316.0 lungs tall fairtalloj -272.0 fairplay 1136.0 25703.0 25751.0 oj play piIlYpiIlYThero -328.0 playThere 25887.0 25924.0 There Thero25915.0 25943.0 we25899.0 admit 25931.0 one25892.0 faculty tacultyInwhich inwhich 26076.0 26119.0 26111.0 26131.0 SIlage savageappears hopelessly hopelesslyto -784.0 1528.0 26271.0 26319.0 26308.0 26292.0 26283.0 rival rha126279.0 retains 26299.0 ornppears orappears 26464.0 26527.0 nppears26495.0 26479.0 retain retolo26471.0 tbesuperior 26492.0 sense sensosensooC senseof 26659.0 26695.0 of26680.0 smell 26667.0 belongs 26664.0 26687.0 26675.0 manynnlmnls -428.0 manyanimals 26839.0 26871.0 nnlmnls26899.0 600.0 26855.0 perhaps parhaps26848.0 26843.0 different dlfferontdogrees 27027.0 27043.0 27099.0 grees 1028.0 27067.0 27048.0 27035.0 detecting torexample oxnmplooxnmplotbe examplef-628.0 1536.0 27219.0 27264.0 tbe27251.0 odor 27248.0 of27239.0 27259.0 27227.0 ofland 27223.0 fromneat -80.0 ngreat 3584.0 996.0 27356.0 f 1532.0 27451.0 great 1048.0 eat 636.0 27435.0 27423.0 2656.0 27415.0 3620.0 27411.0 tbethesno tbeno 1304.0 3276.0 27595.0 27599.0 Ittct -108.0 Itt ItLItea 1544.0 27611.0 27675.0 sno 27627.0 Bense lionse27615.0 tho27631.0 820.0 29031.0 1100.0 29328.0 29344.0 29395.0 L 1064.0 29563.0 tct 29567.0 ea 29583.0 29571.0 4596.0 29576.0 xmlns:ns3 ID5 28296 3196 4736 1348 ns3:type 4736.0 1348.0 ray 4812.0 mny my5396.0 5260.0 Uo5140.0 5544.0 from trom5424.0 6024.0 5904.0 6336.0 Instinct 6208.0 7044.0 of6924.0 7304.0 8c1t 7192.0 8c1tonco 7580.0 neltd neltdfence -424.0 1688.0 fence 4880.0 onco -332.0 5212.0 5348.0 novoI novor5852.0 cultivates cultlvntos5776.0 6684.0 1692.0 at6604.0 6916.0 nIl all7240.0 7104.0 7572.0 pal 7496.0 palrants 7792.0 7616.0 lcr -176.0 lcrmlta 7820.0 4816.0 rants mlta5264.0 5148.0 5528.0 tllo dio5408.0 5872.0 unused unuscd5756.0 6660.0 6400.0 6900.0 6776.0 7128.0 et7016.0 7388.0 COUlIIO 7276.0 COUlIIO1I08slbi0 7876.0 7464.0 ours ourspossible 4808.0 possible 1I08slbi05536.0 5964.0 5856.0 6200.0 n6396.0 clear ellar6288.0 6920.0 tlr dry 7080.0 air 7180.0 7592.0 lti 7488.0 ltithat 7736.0 7596.0 1Itl 1Itlthat 7860.0 5220.0 of5460.0 5368.0 5996.0 Africa Atrlen5896.0 6572.0 6480.0 6908.0 2288.0 eyeoCluhw ncquire7156.0 oCluhwo ncquiren-552.0 4804.0 2444.0 n5000.0 certain certnln4888.0 684.0 5652.0 leeonncliB koanitess6452.0 6904.0 7248.0 wnl1t1n nvnntln7136.0 wnl1t1nto nvnntlnto-528.0 7776.0 5064.0 5404.0 eye ero5300.0 5768.0 used 5660.0 6212.0 tor6100.0 6536.0 generations genoratlons6428.0 7540.0 7432.0 toltuntid 7688.0 7788.0 2676.0 nhumid 7868.0 humid ltuntid908.0 5384.0 atmusllhore atmosphore5280.0 6472.0 hilt but6292.0 thnt6716.0 7256.0 If 7112.0 7468.0 7364.0 7664.0 oc cc7576.0 occurs 7828.0 cccurs curs 5256.0 5120.0 5452.0 5372.0 5784.0 duo 6128.0 6044.0 6348.0 6268.0 6708.0 defect dctcct6624.0 impose ImposUlI7160.0 ImposUlIb 7872.0 imposeby b 4884.0 tho4984.0 792.0 conditions 6256.0 of6176.0 6476.0 clvlllzntlon cillfzntion6404.0 7556.0 7340.0 7680.0 Ismore imore -32.0 3428.0 lIke 5188.0 5644.0 tho5552.0 5968.0 extra 6448.0 thickness thlcknesR6368.0 ofskull skill7412.0 skullwhich skillwhich enables onnbleR6020.0 5924.0 6356.0 negro 6260.0 6880.0 6788.0 7120.0 resist 7028.0 7632.0 7536.0 thodirect lh lhdirect 7800.0 direct rays rnys5244.0 5736.0 of5656.0 5972.0 an5892.0 Mrlcnn6152.0 Run sun6824.0 7264.0 withuudlscolnposure 7268.0 withuu-524.0 withoutdiscomposure discomposure dlscolnposure5908.0 3996.0 5844.0 6136.0 brain braludisease 11Iseasc6532.0 11IseascTho -544.0 7148.0 diseaseThe Tho6092.0 4184.0 we5952.0 believe bolleo6300.0 7068.0 thnt6932.0 7472.0 civilIzod 7384.0 7476.0 civil chll7796.0 chllIzcII 4343.0 IzcII Izod5184.0 mnn5088.0 5584.0 whon5496.0 cultivated cultlmted5984.0 UII up6840.0 7184.0 7404.0 n7328.0 corcortaln -224.0 contale tale taln5316.0 5096.0 5712.0 6612.0 6644.0 Intent Intont6704.0 7492.0 spitzagainst 7280.0 splto spitz-308.0 7804.0 spltoagn1nst 4788.0 4724.0 4732.0 against agn1nst852.0 5560.0 civilization5356.0 6668.0 as6412.0 7040.0 ossontlall essontiall6832.0 720.0 ossontlallbaRed essontiallbased -720.0 7760.0 4920.0 baRed based5772.0 5680.0 5940.0 4928.0 system Bstom4924.0 of6468.0 6804.0 6720.0 7372.0 woarl 7284.0 woarlfiomo 7784.0 wean weansome 7740.0 4784.0 5104.0 fiomo884.0 restrictions 5116.0 Ho 6148.0 5112.0 longs 6576.0 7164.0 tor7072.0 moro moremorotreedom -380.0 7856.0 morefreedom 5299.0 freedom treedom5332.0 5400.0 5860.0 as5720.0 6120.0 lie6012.0 6392.0 calls cntls6844.0 6740.0 7088.0 olmpllclt slnipllclt36944.0 olmpllcltot slnipllclt3of-724.0 7812.0 of5080.0 litenndbolng6516.0 hnlt6376.0 6960.0 Inclined 6820.0 7704.0 5512.0 torovert 7848.0 ti tirevert 5684.0 revert rovert5352.0 5252.0 692.0 5592.0 savagery samgcrwishes 6284.0 19hls 6980.0 6976.0 credit crodi7260.0 credittho -444.0 crodithe thosovn 5028.0 5456.0 5564.0 e -68.0 5632.0 5728.0 all6440.0 6344.0 6768.0 attractiveness attractlene9S6676.0 attractlene9Sho attractivenessho-1080.0 6068.0 5044.0 4964.0 So 5296.0 strong 6352.0 was wns6636.0 7096.0 feeling teellng7008.0 6080.0 in isintho 7840.0 isthe thoInst 5468.0 6264.0 century 6048.0 6524.0 thostate stato6764.0 7368.0 of7296.0 7600.0 6296.0 na 7520.0 nature 7780.0 naturn 6439.0 6455.0 turn ture5868.0 really rontly5980.0 6596.0 tho6504.0 tate stateof7288.0 7604.0 tb 7524.0 tbbrutes thebrutes -208.0 6639.0 brutes 5488.0 6664.0 Wt11represented roprcsentClI6868.0 through 6760.0 7660.0 un arunentlro 7844.0 arentire 4780.0 entire entlroliterature lItornture5236.0 6140.0 6860.0 as6828.0 worthy worlhyofmlmlrl ndmiramlmlrltlon ndmiraton 7012.0 ton tlonSerious thinkers 7004.0 Franco 7628.0 7055.0 7532.0 ospcclnll 7060.0 ospecially 7200.0 pcclnll pecially5616.0 7204.0 actually nctually5376.0 7208.0 believed bellmoll6232.0 7216.0 7056.0 thothonobta thenoble noble nobta7424.0 snvago5284.0 6104.0 7395.0 5976.0 7428.0 oon7436.0 somo7400.0 instances Instnnces 7588.0 stances stnnces5436.0 ventured venturod5336.0 6216.0 7595.0 6108.0 paint pnlnt6364.0 6956.0 7344.0 7624.0 7244.0 thothoBoIUcst thegoltlest 4868.0 7768.0 BoIUcst goltlest5604.0 7779.0 of5432.0 5836.0 humnn5752.0 beings bolngs7140.0 110 Ile7684.0 7811.0 asosn 7816.0 asa 4776.0 7968.0 7995.0 a7972.0 4860.0 5608.0 oftact tllct5760.0 6328.0 neither nelthor6156.0 6988.0 gentle gontlo6876.0 8004.0 nor notnornoble notnoble 8152.0 Allowing 5192.0 8160.0 of8184.0 courso8164.0 tor6928.0 8195.0 7272.0 7500.0 8192.0 7420.0 veryfew Oly Olyte 8340.0 8344.0 te few 4912.0 individual Indhldual812.0 8348.0 exceptions excoptlona5916.0 8352.0 7460.0 8388.0 moremorocapricious morecapricious 8532.0 capricious 5800.0 8535.0 revengeful revongetul5548.0 6856.0 IIsttul llalful7560.0 8544.0 nUll and7308.0 nUllcruol 7836.0 andcruel 8728.0 cruel cruoltho5588.0 6040.0 lowest 8732.0 oftbeclvlllzOII civilizedclvlllzOIItribes -636.0 civilizedtribes 3004.0 8916.0 tribes 8919.0 5208.0 tho6124.0 addtlon nddtlon8928.0 of6712.0 8960.0 6968.0 callous 7092.0 callousness 7772.0 9108.0 9140.0 ness IIko5100.0 5484.0 9116.0 ofFIJI 6160.0 6648.0 6528.0 9112.0 King 6700.0 7032.0 6792.0 ThaJtom TlialconrTlialconrban -700.0 9296.0 9300.0 ban bau5180.0 5576.0 6008.0 9304.0 5912.0 6240.0 launch 6848.0 bls6748.0 9335.0 now 7064.0 war 7452.0 warbonts -292.0 warboats 9488.0 9491.0 boats bonts5292.0 running 5464.0 them 6192.0 9500.0 6680.0 7052.0 9496.0 tho9508.0 woter7292.0 woterovor waterover 9675.0 9712.0 ovor9680.0 bodies hodles9684.0 of6420.0 life6312.0 slaves 81n096640.0 9688.0 Wh01l1 whotoWh01l1the -460.0 7832.0 whotothe 9859.0 9872.0 5092.0 9868.0 wolght5012.0 9875.0 oftho6228.0 1124.0 dlscmbowelled disembowelled6628.0 disembowelledns -1124.0 7928.0 iM 7932.0 4764.0 10059.0 10096.0 M ns4996.0 10064.0 they 5232.0 pRssod 10091.0 passed 1106320.0 6508.0 usul1ll 7132.0 10072.0 trencher treachertreacherous trencheroua10252.0 10284.0 oua ouspartly partl5016.0 5732.0 10280.0 may mny5848.0 6316.0 10256.0 be 6600.0 tromIncapacity 6964.0 Incapacitytor incapacityfor-788.0 10444.0 10452.0 tor844.0 5128.0 10448.0 continuous thought 6892.0 nndnlwasnlwasHreod alwaysgreedy 10636.0 10640.0 greedy Hreodwhile whllolie5816.0 1snhnost10675.0 ex 7528.0 excoptlon excoption 10824.0 10828.0 coptlon coption5428.0 10859.0 moreinclined Incllncd5808.0 10836.0 6852.0 drunkenness drunleenne9adrunkennessthan -976.0 drunleenne9athan -972.0 11020.0 11024.0 5224.0 5568.0 leant leRstabstinent nbutlnontofthocivIl chlI7332.0 chlIIzod civIlizod 11212.0 Izod 1184.0 11215.0 racesLondon 5060.0 Spectator Spoclntor6332.0 SpectatorGETTING -728.0 6424.0 SpoclntorCETTINC 5084.0 11604.0 11608.0 GETTING CETTINC11620.0 5812.0 6180.0 WIFE 6724.0 ON 7076.0 TICK iICKiICKA TICKA7456.0 11932.0 4932.0 11936.0 lormnr rornrt4852.0 11964.0 + 5480.0 5416.0 11960.0 r uluJrllh TuluRrtph6384.0 01trldor OpuralnreStony filnr1of 7608.0 ofIII ofIli 12092.0 12095.0 Ili5640.0 12100.0 CnurI 5520.0 lIlIrldll11 IiIp In6360.0 CItlct 6564.0 Chlcnlo ChlcnloI 7228.0 7152.0 12123.0 -76.0 oI 7224.0 12247.0 40.0 found tound5052.0 5708.0 12284.0 Dl 5596.0 12279.0 nfly 5840.0 wife wlto5944.0 12252.0 Ull anmill odd7380.0 12276.0 wosalll waysaid 4740.0 12431.0 12435.0 salll said12463.0 5048.0 960.0 oxtolograph oxtelegraph6492.0 operator 6388.0 7144.0 7700.0 Isnow isnow 4748.0 12647.0 5156.0 12656.0 a5340.0 prominent promlncnt5240.0 12635.0 officer 6372.0 cer ofa6948.0 western westernrailroad 4756.0 12819.0 railroad 5780.0 12828.0 5364.0 12860.0 5900.0 12856.0 6744.0 third 12851.0 year yenr7676.0 7568.0 Intho thomil 4988.0 101111 -324.0 5832.0 business huslness13000.0 6888.0 had hnllnut 7444.0 nuttorgotton 7824.0 nutforgotten 13176.0 forgotten torgotton13184.0 tho5864.0 tick tlcltInnguugcanll7316.0 h111h111n hada13355.0 13396.0 a4908.0 room 4824.0 5620.0 13400.0 a5796.0 hotel 5704.0 6580.0 Chicago whlcltwhichhad 7808.0 13359.0 whlclthUtl 13548.0 hUtl5108.0 13584.0 5288.0 13559.0 party pl1rty5200.0 13552.0 13555.0 6184.0 13587.0 boarding bonrdlnbonrdlnhouso -684.0 boardinghouse 7716.0 13736.0 house housoadjoining ulJoining13743.0 6036.0 13740.0 thobonrdlngbonrdlnghouse 688.0 boardingliouso liousolived 5744.0 13959.0 5648.0 5932.0 mighty 5828.0 13932.0 pretty prottySill girl7508.0 7408.0 whowas 14083.0 14152.0 5124.0 attending nUondlng14159.0 6032.0 14120.0 commercial commorclnlcollege collogo5068.0 14299.0 next nuxt4992.0 block 6000.0 where whero6540.0 14295.0 thoroWt11also n190a7668.0 ucourso acourse 14488.0 14524.0 coursoof836.0 14492.0 telegraphy telography6544.0 7396.0 nd I1gucssed -56.0 Iguessed 14656.0 guessed gucssed14680.0 bY 5824.0 14664.0 seeing seolng6496.0 14660.0 thobooks 6736.0 aFjdaFjdpl11ora andpapora 14844.0 14864.0 pl11ora paporashe obo5716.0 cILrrlolJ carriotJ5612.0 th tilut 14851.0 l -64.0 Aha 14872.0 w vino tnk tnkIng tnking 14975.0 14996.0 Ing tbat5008.0 14988.0 You 6116.0 BOO see7312.0 WlU wiaWlUwatching wiawatching 15175.0 watching hor ratber5820.0 6456.0 closely CIOG3Iy7116.0 tor15200.0 wasIntorostod wasinterested 15343.0 interested Intorostod5636.0 from5524.0 15356.0 tho15352.0 tlmo6780.0 7512.0 15368.0 evmoversaw 7852.0 7516.0 evmSI1W -336.0 15572.0 saw SI1Wher tho6132.0 street streotstreotSbo 6568.0 streetShe 15731.0 15740.0 She Sbo15768.0 15772.0 664.0 5988.0 15743.0 stranger 5888.0 15736.0 town nndnndat andof 15920.0 15931.0 of4980.0 15959.0 coursc15927.0 thero 6084.0 waBnt wasnt15952.0 6592.0 chance chonCD6936.0 tortorm formy 16128.0 m -128.0 4876.0 5556.0 Introduced bel7036.0 nnd16120.0 as7612.0 torforflirting torIJIrtlng 16280.0 flirting IJIrtlngshowed 16312.0 6340.0 more7196.0 algns7108.0 7692.0 ofatIt ofit 16467.0 tban4864.0 16499.0 5668.0 sister 6220.0 ofcharity chorltywouMwouMthough -456.0 wouldthough 16660.0 16667.0 16671.0 16699.0 cave gave5448.0 horevor ovary 6692.0 920.0 opportunity 6784.0 opportunityI -920.0 16836.0 16844.0 16839.0 tound4796.0 16848.0 5992.0 16871.0 acnrotulofWI1 WI1llows wl 7712.0 tdows 17027.0 llows dows17023.0 thnt5132.0 5672.0 17060.0 5920.0 tho-688.0 17204.0 17211.0 17239.0 17220.0 5572.0 17223.0 mine mlnothohotolhotolnnd hoteland 17391.0 17400.0 nnd17395.0 tbntmade 17427.0 mo me6324.0 feel teel17423.0 worseso worsesononr -772.0 worsesonear 17579.0 17611.0 near nonr17584.0 nail17591.0 yet yot17616.0 17588.0 far turyou undorstnntundorstnntI understandI-864.0 17767.0 sho5700.0 5624.0 17776.0 17772.0 be6732.0 thoschoolmuch school achoolachoolmuch 17951.0 17988.0 mono malO5160.0 tbnn6144.0 17956.0 three tbreomonths 7320.0 17983.0 asnsbolt 7672.0 ashalf 18135.0 bolt halfthnt18140.0 tlmo timo5956.0 lint18172.0 gono 7020.0 nnd18144.0 7300.0 still 7440.0 stillhntl stillhad 18340.0 hntl5228.0 18344.0 maclo5024.0 5748.0 18376.0 18372.0 progress progresB6872.0 began begnn18347.0 togrow 18507.0 18540.0 grow 18512.0 despernto desporato18515.0 tor6688.0 couldnt bel1r betir7324.0 bel1rtho betirthe 18696.0 tho11louKht18700.0 of6016.0 losing horknowa 18884.0 18916.0 4972.0 18912.0 romance romancoIIko5628.0 makes mnkes18919.0 adod doll7376.0 dodmore dollmore 19064.0 19100.0 Impression 19103.0 6588.0 19071.0 follow tollow7504.0 threal 7748.0 thereal 19252.0 real thing 5032.0 thingOno 19255.0 19443.0 572.0 Sunday Sundoyafternoon Itternoon19471.0 waBmr mymyroom 19475.0 Iroom 19627.0 19655.0 5216.0 sho19659.0 hors 6408.0 19631.0 coutdcoutdhear couldhear 19827.0 hear hordriving tlrlvlng5476.0 6272.0 19863.0 nail 6884.0 wnllwnllami wallxncl 19992.0 19995.0 ami xncl20031.0 srentcame camosull sudsullllonly sudonly llonly20199.0 Tho5168.0 20208.0 noxtminute minutoIcaught 7656.0 20231.0 up upono 20236.0 upma 20399.0 ma20371.0 of5444.0 shoos slices20403.0 wns waapounding 7644.0 Ito Itocool tu tuhool 20551.0 cool hool20583.0 20587.0 wan wallwasnt drhln drhlnnalls drivingcalls -560.0 20739.0 nallsNot 5664.0 20744.0 waamaking mnklng20780.0 tela toletelagraph -268.0 toleraph 20923.0 graph raphcall cal15936.0 anything nnythlng7220.0 20960.0 particular par 7764.0 partlculnr 21123.0 tlculnr ticularani 5272.0 21160.0 21127.0 enllnndnndatter andafter atterrepeating 6168.0 21304.0 l6756.0 21332.0 W 7048.0 tsho toive 21479.0 sho 4844.0 ive 21484.0 despair dospalr6308.0 6696.0 waa6584.0 21491.0 answered nnswerllansweredrom -732.0 7100.0 nnswerlltram 21668.0 rom tho5580.0 othcr5472.0 aide sldoThen 7232.0 tele toletelegrl1phed toleraphed grl1phed raphed21872.0 How 5380.0 21904.0 6224.0 nndthntthntwns thatwas 22040.0 22072.0 wnsnnswercd22075.0 bit slow 6912.0 pe pehaps per 22240.0 haps 5248.0 anBwerodallright thothoconvorsatlon theonvorsation 22428.0 1004.0 convorsatlon onvorsationcontinued continuodcontinuedSbe -756.0 continuodShe 22596.0 22599.0 Sbe22628.0 wns22607.0 tho6484.0 22603.0 most 6380.0 sklllod skilledop opirator 22780.0 22787.0 erator irator22783.0 ever ovortaken 6800.0 6656.0 certainty certalnycertalnythe certaintyho-704.0 22967.0 22975.0 22971.0 5600.0 interesting Intorestlngana onenndWB weWBtalked -200.0 wealked 23152.0 23155.0 talked alkedwall6816.0 23187.0 supper suppertime supperfine 23339.0 finefhatevening evonlng23343.0 againnut again -420.0 againbut 23527.0 23531.0 nutsho23555.0 wnshomo homeitgot iot -40.0 23707.0 23720.0 got 4840.0 23715.0 23711.0 wisely wlsolytorobore foreboretoroboresondlng -644.0 foreborelending 23895.0 lending sondlng23931.0 23899.0 good 23904.0 Noct Noctmorning No 23907.0 ct ctnorning 4760.0 24095.0 24099.0 morning norning24104.0 5412.0 hlllJed hailedgoodnorning -352.0 goodmorning -348.0 24267.0 24271.0 norning24276.0 5804.0 6204.0 24299.0 an24295.0 answer tohntohnI thenasked 24451.0 24463.0 24455.0 asked if5764.0 I6188.0 24467.0 meet 6952.0 7584.0 7448.0 heracter herLiter 24639.0 24647.0 Liter acterbreakfast brenktnstnnd24644.0 schoJIschoJIwUh schoolvlth 24823.0 24831.0 wUh vlth5196.0 24828.0 sho6196.0 110veItYou itloo 25007.0 25019.0 loo25044.0 seo5056.0 25011.0 wnsshy 6488.0 25047.0 25016.0 brlc 7348.0 brlcwaU bricc briccwall 25195.0 25200.0 waU25203.0 between hetween5072.0 25223.0 us 5788.0 25227.0 threo25232.0 25207.0 tour fourtourdns fourlays 25379.0 25391.0 lays dns25384.0 pleading plendlns6632.0 7168.0 25416.0 7484.0 25387.0 shooieol shoo shooheel 25563.0 25571.0 heel ieol25603.0 25568.0 wollbetorosho25575.0 agreed tomeet 25579.0 toneet 25763.0 neet25787.0 me 25755.0 25784.0 anI tlmo6512.0 bad had25759.0 toll tol1tollnor 25951.0 25968.0 25995.0 25956.0 everything nnll5960.0 sho6728.0 7124.0 couldntretuso couldntefuse 26135.0 retuso efuse26124.0 cho5516.0 26151.0 somoof7744.0 26156.0 7620.0 bsbow tchow chow sbow26315.0 After Atter26335.0 6056.0 8choal8choalwith -484.0 schoolwith 26503.0 26499.0 26524.0 WIUJutterly 6164.0 gone gono7416.0 andhough nnl nnlthough hough26683.0 Bhostaid 26708.0 I1ndWM wangradu graduated gradurated 26875.0 26891.0 rated ated26880.0 sbo26907.0 novel flavor26883.0 26915.0 Achanco abanco chanco bancopractice ebe27051.0 learned learnedtor -568.0 learnedor 27232.0 tor 4828.0 27287.0 betore27235.0 ajob 6940.0 27243.0 mad madamadaor -400.0 27275.0 aher 27455.0 27483.0 27443.0 promise promlso27448.0 27464.0 marry 27467.0 6500.0 7252.0 glvouptelegraph upolegrapby 2364.0 4836.0 27604.0 telegraph olegrapby27607.0 Now 6028.0 27635.0 Ow York Sun Sunc 29331.0 29399.0 111 29511.0 c 29555.0 if xmlns:ns4 ID6 7892 2900 8036 1476 ns4:type 2668.0 CENfGUY CENfGUYITS 9220.0 CII 8516.0 rI 8484.0 8708.0 8740.0 CIIr 8724.0 9828.0 ONIEIZS ONIEIZSITS 10764.0 ITS 876.0 SCIENTIFIC SCIENilJICSCIENilJICPROFOUNDLY -876.0 9352.0 9720.0 VERIES 10412.0 HAVE HAVEPROFOUNDLY 8188.0 1088.0 PROFOUNDLY 9348.0 9276.0 ATho 9416.0 ED 9980.0 OUR 9904.0 10376.0 LIFE 10300.0 8084.0 Tho 7110796.0 8460.0 llIllrtlh Nlurtcntllt8360.0 9640.0 tt 9748.0 9700.0 9824.0 9916.0 9884.0 10036.0 1lIlcc 1alto9964.0 10484.0 1011 ltnl10388.0 1011tlllll ltnltiott 8204.0 2864.0 tlllll tiott8564.0 1t8788.0 flue UIlII8640.0 9148.0 2895.0 9056.0 9356.0 t9728.0 t9384.0 9852.0 lllllInrlllll 11enrnbtn9760.0 10700.0 11rCrnturlcTutu 10704.0 IIr 11r10844.0 IIrCllItllrluThll 10848.0 CllItllrluThll CrnturlcTutu9732.0 lIielue naluU9284.0 10168.0 lucllfllu Gndrrlirr10112.0 lucllflluAll GndrrlirrAll1540.0 8200.0 8488.0 Our Chlr8416.0 8836.0 IUlJItIl 1lnden18772.0 IUlJItIlTbo 9364.0 tThe 9740.0 8252.0 Tbo8688.0 following tollollI8560.0 9376.0 10288.0 writtenfor 10160.0 10292.0 written 10840.0 writtentor tor8384.0 tho8312.0 8716.0 20th 8632.0 8804.0 Oth Clllt centUl ue9976.0 ut of9900.0 tlw10116.0 10516.0 10428.0 NowYork ow owYorlt 8088.0 Yorlt8572.0 Worltl 1Vorkl3835.0 9040.0 9656.0 lrraan 9716.0 uJlnn 10088.0 10196.0 Iocltor lockyer10092.0 lockyerK 10804.0 K 8132.0 C 8208.0 B 118492.0 8988.0 p F8776.0 9264.0 9092.0 author uthor10208.0 ut10584.0 l11o10356.0 l11oSule rhoSune 8072.0 Sune Sule8588.0 Place Plnro9084.0 9000.0 9800.0 etc Itc9216.0 ItcThero 10000.0 etcThere 8240.0 Thero8808.0 can9176.0 9068.0 9660.0 I1bl ubt9316.0 9988.0 lint Ihat9888.0 10384.0 10616.0 thothoCutmo 10852.0 thefutno 8068.0 Cutmo futno8652.0 hfstor 8552.0 ltrstory 9100.0 cf9188.0 9636.0 9412.0 wurlll vurld-28.0 9668.0 tor10032.0 thou 10392.0 thousBuds 10808.0 thousands sands sBuds8612.0 of8508.0 8860.0 years 8764.0 OI1S t9696.0 utur 9444.0 ntury 10016.0 10084.0 thnt10068.0 10604.0 hnK taus10496.0 hnKjU3t 10856.0 tausjti3t 8052.0 4936.0 jU3t jti3t8456.0 IHlssed pab90daway 8972.0 9072.0 4991.0 9172.0 wn bu9956.0 recordet 9876.0 9960.0 lIIlOrlllll 10552.0 10696.0 4968.0 as10596.0 asone 111ono 8060.0 one8404.0 of8332.0 8636.0 tho9404.0 u9324.0 9704.0 able ollil10132.0 IC If10312.0 trot10232.0 10628.0 tho10548.0 thomost 10860.0 themost 860.0 memorable mOlUornlJle8432.0 9752.0 1fIt 9420.0 9756.0 II 10056.0 Ilh 10176.0 nttlntlun nttentlutlnttlntluncan nttentlutlcan8056.0 be8320.0 8648.0 5515.0 8576.0 9328.0 T1 Ti9124.0 gh 9924.0 5532.0 Ilo 9848.0 position llIun 10512.0 w1l1w1l1bo 10864.0 willho ho8328.0 awarded nwnrllod8236.0 8992.0 9344.0 hI he9944.0 ground groUlul10460.0 thatIt 10872.0 8232.0 8168.0 8428.0 tho8748.0 one 8680.0 whld9012.0 moat meat9476.0 10156.0 IlroCound profututdIlroCoundI profututdlyly 8092.0 8296.0 affected affoctoll9024.0 6076.0 tho8912.0 9368.0 IImillions ndittoms9452.0 oftho10532.0 thohuman thehuman 8668.0 race 8580.0 raceTho raceThe 2624.0 8216.0 Thosalient sallont8520.0 1oabollt9464.0 tie10044.0 10520.0 nine ulneninetoonth ulnetoonth 8044.0 toonth 8644.0 centur 8548.0 -496.0 9332.0 IH is9236.0 9940.0 19 is10140.0 tho10052.0 sclen scleu10368.0 sclentlfic scleutiflo 2848.0 tlfic tiflo8444.0 conturyTh 9708.0 y 9460.0 art nrt9792.0 10264.0 lllrnln learning10124.0 lllrnlnIn 10892.0 learningin 10788.0 8048.0 7000.0 thoordinary orlilnor8540.0 9396.0 are nro10060.0 nt at10296.0 tho10204.0 end oud10528.0 oudot 10884.0 endof of8276.0 7188.0 protty8396.0 9036.0 7195.0 8944.0 hey wero10432.0 7179.0 at10348.0 10660.0 tho10580.0 thobOilnnlng theboginning 780.0 bOilnnlng boginningbOilnnlngTho -780.0 8824.0 boginningThe 8212.0 Tho8620.0 7563.0 gift glttof8904.0 scl scil9736.0 thl10304.0 opening opcnlnRopcnlnRyonrs -600.0 10904.0 openingyears yonrs7752.0 of8464.0 8828.0 thocost cont10080.0 thl10416.0 steam tollm10308.0 steamengine tollmonglno 2824.0 engine onglnothon7940.0 oath COD1h8984.0 7960.0 O 9920.0 cpmmon 9844.0 10624.0 7944.0 USlUSlWatts 10868.0 useWattu 8112.0 Watts Wattu9224.0 8156.0 9228.0 0C1 9480.0 9784.0 8144.0 1800 10472.0 When WhonWhonono 10916.0 Whenone 10912.0 one8308.0 rondo9060.0 8303.0 how 9232.0 wa3 wnsthnt9928.0 10536.0 Walt WattWaltachlovod 10920.0 Wattachieved 8040.0 8487.0 achieved achlovod8820.0 8524.0 one8496.0 of9088.0 9320.0 8500.0 nost 9448.0 10040.0 trmnondou8 tremondoustrmnondou8roolutlons -880.0 tremondousrevolutions 8664.0 8676.0 revolutions roolutlons8712.0 retort rocorlrocorlI 9492.0 12.0 -12.0 9648.0 history hltory10664.0 8687.0 oneonooannot 10924.0 onecannot 8868.0 cannot oannot8856.0 help holpteoll techl9004.0 8859.0 hat 9432.0 10008.0 8852.0 hlaosltlon10216.0 osltlonns positionas8036.0 9080.0 as9048.0 mathematical o1llthomlltlcal9043.0 strumlmt strumunt10456.0 rnnkAr tnakor10320.0 rnnkArto tnakorto10936.0 9211.0 9240.0 tho1152.0 Olasgow 9856.0 OII11o -612.0 10468.0 10668.0 hnll10340.0 xmlns:ns5 ID7 12052 3104 8008 9388 ns5:type 8032.0 9388.0 oorthln 9427.0 8892.0 dow 9520.0 9456.0 Iv 9340.0 9516.0 9952.0 9400.0 Iodwithhis 10940.0 9583.0 9604.0 8356.0 9608.0 friend frlond8256.0 Black 9192.0 cl 9312.0 9308.0 9612.0 ntmo 9588.0 ntmoaphero 10200.0 llhcro 10712.0 oforr090l1rch 10944.0 ofresearch 8028.0 9772.0 676.0 9796.0 research r090l1rch8920.0 Tim Tho8704.0 9804.0 stc ste9783.0 onllno ongine9504.0 cl08cl08I 10820.0 8244.0 10012.0 oro8568.0 all9967.0 scientific solentlflcglclt1ons pllcattons9532.0 11011111 botiltd11011111togethor 10948.0 botiltdtogether 8024.0 10144.0 10167.0 together togethor8896.0 10164.0 underlie underllo9676.0 1U all9524.0 our modern mOltcrn10228.0 mOltcrnprogress -564.0 modernprogress 10328.0 10380.0 tor10351.0 thoIson ason10339.0 thnt10024.0 10592.0 haul hal1l110464.0 hal1l1labor 10956.0 10332.0 haullabor labor 8556.0 thanks thlnlcR9180.0 10539.0 is S 9816.0 heon hcou10324.0 rUlllacolt replacedrUlllacoltby replacedby10960.0 10723.0 8288.0 10728.0 greater srentor8948.0 10755.0 llOworapowersOne -536.0 9484.0 8952.0 llOworaOno 8196.0 10875.0 Oneof8504.0 8832.0 tho9168.0 9540.0 10900.0 J1IllltlonR llicntinns9576.0 10480.0 10888.0 during durlncdurlncthin 10976.0 duringthis 11072.0 11096.0 thin this11104.0 contury8316.0 9200.0 of11100.0 ti9780.0 11116.0 nely 9580.0 11123.0 Source lOUrCl9864.0 ur of10692.0 urpowor 10984.0 ofpower 8020.0 11263.0 11312.0 powor8608.0 wns9020.0 11288.0 8908.0 9268.0 11279.0 loco 9160.0 11320.0 9572.0 11275.0 Ilion tion10244.0 Thin Ihll10028.0 waKwaKdono wasBono 8016.0 11447.0 11472.0 Bono donoh 11468.0 Wall Watthint hln1l9724.0 f9592.0 11460.0 I1n19776.0 10224.0 Smmlnston Smmlns Synuning-712.0 Synunington 11631.0 8364.0 11688.0 8264.0 thuIurth thinForth11656.0 Forth 8932.0 11691.0 11660.0 11644.0 CIlto ClydeCanal Cannl10752.0 11840.0 1802 1802Our 12063.0 12068.0 prosent8480.0 el1012084.0 ous9584.0 hnttllNhlps hnttlesltipshnttllNhlpsand hnttlesltipsand10996.0 11108.0 12047.0 8012.0 12231.0 8376.0 mail JUallsteamers utenmcrs12244.0 12268.0 OUI anudestroyers ItcstrOcll10100.0 destroyersgoing -800.0 11004.0 ItcstrOcllgoing -796.0 12403.0 going 8528.0 12447.0 31 8768.0 36 8888.0 miles mllo12468.0 hour 10184.0 12452.0 nro10500.0 douh douhtho doubly doublythe -504.0 12587.0 12619.0 thoresult 8900.0 of9132.0 Wattl Watti12608.0 worle 9600.0 orlc 10360.0 12603.0 10568.0 la is10776.0 tho10684.0 thostenmenKlno 11012.0 thestoantengine 1036.0 12803.0 stenmenKlno stoantengineIvhfch12796.0 9616.0 builds 9972.0 12831.0 114 10248.0 12792.0 thom thunt11111 alit alitdrives 10964.0 12976.0 12987.0 drives 8584.0 whon9552.0 12980.0 Ill Int10268.0 13003.0 nm 10272.0 cony 10492.0 10672.0 overt ovcnovcnbo overtbe 8008.0 be8272.0 thotMr 8596.0 larson Parson13171.0 9548.0 9908.0 13159.0 thu10212.0 13155.0 ond10136.0 10560.0 of10476.0 10792.0 tho10708.0 thocentury thecentury 13340.0 13364.0 13387.0 porno porvoo13380.0 9768.0 10120.0 13343.0 10524.0 WuU10424.0 WuUmethod 11032.0 Wattsmethod -388.0 method 8696.0 of13543.0 applying I1ppllnstoam13536.0 marine ml1rlnemarinelocomotion 11036.0 13692.0 13724.0 locomotion 8964.0 13755.0 canbe13720.0 lfOldUllon10260.0 13704.0 tor10724.0 forsomo 11048.0 torsoma soma somo13936.0 usesLand 8420.0 uses UROBUROBLand 14051.0 14124.0 Land 14127.0 br liy 9764.0 9832.0 14148.0 mennn meansRtcamRtcamfollowed 11044.0 steamfollowed 14304.0 followed 14308.0 14311.0 1829 8936.0 thoRocket Hockottim thothoStockton timStockton 14479.0 14495.0 Stockton 9244.0 Dnrlinglun 9120.0 Darlln -804.0 tun 14483.0 railway rnl1way10048.0 inaugurating Inauguratlng 11008.0 14667.0 auguratlng augurating8980.0 tho8884.0 lon 14672.0 aeries strlc9628.0 10236.0 of10148.0 engines onglnosonglnosbow 11056.0 enginesawl 14867.0 awl 8304.0 14892.0 8628.0 9008.0 hl 9136.0 9744.0 bow 14883.0 10420.0 co auld ridridand 11060.0 10740.0 14848.0 auldond 14980.0 ond8424.0 sato safo8324.0 transit 8736.0 po4 o4lble le -124.0 15023.0 ovor10656.0 ovortho 11084.0 overthe 15156.0 15172.0 thowholo9016.0 surface surrl1ce1C 15212.0 thoolvllizod civilisedolvllizodworld civilisedworld world 8616.0 speed Rpoodnml9892.0 economy 9896.0 15396.0 ocono01 bolngbolngsecurod 11064.0 beingsecured secured securod15552.0 Jamess InvonUon invontonoftho10716.0 thotu thetubular 1112.0 tubular bular bollBr bailorbollBrElectrlclt 9156.0 bailorElectricity Electricity Electrlclt9104.0 comes noxt9564.0 wllhIts 15943.0 won 10644.0 wondortul wondorful 16108.0 dortul dorful16103.0 record rocordofelectric oloctrtotehnaphtehnapholoctrlc telegraphelectric 16287.0 16292.0 oloctrlc8752.0 IIthtolactnc olectnlctraction tractlolltolo teletelephones 11016.0 tolophones 16480.0 phones 8700.0 16476.0 wlrolo8i1 wiroless8968.0 telesraph10780.0 16471.0 andan 11052.0 andall 16664.0 allsince olnco1836 Ot Ofthoapplications apllcatlo10756.0 16687.0 8 16655.0 ofotoloctrlclt ofelectricity 16852.0 oloctrlclt electricity -680.0 16855.0 acterhnt hnshappened bapIH1t1edbapIH1t1edho happenedhe17039.0 he17036.0 8220.0 17067.0 bold 17064.0 17032.0 10608.0 wouhlwouhlvonture wouldvonturo vonture vonturo9076.0 17216.0 predict whore wberothoy10152.0 wilt willwiltstop willstop stop 17443.0 8756.0 17407.0 tbat17436.0 nocQuuUt equatlt9336.0 striking ntrlklng17432.0 IO IOvolopmonts der dervolopmonts 17595.0 volopmonts 9052.0 17623.0 lirOyotstore oloro9880.0 rorUH usUHIt usif 17783.0 if8280.0 thoy17811.0 como comaViti9808.0 IJO bo10104.0 1J0causothothefuture 10812.0 thotuture future tuture17963.0 17995.0 Ilrol produce 9292.0 17992.0 ucu 9528.0 17960.0 Faradays Farada1110796.0 itsKolv Kolv 8180.0 01vln9 01vln9Tho inn innThe 18324.0 Tho8604.0 18335.0 saving salngoftho18328.0 IITos linos18331.0 of10076.0 18360.0 10316.0 Hall nail10652.0 Hallors nailore 18560.0 ors ore8368.0 18528.0 18535.0 storm 18556.0 warn 18519.0 warnings InKS 9936.0 tho10632.0 10540.0 studyof Html Htmlat 18716.0 oftho18707.0 laws ofstorms stornlB9840.0 18735.0 -60.0 18731.0 oneof10440.0 thothooppllcallons theapplications 944.0 18896.0 oppllcallonsof18891.0 thosclunco ofmeteor moteormoteoralas -540.0 meteorology 19068.0 alas ology8452.0 thn9424.0 19075.0 contur hOKbrought broughtU8n broughtuaa 19300.0 U8n uaa19259.0 rosult9044.0 undr undreamed 9380.0 arnd 9860.0 9932.0 of10748.0 whoflrst whofirst 19436.0 flrstweighed wchhed9280.0 tho19440.0 Nor 10816.0 thuthubenefits thebenefits benefits ofscience sclenco9836.0 10336.0 seafaring soatarlnKsoatarlnKand seafaringand 19808.0 8436.0 seagoing populations 19811.0 hero horohoroOconn heroOcean 20011.0 Ocean Oconn8592.0 currants currontsWI asVeUal 19999.0 abair nil 10344.0 currents currentshavo currentshave 20179.0 havoboon beon916.0 20183.0 investigated Invostlgatedanti andcharted byhydrograpltors byhydroKraphorll 20364.0 20379.0 hydroKraphorll hydrograpltors10276.0 added addod10172.0 totbltso tothose 20571.0 tbltsobenel1tR8448.0 20580.0 maps showing sbowlni10220.0 sbowlnidopths showingdepths 20755.0 depths dopths20783.0 20764.0 thocontours of11076.0 tho20939.0 bottom ofseas HCas9652.0 20955.0 oceans ocoanaaroarenearly aronearly nearly 21151.0 8792.0 known 21139.0 aB asthoso ofthotholand 10832.0 theland surfaces surtaccsxmlns:ns6 ID8 6764 3160 8040 21479 ns6:type 21500.0 Moro MorethlUlhln180tt10676.0 hashoen hasbeen 21663.0 21684.0 hoenproeil8412.0 hnveprosent10128.0 10896.0 ontho onthe 21847.0 thosceno aconocontemporaneously contomporaneously21851.0 withmany 22035.0 extinct oxtlnctanimRIR22043.0 10544.0 tlmotlmolong 11080.0 timelong 22224.0 22235.0 8512.0 22228.0 antecedent antecodont22231.0 favored lavoredbyArohblshop byArohblebop 22408.0 888.0 22419.0 Arohblshop ArohblebopUsher This ThlR9512.0 work 22412.0 10688.0 hasboon 22587.0 extended extonded8408.0 22591.0 thosclenco sciencosclencoat sciencoof22771.0 22799.0 ofarchaeology archacoloKdemon domonstrat domonstratod trat tratod 22959.0 22980.0 od thoexistence cxlKtonceof9372.0 settled settlodcommuni communlcommunities communlties 23164.0 ties 23159.0 8844.0 23180.0 23175.0 moatla nieansrude rudfl9912.0 clvlllza civillzaclvlllzatlons 11040.0 civillzaLions 23327.0 23352.0 Lions tlons23336.0 thoUllllmls thousandsof9556.0 23359.0 23371.0 9968.0 nnd23511.0 23564.0 evident 23520.0 thntthonoblostllud noblostlludat -944.0 noblest tudy tudyof 11088.0 23691.0 23723.0 ofmankind 23704.0 thogeologist HcoJollgtantiarchae archacarchaeologlst -512.0 archacologist 23876.0 ologlst ologistmust 9208.0 23883.0 23888.0 togother10768.0 dIva divedIvastili divestill 3152.0 24071.0 24088.0 stili24083.0 turthermans mnns24076.0 early onrly10504.0 24079.0 hlstor 10404.0 hlstorDut 10952.0 historyBut 11196.0 24187.0 8224.0 24251.0 Dut24260.0 htl 9028.0 alaoanother anothor10352.0 anothorvory 11092.0 anothervery 24287.0 24435.0 24492.0 vory24439.0 practical practlcnlapplication appllcl1t1onofgoologl 10400.0 goologlcal 24619.0 Geography GcoJrallh24623.0 24671.0 24667.0 save gavesaveus -356.0 gaveus 24803.0 24863.0 24851.0 24819.0 of8760.0 Il1nll24811.0 urtacosgeology geologyhns geologyhas 24995.0 hns25039.0 paned hnned25023.0 geological gcoloJlcalgcoloJlcalmaps geologicalmaps 25175.0 of25179.0 priceless prlcttesR8720.0 value nltlo25187.0 Inter 8064.0 25363.0 ested 8784.0 25375.0 thoproducts llroducts25368.0 of25371.0 thomineI mineit25595.0 tnrllllrly formerly25543.0 25559.0 thestudy 25731.0 stud oforganic oTllnknnture25740.0 25743.0 haonopossible noposslblc 25911.0 25935.0 posslblcnpptlcntlon nppilcallontltat9596.0 25919.0 tho8tml 25940.0 of10880.0 atanimals ofanimals 26095.0 anl26099.0 pJ1tt piartnled le126115.0 26108.0 clnsslfica clanslficaclnsslfica1lon clanslficatlon 1lon tlonchiefly chlel1rif9544.0 oxcluslvoly ozcluaivolyoxcluslvolyIn ozcluaivolyIn10408.0 26459.0 26487.0 thlo8812.0 26475.0 region rtglon26467.0 of26508.0 we26483.0 find flntl26519.0 10876.0 26655.0 revolution reolullonas9820.0 strIking Ifnotmoro notmore 26832.0 26895.0 morestrllclnthoRoalready alroady10 ro10terrod roferrod 27016.0 terrod ferrod8624.0 8536.0 8976.0 27023.0 genius ofDarwin Darlnhn hnevotved hasevolved 27199.0 evolved evotvedfromtud 27211.0 thoorigin ofatpoclosthat ofspeciesthat 27379.0 27395.0 poclosthat speciesthat27388.0 causo 27407.0 of10572.0 27404.0 theIntroduction 27575.0 27583.0 Introduction of1312.0 nowtormsanrt new -1312.0 formsand 27591.0 10720.0 hasf 27972.0 28159.0 xmlns:ns7 ID9 8068 3236 10960 1332 ns7:type 11028.0 1332.0 11548.0 11640.0 11760.0 12156.0 12184.0 l1r 12104.0 presence 12344.0 12448.0 scneo 12872.0 12944.0 of13172.0 1456.0 thl13104.0 13488.0 1440.0 worle13416.0 1436.0 utevolution 13884.0 13960.0 utotovolutlon evolution ovolutlon11836.0 11744.0 12072.0 moulltlnR moulding11976.0 12884.0 tho13208.0 1636.0 nnlmlll animal13128.0 13828.0 andantil 14111.0 andvegotablo vegotablo 11124.0 11772.0 11304.0 otnblo 11176.0 11896.0 Itlt1 lchlgdom 12128.0 12248.0 llom 12560.0 12684.0 thmllgh13424.0 tho13292.0 13792.0 vast 13664.0 vastfolorlrnl vastgeological folorlrnl11908.0 Iwntllls periods11800.0 1111113028.0 wl1lt13500.0 in13412.0 1101013620.0 11010ImlHIItnnt 14116.0 moreinpartnnt 2192.0 764.0 ImlHIItnnt inpartnntfront tlom11796.0 12356.0 tho12696.0 prortital13476.0 1I0int13372.0 13964.0 of13876.0 otIow ofview view 11132.0 Iow 11384.0 11528.0 11388.0 11664.0 12112.0 own 12016.0 12524.0 times UU1t812424.0 13236.0 Vhdlo 13352.0 hllo 13632.0 ant UI113780.0 UI1wrltlnc antwriting 14060.0 writing wrltlnc11696.0 t1lro11600.0 12188.0 is12096.0 an12316.0 international IntlrI1l1t1onnl13804.0 cnn13708.0 cnnfereoco 14072.0 13808.0 conrlru1co rlru1co fereocositting 12420.0 12312.0 12724.0 hhrlltz1t1011 libridization13968.0 of13760.0 orIllants 14128.0 ofplants plants Illants11616.0 nnll11512.0 11992.0 nnlmals aulnialn12708.0 ItltoCt12844.0 13512.0 relation loll1t1on13404.0 loll1t1onto relationto11256.0 Darwins 11184.0 11260.0 DarwlntIwork 11940.0 12060.0 12392.0 12532.0 JhIA3136.0 shows sluonva12876.0 13496.0 tho13816.0 wily wnywnyIn wilyin wblch11788.0 tho11712.0 must12544.0 abstract nhutrl1ct12484.0 13268.0 generalizn 13196.0 generalizntun -820.0 14088.0 PI1l1rallzl PI1l1rallzltlon -660.0 14028.0 tunof11340.0 11724.0 sclonco ectouco12416.0 cony12296.0 12864.0 affect nffl12736.0 13244.0 13304.0 industry InduRtrindustryIt -656.0 14080.0 13428.0 InduRtrIt -652.0 11276.0 wus11168.0 stated Rtatlt11564.0 3708.0 at12136.0 12508.0 3692.0 tho12400.0 12852.0 conference conrorenco12748.0 13812.0 thattho 14132.0 thatthe tho11392.0 wholoorange 12564.0 h1ltultr12464.0 13312.0 of13216.0 13564.0 13464.0 Florida lurhln13608.0 Floridamust 13680.0 lurhlnmust 4035.0 11552.0 11436.0 abandoned nbl111110nclt4056.0 unless UnIN12676.0 13420.0 13300.0 13628.0 hybrid hlIrhlhlIrhlcnn -500.0 hybridcan can11396.0 lit 1114251.0 slcurOlt12320.0 whlrh IhlchtInIll 12772.0 13132.0 13220.0 stand stl111113732.0 frost trost13636.0 trost1llIclno frostMedicine 11232.0 4451.0 Medicine 1llIclnoanll11924.0 12496.0 4444.0 nstronluu nstronptny12384.0 13240.0 13316.0 4448.0 nro13864.0 cor 13668.0 cortaint 14100.0 cortainly taint tainly 11408.0 11720.0 4632.0 tho11504.0 12172.0 mORt12752.0 4612.0 IllIllnt nneient13540.0 of13904.0 tho13688.0 thoscloncos thesciences 4775.0 4832.0 sciences scloncosonll11704.0 12216.0 12116.0 12588.0 strange strnngo13272.0 tell tllItho13756.0 thond theadvances advances 11348.0 5036.0 ancos -432.0 11780.0 11968.0 h1ro12488.0 12304.0 12668.0 13032.0 1l11I011 equalled13872.0 nntither 14048.0 anyother 11068.0 5152.0 tither11560.0 11784.0 5175.0 12332.0 I12240.0 12460.0 have12376.0 12904.0 referred rlrOrrOlt12824.0 11248.0 11368.0 5407.0 11111292.0 11676.0 nn11928.0 5360.0 old ollt12236.0 mnn12152.0 12640.0 13064.0 lIut13392.0 stilt still13320.0 13768.0 13684.0 13892.0 ttlsttlsI thistinetly Unctt tinetly romomhur romemhur11584.0 12660.0 12520.0 13112.0 large InrKo13640.0 13504.0 13928.0 myyouth 13784.0 mY 14168.0 mYouth 14156.0 youth outh WUR12196.0 tho12008.0 12632.0 nuru number 12960.0 12984.0 of13232.0 faces 13572.0 facesmarked 13772.0 tnC 14008.0 13992.0 14092.0 Kmnrkel1 14164.0 5928.0 marked mnrkel111816.0 5915.0 thosmallpox B111nll1012548.0 encuun encounencuuntoro encountorod toro 6115.0 torod 11400.0 11480.0 11412.0 11440.0 11424.0 11580.0 6112.0 11808.0 an11716.0 hours 11988.0 12652.0 watltSuch 13008.0 nights nightsnnd -464.0 14172.0 nightsand nndtho11356.0 11756.0 deaths IIlmths11684.0 12348.0 and12700.0 6304.0 12616.0 ravages 12760.0 ngoR 13308.0 13388.0 caused rauRed13996.0 13908.0 IthlR 14036.0 bythis 14176.0 thlR11464.0 foil telt11380.0 Itillonsa dlseaso11708.0 hlo12368.0 832.0 12900.0 practically practlcalt12812.0 13820.0 linenboonabolloholl linenabolished abolished abollohollhy by11828.0 12300.0 vaccination cclnlltlon13344.0 lutrollucollh introducedby13192.0 13348.0 introduced lutrollucoll6864.0 11180.0 11360.0 JonMr Jonner11900.0 12212.0 tho12124.0 flnt tlrst12936.0 halt half12848.0 oftho13468.0 contury tur tury 11324.0 11652.0 Pnstourlnd Pasteur 12352.0 12308.0 Listen LlRtorhlo13200.0 13776.0 mndomndotor 14184.0 madefor tor11416.0 thomllohoB thonsolvosimmortal Immortot12288.0 names nnn1CI13096.0 13788.0 slncoslncothon 14188.0 sincethen thonnull and11444.0 at11872.0 tho12140.0 12604.0 cndoftho13596.0 7379.0 contury13484.0 conturywo centurywe-596.0 14192.0 7636.0 wefiUll11316.0 ourselves ourRol0811692.0 12612.0 12880.0 thotrack trnok13120.0 13712.0 of13616.0 13948.0 tho13860.0 thorllUICS theanuses anuses rllUICSof11868.0 7763.0 lllllcnBos diseases12336.0 Thu13084.0 13716.0 germs 11111813612.0 111118tram -472.0 germsfrom 7979.0 from7956.0 12192.0 thoy12064.0 12648.0 spring 13260.0 7963.0 MO are13136.0 13508.0 knownRm 14136.0 knownand 11120.0 8119.0 Rm 11596.0 preventive provontlvo12540.0 medicine 12428.0 13356.0 awellunderstood 8140.0 14196.0 awollunllor wellunderstood 8335.0 wollunllor 12024.0 tood 12480.0 8clenco13384.0 lIthopho Ilydropho13044.0 lIthophoIIln Ilydrophobin-764.0 bin IIln11624.0 diphtheria dhlhthcrln11352.0 992.0 connumpUon connumptionnl1l1nl1l1other andother 8703.0 dire dlro11540.0 humln11904.0 12576.0 mnlllUcR miladies12500.0 show 13800.0 sl signsof 14032.0 nlJ nlJat 11128.0 8903.0 of924.0 capitulation capltulntlon11280.0 12492.0 whllo13024.0 Lilltorism Listorlsm13896.0 onl1 onaonl1bios onatiles bios tiles11532.0 9075.0 tho9096.0 surgeon surgoon11776.0 12476.0 12800.0 stuccoed succoell12716.0 opera ollOrnollOrnlIona 14160.0 operations 11140.0 9227.0 lIona tions11520.0 12208.0 wore woroformerly forU1oll13480.0 novor13360.0 14024.0 Ilt at13912.0 xmlns:ns8 ID10 3208 11148 9443 ns8:type 9443.0 tempted tomptedtemptedMuch 11768.0 Much 11812.0 of11732.0 tremendous tromondous12328.0 alleviation nthwlntlonnthwlntlonor alleviationof14220.0 11152.0 9827.0 of11404.0 12028.0 pain pnln11920.0 9799.0 Ind12840.0 thoattendant attunttant14044.0 13940.0 InerOl90 14180.0 increase 11160.0 crease erOl90tho10015.0 span BIII11112672.0 9983.0 of12888.0 lICo13204.0 hoo13140.0 110110nll dopond13568.0 110110nllClt doponded11164.0 Clt ed11428.0 11328.0 11888.0 tho11792.0 improvement ImllrOOmlntiii10151.0 tbo13919.0 min mlc13824.0 mlcl11itopo 14240.0 minroncopo l11itopo roncopohrouhl12512.0 nbollt13276.0 tboRtully stuly14096.0 14016.0 ofollth 14248.0 ofoptics ollth optics 11508.0 11820.0 Strangely 11628.0 11824.0 Strau -760.0 12584.0 enollth13656.0 last tult13580.0 14012.0 1m IncIncportent 14252.0 1mlnrtlnt 11172.0 portent lnrtlntproHro8911748.0 12552.0 10739.0 tn toshall tlhnllrotor roterrotercomo rotorcannon 10891.0 cannona12088.0 Inrgc12020.0 extent extout10907.0 trum 13040.0 13472.0 tho13856.0 same MmoMmoKUU samesource KUU source sourceThe 11452.0 ICO ICOTho 11272.0 11307.0 Tholarllol1t earlioatvictories tlctorlo913188.0 ofastronomy astronomastronomywero -836.0 14264.0 13436.0 astronomw 11188.0 11523.0 wero 11300.0 ro 11556.0 Ichllmt12292.0 13020.0 nny12956.0 Instrument InstrtunetttInstrumentJho InstrtunetttThu-852.0 14216.0 11192.0 11679.0 Jho Thuhorizon 11492.0 formed torU1C1t11647.0 tho13212.0 11636.0 13124.0 110Int quintofotn 14272.0 ofavailable 11200.0 available l1nblo reference rottronco11831.0 thon12832.0 13492.0 11847.0 camo13888.0 Inalrumonts 14228.0 11204.0 11996.0 utrlmontB alrumonts11980.0 tho13168.0 12012.0 totescoo teloscopo13048.0 14000.0 n11ltn11ltclork 14276.0 outclock clock clorknoxtthosoworo12636.0 12187.0 mlttCll13984.0 Tho13660.0 ThosteRmonlno 14284.0 Thesteamengino 11208.0 steRmonlno steamengino1116.0 12387.0 Itnprovomontu improvomontu13556.0 thothomanutacturo themanufacture 11216.0 manufacture manutacturo12340.0 of12204.0 12580.0 glass rlnAR13144.0 JOUoWOIt13016.0 nudnudIllmlllttod andDermittod 11224.0 Illmlllttod Dermittod12456.0 12755.0 construction conRtruction13600.0 of13432.0 12768.0 enol enor13748.0 enolD10U8 14256.0 enormoos 14232.0 11228.0 12920.0 moos D10U8telescopes tollscopoS12692.0 12939.0 olnntly Fluaily13328.0 13460.0 12971.0 12932.0 havo14052.0 tho13980.0 theoptical 14300.0 14056.0 thooptical 13116.0 optical studios stuetoH11752.0 13127.0 whicht12728.0 13440.0 havoro10terrOll 14260.0 roerred 11236.0 13284.0 terrOll 13375.0 erred 11880.0 cnrrloll cnrrfod12744.0 strict ntrlct13696.0 alliance attlancoattlancowltb 14303.0 alliancewith 11240.0 13527.0 wltbchemistry chlmlstr11572.0 13483.0 Celestial Colosllnl13752.0 objects obJoctsobJoctswblch -556.0 objectswhich 13667.0 wblch11804.0 thohum 12048.0 12472.0 13727.0 oye oyowm will13036.0 13528.0 novor 14068.0 13683.0 fWOfWOaro 14312.0 twoare 13851.0 aro11612.0 12032.0 13883.0 utlllllOl stnthind11916.0 12712.0 13879.0 13156.0 hundred 1uI1l1rol13056.0 13867.0 wraps WlSwrapsby WlSb 11252.0 11336.0 11576.0 means moanR14076.0 ofphotography lholoRraph13652.0 14035.0 anltthothohOIons theheavens 14267.0 heavens hOIons12004.0 hno14251.0 12364.0 expanded oxpnndmtturuo usuon usa 14400.0 a1032.0 14435.0 tllomut1lJtold 14440.0 thousand -1032.0 told 12180.0 12720.0 14432.0 ond12516.0 14412.0 ohel1118tryhilAhilAnot 14403.0 hasnot 14584.0 14644.0 14628.0 stopped atolJlled12264.0 14623.0 tbero12176.0 12868.0 14616.0 13252.0 14603.0 substances RllIRtnnocBofotwhich 14340.0 ofwhicht 11264.0 14780.0 14819.0 whicht11864.0 14816.0 tho11728.0 14800.0 12620.0 distant taut worlds worlltR14796.0 nronrocomposcd arecomposed 11284.0 14959.0 14972.0 composed composcdnro13012.0 14968.0 wo11within ellthon 13952.0 onr elltonrkon 14348.0 hon kon15331.0 15336.0 With Ntth12132.0 15340.0 hundreds hut1dr 12688.0 ll ofthounant19ofoffirm atnrm 15515.0 15524.0 firm nrm15527.0 facts tacts12120.0 15531.0 12272.0 12680.0 disposal diRPOsdwe13676.0 nowTntnh 14336.0 nowwatch 11268.0 15699.0 15712.0 watch Tntnhtho15704.0 gradual Krmlualformations torrooUonn12948.0 ofotworld8 ofworlds 15887.0 15896.0 world811892.0 atull 15892.0 hothcause cnUROnndofottoct offeet 16067.0 16087.0 feet toct16080.0 hence lIenco12380.0 16115.0 12568.0 new16076.0 111laofcORmlcRI coamlcnl13560.0 cORmlcRIovolutlon -672.0 14332.0 coamlcnlevolution 14328.0 16260.0 16264.0 ovolutlonnndhenooalRoIdol ideaof14084.0 otRnotl ofanother 16444.0 16451.0 Rnotl -392.0 16483.0 12000.0 16448.0 oolutlon13448.0 deals doaln13848.0 withtho withthe 16627.0 tho16632.0 graduat16636.0 formation formntlon12164.0 13088.0 of13004.0 thochemical chomloatchomloatRuhatancos chemicalsuhalancnn 16816.0 Ruhatancos suhalancnnof12108.0 12388.0 0111mirth oarthoarthnR mirthas16995.0 nR aswull astho12052.0 dlutant13068.0 17000.0 aro13576.0 built 13900.0 builtUIJ builttip tip UIJtipMI 17375.0 Att MItho11648.0 12536.0 13092.0 ofthomnny17404.0 np ap14040.0 nppllcatlonR appllcations 17560.0 pllcatlonR pllcationsoftho12664.0 12572.0 alltronomyHomu somoHomuot somoof 17744.0 17756.0 ofhavohoen12372.0 17779.0 soimproved Imllreollto13836.0 re10cont 14140.0 recent 17924.0 cent cont17967.0 oars 17931.0 12896.0 ship at16 knot knotsknotRpl10d knotsspend 18119.0 spend Rpl10ddetermine dotormlno12988.0 bor13324.0 IloAltion nnition 18147.0 1mile amile 18296.0 mile ortho13080.0 trackless trRcklcRRtrRcklcRRocelln tracklessocean ocean ocellnThonppltcntlonof13672.0 thonownstronomy nowastronomy nstronomyaro12080.0 yot12892.0 12788.0 sllolc seclc13644.0 thoythoywltl theywill wltl11632.0 come 19147.0 12324.0 UIturblne 111iturhIna19156.0 IIl1nrll RnnreRnnreIt 13588.0 IIl1nrllIt 19307.0 19319.0 19347.0 WIlR19316.0 11948.0 12436.0 attlio12928.0 Imprnnnivq Imprnnnivqpoint -848.0 14344.0 Impro -844.0 Rlv 13944.0 Rlvpoint 19496.0 19503.0 of19500.0 tho19507.0 grent1144.0 Shakespearian ShakeRIonrlnn19528.0 producllon 19532.0 production 19680.0 19691.0 ducllon duction19687.0 rboIludlonco audielcogazed gazeel13728.0 gazeelspellbound gazedspellbound 19868.0 19875.0 spellbound 19887.0 at19871.0 19903.0 maR massive lvo 13444.0 splendor sptendor14200.0 ofottho 20052.0 20063.0 tho20068.0 stage 20059.0 20056.0 drank drnnkeagerly oagcrlytho13988.0 thoImpa9 theimpassioned 20240.0 20247.0 Impa9 956.0 20243.0 impassioned lonoll eloquence eloquencooftho13796.0 famous tamoustamousoctal famousactor 20424.0 20443.0 octal actor11912.0 20431.0 Ills 20427.0 lIuhllo nubtlo12168.0 20436.0 touched 14268.0 20459.0 ar 14356.0 aresponsive 20608.0 20656.0 20615.0 responsive 11524.0 ponRlvo chord 20611.0 thohearts htJartaofhlRhlRhearer8 14352.0 hishearers 20792.0 20803.0 hearers hearer820799.0 Tho12528.0 20795.0 quiet intensity Intonslty12924.0 13844.0 ofthothoscone thescene 20976.0 21024.0 scone scene21019.0 cauBoI 20987.0 -468.0 21015.0 men21008.0 women womon13076.0 holll hubhollltholr hubtheir 21155.0 21176.0 tholr21171.0 breaths hreathsThoutallnoBs atillnoss21196.0 waHatalmORt atmost 21348.0 21371.0 mORt21355.0 tloatblIko 21360.0 doath Ilko 21383.0 WILR21380.0 triumph xmlns:ns9 ID11 6164 3096 11276 21535 ns9:type 21535.0 21555.0 ofillusion 21539.0 And 12908.0 thon21564.0 21567.0 rl nian niansnoreda 21719.0 21732.0 snoreda 21767.0 Il 21727.0 0redn 11344.0 12160.0 21723.0 Kontlu gontlopeaceful peacoful21755.0 snore IInorothntthntt01ll thattold 21888.0 21916.0 t01llof11568.0 retro 21907.0 refreshing blng slumber IIlumberTbo Cho13452.0 tonslon tonsion 22104.0 slon sion22127.0 WAS 11588.0 22095.0 broken 22088.0 People Ieoplolaughed lauKhed13296.0 bye hyshysterlcally byeterically 22267.0 22279.0 terlcally terically22311.0 an22275.0 tbey12280.0 13224.0 22272.0 whonsharply RharpyRharpyconlrastod sharplycontrasted 22456.0 contrasted conlrastod22459.0 emotions omotlons22491.0 nrobroulht13248.0 Rud nudRuddonly nudlonly 14296.0 22651.0 donly lonlynndunexpectedly uncxpoctodly12144.0 22640.0 pinyplayAgain pinyAKnin 22840.0 Again AKnin22831.0 11736.0 22824.0 aRaln22856.0 camolontlalontlaRnorc gentlesnore 23060.0 Rnorcfinally 12740.0 23040.0 drowned aru arustling ru rustling tllng 11984.0 of12220.0 23228.0 gowns 10nRnnd13152.0 13060.0 buzz ofcom coincommont coinmont mont 23419.0 11680.0 23380.0 people peoplo11944.0 turned turnorlThoThegroat Thogroat 23559.0 groat actor 12232.0 boasts hO1RtSthoecclm eccenecclmtrlclt eccentriclty 23743.0 23763.0 trlclt triclty11844.0 23759.0 of23752.0 conlus23747.0 knew something lIol1wthlnltlIol1wthlnlthnd somethinglend23923.0 lend hnd23936.0 haplJOned12820.0 23927.0 IA isdoubtful doubttulif13840.0 thothesnore 24111.0 SDoro24127.0 24115.0 penetrated pototratcd12076.0 24147.0 across ncrORSthotoot footfootlights 24320.0 lights IIKhts11956.0 24311.0 lie24304.0 halted paused pnuscd12732.0 24331.0 moment momont13592.0 momontanI momentanti 24479.0 24539.0 24504.0 24499.0 went 24487.0 13228.0 24515.0 notice noticeahlo noticeable 24663.0 24692.0 ahlo24679.0 coldness cohlneof12804.0 24703.0 manner Had Hnllheknown hehoknown 24879.0 24867.0 24860.0 12148.0 24855.0 mlchthnvo24876.0 rungdown rung rungdon 25035.0 25063.0 don down11832.0 25051.0 thocurtain curtl1ln12916.0 tot 13052.0 13072.0 25071.0 13100.0 doe Ines 14004.0 such luchsuchthingsPhlladelphin luchthlngsPhlllutolphln thlngsPhlllutolphln thingsPhlladelphinHocord ItoeordItoeorditn 25519.0 25524.0 11114411111 25531.0 itn -572.0 Inn 1111The 25679.0 25708.0 25695.0 manutrtllro manufeture25687.0 ofhells bollGhnR25683.0 ror25711.0 cencenturloo contunes 11308.0 25851.0 25879.0 tunes turloo11848.0 25876.0 1wun befni25859.0 carried carrlod13456.0 HUSRlu itissin25855.0 On Onnecount Onaccount 26039.0 26067.0 account necount26059.0 of26051.0 tlto26043.0 Immol1llo imnionno14208.0 oflitchurchcR 14360.0 ofchurches 26227.0 26248.0 churches churchcR26232.0 throughout thoctllillro emmipirothus tllJtllJdcmll11l1 thusdemand 26407.0 26432.0 demand dcmll11l126427.0 tor26416.0 bolls hallshan hl8ulw1I 26411.0 beonbeonKrent beengreat 26607.0 26643.0 Krent26627.0 As far26616.0 bllck13264.0 1f 13164.0 1663 53 26611.0 tho14019.0 cole tolecolebrated 14316.0 tolebratod 26783.0 26803.0 brated bratod26795.0 boll 26787.0 cattellTyar Iolokol Kolokol26816.0 Vas waswasmade 14364.0 Vasmndo 26967.0 26991.0 mndo26983.0 26979.0 12432.0 26975.0 tholargest Inrgostbell 26972.0 thothoworld theworld 27156.0 27175.0 27167.0 beln 11740.0 27163.0 27159.0 teotdiameter dillmoternnd27340.0 27372.0 11544.0 27363.0 teet27347.0 high blgb27343.0 loss lel8Iii tons ofatcopper 14372.0 ofcopper 14368.0 27527.0 copper 27563.0 woreusod 27531.0 manutacturexmlns:ns10 ID12 8072 14308 1352 ns10:type 14420.0 1352.0 1396.0 tHE 1384.0 MAN 14748.0 MANlIt 15224.0 15355.0 1372.0 WITH 15880.0 15780.0 16104.0 HAPPY 15972.0 16744.0 SMILE 16628.0 SMILEIii 1588.0 lIt Iii14652.0 trllll tried14528.0 15104.0 14984.0 15344.0 scatter 14tI1UCr15240.0 15664.0 emishiuo 15847.0 HllllllhiliO -632.0 16584.0 1708.0 111116588.0 16991.0 along 16880.0 alongflue 17392.0 16996.0 nlllI nlllII 17275.0 14736.0 14768.0 hi 14952.0 15048.0 14916.0 wayIle 15176.0 1Il 14456.0 Ile 14460.0 14756.0 Mlllluht 14576.0 sou 15232.0 15096.0 14979.0 15320.0 In15536.0 1111110 Iuulw15455.0 16012.0 Ihu15923.0 worhl16231.0 16804.0 16712.0 16964.0 butter botterbutterpines 17396.0 111111 111111III 14992.0 pines pinesIn 15108.0 In14568.0 lIIItI sphe15012.0 15160.0 1200.0 15248.0 2352.0 IIIMI1IIIWlnllllllIt4 dhnppohltalents16536.0 he16788.0 WJllt ivuut16696.0 17224.0 011 on17140.0 onfiont 17228.0 011fllIlII 1232.0 fllIlII fiont15171.0 dui 15080.0 15404.0 15512.0 15576.0 15652.0 15720.0 tiny 15644.0 tiny11Ith 15980.0 2620.0 11Ith 14764.0 14728.0 14940.0 14944.0 15020.0 15144.0 hlllll 14971.0 happy 15447.0 dWlf ch 15900.0 15884.0 15944.0 15939.0 15976.0 ery 15964.0 16320.0 16204.0 16732.0 UI1OI1 11101116615.0 17196.0 bill his17075.0 billIll 17408.0 histrace trace traceIIt 15052.0 14812.0 IlllIt IItklltllel kisved15163.0 the15068.0 15476.0 15388.0 15532.0 luh 15820.0 15776.0 children hllt1rn15928.0 16468.0 16868.0 ItrokolI strokod16776.0 ItrokolIIhllr strokodtheir 1300.0 14604.0 Ihllr15036.0 silllty 14956.0 15044.0 11111111 15472.0 15544.0 Burls 15380.0 BurlsI 15636.0 IIIlIl 15580.0 IIIlIlI 14556.0 fl 14516.0 14776.0 tlhll ttied14684.0 15208.0 U115424.0 fill15692.0 tlw15600.0 15996.0 3419.0 toilers tolldtl15912.0 16560.0 breast Ilftnlt16488.0 17088.0 withtIIItr withehwr tIIItr ehwrtIIItrIlo 15148.0 ehwrIle Ile11111114552.0 15088.0 JnIlIlIlU gaihuUryCur for16248.0 Indic IIllhlI16607.0 16856.0 h017152.0 hadhadsullies 14752.0 3908.0 sullies 141111111115292.0 for15568.0 111115500.0 15831.0 thl15744.0 gils 16056.0 gilsIIt 16220.0 hll4 14476.0 IIt 14608.0 14784.0 wins 15071.0 15152.0 trying tflnl15060.0 15680.0 4080.0 4044.0 bring 15812.0 II1III hlIIOn Ilenvun16196.0 16960.0 4048.0 11lnr 16872.0 nearer nearerhere 17364.0 r111fl here 111fl111flII 15076.0 herelie 14468.0 tried trltll14560.0 15092.0 to15284.0 Nlnlttr vcntter15228.0 15916.0 1IIIIIhllll suashino16691.0 he16548.0 16948.0 141111tht 141111thtIII soul 17283.0 ht htto 4696.0 to14852.0 4680.0 14760.0 14856.0 polite IlIIlhpoliteIle 15492.0 Ile14787.0 11111114712.0 15220.0 4848.0 lu to15124.0 15444.0 tullm fullnw15956.0 lilt tintthl16180.0 16556.0 goldeut 16484.0 lIlctln 17024.0 17116.0 rullrull1m ruletoo 17356.0 14392.0 too so15016.0 11111111114900.0 15584.0 jot nuttll to15804.0 16152.0 1IIIIIkllll thiukiug16048.0 Ihnt16772.0 hu 17172.0 huwasnt 17444.0 17280.0 14908.0 1114111 15252.0 hnlllIcllll bulnuctidrhht15992.0 rhhtlll 16415.0 rightThey They 14624.0 lll voted ohlI15428.0 Itiu115760.0 15688.0 15788.0 nulNllllcO nulsnucu15828.0 5268.0 nod IIntl16968.0 16888.0 17136.0 roo 17040.0 roohhIIUo 17348.0 foul foulhienko 1600.0 15655.0 5440.0 hhIIUo hienko1040.0 16215.0 IhlllHllerlhl rimes10ruidrimes10ruidHUMOROUS -1040.0 17256.0 16244.0 IhlllHllerlhlHUMOROUS -1012.0 15460.0 HUMOROUS HUMOROUSProtclIsorWlmt 16352.0 HUMOROUSProfessor1Vhat ProtclIsorWlmt Professor1Vhat15988.0 khllt16432.0 of16323.0 16683.0 Iron 16580.0 17091.0 hills husl16988.0 huslneRS hillsness 14395.0 6315.0 neRS14804.0 is14716.0 your 14924.0 15452.0 father tnthor16004.0 16140.0 16356.0 Ir 16620.0 Freshman roshmanFreshmanfreahnanVhyer roshmanIreshnllLnWhycr 6464.0 1668.0 IreshnllLnWhycr freahnanVhyer16212.0 16060.0 think thlll1t16875.0 17212.0 11lJ4 nue17108.0 11lJ4tallle 17480.0 nuetalllc tallle talllc15276.0 sir sirWhnt sirWhat What Whnt15168.0 U1ukl1 uuukes15084.0 15739.0 15836.0 OU 16008.0 16100.0 6871.0 16604.0 hue16515.0 16860.0 line hnlhll Intl17120.0 Intlhis 17483.0 hllhis 7039.0 7084.0 14720.0 salary siliury15392.0 rnIBml raisodIlsltCII15839.0 16824.0 Cheerful CheortulCheortulMUK CheerfulMug 7236.0 Mug MUKllul Hes15416.0 7271.0 talcn15348.0 Ul1 up16160.0 gulf toU16652.0 rellllciltho 16452.0 rellllcilthoWfllo -840.0 17492.0 replied 17248.0 17180.0 theWise 17496.0 7471.0 Wise Wfllo14879.0 Guy 1000.0 convincingly cOI1lnclnKlycOI1lnclnKlyTommyltlll -1000.0 convincinglyTommyPop 7708.0 Tommyltlll TommyPopwhllt15620.0 16348.0 7687.0 16164.0 16568.0 16599.0 fatalist tntntatfatalistrommys 17428.0 rromma 14436.0 7908.0 romma rommys7896.0 loA lopA15116.0 7880.0 fntnllRt15808.0 7900.0 16952.0 son non17372.0 ina 14408.0 8135.0 8124.0 mun8087.0 knows kl10ws15271.0 15888.0 8080.0 lies hOH8071.0 16188.0 8076.0 17252.0 lho17188.0 thoworat lhovonlt worat vonlt14912.0 of14840.0 15140.0 15063.0 15360.0 11n11doetJllt desut16336.0 care cnrccnrcWhich careWhich Which 15312.0 15560.0 thopond hOlll115796.0 16496.0 barber ll1uhlr17304.0 16999.0 Inquired 17504.0 17308.0 InQulrell 17451.0 Qulrell quiredcustomer cllutomorWero IVoro16023.0 111fiend I1mlt17044.0 I1mltharbera fiendbarbers 14428.0 8864.0 barbers harberafllllIctt repliedtho16307.0 artist 16176.0 17083.0 Whlt16724.0 Whltdh1 17516.0 Whatlilt 17512.0 dh114772.0 9119.0 SUIIIOtiu suppose15860.0 we15752.0 16168.0 werccorn werecorndoc I10cI10ctors 17448.0 doctors tors 14732.0 xmlns:ns11 ID13 12028 4708 14452 9475 ns11:type 14600.0 9475.0 1228.0 Ynungtvlt0lIY lInKwlttt 16200.0 16052.0 16304.0 dear 16384.0 thohnnlt banlc17028.0 hnnltIn banlcin 14452.0 9672.0 14704.0 14587.0 15260.0 9735.0 nay15596.0 money monoy15496.0 16207.0 In16428.0 lIopOllltCiI doponitcd17264.0 h111h111broleen 17524.0 hasbrolcon broleen brolcon15280.0 Mrs Td 15564.0 15400.0 15824.0 Yuul1 1420.0 Youngwlhr1Vhat 16332.0 wlrl -912.0 17244.0 hlt 17440.0 9891.0 aamercy 17532.0 11morc 14464.0 morc 10123.0 mercy 15040.0 yonvo 15132.0 15468.0 15308.0 15647.0 Hut got10107.0 uur check eheckbuolc 16907.0 boule 17272.0 17380.0 ittnthomo 17536.0 itthontn 10291.0 hontntWt lve14876.0 tWtJho 15100.0 lveThe 14620.0 10491.0 10523.0 Jho15008.0 0111rrl11l111s friendn15592.0 16288.0 matt 1111116640.0 met nuet17004.0 Ittrr16936.0 a-96.0 17548.0 17456.0 nlong 14480.0 10680.0 10732.0 tlnw15876.0 16223.0 16296.0 IInIlKhtt1r ulnughter17236.0 said Imhl16983.0 Imhlntll saidlni 10932.0 ntll lnihitstun Hhoharried mnrrllHl15436.0 16131.0 retllietithe 16796.0 lclltUtl retllieti17540.0 lclltUtltho 17543.0 14484.0 tho14836.0 11091.0 olhllr14724.0 15700.0 hlo111101 nevor11063.0 felt toltthlt16956.0 Icuulll Icould cuulll couldafford IIrrurll14888.0 15528.0 a15440.0 15624.0 15708.0 80nlnlllw 15960.0 80nlnlllwBluhhsItK 16528.0 16272.0 hlw 16184.0 hlw111abbs 16532.0 932.0 BluhhsItK 111abbs -932.0 lts 15676.0 unl11539.0 11495.0 lwlIlIol gtlentlnnof16899.0 thnotlmotlOrorll 17564.0 19044.0 tbefore 14500.0 tlOrorllIlllimllOlIIll1t -1036.0 16084.0 15316.0 Impotuunt 15236.0 16156.0 dlcUJ1onIH tttlcu1111011tatwill wl1116972.0 17328.0 Inrll irecorded 11863.0 11939.0 rll recorded 14687.0 14740.0 urlht 15263.0 15112.0 phOlliIIIIlhR ptlonoipnphs16916.0 Siollhl Slobba16612.0 SiollhlOwnt 17412.0 Slobbaboat 14508.0 boat Ownt15032.0 12111.0 Scott 14936.0 Thou JhtJl1w11ltll whnta16768.0 16672.0 become hccomuhccomuot becomeof14512.0 ofthohandwriting Itnl1dwrltlllOXIIIJIt uxpurt16036.0 OXIIIJItA uxpurtA12511.0 teacher leacher12504.0 hind 1111tolll tutua16423.0 clllna clans16340.0 of16783.0 juvon juvunjuvunIle 14520.0 12695.0 12723.0 Ile14820.0 111111119 14700.0 pit plIs Umt15816.0 Dutton MIHantbo16820.0 poet 16704.0 lutJt 17132.0 17291.0 wnsblind 17296.0 Wntl wns17580.0 Wntlhllnd blind hllndFlue rho14904.0 12895.0 nUlt noxt15412.0 12879.0 Ilay11110Iwltull muiketl16552.0 If17048.0 unyanyof 17596.0 17312.0 unyat of14744.0 tbomcoulll could15120.0 15684.0 13067.0 remember rememher15604.0 wlmt16975.0 13047.0 Mltton MiltonsMlttonKroat 17600.0 Miltonsgroat 17472.0 Kroat groataffliction ntnlctlon14932.0 13311.0 wits Wl815696.0 13267.0 Ycam Yoamroplhd16840.0 roplhdone 13247.0 repliedone 14532.0 13447.0 13511.0 lIttto little15376.0 13467.0 15639.0 15616.0 16172.0 13463.0 He15844.0 VM wan13479.0 POOL llOotllOotAngeJlnlllhut 13624.0 Angelina 1244.0 AngeJlnlllhut -868.0 13679.0 WIUI wiu16344.0 16376.0 16512.0 16380.0 16740.0 13648.0 lovely lovoty17340.0 ene eneagcmont ongagenwnt 19095.0 j 1580.0 14540.0 13832.0 agcmont gagenwntrinK ring15756.0 13895.0 gave 1110tllo16812.0 Inst17164.0 nightdoar nightdear 14548.0 doar14067.0 15332.0 dethOBO thoso16716.0 Inlllnio initials17459.0 17259.0 17464.0 E EC 14219.0 14860.0 mean tho15516.0 trickle naldorEllwlnWhy CdwiiWhy16364.0 EllwlnWhyerthllt -1020.0 17628.0 CdwiiWhyorthat 14416.0 14451.0 erthllt orthat15420.0 14444.0 Isdont Imowrhatu Thatu17175.0 rhatutho 17636.0 19119.0 rthe 19160.0 14607.0 thoYOY15255.0 14639.0 of16123.0 14619.0 utnmlJlng utamping16980.0 eighteen eighteencarnla eighteencarats 1292.0 caratsthin 14572.0 carats carnla15039.0 15067.0 blo 16883.0 15055.0 15384.0 15143.0 nnu 15968.0 ltF Jet 16300.0 15147.0 wOf wOftho 15283.0 thofir 15296.0 15324.0 15288.0 tlmonnd15327.0 on16360.0 16807.0 15299.0 return retutnhor17300.0 hergrandma 17664.0 horgrnndmn 15480.0 grandma grnndmn15483.0 alkod15488.0 hor16240.0 16144.0 oho alto17012.0 liked IIkod16912.0 17383.0 ItI 17604.0 itI 15671.0 didnt 14868.0 IIltotho15800.0 argon organ16668.0 VolI17104.0 wellwan VolIVU 14564.0 15864.0 VU reply 15871.0 16396.0 15883.0 netaskOlItho17320.0 thinold 17659.0 thoold 16051.0 lady 14792.0 16064.0 Cnllso CuluuoDI1BWerlJlI anewereil17167.0 Ediththere 17052.0 Edith Ediththoro thorowusnt wasntmonkey moukey17240.0 16508.0 RlIIPOIIU stlppcaloSIIIII said16284.0 tho16148.0 visitor 16524.0 Ils ItllIlsIl1to 17651.0 Itlllike Il1to14920.0 pulling plIlIIn16680.0 tooth tonth15463.0 16692.0 to16192.0 lot gotmouey16760.0 outot outof of16896.0 14928.0 husband huublIld16876.0 these days dnya17359.0 00chipped Ochlppoll 17071.0 chipped chlppoll17076.0 17080.0 IIttluloII11U Tontuy 16596.0 botorohlH17324.0 hlHmuther 17643.0 lifemother 17243.0 mother muthercuullUIH speak llk mu inndont hnohnonl1 17648.0 haveany 17452.0 nl1 14964.0 trollblo troublu17455.0 Ilullln pullingteeth tootb16940.0 Rho16688.0 17344.0 jUlitjUlittulws justtalcus tulws talcus17655.0 cat 011117632.0 15300.0 nnd15628.0 puts Imtllom ant16764.0 17668.0 aulaHIIglassill 17508.0 17124.0 ulaHIIJlII1IIlal 18023.0 JlII1IIlal 18032.0 ill tutcl Inllllli SniUnhl18036.0 trout frcunHI1I NandiHI1IPorlmlltl NandiPerhaps 18223.0 Perhaps Porlmlltl18236.0 moutInlcrelltlny16112.0 17096.0 expert oXferloXferlcnco expertonce 18423.0 18464.0 once cnco14976.0 18432.0 ofmusical sods HaDlls15792.0 18427.0 rocurdull rucordud16891.0 rocurdullhy rucordudby17640.0 18595.0 18599.0 by14824.0 1lngluko Kluglaku15852.0 hits hlHJourney Journoy18627.0 ncrOHR16752.0 tllUtllUdescrt 17656.0 thedesert 18779.0 18783.0 desert descrtIto18811.0 Bays sl1ytl15484.0 As16520.0 18788.0 droolloll droopodmyIlend myhead 18963.0 18967.0 head Ilendundortho18992.0 nuns HunRlire Uro16540.0 Inl closed clouml17416.0 18995.0 myeyes 19183.0 eyes 14960.0 aKllnHt15608.0 19151.0 tho15520.0 glare Kll1re16388.0 tbatsurrounded surroundedme 19328.0 19372.0 010 me19335.0 14779.0 slowly loft toHuloeptor asleepfor19332.0 19363.0 mnny17148.0 mnnymlnutell manyminutes 19516.0 19519.0 mlnutell19551.0 19523.0 moments mOlnolltR16399.0 16920.0 butacter butafter 19700.0 19712.0 acter19739.0 awhllo15632.0 19703.0 15555.0 19728.0 Wlvt15672.0 1252.0 IJOlltlYl1wukellol 16028.0 gently -1252.0 awakened bya 19879.0 19932.0 19928.0 19884.0 peal Ileul14640.0 19891.0 of15024.0 church butillmy hullomynative natlvobotltlbollsthe botltltho 20075.0 tho20071.0 Innocent botiR15764.0 ofMarion Marlon17332.0 thnt17160.0 thntnoor thatnever 20287.0 noor20256.0 betore15668.0 20263.0 Mont sent20252.0 16564.0 music Inuslcboyonll17008.0 boyonlltho beyondthe tho14884.0 Ull1gllon Iilagdon14808.0 blllo hills20440.0 My 16404.0 I1r 16656.0 16707.0 nutur nuturntly nuturally 20624.0 ally ntlywas20620.0 15268.0 utiliremained fast flUllflUllunder fastunder 20811.0 tho20836.0 15328.0 15948.0 ofroused rousCllrousCllmyselt rousedmyself 20983.0 20992.0 myself myseltonddrew drowaside 11Bllletho16472.0 silk 17336.0 Hunt thnlthnlcoverod Huntcovered 21164.0 21180.0 covered coverod15244.0 21203.0 21208.0 21199.0 21167.0 plunged pllmgedbarn bnrobnrofllco barnfitce 21367.0 fllco fitceinto Intttho15728.0 21351.0 IIXhtThonatleast xmlns:ns12 ID14 8232 4528 14540 21527 ns12:type 21527.0 21576.0 wuswollnolth nough16044.0 uwakenellhut but16799.0 RtllIRtllIth080 stillthose 14580.0 21711.0 th08021716.0 Murlen Marlonholls21748.0 ruing rtngnotrlnRln notringing ringing rlnRlntorjoy properly llrovurlyprosily 111081116924.0 1110811Rteadlly 17592.0 prosilysteadily steadily Rteadllymerrll merrily rlllgln ringingCor17072.0 churchArter churchAfter 22259.0 22283.0 Arter22307.0 thu16136.0 sound died dlodawayHlowly awayslowly slowlyKinglako Hlowly15056.0 22644.0 lngll1ko Kinglako15432.0 ball hindUIIUIIvictim thevictim 22807.0 victim of22847.0 ahallucination 15539.0 IsvrolJable isprobable 14544.0 22987.0 22999.0 probable vrolJable22996.0 thnt15716.0 22991.0 hoard hOllrdactual IlCtualmUlllcal musicalmUlllcalflound8 musicalsounds 23171.0 23183.0 sounds flound8either oltherIssuing trom16315.0 rock rucksrockheneath rucksbeneath 23355.0 23364.0 beneath heneathsnnd nnntl15504.0 cauRedthothotrlctlon thefriction 23536.0 23547.0 friction trlctlonof23543.0 thoparticles pnrtlcle23539.0 ofsand RRnd23571.0 overwhich 23731.0 23727.0 tho15004.0 travelers trnvelerswalking 17316.0 111In 23755.0 tut tutin 23915.0 tho23939.0 cane CIUIO23911.0 ofD acurious mountain 16720.0 mountainwhich -744.0 24092.0 15747.0 vlHItOilln visited Guiana Oulannhicalled IIclllled 24279.0 clllled called15660.0 natives natlvcREl1104.0 Uramadoror IlramadororUramadorortho Ilramadororthe-1104.0 thoIJeliowerlJecll1l8o Iiehlowerbecnusoof24460.0 ROllndROllndfhcn soundgiven 24635.0 given fhcnforth torthwhontho80ml16372.0 covering covorlngcovorlngIt coveringit-676.0 24816.0 24835.0 is14668.0 put inmotlonCbambcru niotlonClrnmbernJour Journal Jourwhnn nal 15128.0 25347.0 25359.0 whnn 111m 1IIIIIan linlln25352.0 l1M A1ty fate fateAn flt fltAn 25552.0 An 25555.0 rullnnmnyvat vote 25584.0 OR as17467.0 25591.0 nJ asnJhe aslie 25735.0 liere1l1111n8 renntns25771.0 member memhorof16728.0 tribe 25747.0 butif butIt ifhe25927.0 gives hfK liP raphili16072.0 tribal trlhalrelations rclatlonll17351.0 nnllnnll1amlH andhecarnos 26103.0 26127.0 1amlH hecarnos26143.0 acltlumho16780.0 otu undertho underthe tho26331.0 Hllmocondltlon contlillons26324.0 I1S as26295.0 othorcltl cltlun cltlton 14632.0 26807.0 26827.0 1893 26811.0 California CaUtornlashipped 26823.0 17288.0 Eng 17183.0 EngIlInll England 26995.0 27011.0 IlInllDli817 0681727032.0 cases CI1SeH16039.0 26999.0 of27003.0 canned 16928.0 fruits trults16832.0 17488.0 27183.0 1899 27188.0 numborof27215.0 canon clUlesworo17099.0 27195.0 659303 669303659303nn 669303an27367.0 an27375.0 Increllsoof27399.0 OVQr600 percent porcentIItIvcn lasevon ItIvcn sevonyel1rs28271.0 19032.0 28339.0 rr rrR 18979.0 28907.0 18443.0 29111.0 17824.0 29220.0 29475.0 29668.0 29675.0 R


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\spin01.iarchives.com\scan1\jobq\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01343\ocr\0409b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:27004
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1759
splitwords:0
ScansoftOCREngine Character Count:19350
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:23968
Abbyy6OCREngine Character Count:21570
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;21570;3794;44.0019;88.8929
language:en
ScansoftOCREngine Predicted Accuracy:58.24%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:7651
ScansoftOCREngine Character Error Ratio:0.4953
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;23968;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:88.89%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:88.89%
ImgPrep Component Range:26253,27004
version:Newpah v2.32 RoundBox
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;19350;9584;0.716796;58.2396
noPunctuation:1
ImgPrep Component Count Low Estimate:26253
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.32Styles TextStyle ID4 FONTSIZE 10.0 ID5 27.0 ID6 24.0 ID7 11.0 ID8 7.0 ID9 9.0 ID11 12.0 ID12 17.0 ID13 14.0 ID14 26.0 ID15 8.0 ID17 30.0 ID18 18.0 ID19 15.0 ID20 13.0 Layout Page ID1 HEIGHT 30396 WIDTH 19400 PHYSICAL_IMG_NR 3 PRINTED_IMG_NR [3] PROCESSING PrintSpace 29647.0 18952.0 HPOS 116.0 VPOS 392.0 PC 0.8889 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1196 5676 6816 392 ns1:type simple language en TextLine 880.0 1880.0 8384.0 String 488.0 532.0 540.0 CONTENT 1 WC 0.8095238 384.0 9880.0 7i SP 964.0 8916.0 344.0 164.0 12328.0 876.0 r ri -164.0 12492.0 2992.0 6816.0 1424.0 140.0 44.0 1448.0 i 88.0 80.0 8288.0 ti 1428.0 6860.0 76.0 52.0 9756.0 1512.0 Y 1388.0 8368.0 xmlns:ns2 ID3 27992 4476 116 1720 ns2:type 556.0 1636.0 2772.0 1720.0 516.0 mii STYLEREFS 1632.0 2776.0 1892.0 Tolksfbollt -512.0 3288.0 TolksfbolltQJlL -1632.0 4408.0 324.0 464.0 3764.0 1944.0 bozi -644.0 bozit1 -464.0 4228.0 492.0 2376.0 2272.0 328.0 640.0 t1 608.0 2784.0 2372.0 QJlL -232.0 3016.0 QJlLA -608.0 3392.0 336.0 1156.0 2940.0 mankin 0.82539684 -452.0 mankinA -1156.0 4096.0 200.0 216.0 3112.0 2388.0 1C -984.0 304.0 572.0 3428.0 2300.0 Il1I 100.0 3328.0 Il1IA -572.0 4000.0 1392.0 2256.0 3004.0 108.0 3008.0 A 588.0 2444.0 Ioimlnr ALTERNATIVE 1tollnr1npnlnr2364.0 104.0 548.0 3100.0 3011.0 ItautnuUnity 68.0 3032.0 112.0 3104.0 YVaninu Itautnu-544.0 3648.0 YVaninuMnny -540.0 3644.0 84.0 380.0 3264.0 olllnll -380.0 olllnllJnl1 160.0 2944.0 1568.0 3208.0 156.0 444.0 3212.0 Unity 0.95238096 Mnny128.0 248.0 1660.0 3216.0 Jnl1 -352.0 2012.0 132.0 756.0 2096.0 anecdotes tlllll1ullil11ucdulrP188.0 1908.0 2936.0 of 0.96825397 or2852.0 232.0 3176.0 the till3092.0 136.0 792.0 3488.0 kindliness kildlhtess3408.0 kildlhtessilic -792.0 4280.0 788.0 3492.0 kindliness1ho -788.0 32.0 3596.0 111I11InC 72.0 3524.0 152.0 4360.0 276.0 4084.0 of1ho -152.0 4512.0 1400.0 3400.0 272.0 1ho ilic692.0 1764.0 3404.0 Impress KmproBSI1II1Hll4f92.0 1672.0 2548.0 or2456.0 712.0 2804.0 Germany Cccuutny96.0 2708.0 600.0 2808.0 nlImnll -708.0 3516.0 252.0 3608.0 3440.0 are rultire416.0 3968.0 llmlliitliulr 3860.0 tludltliulr -416.0 4384.0 432.0 3972.0 llmllii 111II1Intludl-332.0 4304.0 111II1Intholr -432.0 4404.0 3036.0 1416.0 3592.0 tliulr tholr1884.0 3624.0 way 1800.0 wn -328.0 2212.0 292.0 2304.0 Into lutolulo204.0 2100.0 228.0 2688.0 tin tilltllu2596.0 468.0 3600.0 public ll11hllc2916.0 456.0 3552.0 prlntn 11lntoprintn3472.0 120.0 3604.0 S 220.0 4008.0 Stuns -92.0 4320.0 4232.0 SI -88.0 SIwas -136.0 4368.0 Shl ShlWIIS -220.0 4452.0 168.0 3088.0 1412.0 3784.0 320.0 3816.0 was WIIStuns1796.0 riding rldh11r64.0 1732.0 364.0 I1c1ln -468.0 2264.0 352.0 2328.0 3788.0 with wltlt2160.0 2476.0 I -204.0 2680.0 Ii 2508.0 2736.0 3820.0 a u56.0 36.0 2788.0 t -32.0 2820.0 2896.0 3792.0 couplo 101110vogAU2824.0 148.0 3456.0 3800.0 3384.0 3832.0 o -148.0 832.0 3668.0 attoiulnn nttl11l1nnlnttrudat144.0 688.0 attoiulnnThrough -832.0 4500.0 nttl11l1nnlnThlOlJh -688.0 4356.0 596.0 3712.0 ttrudatthrough 3064.0 3980.0 628.0 Through ThlOlJh236.0 2164.0 tho the124.0 2040.0 2516.0 village vtlingr2400.0 2620.0 lIIn -412.0 2960.0 4024.0 2848.0 3152.0 3992.0 lIr2996.0 568.0 3416.0 3984.0 Domini nOlnlUlIloruhu3304.0 4164.0 4012.0 no tit180.0 norotsdam -168.0 4332.0 312.0 UlI1 UlI1Iotsdnlll -312.0 4476.0 tit1otsdunl 4172.0 680.0 rotsdam Iotsdnlll1otsdunl2232.0 recently IClCntlriecenly2984.0 4180.0 and nnl12860.0 504.0 3348.0 passed IlnSl11pfH511I3256.0 240.0 3940.0 4176.0 tliotho3852.0 4264.0 4203.0 vInge 4268.0 v -60.0 4328.0 -76.0 4344.0 4364.0 11 20.0 11InJl -84.0 4448.0 3084.0 4363.0 Inge InJl472.0 1816.0 school 1736.0 924.0 athllolhn1fI Hchoollolusts-472.0 2288.0 424.0 2316.0 house -424.0 2740.0 2964.0 4372.0 tp lp1t224.0 4392.0 at 3180.0 4376.0 Ihetime684.0 wlndov wlIlowl41v1idot3732.0 wlndovvtut -684.0 wlIlowl4WNll 512.0 1v1idotvmt 1468.0 4556.0 340.0 4588.0 vtut WNllvmt1948.0 iho dll1808.0 176.0 2008.0 it -172.0 2180.0 852.0 4572.0 youngslcrs yuuugPlcrs2184.0 2404.0 4592.0 OIlU1 -748.0 2812.0 lhI 2724.0 388.0 4568.0 faces fllcu288.0 3040.0 3844.0 4560.0 ntHlnurl3716.0 tl 4120.0 tlTclioolmaMcr -96.0 212.0 thl thlrClI001UlII -212.0 40.0 trchoohnuster -40.0 3044.0 4748.0 1056.0 TclioolmaMcr rchoohnuster708.0 rClI001UlII -1032.0 2448.0 4768.0 tlr 2124.0 2536.0 4756.0 opened oencd4784.0 01 -532.0 3068.0 2684.0 4788.0 II 16.0 2668.0 208.0 1Il1 48.0 2760.0 Il83376.0 window whutlwivhulo3896.0 4792.0 -80.0 3976.0 4752.0 wld nkwldHor -272.0 nkSier 196.0 4240.0 llll 4316.0 lllllIIH -196.0 4436.0 4944.0 316.0 Hor lIIHSier632.0 1832.0 4948.0 Majesty Jittjesy1924.0 4952.0 2464.0 1992.0 njcs 1976.0 2576.0 rode Iotll280.0 2296.0 192.0 4980.0 up UII3312.0 111111448.0 3696.0 asked staked3588.0 3876.0 lal -268.0 4144.0 4256.0 172.0 tltoucher -112.0 4956.0 ttcnchet 4336.0 4260.0 thollnllIlH -240.0 4.0 5068.0 3024.0 5136.0 toucher llnllIlHtcnchet408.0 5140.0 wltat whlllwhat1996.0 tie thoIho560.0 5144.0 subject IIIjerattbjeec3636.0 5148.0 3908.0 instni ltlstlUC11ishr452.0 instni1loii ltlstlUC1lon 428.0 11ishrtlott 1396.0 5328.0 1loii 1lontlott296.0 1788.0 5356.0 wan wnH1708.0 5360.0 WII -296.0 2084.0 2292.0 5336.0 Hlnin llenrlu-536.0 2832.0 oaring 2348.0 5332.0 that thllt2932.0 3396.0 It 3308.0 3568.0 5368.0 WRwas3504.0 3948.0 histor hlsh11lhlsto3872.0 historial -492.0 4440.0 hlstocal -448.0 4396.0 3072.0 5520.0 cal ial111284.0 1740.0 5523.0 81111640.0 1744.0 5552.0 fUll -280.0 2024.0 1984.0 1964.0 2128.0 thnt2020.0 1t2452.0 544.0 5528.0 treated troatodhlnhll2656.0 5536.0 3664.0 thotieperlcof 3912.0 4016.0 peril perlcIHllcd-376.0 IHllcdnr 4488.0 perilof 5712.0 5715.0 nr476.0 1668.0 Quern QuooiiQUlnLouise rolltio2144.0 2864.0 5720.0 tilt thothl2768.0 376.0 3204.0 Jooil HOlIIood3736.0 the3580.0 4080.0 Kal IntlKalorin -276.0 5724.0 264.0 Intltein -52.0 4132.0 nlrl -116.0 nlrl1ln -216.0 4444.0 3076.0 5904.0 orin tein1500.0 1ln -208.0 440.0 1820.0 5907.0 nflleltnslccdlhlIlse2260.0 5924.0 master mnflll1mnster2604.0 3340.0 to 3240.0 5948.0 go 3480.0 3676.0 5952.0 0 3752.0 3856.0 5944.0 on ou4140.0 wit 4032.0 wittho -236.0 348.0 withthe -348.0 5936.0 tvi tvithe -180.0 6096.0 tho460.0 6100.0 lesson Ilfosuu1652.0 2396.0 whllo whltutvhllu2248.0 2956.0 6104.0 she Rhesilollsloncd lIs1nlllllsiencd184.0 4212.0 Sh 3936.0 Shwas -184.0 Slw SlwWilli Si Sitins -132.0 3080.0 1408.0 6296.0 300.0 6320.0 Willitins6304.0 flfor496.0 2064.0 6324.0 course course11988.0 2068.0 6332.0 co 2560.0 2240.0 msl 2220.0 528.0 obeyed 2528.0 Ohl -528.0 CI1 3336.0 6300.0 nnl1nodfor 6328.0 aver ovor0113920.0 ovorquarto1 -340.0 averqumter 4400.0 aeIUI1ll 1404.0 6488.0 580.0 6496.0 quarto1 eIUI1llqumter2108.0 6492.0 or6524.0 nn an2696.0 hour 2568.0 3168.0 her 111ier624.0 3540.0 1tTijesly3420.0 3628.0 lbjcsl 4288.0 6520.0 n 4052.0 ninalnid 4380.0 10 10UlIII1I1II 60.0 rumlutU 4348.0 1824.0 6680.0 inalnid UlIII1I1IIumlutU2060.0 6692.0 nt1968.0 tho6688.0 2544.0 Ill 28.0 2336.0 612.0 2624.0 whulair2500.0 windowSo whulairSo-612.0 3236.0 2884.0 1544.0 6872.0 So 564.0 pleased plllIlill1724.0 2484.0 6907.0 2488.0 6904.0 WHS-100.0 2588.0 as 2880.0 6875.0 sho she3228.0 wHit11Ith3128.0 thoth 3904.0 3988.0 6880.0 Juveti jmln420.0 Juvetillos1 -440.0 4428.0 jmlnHlR -420.0 Jtivi Jtivities -304.0 4292.0 3028.0 7060.0 ties llos1HlR644.0 7096.0 answers III1WlINtutslvrrs1700.0 7067.0 tliatthnt260.0 2976.0 7064.0 site shoeho2876.0 told tolltthem Ullmtltrnt4224.0 7072.0 shwould 4124.0 sh HIliHIliwoulll 4432.0 4312.0 l -120.0 lwould 7256.0 would woulll372.0 7259.0 treat Itrnt1868.0 Hlmtitannil all2924.0 7272.0 3704.0 7264.0 cake law3556.0 7300.0 c iko 3768.0 4192.0 7296.0 an nnanchocolate nl1l1 nl1l1lIII1Iolntl 4472.0 nnhnnl8tr 7444.0 724.0 chocolate lIII1Iolntlhnnl8tr2208.0 7476.0 very 2120.0 cl -244.0 2628.0 7484.0 soon toonsoot2424.0 3052.0 7452.0 nittl nntl1111l110I1u 3324.0 3412.0 rodo fndn3740.0 7456.0 off elf268.0 4092.0 nullthe null ami-264.0 amitho nUl leI leItho 7640.0 thecheers chccrM1644.0 7644.0 2204.0 244.0 the2436.0 844.0 7652.0 youngsters 2744.0 2908.0 7668.0 olm -744.0 3652.0 3292.0 EotlI 3616.0 7680.0 3848.0 flit Thojlw4220.0 7648.0 fo to4152.0 folowing -156.0 tolo1ing Col Col10ln 4420.0 7828.0 524.0 lowing lo1ing10ln -524.0 1920.0 7836.0 flay dny7864.0 In -288.0 7832.0 the1008.0 2732.0 Rchoolmaster RlhoollllnHhrschoolmaster2632.0 3840.0 receive rccehellreceiven rccehella-632.0 8024.0 8056.0 a332.0 1580.0 8032.0 note UOtl1480.0 from tlOIlliron1912.0 256.0 2480.0 8028.0 hl1Item620.0 2836.0 Mnjesty2920.0 rnJeRt 508.0 saying riyhig3352.0 3632.0 8064.0 -428.0 4060.0 3824.0 hl 4160.0 tha thntthr3956.0 thatho -316.0 thntthe thrthe 8212.0 8216.0 tho592.0 1772.0 rornlin 110rllhnPornlut1508.0 2592.0 lichoollhlhlrcnWO schoolchildren1001104.0 schoolchildren -1504.0 4100.0 8224.0 100 3700.0 li 4104.0 linumber i1iUmherhere -36.0 8407.0 number 8436.0 -596.0 1124.0 1iUmherhere 1432.0 1600.0 -916.0 520.0 1748.0 IIIlw 1676.0 8439.0 wore -124.0 2268.0 141 -144.0 2648.0 8419.0 lip hlJe2796.0 8412.0 regaled 11JnlelregniedIIIillhe isheinvitation hCr hCrInUnilon -248.0 isInvitoIion 3020.0 8599.0 748.0 invitation InUnilonInvitoIion8611.0 lent tiiattilnt752.0 2660.0 8604.0 nfternoon nfteinooo704.0 2712.0 8631.0 1Inoon -700.0 360.0 3528.0 upon UIIOI1clotInto 3888.0 3996.0 chow lholIclotchowlato 4416.0 lholIInh 8791.0 latoInh1780.0 1vit111680.0 8820.0 croam crontn2132.0 11011 -372.0 2700.0 8796.0 nUll3192.0 ealce3272.0 nll 8804.0 nt at3512.0 8800.0 ilte3780.0 vil villago -188.0 vi viInge -128.0 tInJe 3048.0 1384.0 8983.0 lago InJeIngeinn 2280.0 That ihlt2324.0 lhn 2608.0 8992.0 2580.0 there thlIe3248.0 9015.0 wns3144.0 WI 3640.0 8988.0 joy in 3884.0 8996.0 tilltlltinvillage -200.0 tilllIInll1 tll191ingo 9175.0 lIInll1191ingofirut9180.0 ronilri Horllll1lPorni2780.0 9212.0 2912.0 need nelll3356.0 9188.0 not 3688.0 9184.0 bo ho3692.0 3864.0 stated tnttIIstatednor -476.0 4424.0 9192.0 state stateoar 4324.0 4036.0 tnttIIJIm 9367.0 9399.0 nor JImoar1768.0 nerd nood1648.0 -344.0 2112.0 9404.0 1848.0 9372.0 2236.0 till thotilts2600.0 fact ractfeet3012.0 tilutlJat3436.0 Iho672.0 9380.0 Kmprosi IlI1llrcM9376.0 Kmprosipofsoesos -672.0 IlI1llrcMIII -624.0 3932.0 9408.0 nlpres nlpresI1 9560.0 728.0 9592.0 pofsoesos III I1-728.0 lI 1556.0 1888.0 9596.0 IH PS helohere9572.0 -392.0 2640.0 9567.0 JUt3140.0 3320.0 -160.0 loyal loynl4108.0 9564.0 lllth tlUll1111lllthtitibjcctg 4456.0 tlUll1iuhjcctF -320.0 1111i 660.0 1364.0 9752.0 titibjcctg 1iuhjcctFubjects1368.0 9791.0 -656.0 9788.0 + -4.0 1420.0 9948.0 1840.0 10032.0 10111.0 Atlvlcfl 10116.0 tit -460.0 2472.0 2140.0 hlc 2224.0 2284.0 Icn 10123.0 2468.0 tn 2584.0 10148.0 < 2636.0 llaclirlor IIlIcllrlor10120.0 nl tclirlnr -44.0 2892.0 3484.0 flirt Ofrlfllris3300.0 flirtSome OfrlSOIlO fllrisSono 1524.0 10268.0 Some SOIlOSono10271.0 ixoillent lxcclllntcseelleut500.0 advice 2900.0 lUih -496.0 10303.0 u 3276.0 2968.0 3184.0 ICO 10312.0 e -72.0 10288.0 584.0 3808.0 bachologirls 3812.0 bacholo hnhlollinehelo-580.0 hnhlolhl -628.0 576.0 linehelogirls 1380.0 10463.0 girls 1492.0 1936.0 given 1896.0 2116.0 Iln 2432.0 10468.0 by h 10500.0 11writer nltcl1vriter3424.0 3724.0 4040.0 PIttrinmrg 3960.0 368.0 4044.0 Pitts J11ttPIttrPittsimrg -368.0 4412.0 J11tt11m 892.0 10655.0 imrg inmrg11m -356.0 10660.0 PressNight 1624.0 1856.0 Press 1Iel2276.0 1Ielh 1528.0 10844.0 10852.0 1608.0 Night 1752.0 lht 2056.0 400.0 10847.0 work w01kiurn2052.0 does 110l9fines2980.0 10860.0 nut not10884.0 pay 3220.0 Ila 3572.0 3760.0 fhe3460.0 says 5nys4020.0 saysI 5nysIf1n 4 4hll 2928.0 11040.0 11044.0 1620.0 have hnvo1532.0 hll -360.0 11084.0 known Inownktlown2672.0 11072.0 many ninny11076.0 II1nn 3096.0 784.0 11047.0 sucerpsful IiUClCPHfulsucrrP5fu12988.0 4048.0 worn WOl1111111wornon WOl1en 111111cit 1376.0 11232.0 11260.0 encit11236.0 who win1552.0 11264.0 w -324.0 110 1756.0 11248.0 lit2320.0 tho11239.0 760.0 2652.0 beginning bcgluning652.0 hcllInln -760.0 3728.0 their 1110114168.0 11268.0 enrcers car enr-224.0 carrors nr nrrmR 11424.0 11468.0 308.0 11456.0 rors rmRcers1116.0 1836.0 11428.0 worked VOliellvoricvd1684.0 eighteen ciglntecn2412.0 d -640.0 3148.0 404.0 lttefn nours IIOUlSIln1IVP11n3684.0 4136.0 11431.0 day dayThis day1iis lln -260.0 lln1Ihl 4308.0 1372.0 11616.0 This 1iis1Ihl 1812.0 11648.0 may II1l1jmany356.0 11652.0 11620.0 seemed scenlrtlfiCell1l1 -548.0 necessary nctrssnrynClIJo 4072.0 11623.0 bit leibitIt -176.0 4388.0 lint lintIt leiit 11808.0 11840.0 vny1496.0 11844.0 ns 11820.0 11815.0 wise wiso2228.0 although nlthou 11812.0 tiielie 3892.0 persistenco persist IlcrslHt-508.0 persistonce IlcrslHtlneo 11995.0 12032.0 once lneoenco12007.0 amid iind1111112252.0 energy 2340.0 IWI 12036.0 2552.0 2904.0 which tviieh3500.0 12004.0 3364.0 648.0 revcalec leelllldrevciiletrevcalecvero -648.0 leelllldl -600.0 revciilettrere 1272.0 12196.0 12224.0 vero trere1520.0 12231.0 1612.0 fI 1548.0 admlrnhl ndmlrnhlndmlrnhlClle -692.0 2540.0 1852.0 admlrnhlTim 12228.0 1876.0 2044.0 2192.0 hlI 2416.0 liLt 2384.0 1604.0 12384.0 Tim 1110Clle1980.0 12396.0 most lHUStmast1900.0 2428.0 12388.0 prolltablo Ilro11tnhlCprotltnbin2356.0 840.0 3244.0 Indulgence lntlulgencrh1l1ul -836.0 12424.0 mc 4156.0 pos IORpotsposslblo -256.0 potsamble IORflhlu 12576.0 amble slbloflhlulH1728.0 2016.0 12579.0 tlmt1932.0 412.0 2408.0 2332.0 2512.0 Illl -308.0 12588.0 3124.0 12584.0 good 3224.0 non 0011-252.0 3476.0 3612.0 wholosom whollsOUlciyholesotuwholosomrecreation -756.0 whollsOUlcllCIC1 -752.0 iyholesoturrcrcnliuu -844.0 12768.0 772.0 recreation rrcrcnliuu12795.0 llCIC1 -772.0 1872.0 tioll 1844.0 viiIcilIutult3296.0 12776.0 only 01113onl 700.0 3756.0 Improve 11111110131milprotImprovetho 1111111013I 1milprotthe 4216.0 12940.0 12960.0 tho1100.0 1688.0 quality lJutlilgtnlity12963.0 ot12995.0 ones oncsuues436.0 12968.0 effort cfroltbut hntbat3448.0 also nlllonlsoex lXcxcxtends -192.0 extends lXI 13032.0 4184.0 13152.0 13219.0 tends tCIHI41112.0 13155.0 tholl1u1792.0 2244.0 time line2136.0 13160.0 hl2828.0 13172.0 win ivn3660.0 13192.0 sue HUCsucsuecess HUCes succes5 13344.0 13372.0 cess ces51456.0 es rile Tho1904.0 2072.0 480.0 aelivo netivo2168.0 mlI 2644.0 13384.0 484.0 period IleilOIlperlod13352.0 ot676.0 3776.0 13356.0 womanY W0Il1I111t3672.0 womanYlift -676.0 13379.0 W0Il1I111ti 3916.0 otnuu otnuu11Ce 13527.0 13532.0 lift tlfl11Ce1108.0 Heading Ientll11gIilnlIl1 13536.0 should ho1hl13539.0 form tormforut13576.0 uconsider mUSIIllrnnsider3680.0 considerablo 616.0 mUSIIlluhlo rnnsiderable -616.0 13719.0 able ablouhlo13724.0 element llelllut2616.0 13728.0 13763.0 u2752.0 3136.0 13760.0 young ymuioml 3620.0 wnninnGrecrention 3560.0 womans oUlnnswnninnG-668.0 womansrecreation oUlnnsIocrntlon 13911.0 776.0 Iocrntlonrecrention13916.0 On 2148.0 this mils396.0 3000.0 13920.0 point llOlnt3464.0 13923.0 speak Rpenlwithconviction withI withconllcllt11 14103.0 14112.0 conviction conlctlonconllcllt1114108.0 tram iroin1nun14140.0 ivy nyl11 own otu2868.0 personal lOrRollnlpersonnl14144.0 experience 14155.0 tIHrhmcc 4272.0 C Cpnrlonce 14176.0 14292.0 perience IHrhmccpnrlonce14300.0 14332.0 can cam2312.0 2764.0 14295.0 recall lecnllrecoil3284.0 scarcely scnrcely3188.0 IIcnrcel 14335.0 14304.0 4088.0 dayu dn tindnU tinu 14484.0 14512.0 1584.0 14492.0 otwhllh3116.0 hne3748.0 14500.0 14507.0 sprulfrom 14504.0 spent 811lItsprulspentfrom -404.0 811lItfrom 14676.0 14704.0 one tine14679.0 2080.0 two hours hOlllH14711.0 or 013432.0 more mOlnrnoro14684.0 reading rendhitreadingsomething -584.0 4460.0 lcnl1ln lcnl1lnfomothlnJ -488.0 rendhitsomething 3056.0 14859.0 812.0 something fomothlnJ868.0 14864.0 substantial 2176.0 1560.0 fluhstnntlnlhIBtor substnntinlhistory-868.0 536.0 3268.0 14868.0 history 3804.0 3924.0 14879.0 poetrypolitical 3928.0 poetry 1100h1100hlw1ltlcnl 15051.0 political lw1ltlcnl15083.0 economy tcmomyecuorny15088.0 732.0 15059.0 historical hlfitollcnl3132.0 15095.0 ro 104056.0 roinnnco rona 15240.0 15272.0 innnco mnnclna 15243.0 Nat 1664.0 Nlt -292.0 15248.0 Ilt Qnyphly1IInolutwo13372.0 founa touIl11fouutlthin thlllflitthinono -284.0 thlllono 15371.0 15403.0 15423.0 > 15464.0 ono 01101016.0 15432.0 1972.0 tirotfuTrarest 15428.0 rarest rnlest740.0 2840.0 15420.0 pleasures 1lcI18Urp9plensurea15416.0 ot3900.0 15440.0 my 15408.0 11fcbut life lire11fclifebut lirehut 15595.0 15623.0 hut15620.0 15615.0 has IIns102196.0 15644.0 2572.0 2748.0 15632.0 15635.0 Cll 972.0 considerable cOllsldornlllo4244.0 ctextent 4248.0 cttnt extout 15652.0 15783.0 15812.0 tent tnttout1804.0 15804.0 made mndom8l01692.0 15832.0 tip2564.0 15800.0 10115795.0 thotllO2792.0 3172.0 15792.0 lack Incl3564.0 oC15820.0 a3720.0 collegeeducation 3944.0 college -500.0 colllS colllScl1ucntloll -396.0 4340.0 15975.0 15996.0 education cl1ucntloll15987.0 Study 15992.0 Stu 16019.0 y 15984.0 16012.0 season aensonacnson3828.0 llIl outof out outor 16159.0 16191.0 or16216.0 Henson16179.0 Never 2460.0 16208.0 opr 2800.0 stop 16167.0 half hnte11nht16196.0 along nlollJnlongalongany 4480.0 nlongally nlollJnn 16347.0 16408.0 any ally16376.0 line hueMaster llnsterUIH 16379.0 tor 2520.0 2856.0 16364.0 16396.0 2972.0 16359.0 keep Iteel3576.0 16391.0 16368.0 nt16351.0 until u11tlluntilforced untiltorced u11tllformed 16544.0 16571.0 forced torcedformed16576.0 16560.0 admit Iflmttnilmlt16551.0 hna11nsmastered mnHtercmnstered16583.0 youNever 4148.0 you 4252.0 01l 01lNeol 16728.0 16760.0 Neolforget COlgetforgot16783.0 664.0 16743.0 overlook overloolc2612.0 16780.0 -664.0 llool 16772.0 11113656.0 16740.0 old olelfriend tlIUlUlfriendand tlIUlUlnUll friendnud 16920.0 16952.0 nUllnud16947.0 make 1II111emile16975.0 its16979.0 16967.0 ninnyI1Inn -436.0 16964.0 now 3388.0 16960.0 oncsnapossi poH513964.0 poH51ble possible 16984.0 17112.0 17144.0 ble hIe1784.0 17135.0 without tho17124.0 Rnerillcc Imerlllclsnertfce17120.0 or17152.0 n4116.0 whit whitof whitat 17307.0 17339.0 at888.0 17327.0 selfrespect HllerlSllIctself -888.0 552.0 respret 1956.0 17356.0 992.0 individuality hullldunllty17315.0 Indl -992.0 Idunllty Do Dothis 17475.0 17524.0 1776.0 flom froul-364.0 17511.0 principle I1rlnclple736.0 17504.0 Inasmuch 1nns11tuclm17507.0 Inl1 -736.0 ml1eh 17531.0 UR17499.0 17496.0 Is IHIsthrough IHthrou isthrough 17691.0 17716.0 through throu 2000.0 1916.0 17740.0 our om17703.0 friends Crlel1817699.0 thnt3508.0 17696.0 hest best17720.0 op Oilopportunities Oilt1ortullltll 17723.0 oportunithcH 17752.0 17895.0 848.0 17903.0 portunities t1ortullltllportunithcHottlfe17923.0 come comocarve3316.0 17915.0 usiupplo us usSupple 18043.0 18248.0 18260.0 Supple 81111110iupplo18255.0 Iafeet -56.0 fleet treetItrFun IrrFursItrFunIt IrrFursIthr 18252.0 Fun FunI 2952.0 1536.0 18435.0 18467.0 18464.0 IJ18455.0 truly trub800.0 18447.0 wonderful wonllorful18476.0 ECO treewhatitcht what 4468.0 whatlight lmt lmtlI 18624.0 18647.0 light itcht18656.0 ht 1488.0 1928.0 soft 2344.0 effects ctrlctsetfects18676.0 nronre18632.0 obtained Qtnhcllobtnlge118627.0 wallfurs 4128.0 wallwithfurs withtun 864.0 18412.0 18851.0 furs tun780.0 18844.0 nowadays nowfiflnJfInnivndays18839.0 18836.0 pretty IllCUj18831.0 garment 3520.0 18863.0 J 4276.0 18856.0 rmcn 18819.0 is isa 4492.0 isn -104.0 19011.0 19075.0 a1592.0 19040.0 short Ihort2104.0 19031.0 bolero boloroat19023.0 seal Renl19019.0 quite 3880.0 19048.0 open ollenInfront 4484.0 Infrout inrout 19208.0 19231.0 front froutrout19220.0 rounded 1Oll1l10doil alloff19215.0 3332.0 small smnlt3452.0 19240.0 reviers 19235.0 1lre-140.0 rovers 1lers 19267.0 19359.0 19455.0 vers viersers -228.0 19415.0 circle chcle19408.0 Uietlle19403.0 low 3232.0 19412.0 cut 19400.0 neck Inthe 4352.0 Intho 19587.0 19607.0 thoback hlc1hack19604.0 19615.0 19595.0 shallow i1nllow19624.0 capes CllpCSItdiscloses Itcthc1oKoH 19779.0 19799.0 discloses cthc1oKoH2088.0 19795.0 Cront19787.0 11111midseveral slernlhiehePabove Inches InchohiehePInchesabove 4496.0 InchoI 4300.0 19947.0 19991.0 above 1180.0 1504.0 19996.0 bol 1864.0 19987.0 helt belt2188.0 19984.0 ill19976.0 tho19979.0 3108.0 20008.0 n3536.0 19971.0 blouse blo1sOotofermine oti 20164.0 20191.0 20188.0 ermine Cnnln20183.0 From Irom20176.0 20171.0 tho20168.0 pagoda pngollnpngodnsleevetit sleeve slocvosleortslocvoof sleortor 20363.0 20380.0 ortit20375.0 Renlsent1572.0 20403.0 comes conies2692.0 20400.0 flU916.0 uudorslecve 1nd118Ico0underslceveot20383.0 er 20388.0 ert 4464.0 20420.0 20471.0 20555.0 20567.0 mine minIname2004.0 20563.0 The lhecollar 20560.0 aUllbolt lIeltbelt20583.0 nre arcottur turquolso turI 20663.0 20727.0 20760.0 quolso quolse20755.0 velvet ohlt20747.0 crushed crus11ell2556.0 3548.0 amI20743.0 drnwatight 4004.0 drawn drawdrnwadrawntight drawtlsht 20932.0 20947.0 tight tlshtnmlnudtllt20944.0 little llttle20939.0 cuff cutrband Imndbald3380.0 holding holdingin 4516.0 lIolllln lIollllnIn 21127.0 21147.0 21139.0 tho1564.0 erulne920.0 21131.0 nndcrsleeve umlorslcooundersleeve604.0 consists conslstBotoftwo 4508.0 otto 21316.0 21351.0 to21360.0 narrow Ilnrrow1712.0 21328.0 gold 2368.0 21319.0 ribbons lllIbons968.0 embroidered enhrolderedembroideredIn enhrolderedin-968.0 em rohleredl rohleredl1n 21508.0 21531.0 1n804.0 21528.0 turquoises 1576.0 21516.0 wltbwithm21551.0 n3060.0 3156.0 hit3532.0 21519.0 otturquoise turquolsoturquoisevelvet -740.0 4520.0 turquolsoYehet 716.0 -732.0 21708.0 21715.0 Yehetshowing IhowluJbetween hetweenlIcl 21740.0 themAnother -384.0 2948.0 21900.0 21912.0 Another 21903.0 striking strhIclugslrlllll holero21927.0 21932.0 or21924.0 veryclose 4504.0 cry cryclosc 22087.0 22104.0 close closc22099.0 nulHat22092.0 white whltowhltncaracal cnrnllIcornealopening opcnlnJopeningupon opcnlnJ11pon -556.0 22284.0 22323.0 11ponn764.0 22287.0 waistcoat wnlstcoatorrule nllc1111022311.0 green 22316.0 cen panne panneKO pannesit22476.0 22520.0 KO sit1588.0 22479.0 completely comlllltetycOnqletelybraided hrnldct1brnldetl22508.0 over ocr22499.0 nnrrownarrowblack -560.0 22503.0 nnrrowhllck 1440.0 22663.0 22675.0 black hllcknmlnud0111 22671.0 braids braltlHIIraldH22703.0 os3796.0 22668.0 show 3708.0 thegreen tho4524.0 thoreln 1436.0 22860.0 22903.0 1540.0 reln 22871.0 shimmer 22867.0 -336.0 3120.0 22863.0 here nndsandthorethereThe -400.0 thore11he there1Iie 23055.0 23067.0 11he1Iie808.0 23060.0 somewhat sonwwhatsonewliat816.0 vulgarized ulgarlzcd3544.0 fox toxfax23084.0 seems tohold 4532.0 23063.0 toholtl tol 4528.0 23239.0 23255.0 hold holtl23259.0 Its It123279.0 011oxn2048.0 lheiherare rnr 3360.0 3444.0 23247.0 hlack4296.0 23244.0 fill silsibsibtier silver fillt 23307.0 23439.0 23476.0 tier ver23479.0 23447.0 blue hlul2036.0 2524.0 nre2420.0 904.0 everywhere ceywhercstacks staclHstacicsstacksThe -484.0 staclHI stacicsIstacicsthe 23535.0 23584.0 23639.0 fllC1128.0 23668.0 pure puro23636.0 whltl23663.0 appears nppcnrsnll1 -604.0 23671.0 0.0 cnrs 18n3836.0 4028.0 23631.0 lovely lorotylovelysoft 23784.0 23787.0 -16.0 1444.0 23819.0 23835.0 Roft1828.0 23831.0 trimming trlmmhl 23860.0 23828.0 those thoso23855.0 opera cloaks cloalacloaksthat -480.0 4536.0 23823.0 cloala1hat cloakstint 24011.0 24023.0 1hattint24055.0 arc24027.0 mallo24020.0 entirely enUrelyat3368.0 24047.0 some flatavhite flat 11atflatwhite 11atwhite 24203.0 24215.0 avhite24219.0 fur CUIflu24212.0 011Oil24244.0 a24207.0 long lonlredingote redlngoterldln otl ofwhite ot4540.0 otwhite 24395.0 24407.0 24404.0 Cnlncalcnracal948.0 2716.0 24399.0 wonderfully OIHlerCullyvondertnilysilky nudmidandas nudf midbg 24584.0 24591.0 bg f -64.0 1452.0 24627.0 ns24599.0 anltiSns24631.0 athick moire 3744.0 24587.0 adds adlls24619.0 asnowy af 24776.0 24779.0 24819.0 snowy 1208.0 24787.0 nntl1952.0 720.0 nmllonI lowly lovelysoftness soflllcaH24811.0 18wide whllwllewideedge whllcdJe wlleedge 24971.0 24983.0 edge cdJe24975.0 thobroad hrond2392.0 opcned81cocandaft nmlandat nml1lt 25163.0 25183.0 1ltaft25171.0 high hllh25168.0 rolling rolllns3584.0 25195.0 nBcaressing cnresslnJcaressingto cnresslnJj-724.0 4548.0 25351.0 25387.0 j 1460.0 25375.0 25363.0 25360.0 cheek chcel1940.0 25392.0 nRn25355.0 powder 2888.0 puff l1ffpullVlti WittWittlhe Kith Kiththe Vltithe 25407.0 1464.0 25539.0 25552.0 lhe25559.0 tWClttvu25547.0 heads heRdskends2704.0 crossed crowttl25579.0 cro -568.0 Ro1 25555.0 ntthobuck bnclbnclcofthe oroftho ortho 25735.0 25744.0 thecollnr25739.0 encircles encIrclcstlmf1l1t1andfalls 4544.0 f1l1t1rails 25924.0 25931.0 falls rails25963.0 os25968.0 a25936.0 boa lIonion2216.0 thcwhole 25927.0 length lngth4076.0 otthltlltinCarmout thlplrmcnt tllnrment 26116.0 26131.0 Carmout plrmcntnrment 26119.0 iulu26123.0 trontWllshlngton frontWashlugton928.0 Washington -928.0 StarTecrtnltlue Star StnrStarTcc1mlfnn StnrI StnrTtc1mlqllll 26271.0 26475.0 Tcc1mlfnn Ttc1mlqllllTecrtnltlueorIroirlns nrlHrlnirnwingOld 01e1OttlOldOn 01e1On OttlOn 26623.0 26639.0 26667.0 26635.0 final 11nnlOnnl26631.0 analysis I1n1I818tl10horror hOlIor3468.0 atoldage olttoldige olttISO 1472.0 26803.0 26855.0 ISO igeage26847.0 comos26823.0 rromcentering centcrJngliCenndnod4196.0 andour 4552.0 nndOur nodour 1476.0 27011.0 27047.0 strength 27015.0 2440.0 things thlnSIl011doomed doomleldoomedto doomlelto1484.0 27195.0 27215.0 27239.0 pass pOliS27235.0 away aw03027203.0 Tho Theresult tcsult3164.0 27207.0 loneli 10ncHloneliness 10ncHllesslonellncss lonelinessloneliness 27259.0 27391.0 27431.0 ness 1252.0 27395.0 llesslonellncss nessloneliness2816.0 end each27423.0 sees SOPHseesus 4564.0 seesits SOPHus 27579.0 27619.0 its636.0 27587.0 stripped 27599.0 27583.0 lively IIrclyassoclalions assocla associaassociations assoclatlons 27647.0 27767.0 27791.0 lions tionstlons27779.0 1860.0 27775.0 thotbo27771.0 world orIII orstrong stroDJtiesi tIostiesbinding tIosbinding 27955.0 28035.0 27975.0 binding 1200.0 28000.0 2200.0 18 27968.0 27963.0 kindred klntlrcd27959.0 trlendsbutftrlppcd butitrlyped tttlJpped 28131.0 ftrlppcd ttlJppeditrlyped28167.0 too 28151.0 9csbt 2872.0 28147.0 flesh tlcsbphysical vhslcnl28143.0 vigor vigort 28711.0 29567.0 29640.0 xmlns:ns3 ID10 27960 3272 4596 1748 ns3:type 7856.0 1IIhlr -12.0 7868.0 7496.0 Oi Oiearthly 7556.0 1citrlhly -28.0 7584.0 4692.0 emotional lnlotlo1lnl5560.0 pawer IHmCrpDwer5440.0 6208.0 mental 11o111nlluntnl6048.0 force Corcl6732.0 Onr 7240.0 4684.0 earthly IIhlrcitrlhly5348.0 treasures UenMUUgttenEUrus5248.0 6164.0 2076.0 drop 11116064.0 6608.0 ninny6508.0 7032.0 7140.0 6924.0 7508.0 fromI 7408.0 7280.0 om 7616.0 irno 7664.0 HI HII 7780.0 4596.0 4676.0 rno rl1lrtio4616.0 5012.0 5016.0 5200.0 5260.0 2308.0 milone5100.0 5632.0 5916.0 nt5856.0 6136.0 last 1111tinst6076.0 6484.0 we 6428.0 6632.0 6704.0 6768.0 live IInIivt6672.0 7156.0 n7312.0 ghosshivering 7244.0 7316.0 ghos Iholltglto7656.0 IholltfhhIIln 7720.0 gltoslivering 4680.0 shivering sliveringfhhIIln 5404.0 5508.0 lu5300.0 5760.0 5640.0 6092.0 shaking simniing5996.0 2496.0 6700.0 6176.0 hnlln 6128.0 6800.0 FtrutMtir FI1UIIm4stnenn6596.0 FtrutMtirour -720.0 7520.0 stnennour -636.0 7436.0 7620.0 7400.0 2492.0 7776.0 0115028.0 4932.0 5444.0 skeletons FIlJt01ls5344.0 6396.0 IiIt6160.0 U Iiis6856.0 Ihltle6744.0 7192.0 foaffi CllrClIfoaffifearful 7716.0 CllrClIfenlClI1 7632.0 7260.0 -456.0 iC 7412.0 iCfentfnl 7576.0 fearful fenlClI1fentfnlIll1HIII1I8SInneliuiss5220.0 6212.0 6472.0 ollJ6368.0 6824.0 ago 6708.0 mg 7100.0 6876.0 7016.0 7024.0 O 7216.0 IIlIttintthattho 7540.0 7220.0 tintthe 2844.0 114 7532.0 114tIll 7768.0 tIll thothe5020.0 wholowholl4920.0 5568.0 terror ttIror5464.0 6112.0 3043.0 or6024.0 itNow 6272.0 6372.0 ItNow Itow 4820.0 Now ow 5164.0 thotl5448.0 6080.0 anything unythiug5964.0 6780.0 6384.0 thlnJ 6260.0 6728.0 7160.0 UR7040.0 thu 7328.0 thucan 7660.0 thnt thntlall 7764.0 thcan 7596.0 4668.0 lallalter nltlI4924.0 5468.0 thlll5388.0 5840.0 situation situatlun5748.0 6612.0 hiltIlan6516.0 6928.0 confront conloulconfro6652.0 confrontus confrous 3607.0 4720.0 111 4836.0 4904.0 all4824.0 5216.0 hartlug ImrlluJbarrlug5088.0 5860.0 thl5792.0 6168.0 accident ncellllnt6888.0 6820.0 7116.0 111cut7044.0 7364.0 3639.0 ear 7292.0 earTenth 7600.0 7368.0 earl 1l1rlearldeath 1l1rl1nlh 4664.0 death 1nlhTenthYes lcR5096.0 5752.0 tho5612.0 5828.0 Iw 6068.0 ghost 6172.0 6440.0 6340.0 6560.0 6604.0 If 6720.0 6788.0 6884.0 hI 7020.0 ngcage7440.0 tlm tlmsurvives thntHhlldllIIlo 7760.0 titttnvIve 7592.0 survives ttnvIve5432.0 HhlldllIIlo shuddcring5316.0 5436.0 shuddering -860.0 6416.0 mulelamhl6920.0 thothl6796.0 7288.0 irre 7168.0 irreof 7572.0 wlcl wlcloe 7696.0 7336.0 vrec vrecof 4660.0 4208.0 oe4908.0 11M5168.0 4235.0 pcnoiitllty IIUlbOllt1tperenutilty5484.0 6532.0 IN6444.0 6736.0 6644.0 6960.0 6868.0 7196.0 begli hlllnbegi7112.0 beglining -408.0 beginhig 4395.0 ning nhig11111 5128.0 a4896.0 spirit IIlIht5212.0 5884.0 thnttint5756.0 needs lIlI11Rucetis6216.0 6896.0 6900.0 Oll 7228.0 7360.0 somslight 7128.0 son somIIOIIl-300.0 IIOIIlt11 7724.0 sonslight 4576.0 slight t11 4832.0 5204.0 atUiulou aHlnlontttenliau6060.0 4580.0 whlllwhlit5896.0 6592.0 4612.0 wo vo6480.0 6908.0 nllcute7268.0 7512.0 tlpossession 7612.0 7516.0 thpossession tho1I0811lII81011 7748.0 4772.0 possession 1I0811lII810115572.0 4780.0 ot5460.0 5836.0 4804.0 om5728.0 6204.0 faculties Cnu1tlllIfitcttltleK6864.0 4796.0 even Ilen7176.0 evenfur 7284.0 4776.0 croat croatfor tu 4976.0 CIIIfur5008.0 5004.0 UN1185292.0 Itn5180.0 5496.0 4972.0 sphere 5500.0 6008.0 5584.0 llhlrl 5532.0 6120.0 oC5968.0 4959.0 beautiful IWI1ttrulhenutlful6284.0 lifeichlehi 7108.0 lIfl7608.0 7480.0 liwhich -68.0 7676.0 111whllh 7740.0 whllhichlehi5228.0 5196.0 5124.0 shall IIhllll6004.0 5156.0 walk wnlkwllhvithi6376.0 6932.0 constantl COl1f1ll1l1t1con5tnntlconstantlIncreasing COl1f1ll1l1t1InclCnllI con5tnntl111crenslilg 5340.0 Increasing InclCnllI111crenslilg5636.0 5776.0 5392.0 5664.0 6056.0 5352.0 constantly cOlltlll1l1t1 -808.0 6948.0 Incrrmshrs 6760.0 Incrrmshrscepaety 6956.0 Inereashij IncrIIRlnJInereashijcapacity IncrIIRlnJlIIHlH 4648.0 656.0 capacity lIIHlHcepaety5424.0 or5304.0 824.0 5688.0 5548.0 enjoyment enjoynmentul1jo -824.0 6512.0 5555.0 nlent 6676.0 5576.0 1111us6968.0 thothl6840.0 7320.0 5564.0 yensmnd 7208.0 7324.0 year yensyearand 7504.0 IlS IlSnntl 4644.0 5744.0 nntlmnd5040.0 tho5384.0 5740.0 wOIltltvorltl5276.0 1110115816.0 behind hlhhtlhrhlntl7000.0 6892.0 7052.0 7164.0 7392.0 Thl Thlspirit 1h 1hsptvit 7416.0 lhls lhls1IIIIIIt 7744.0 1IIIIIItsptvit5932.0 requires llqUItISregtiires5928.0 tot5820.0 its 6192.0 Il 6640.0 perfection IIClrlclonperfeetlou6424.0 7564.0 7424.0 nmute 7624.0 7568.0 m mmore notUOlO 4652.0 6108.0 tUOlOmute5132.0 than thmt6124.0 thntlimit5988.0 6148.0 1ve5900.0 6119.0 loam hl1mlearnlove 1007420.0 sottulle soil 6011sot7628.0 soiltude 7684.0 6011tUlle tUlle tudeNot Xot4984.0 5592.0 6316.0 thnt6311.0 like 111m11115908.0 6432.0 6308.0 thothe6336.0 nti8nuthroiomit 6772.0 mlsanthropi mlsnnhlollonti8nuthroi-828.0 908.0 mlsanthropiami mlsnnhlollo1It4640.0 ami 6544.0 omit 1It5032.0 churl 4880.0 6540.0 1e5428.0 5888.0 arc 1110are5796.0 6232.0 6140.0 shun fl1111shin6944.0 6500.0 tho6848.0 worh worhbecause 7688.0 6528.0 7432.0 01111 01111IIf1 7728.0 Ibeenttse 6683.0 because beenttseIIf1 USl 4940.0 5364.0 we5224.0 5684.0 lovo100ourselves ourlllhI86000.0 Wo lireVc 7332.0 wll wlwllsimply wllfllml wlsimply 7672.0 simply fllml -516.0 4964.0 6936.0 5288.0 take tnlo5052.0 advantage nl1nlltngo5608.0 6660.0 ortittimeMotunod 7304.0 h0l114Motuhourand h0l114nUll 7092.0 nUllnod696.0 moments mOnllutsmnniettts5868.0 7084.0 when wlwnthen6408.0 others other6292.0 IInlenlulce7548.0 7099.0 IK IKdemand 7692.0 7552.0 nodlnIIl1I1 7736.0 ndetunnd 7636.0 7279.0 demand dlnIIl1I1detunnd7308.0 ullon5256.0 5800.0 5848.0 1S 11111mil6468.0 Instead lustendhRt -552.0 Il1 6740.0 7104.0 ot7344.0 rush rushIng rushIIIJ rims rimslog Ing IIIJlog7492.0 ot5208.0 5504.0 forcoCorco5960.0 om6288.0 7460.0 demands dCIII1111K6220.0 7048.0 UIon6972.0 7500.0 t11tinworld t11worlll Ili Ilitvorltl 7663.0 worllltvorltl5236.0 7695.0 wo5080.0 5556.0 will 11115452.0 stay stny5844.0 stn 6268.0 nt6624.0 homo hoursquietly IulcUtgniell7036.0 quietlyalouo IulcUttlloHe gnielltloue 4632.0 7843.0 7855.0 alouo tlloHetloue5120.0 7852.0 llth5044.0 7880.0 om5472.0 5872.0 7848.0 souls 1268.0 soulsUnrlerH soulsIlnrpers-388.0 6460.0 Harpers -680.0 IlmzamI IlmzamQueen razar IlmzamrazarCN I1nzl I1nzltl 5544.0 8308.0 8424.0 6352.0 CN 5620.0 6748.0 AND ANDTIBER ANDTII 1308.0 5704.0 bWOnrr 8540.0 TIBER 6580.0 TIBERQueen 7012.0 8544.0 TII R 6636.0 RAtS 8784.0 AtS 8832.0 dO 6812.0 dOQ1eell 9076.0 9352.0 Queen Q1eell9364.0 Wllhelmlna Wllhllmlnn1Pllhelntlna5268.0 9360.0 IR6244.0 6504.0 9355.0 devoted 110otOll6436.0 7180.0 7388.0 tern tel11temternjoranco tel11IHlnnCC temimeance 9536.0 IHlnnCC joranco imeance-576.0 5244.0 1wenQuleu9552.0 Helena HelclHIIelena6764.0 or6620.0 Italy Itnly9540.0 tguotl 7588.0 tjood tot0l1 9759.0 jood guotl4744.0 t0l1 1052.0 5084.0 housekeeping housekeepingTho housekeepingThe-1052.0 hous -1048.0 lelllhJ lelllhJlhl 6072.0 9956.0 9983.0 Tholhl9980.0 Duchess DuchlIIRClf5808.0 9963.0 Newcastle XCWtlstlo6044.0 9976.0 New 6916.0 6476.0 9968.0 cnstlo 6996.0 IR9995.0 7120.0 7356.0 lovo110Cl7276.0 lovo1if 10Clor 7708.0 lovet 10180.0 if or4740.0 4800.0 10220.0 4912.0 dogs 11mI4lors5416.0 10212.0 ii 5420.0 10175.0 10204.0 5696.0 ad 5652.0 5812.0 10168.0 hits hlillhastaken tlllNltoken10188.0 111I1l 10152.0 prize lrl1CMttrize7056.0 prizevlth 7732.0 lrl1CMwith ttrizewith 4656.0 10348.0 10372.0 vlth5104.0 5000.0 10376.0 wire5876.0 10360.0 haired hnhell5788.0 6808.0 terriers tl1Ilels6712.0 terriersA tl1IlelsA7380.0 4764.0 10568.0 10608.0 10604.0 statue HtatuoHlntuo4892.0 10596.0 oC5456.0 5772.0 10591.0 Quccn10579.0 Victoria Ylctollll6252.0 b 1rittless Prill llI1I1rittPrilless llI1IelR 10764.0 10823.0 less esselR10788.0 roull4936.0 10776.0 Dlhesil5580.0 10780.0 lit6668.0 10768.0 Argyll 6664.0 10803.0 7188.0 1t 7076.0 havicon ha hameet hav ImqImqlIeun 4628.0 10960.0 10983.0 lIeun 11015.0 icon meet10963.0 Ien 5480.0 10980.0 Her licr5656.0 6144.0 10972.0 Royal lloyal6012.0 6228.0 1to -444.0 6536.0 1I1 Highness IlllhulslIIllghuess10976.0 7488.0 toiho totill -48.0 11168.0 11180.0 ihohe4968.0 11175.0 city 4868.0 lIt or5152.0 Manchester Il1nchlstllInuchester5512.0 ManchesterTho -904.0 Inuchesterthe -820.0 5700.0 Il1nchlstlllho -812.0 11376.0 11408.0 Tholho796.0 11396.0 legislative IlHllllntho5064.0 5184.0 11399.0 legislat 5976.0 lye 5732.0 11387.0 council oC6648.0 IllorlnVictoriaAustralia -620.0 Victorialustraiu IllorlnAUHtrnltu 11576.0 11596.0 Australia AUHtrnltulustraiuhtlshits11591.0 torfar11584.0 thl6116.0 6572.0 11579.0 sixth Hlxth7068.0 tlnlUline6952.0 11588.0 11604.0 re recotctl 1tjeetett reected 11764.0 11792.0 jeetett 4688.0 11796.0 cotctl ected5076.0 thewomnns6348.0 11776.0 suffrage suffrago6240.0 lIurCrl 6984.0 7088.0 bill hilthillIIits 1tII-108.0 UKIS 1th11 11872.0 11983.0 h11 12015.0 KISalo4884.0 ul 12020.0 11980.0 rejected IIjeetfrJectmd5880.0 5972.0 n6224.0 11968.0 proposal IWOIOnlirovosnl6132.0 11972.0 7184.0 11951.0 submit RulImltsubmitho 7824.0 Itllo 12155.0 12175.0 tllo 4696.0 ho 4860.0 4996.0 12172.0 question el1lHtlOll5780.0 5648.0 u900.0 referendum leCmeutlmurefcreudutuleCmeutlmul1c refcreudutuline-900.0 7172.0 896.0 6276.0 referendumMine -896.0 4760.0 12379.0 12408.0 Mine 4856.0 12411.0 12440.0 l1c 12404.0 lean 1111JeanPommerol IOmtUllolIolnnterol5676.0 thotime7148.0 French 1retcli7028.0 FrenchXplorer -564.0 7712.0 1retclixplaeet 7152.0 rotlch rotlchCX 4620.0 12571.0 12628.0 CX 4704.0 12600.0 Xplorer xplaeet12632.0 ll 5408.0 12596.0 5240.0 12591.0 about uhlJl1tctinut5524.0 6380.0 start Htnrt6836.0 12611.0 6752.0 nnotlmetxpeditlou another unothennotlmetanotherxpedltlon unotheIXPlltitlOU 4624.0 12788.0 xpedltlon IXPlltitlOUxpeditlou12780.0 lhl9rutstinie6556.0 IIho141106452.0 6912.0 tvllllion pcno7200.0 pcnorate 12800.0 lionrate cur curtrntH 12992.0 rate trntH5112.0 12980.0 the12975.0 Sahara Snhnln12972.0 6016.0 13004.0 nm writo WlltCllvritm6364.0 13000.0 H naboolc lIoole7144.0 boolcihout boolchunt 7348.0 lIoolenhout 13175.0 hunt ihoutnhoutOwcustoms customR5372.0 13164.0 natives natlolnativesDr 7232.0 nativesIr 13404.0 Dr Ir4916.0 13436.0 5116.0 Conan Connn13396.0 Doyle 5596.0 13399.0 lo 5892.0 13420.0 13423.0 6552.0 13388.0 thnttimesitu sohlsniusniuanon sohltntllJn 13440.0 13596.0 anon ationtntllJn5172.0 13591.0 glUll5672.0 13588.0 13583.0 his bis13580.0 httlogirl 6792.0 whl11lvilenliohoeturncd lioretmnCII hoeturued 13783.0 eturncd retmnCIIeturued5376.0 home 11011105280.0 13780.0 after nrtlrnfler5784.0 6344.0 13768.0 6256.0 13771.0 defeat dufeat13776.0 7136.0 13800.0 7464.0 limonrlinmeutnry 7468.0 tholimo7704.0 themrllameutary thol11lInll1lutnt 13955.0 1068.0 13972.0 mrllameutary l11lInll1lutntnrlinmeutnry13968.0 election lloctlon13992.0 WUSOh Oltdad tllulclad7248.0 dady 7384.0 tlluldr cladI 4636.0 14147.0 14167.0 dr 4736.0 14192.0 14172.0 114196.0 am antso 8014187.0 sorry sOlr 6196.0 14184.0 6568.0 did dill14152.0 7236.0 14179.0 passMrs 111881 111881hi 1Mis 14371.0 14396.0 Mrs Mishi 5072.0 14391.0 B n14388.0 K 5320.0 Bruce Hluce14384.0 the6180.0 widow wlttow14379.0 ot14376.0 tlio7396.0 tlioinly theonl therily 14564.0 14588.0 4700.0 inly rily14580.0 colored colorellmaii mnli14608.0 mnn 6084.0 14576.0 1vlo6020.0 14571.0 served 14603.0 serI 7080.0 full 1111fullerm fullr 1111term 14756.0 14783.0 term 14804.0 erm 14815.0 14807.0 rut 5108.0 14768.0 tho5708.0 14763.0 United Unltcl5600.0 States StntcJSenate IHIsow IHnow isor 14952.0 14992.0 14995.0 or14963.0 head hendhca1ot14955.0 tho14984.0 womnnwoinnnsdepartment IIC1nlhnelltdepnrtneutdepartmentf IIC1nlhnelltotdepnrtneutt-892.0 15140.0 15155.0 ot tthejhuskownTnBtitutn 4876.0 15152.0 tlKVTtiskcUi -1804.0 t1u 5804.0 rIl8kjIlTI8t1tuhn 15184.0 -1084.0 5852.0 tv 15144.0 Institute 6756.0 lniMnl InAlahe6684.0 Ahl1 7428.0 inI inIIt 1I 1It 7752.0 15283.0 15339.0 15336.0 1115284.0 15288.0 said sRIlI15312.0 thnt1132.0 comparatively colDpnratlcljcowpnrntlvoly6032.0 15307.0 veryew ClY ClYCew 15524.0 Cew 4712.0 15544.0 ew 4928.0 4728.0 15548.0 011 15536.0 women woven5644.0 15504.0 ht15484.0 England IgIIl1l115499.0 -652.0 15475.0 read renllrend15472.0 tho7340.0 tinily dallydallyewspapers tinilyu IIWwsl11llJlr8 912.0 15723.0 ewspapers IWwsl11llJlr8vspnpers15743.0 15672.0 preferring lJrcfcrrJuJ4812.0 15667.0 the668.0 15655.0 weeklies weekllcsiveekhIesweeklieshis iveekhIesills7820.0 Ifhls 15847.0 15891.0 fhls 15888.0 ills15884.0 Jlvlu15908.0 nR5940.0 15868.0 thocause 15900.0 cn usa 6400.0 15852.0 why wh London L011l10nLomlonLondonlas LomlonitsL011l10nhns 16031.0 16088.0 hns 4708.0 16115.0 las its16076.0 such lIuch16108.0 u16063.0 nUI1lr16056.0 ot16048.0 16044.0 class clns8week weelt7204.0 weeky weekrweeltly 16263.0 16275.0 ly 16307.0 mugnzlnesMiss 4888.0 magazines mugnlncsmugnzlnesmagazinesMiss mugnlncslIss 16452.0 16499.0 Miss lIss 16487.0 Helen HclenIlelei16475.0 Gould Gou1Il16467.0 always 16472.0 nhn s 6992.0 excites 16484.0 a7524.0 arent nreat nrent 16644.0 16699.0 rent reat16679.0 deal tical5616.0 ot5488.0 16664.0 Interest Intlflst16652.0 wherever whlleel7472.0 slw HhJ7352.0 slwoes HhJJOlS shDes 16836.0 16851.0 America AUlellcl6976.0 Americakhoso AUlellclWhOR Americallos -592.0 16868.0 16915.0 JOlS 4732.0 Des oes16879.0 There lhlle16896.0 1106184.0 16883.0 woman womnnvumnn17028.0 17075.0 WhOR 17071.0 khoso 5036.0 llos 17095.0 name IInme17060.0 IKis17056.0 better helter6588.0 17048.0 Imonknnw1117043.0 tlmttlUtimeublic tlmubllc ttlUImhUc 17223.0 17263.0 ImhUc ubllc ublic17260.0 nnllanti5680.0 17248.0 thell17243.0 IH17236.0 nlwnsngreat grentSlcntgrenturloslly greaturlusity Slcntcl11loIl 17440.0 17455.0 cl11loIl 17452.0 urloslly urlusity17460.0 5324.0 5628.0 see sechel11erherMrs 11erMrs 17644.0 118 17684.0 Tano TnnoJnimo17667.0 McM MeM17676.0 Ic 17671.0 17647.0 Smith tho7404.0 new nownowresident newPresltlNlt newresident 17839.0 744.0 17880.0 resident PresltlNlt17868.0 5396.0 17863.0 thothl17848.0 Federation 17859.0 -840.0 17851.0 cllern tlon 7008.0 17844.0 otatWOOl WomWontWontls Womns 7816.0 IInH 7844.0 18028.0 18103.0 InH 18100.0 ls18068.0 Clubs Clubllsubs18063.0 015832.0 18048.0 Indiana llUlInun18039.0 IJ18036.0 tliotho7124.0 wlfo wltowIfuototthe ofme 18216.0 18263.0 18299.0 meprivate prlltlprivmltesecretary RlCrctnr6784.0 18231.0 ot18220.0 timelnl 1I1l1atlnleorgo 1atcargo 1I1lGeorge 3200.0 18408.0 18459.0 George 18487.0 cargo eorgo5188.0 18452.0 M 18440.0 Pullman PullmnllPullmnm18432.0 lIlr1lcrhusband huslmrulnowwns nowwas iowns 18595.0 18679.0 owns wns18644.0 tho18639.0 street slrcet6036.0 cursystem 18652.0 stcm 18607.0 orSouthoil South Southtend SouthHend 3196.0 18735.0 tend HendoilIndBalzac 5192.0 Ind 11111IumlIumlIialzae 5492.0 Illnl1nc 19060.0 Balzac llnl1ncIialzae19055.0 hnlmnllemnde19068.0 lIomocurious Rtntcstatements Rtntcmenta statememits 19087.0 19223.0 19263.0 ments mentamemits19279.0 1Sits5516.0 19255.0 hla5660.0 984.0 observations ohHermtions19247.0 among amongomen umon Iwomell 19476.0 womell 19472.0 omen 19440.0 IIu IIIIIe19464.0 19467.0 sn 19427.0 6584.0 19423.0 dame dumedentewlwwhorears wlwwcarll whoears 19600.0 19668.0 rears wcarllears19659.0 orange ornnJe19647.0 rccn 6448.0 19612.0 6724.0 quarrelsome IUarrelsomciquarrelsomeno IUarrelsomciollequarrelsomeat19863.0 olle 4724.0 19859.0 19827.0 wlrowire19824.0 likes Ics 19811.0 hlnclebinclc6420.0 19839.0 6280.0 a6844.0 yellow 3cllow19792.0 hat lintlintencierous hatcachorous hn ttrcnchurous 20019.0 cachorous trcnchurousencierousindicates 111l11catccoquetry coquetrYicoquetryInk 20031.0 ipInk -24.0 20211.0 pInk Ink 20203.0 marks 11111111120196.0 gentleness gcnUencllsn11l1thoughtmtineutnl thought thoughtithoughtcnthncntal thoughtiHenUmoulnl 20359.0 20395.0 cnthncntal HenUmoulnlmtineutnl20415.0 womclI6264.0 affect affcct6776.0 gray grnYi7252.0 purple purpleenotes purpledenotes 20599.0 enotes denotesadvancing ntlyanchlJndvnncing20607.0 agcageThese ThcsolluRu7372.0 rules rulosrulesiardly ruloshnrlll rulesnrdly 20787.0 hnrlll iardly nrdly5252.0 20779.0 apply npII 5768.0 5984.0 20799.0 6312.0 20796.0 OWll20764.0 land 7132.0 n11l1ourwn ourown ourn 20952.0 21011.0 21016.0 4988.0 4852.0 20976.0 20971.0 IJecnuaeAmerican AmnerlcanTOmlnwomenenorally 7756.0 womenenernlly TOmlnencrnlly -504.0 21136.0 21168.0 enorally encrnllyenernlly21191.0 wear woar21156.0 whatever whateelfashionhie 7004.0 fashion tl1l1hlon7700.0 fashionible tl1l1hlonnhle 21363.0 ible nhlehie4992.0 reference rercreDCC21348.0 personalJlosyncrasles personalIiosyneraslcs 21343.0 1024.0 21548.0 Jlosyncrasles IdlosncroslcsIiosyneraslcs1088.0 IdlosncroslcsI 5920.0 22023.0 1EAHIHCS LEAHIHGSLEAHIHS1EAHIHCSv LEAHIHGSILEAHIHSI-1724.0 1304.0 22339.0 22432.0 22380.0 FROM FRO Trie Tt4cTmlrTrieRound Tt4cr 22343.0 TmlrS1 1160.0 21944.0 22363.0 4872.0 5736.0 22584.0 22720.0 22727.0 5588.0 S1 22819.0 1000.0 22683.0 1f10pS 1f10pSnOl1ll1 -1000.0 oPS oPSIionud 4828.0 23119.0 23159.0 Round nOl1ll1Iionud5400.0 23148.0 bracelets hrnclletll23143.0 23139.0 Jade Jude23127.0 covered cOlretIcoweredwithold 7784.0 Ith Ithgold 23351.0 23363.0 tracery traceryLilies trllcr trllcrLilleR 23367.0 4840.0 23563.0 23579.0 Lilies LilleRot23575.0 ullver oilverler 23599.0 gauze gauzo23567.0 forlint23592.0 cor carcorago corsnHe carige 1244.0 23767.0 23811.0 snHeigedecorationGloves decoration docorutlolldocorutlollGlOts 23979.0 24003.0 Gloves GlOts23999.0 tho23983.0 oldstylo oldslylo23991.0 slylu lacing Incnsallliailandasscls alllitnssels 24183.0 24195.0 asscls tnssels10501824227.0 au24191.0 huckbackTurnover hucklurnocr 24436.0 Turnover lurnocr24415.0 collars coHnrs24419.0 ot6548.0 fine flnolinewhltosilkernstltcited silk sillsilkomstltchcd sillhomstitchel1 24604.0 24616.0 omstltchcd homstitchel1ernstltcited24611.0 nnllamidetnbroiclered6028.0 embroideredSilk etnbroicleredSilk-964.0 24643.0 hroltlelcd hroltlelcdSilk 4844.0 24831.0 24851.0 Silk gloves glocII24840.0 lonJopenwork ollonworlopenworkfrlsts 7788.0 ollonworlwrists openworkrists -712.0 25032.0 25047.0 wrists frlstsrists25043.0 Cortorspring slJrlnnull25055.0 summer summerShirtwaist summerShlrtwnlst 25251.0 25271.0 Shirtwaist Shlrtwnlst25264.0 goods Joods6236.0 or25259.0 madras uiadrasllu1I1rn8gingham ginghamml ginghamIdJln 25255.0 hlltn hlltnnml 25447.0 25468.0 nml 25463.0 ml Idpique plquc5692.0 25459.0 stripes strlpCR1140.0 predominating predonhlntingpredominatingMushroom -1140.0 25483.0 prc predonhlntingMushroom omlnnllnJ omlnnllnJhlshroom 25680.0 820.0 25695.0 Mushroom hlshroom25687.0 hats IIMShints25683.0 composed COUlI10llcI1comuposed11lUrelyentirelyf 11lUrelyot7804.0 entirelytiny 7800.0 2728.0 25872.0 25892.0 25947.0 25887.0 tiny tlu 25879.0 rallies rullcRrufflesor25875.0 chltTau Chl1OllcldtrounllllamidsilkHandkerchief silkI1l1nlllcrehltli silkIlnnllkerehlefs 4848.0 26103.0 26111.0 Handkerchief I1l1nlllcrehltliIlnnllkerehlefs26107.0 Uh 6456.0 6564.0 borders tJorderborderxbordersdainty tJorderIn borderxL4716.0 26295.0 26311.0 26359.0 L 26308.0 dainty dnlnt 26303.0 violet Iolet26299.0 nml6392.0 rosebud rOllcll1l1designs deijlhllHdesignsKnots designsICimts deijlhllHI 26520.0 26532.0 Knots ICimts26539.0 uots 26535.0 at26527.0 chenille chcullllnud26523.0 6716.0 olt1 threadRh thread throllthreadrlth throllwltb 26663.0 26727.0 rlth wltbRhIons26751.0 onus 26756.0 emus 5668.0 8 26719.0 al80Cor26744.0 corsage corsnge26712.0 decoraon decora dccoradecoraIon dccoratlol1 26923.0 Ion tlol1tlol1Inncy 26951.0 onFancy 27139.0 27155.0 Fancy Inncy27143.0 brooches broochoscrab shape 6804.0 81I 27175.0 p withnrquolBo withturquolsl withirquolse 27327.0 27343.0 nrquolBo turquolslirquolse27340.0 body 27335.0 nnd27331.0 sprawling 91lrllwlInlogs Jegslegsat7560.0 ofold 7812.0 atgoll1 ofld 7808.0 27535.0 goll1 goll1Sntln oldSatin ld ldSatin 27756.0 27763.0 Satin Sntln27759.0 foulard 5264.0 tor27783.0 lIummerdresses droESlsinItt Inoft InElott 27948.0 Elott oft Itt pastel plstel27951.0 shades shadol6988.0 aDdpink pInkchlu pinkluliy chlu luliy 28179.0 28256.0 28384.0 28547.0 28639.0 fit 6052.0 29651.0 29659.0 6576.0 xmlns:ns4 ID16 13136 3100 7928 1656 ns4:type 11004.0 1656.0 1084.0 9856.0 980.0 CPCGOCOcpOF 1080.0 9860.0 cCCCOCOJO CPCGOCOcpO-976.0 10836.0 cCCCOCOJOOPICS -1080.0 10940.0 7996.0 1100 1960.0 F 976.0 9772.0 OPICS jOPICs8464.0 9872.0 OPICSDoccccooocg -876.0 10748.0 10412.0 CSl CSloocoocooccu 10928.0 7972.0 vaocco 1152.0 9764.0 Doccccooocg 8696.0 DoccccooocgtJmnl -1152.0 10916.0 7976.0 doooooi doooooiNUiinU 8728.0 1148.0 oocoocooccu aoccacoccc1036.0 1048.0 oocoocooccua aoccacocccHlcanlc-1148.0 10912.0 9796.0 R9940.0 9868.0 1lelllll 10040.0 10100.0 niii niiifur 2532.0 8456.0 NUiinU tJmnlHlcanlcNUiinUIf 8932.0 8460.0 HlcanlcIt 10968.0 8924.0 IIt -20.0 10988.0 IInl ita1ita1of 10200.0 8132.0 If8360.0 a8276.0 man mUllteen8440.0 8960.0 8872.0 Aof 9012.0 7984.0 oC9784.0 1118140.0 10024.0 10184.0 10304.0 10428.0 10336.0 10560.0 10452.0 10728.0 tii 10584.0 1thshoultl 10796.0 1tshould 10964.0 8244.0 raising lnIHluJrnishilg8880.0 siHIshould 8984.0 0011 omm10192.0 t10016.0 10316.0 10228.0 10552.0 nll10356.0 nllmrrnnged 10832.0 10640.0 vl vlVC 10784.0 shoultl8556.0 he8492.0 8928.0 Intrl1n IIparranged 9068.0 1072.0 9744.0 VC 9828.0 0110 9892.0 9964.0 110104.0 9996.0 10532.0 10464.0 IUII 10644.0 IUIIto 10816.0 10664.0 iii 11It 8844.0 II111 arranged mrrnngedntrl1n 8676.0 8512.0 8392.0 8744.0 yard yurll8624.0 yardoy 9080.0 3772.0 oy 8012.0 8144.0 8060.0 be liehe8364.0 mnlhnnik8608.0 madetiled 9760.0 If9924.0 19928.0 W 10420.0 r10064.0 hail 11111hcm10488.0 hcmtlletl 10564.0 hailpiiiiy 11111dlltI 9712.0 ill 3868.0 u01i 9816.0 9844.0 10008.0 they theywlil 10868.0 10556.0 thwitt 10692.0 tiled dlltItlletl8472.0 lint8292.0 8532.0 3952.0 lilt IIIInwill 7980.0 wittwlil8372.0 8268.0 8712.0 do tlo9800.0 nf as8892.0 i1 10516.0 10544.0 10548.0 nrapt 10792.0 10648.0 1Irt1 1Irt1nllt vt vtapt 9108.0 9044.0 7968.0 apt nllt8296.0 cat eat8700.0 8828.0 thothlthofur 9064.0 9748.0 Xc Se10388.0 9936.0 10440.0 10524.0 il 10436.0 10528.0 Ihr 10616.0 10632.0 10864.0 ir irfur fmHO so8348.0 8428.0 8488.0 8588.0 8920.0 wli lvliwliof 9128.0 9056.0 aa 9792.0 9916.0 10424.0 piiiiy pbumy9832.0 piiiiyof 10872.0 pbumyof ot8192.0 roomthey 8128.0 8196.0 room 1001118572.0 roomThey 100111jhl 8092.0 They 8112.0 jhl 8496.0 8580.0 feed flellevil8980.0 4927.0 oiij 8900.0 oiijmultiply no9716.0 or9156.0 9876.0 Ihlt 10076.0 rat 10280.0 ratthi 10144.0 Theymultiply h1IIl1tllll 10684.0 7960.0 multiply 1IIl1tllll8724.0 rapldl rnllhtlraphll8612.0 rapldlshould 9164.0 9688.0 Ilr 10036.0 ollllll 9884.0 10484.0 UII4 lmerrslmerrsslmmdd UII4fhoultl 5272.0 fhoultlslmmdd8548.0 hlho8792.0 5308.0 arrat 111111armnm8716.0 arrators 9160.0 thi tllIII thin10224.0 nilIInisi10580.0 oth IIIhutli10508.0 othjo 10812.0 IIIhIi utliern 1172.0 9680.0 Iia 5427.0 1111 9848.0 10368.0 shouldconsist 10456.0 hnul hnullon 10756.0 7940.0 ors ern8040.0 8176.0 em8164.0 8312.0 8448.0 8552.0 tho8444.0 5476.0 8596.0 8884.0 sun 8760.0 sunconsist 9176.0 8888.0 14m9100.0 titrd 9704.0 7944.0 consist 5683.0 lon 8484.0 8304.0 lst 8204.0 8576.0 oratto8732.0 twotho 9608.0 jo 9636.0 o9700.0 acres nClllI10256.0 5619.0 or10172.0 In1lIIattI10404.0 landThe 10808.0 In1lIthl IattIthe 5843.0 thothl8264.0 largertho 8184.0 larger 11I1Jl1-780.0 8808.0 Ithof 9204.0 9348.0 9660.0 fht9396.0 fence CIItIGan 10416.0 must IIIUlt10252.0 musti 10856.0 IIIUltor mustof 6040.0 or8172.0 COUl1I08736.0 8668.0 8912.0 8864.0 iitwo 9088.0 9052.0 igl 9084.0 9196.0 9224.0 9368.0 9228.0 9656.0 19400.0 9696.0 a9920.0 wall wulltvitll10300.0 nt10236.0 10344.0 10512.0 lonsl 1lIlIt10444.0 lonslOn 1lIlItt 10572.0 atst atsttwo 7948.0 6188.0 8232.0 8160.0 8000.0 8344.0 feet Celt8228.0 under 8636.0 underit 8780.0 1IIIlI 9144.0 10140.0 11I1 10408.0 stale Mnlt1lItMnlti staleit 10588.0 1lItIt 8156.0 wlI111118536.0 doubtlos tlOlhttlNdoubtles8432.0 doubtlosU 9356.0 protltablc poltllIhptotltahlr9576.0 poltllIhD 10476.0 10668.0 Wand 10824.0 6388.0 DJohns uhmlJoimuv8628.0 8756.0 IIIlu8248.0 8968.0 Nov NovTho 9248.0 9092.0 e1 9096.0 9412.0 6696.0 9648.0 nUll and9436.0 9992.0 Iloniostiud HII1II1Shl1llIloniostiudDraft Iloniostiudi HII1II1Shl1llThn10044.0 10068.0 10820.0 10136.0 10112.0 mustvul mustvulTin 8816.0 6964.0 Tin ThoThn9172.0 6971.0 1rIFor 9220.0 9568.0 9424.0 Draft UrlrrIrnft9600.0 DraftItjso IrnftInr 6811.0 956.0 8076.0 For IorInrn8584.0 8504.0 8948.0 8680.0 9028.0 nol volvelvolWould 9232.0 9416.0 7212.0 9652.0 Itjso tQQge9444.0 tQr IIh II9900.0 observation 10196.0 Ilnlhlll intlonIlnlhlllWoulll 10328.0 intlontvnn111 7227.0 Would Woullltvnn111Hiom 1I1IIs1t1118404.0 8964.0 Ietishould 9268.0 9672.0 99732.0 9808.0 tlnllIIIItintrace Itncttraceat Iii 10628.0 ilCU 10696.0 ilCUshould 7936.0 Nlmlll11Iwbe8708.0 8896.0 lr 9148.0 9236.0 u9048.0 ito 9264.0 9708.0 al9804.0 right llhltight10396.0 anglesto 10308.0 10400.0 angles ulIJlclanglescan 10992.0 7580.0 Ito 11012.0 8084.0 8476.0 icllar lotlnrtchar8400.0 9036.0 thitlmIno 9296.0 9276.0 9644.0 cnneasily 1IIIIIyenslly9888.0 10460.0 liming linag111111110380.0 liminghie linagequally 10996.0 I11ll 7887.0 Ino 11llhie7892.0 thC thotime8528.0 resistance resistanceovor 7924.0 8772.0 8568.0 8904.0 tnllll equally etunlly9260.0 clIall 10320.0 7860.0 dividedover 10160.0 10324.0 divided 11Ihh1dividedre 7928.0 8044.0 8108.0 ovor8116.0 8272.0 8340.0 8080.0 the8656.0 working worklttgworkingtier olkluj 9736.0 8088.0 9776.0 9912.0 8052.0 or1111ililt10060.0 10432.0 8048.0 sliottl lhoulPiotd10364.0 Piotddel sliottlftsos lhoulct delct 8016.0 8120.0 8104.0 As AH8152.0 limo8259.0 lori lnri8936.0 loritho 9284.0 8240.0 ftsos Ilmecs10048.0 8252.0 IIIl11weight whht10272.0 weightlovrivd weightthe 11000.0 7932.0 the8300.0 hitch 8688.0 8520.0 elm Hholltlsttonlshouldtlonatel 9300.0 8468.0 8503.0 lovrivd tar NI erttl9780.0 10352.0 propor IIIollmprnpnmproporIt 10840.0 prnpnmtlouate1 11008.0 8535.0 Itlonntto1 11020.0 8652.0 tlonatel tlonntto1tlouate18836.0 Good hl11toll 9292.0 8660.0 9216.0 Iwhen 9324.0 9664.0 9320.0 8643.0 9728.0 pulling 111tl1I1pnhl11g9724.0 Iv 10448.0 8663.0 10480.0 done Bancdonegood 11111when Bancvhien 8812.0 vhien8452.0 8840.0 thothl8356.0 team lentil9252.0 Iih9256.0 8848.0 lilag 111011guntl10176.0 firm hlIII1r111foot CuuIfnutfootii fnuthog 9003.0 9035.0 lag 1111hog8316.0 9040.0 l11ulilttI8188.0 9032.0 thlM8592.0 114Ishitch 9720.0 9812.0 9008.0 Lining 9896.0 10576.0 lat tag 10472.0 timetimehitch 10892.0 10672.0 Ih Ihhitch 9195.0 8388.0 In1v8320.0 9259.0 thothetithe t9227.0 9sdvnvn IhI1I9820.0 fir 10028.0 iwn toward mvard10284.0 towardi 10896.0 9207.0 mvardthe 10392.0 9384.0 9448.0 gr Jr8664.0 nd 11mid9120.0 9419.0 Mn tinMnspoiled 9328.0 9431.0 9824.0 9387.0 gontl 1111111gnat 10292.0 111111IamuIsicil isspoiled 11016.0 9480.0 INIIOIIIII 11028.0 9604.0 spoiled NIIOIIIIImillmaddim disctdimhitch Itl 9640.0 9140.0 9643.0 9676.0 icil NIctt9579.0 lufaiisi btrm151k9852.0 UIIIIlI 10504.0 thefir 10904.0 theIii 10716.0 10744.0 IIIhitch 11024.0 9611.0 8328.0 8096.0 tcli 8420.0 pulls 11111148324.0 tllllI18788.0 9336.0 Iticnro 9392.0 Ir hr10000.0 ftcttll 10260.0 9771.0 5rent UrulUrulcnle 10900.0 5rentto 10620.0 retmt retmtente 9960.0 10015.0 cnro cnleenteslioviJ sliorJhllie9152.0 10012.0 use 118luseejijwry tn10020.0 luivo 111119952.0 iulv tlnlleissnry linnet tlnllelinnetof 111111IIlnl ejijwry issnry1IIlnl Tolglit velghttlhht 10207.0 ouonaccount 9984.0 10163.0 10208.0 10052.0 nook 11ctklIlI 10736.0 mnccoutt 10740.0 unmonpalllnc 10908.0 unIcom 10335.0 Icom nccouttaccount -520.0 8616.0 10367.0 orat8852.0 dialing lInllllJciullmig8776.0 dialingtie palllnc gMilne9944.0 9988.0 10264.0 10712.0 lit liton littic litIle 10527.0 ticIlepowdered IlowlllIlIJpotvtloreti10559.0 still siiljRull9004.0 siiljplaces en10004.0 sttili lIdlsu9isoro soyasoyalnces 10612.0 soroics I11 I11Illncl 10719.0 places Illncllnces 8408.0 tol1vu9072.0 Hirer Hirerully 9432.0 9112.0 hlll 10751.0 ics IONIesn9904.0 10759.0 10124.0 tlty mitygoner J1nllgtoergonerlieilliiioly J1nllIII gtoerIlly 10848.0 10931.0 ully Illyheals IlInlH10936.0 thothethslIitslfleshcont 9440.0 lieilliiioly ncdlatlylwIIIlIII 10520.0 10700.0 ilcdtdttent 10876.0 10704.0 ilctms IllCllIt 11096.0 11132.0 contCllIt11155.0 care lUC11128.0 110hetnl lul9016.0 tnlFarmer 11123.0 tms lfnIctTttugc10132.0 10276.0 11143.0 Jiitld ittddJiitldnnxcn 11104.0 ittddlnruur 10652.0 ulltl ulltl1mmer 11315.0 Farmer 1mmerlnruur1696.0 11655.0 11680.0 To Ufllr ilrncl8768.0 9312.0 11712.0 n9244.0 IITho 9684.0 11684.0 err rant 9908.0 rantThe 8068.0 11803.0 11832.0 Tho11860.0 wrung 11864.0 101lJ wnr9304.0 9420.0 et Iht strain 10680.0 ont 10920.0 11988.0 12056.0 8008.0 12052.0 corner OInlIpost IWllt9168.0 12027.0 oful11II11111 hc 12000.0 ftner fromnlllitlg 12180.0 12207.0 11II11111 nlllitlg12212.0 uut12219.0 8976.0 9288.0 12216.0 hIt 12192.0 rottntl 12204.0 Joint 10540.0 Jointt 10924.0 8036.0 8516.0 a12420.0 barter IUlueltm to9240.0 tmnnACr 9472.0 rocks uent uenty 10888.0 13564.0 9344.0 13859.0 lnnAcn 13856.0 Lr tLr 1336.0 14280.0 14231.0 14219.0 lf 14283.0 8380.0 14664.0 nnxcn nnACrnnAcnFon ron8856.0 9504.0 14667.0 CONNER C011SCRQoltllaPOST 1OST10128.0 lO T xmlns:ns5 ID21 15080 3280 7880 14940 ns5:type 14940.0 14999.0 erIImlmid14948.0 aucccssf lucleB8fsttccesshtiicthod UlClhl1ulelhotlIAtojiost toLLattnnnfthe 1060.0 15128.0 thcutnunfthe LLattnnnfthethcutnunfthellost -1060.0 LLattnnnfthepast 7952.0 15231.0 15256.0 past jiostllosttort 15260.0 8640.0 15292.0 stoic stonofltoncaiuWi un trim9864.0 trimsix Wtft Hr 15263.0 tuu tuunix oJ oJNix 15356.0 nix sixeight 8620.0 llht 9020.0 teotrr frfrJj 9548.0 base hllSC15396.0 nline 10804.0 11naline 11line 15583.0 8236.0 15612.0 tho8648.0 15608.0 rCIlC 9668.0 15588.0 rhat rhntVint15591.0 wllllull call Corfortwo Cortwu 15772.0 twu8336.0 nteach eorncrAinorlcan 8944.0 15824.0 -1416.0 Ulcrlcull luterlcnnAgricullurlst Agri AgllAgriculturist Agllcult 10952.0 15836.0 culturist cullurlstculturistHtnrt 15999.0 cult cullurlststart 8284.0 16028.0 rlli tRlnrt 16336.0 16356.0 HtnrtRlnrt16344.0 With Witht8524.0 Ono One8956.0 9316.0 Vnrloty nflotynrloty9428.0 or9456.0 ntInullry ntInullrySelect 10724.0 Ioiillrj IoiillrjSelect 101111 rSIICI 8072.0 16512.0 Select SIICI8480.0 16524.0 16536.0 OIWammo019620.0 varieties lrletioRvarlelles9520.0 16492.0 orpouttry 10624.0 pout poulllOul10948.0 poultry llOultr 16539.0 16676.0 16711.0 try tr 8260.0 thntsuit Hultstilt16723.0 your OUl 9496.0 16691.0 fancy 9500.0 rllne 16688.0 aminndrequire rOfUlrlrequirements rOfUlrlUllntt requirenlents 16736.0 16871.0 16900.0 Ullnttnlents16891.0 111111stud8396.0 16888.0 cIauot16876.0 attempt IIttemptntteutpt9484.0 keepmore lecelllecellmOle 17115.0 mOle17092.0 nt17107.0 8740.0 rnte8876.0 17083.0 17063.0 3oU10636.0 havebecome 10536.0 hnchnchecome 17252.0 17280.0 become hecome8560.0 17268.0 well 8500.0 8940.0 acquainted ncquulntClIncgtutintetl17255.0 whnt17275.0 youhave 10656.0 10732.0 youhuc 17467.0 hucOlllOnebrood hrocIlbreedalone nloucatomiccnn10232.0 17447.0 IJhousedand housed houRedhouRedanll 17627.0 17659.0 anll17652.0 cared cllll117656.0 tor17639.0 9060.0 loss lessIe liS 9972.0 17664.0 expense etllCIlHenullantiandyou nullou antiyou 17827.0 ou 17876.0 cuu17836.0 attain nttuln17871.0 ahigher hhhor17831.0 stnleotper pelpeltecUolI perfecliml 18007.0 fection tecUolIfecliml18031.0 lhoime 18056.0 owner ownur18016.0 9508.0 18019.0 111110 18024.0 heIJCttlrableto ohleohleto 18203.0 18223.0 supply SUPIIIeggs ug11wllln9588.0 18211.0 ordered orlloroll9528.0 10244.0 tothatch hatching hatchlag 18208.0 tch tchlnJ 10984.0 18400.0 18427.0 inglnJ18420.0 nl111tvlllho18403.0 ablonholearn lenrninuremorenbout moreoJOut inureabout 11156.0 18472.0 18583.0 18619.0 nboutoJOut18612.0 tho18600.0 fowl Cowlthnt9512.0 heliemakes maleHnspecial IIlleclnl10384.0 specialty IIlleclnlty18767.0 18816.0 ty 18804.0 18799.0 thlln18795.0 18784.0 keeping leeplnJ9692.0 ac rnl 9840.0 18775.0 varietiesAnd 10248.0 nrlatlcavariatiesvariatiesAnd nrlatlcaAmI 18972.0 18996.0 And AmI18987.0 whnluCwiuttever18976.0 numllernumherofbreeds 9836.0 18979.0 atbreeds IJrceds10092.0 18999.0 wcwekeep wclCep 19159.0 19188.0 lCep19179.0 8952.0 19183.0 1I0t19171.0 1m 19203.0 thoroughbreds thoroughbredsThero -1132.0 19164.0 thorouJhhr thoroughbredshero 19196.0 10944.0 IlR1 IlR1llllrn 7964.0 19356.0 19376.0 Thero llllrnhero nIlenough clloulhkinds lh1l18Cor19380.0 anyone nl1YOlletoBcloct 11032.0 toselect toseJcct 7956.0 19543.0 19563.0 select BcloctseJcctCrom19555.0 19560.0 9124.0 f19580.0 woHhould9468.0 19575.0 cross 19568.0 sever Beversevernl 19572.0 Bevernl 19735.0 19763.0 19747.0 nrlctlestho8860.0 chances clJnnccschnnces10056.0 19767.0 1110aretlmtwewould 11036.0 weWoultl 19923.0 Woultl8908.0 19939.0 get 19927.0 nllthluJ19952.0 nsdesirablen desirableas10332.0 desirable deslrale11152.0 20112.0 nK as8136.0 20139.0 tha20132.0 IIreedll9104.0 20119.0 already nlrlIl1y9024.0 established cstlllltlRIICll20115.0 andto 10752.0 1111111111to 20307.0 20343.0 20327.0 Rtnrta20348.0 now20311.0 breed IJreellor 9768.0 variety urloty20336.0 reqnlrcs rellulres retiuires 20491.0 20523.0 qnlrcs llulrestiuires20543.0 years 8672.0 cnrll 20508.0 ot8972.0 20496.0 breeding hrccdlng1reedinganllwhile vllltowhilevo 11048.0 whilewe 10676.0 vllltowe 11052.0 20683.0 vo 20740.0 arc20715.0 nt20695.0 20691.0 la Inht20720.0 10496.0 onuoneonowants onewants 20875.0 20907.0 wants wnnts20923.0 20927.0 20891.0 at20912.0 9524.0 20880.0 stock Htocklhe9932.0 proba prollllproiaprobabilities prolllltJllltllR proiabllitles 21067.0 21092.0 bilities tJllltllRbllitles21115.0 21119.0 21107.0 WIivt9280.0 21072.0 tire tlro9556.0 21075.0 atthcm10164.0 21099.0 011011IIchcs 21252.0 21284.0 selves IIchcs21279.0 before hcfol21299.0 wo9000.0 accomplish nccoU1IIt1Hhneeompllslm21255.0 anythingPractical -704.0 21291.0 thlng thlngPInetlcnl 21456.0 21471.0 Practical PInetlcnlIoultryman IoultrmnnIoultrymnnIoultrymanHnir Ioultrymnn1nw-912.0 IoultrmnnUnw -908.0 21807.0 21819.0 Hnir Unw1nw21811.0 lee Fred FredIt tII tIIIt 21848.0 21971.0 21996.0 8376.0 21988.0 21991.0 nol21983.0 22003.0 an9476.0 21999.0 easy lusymatter mntter21976.0 tntodetermine 11056.0 tnelltelmllla todetermimhle 7992.0 22163.0 22183.0 determine elltelmllladetermimhle22176.0 just 9308.0 how 9740.0 22168.0 9612.0 22200.0 Cccilpoultrpoultrysince poultrRlncc 8004.0 22351.0 since Rlncc22368.0 local locillconditions ollllltlonshue22355.0 much 10096.0 22360.0 10592.0 dowith 11060.0 22543.0 22567.0 22563.0 thothu8752.0 22547.0 detail dllIlIlIdetails8684.0 Itall n11811climates cllmnteHclimmntes10688.0 22575.0 herethe 22572.0 werlhereworethe 11064.0 werlthe 22732.0 22764.0 22784.0 sumo IItl1ll0snnie8256.0 22747.0 rind8748.0 22775.0 liltnil9532.0 foods 22735.0 cqunlly22759.0 easyto 10772.0 22767.0 IllI 22919.0 22956.0 1022971.0 procure proeml22935.0 then hillI1mPl22924.0 thltine9624.0 IUllItlOI1woultlirouhlhebean henn 23011.0 23171.0 nn7908.0 23163.0 23168.0 efls 011523156.0 1I11l9116.0 lIut23107.0 nit23111.0 thll1 23151.0 10296.0 23116.0 being Inln 10720.0 dif cUtdlfdifferent dlferent cUtC 23175.0 8020.0 23299.0 23331.0 ferent erent23335.0 rcnt 23348.0 WIwt23339.0 art IIrtire23303.0 Corcclltu8u1llt10080.0 10760.0 tint thnttllntthntmethod tllntmC1lholl tintmethod 23488.0 23515.0 method mC1lholl23499.0 whilhwhleh23511.0 HOCIIH IitlIIIUseeulsbest bCRt23495.0 suited suHellstilted23520.0 ourindividual 11068.0 ourhlllhhlulil ourJndivhluul 23688.0 23703.0 individual hlllhhlulilJndivhluul8868.0 23723.0 case amse23735.0 ali 9580.0 gOOllwny 23715.0 m1l123712.0 otii 0111oatioatiwhich otiiwhich 0111whlth 23871.0 23895.0 whlth23915.0 fHlllIfstems23880.0 1II0litgenerally HCllerallyaccepted acccptedacceptedIK acccptedIacceptedhi-660.0 24079.0 24091.0 hi24119.0 nKfollows follllWlIfollowsOae 8508.0 follllWlIOne followsOne 24251.0 24279.0 One Oae8564.0 24283.0 quart elulIlt24264.0 grain Irnlnon grainoats24259.0 oats tA wheat wJllnlair10828.0 orbarley 11080.0 ormler airbarley 24444.0 24471.0 barley mler8644.0 24451.0 vartod nrh11vnriett24479.0 1114III24447.0 order ortIernamed 11IlU1lllnnmednamedto 11IlU1llltnnnmedto24680.0 tn24655.0 cucli 1llchceci24651.0 fifteen lnlIl1tifternfowls 24671.0 nilasearly cnrJ 24675.0 aM24639.0 theycan 11088.0 tile tileCIHl 24823.0 24883.0 CIHl24879.0 nee see24847.0 IIIlu24860.0 ouw Crolnrain 24835.0 roost rooHtOr 10800.0 bet lItlIttr 24887.0 25015.0 25052.0 ter tr25035.0 stili25027.0 scatter IiClIUer25020.0 nt25023.0 night al111bury huryhairyburywell hurywelt hairywell 25232.0 welt25227.0 Iii25219.0 t11e8692.0 25239.0 25223.0 straw strnw9452.0 rn 25203.0 at25207.0 scratching scr tChIJl shed nhodIlwllnhodand shedand Ilwlln11111t 25427.0 25419.0 n11111t lot let25411.0 thc25395.0 Avis fuwlsvwlsbegin hlJlll9332.0 25431.0 25404.0 carJynextniurnitl nest nctnextnestmorning 11092.0 nctlIIolnln 25611.0 morning lIIolnlnniurnitlmorningAt lIIolnlnt niurnitl1t25771.0 25811.0 At 25815.0 25823.0 noon IIOIIuoum11101 9200.0 rnln 25783.0 rented25787.0 rente ashlhehefnrnIn 10880.0 hl11ll 25843.0 26003.0 fore 25991.0 fnrnIn 8352.0 25988.0 fu126000.0 11ll JIH asoften othm25971.0 during daringdurlll 10492.0 25975.0 thldnydnyas lira liranil 26160.0 26219.0 nil11526183.0 8208.0 26167.0 1fJlt15cease aIlO 9584.0 26163.0 worl111ththetheevening tinevening thellln 26347.0 26375.0 evening ellln 26399.0 a26351.0 IJl1l1rt26363.0 enchdozen rtoxeneo1en26355.0 11IIHfowlsof 11IIHor 26575.0 or26555.0 cooked coolWl1cooiwrlmash nmuslIIlIl 9464.0 26543.0 26547.0 conipOf otcookedvegitnbles cookcllcookedvegetables cookcllItollha 26724.0 26747.0 vegetables vegitnblesItollha mid 111111andequal Nlual26731.0 parts pnrtR26735.0 ut10240.0 26759.0 corn cornmeal 11100.0 cornmenl 26911.0 26947.0 meal menl26931.0 cool8416.0 26968.0 nllI middlings tniddllngs1lIIddlln 9632.0 26915.0 slightly IIhChtly26919.0 saltedAn Halted MllltellsaltedHaltedAn Mllltelln 8200.0 27096.0 27148.0 An 8332.0 27167.0 27151.0 ounce OUlICO27128.0 9208.0 CUI9132.0 27099.0 towl27107.0 twice 1127111.0 weekof eel eelot 27288.0 ot27315.0 ground Jrolllflgroumlgrnen27291.0 bone honengenerous generoungenerounsupply generousSupply cnerOIUI cnerOIUIIIU111111 27475.0 27511.0 IIU11111127503.0 at27487.0 grit rlt nnll27479.0 fresh tresh27500.0 water fntcrventer27491.0 Invery Incr 27660.0 27735.0 27739.0 cr 27692.0 cold 27671.0 weather wentllcrtbe27675.0 ater 27679.0 tJbflllghtly tJflll beslightly 11108.0 27855.0 27887.0 flllghtly slightly27899.0 flll -588.0 htly 27859.0 warmed wnnnlllplaced plflcetlpJltcecJ27867.0 where whero27875.0 Itwill 11116.0 it1vi11 11112.0 28043.0 28083.0 1vi1128079.0 28071.0 freeze 1092.0 treczlIIomc freezehomeHome 28051.0 BDllanti28055.0 10216.0 Farm Farmt 28087.0 rm 28455.0 28599.0 28643.0 28751.0 1i 29695.0 29875.0 29911.0 stilt xmlns:ns6 ID22 13000 3172 11072 1772 ns6:type Ia2I1G 11332.0 ZltC 11940.0 AT 12040.0 12144.0 12276.0 12504.0 GIRLS CIRI5GIRIS12368.0 13144.0 COLLEGE COLIEGECOLLEGEriii COLIEGEr13884.0 COLt 13688.0 CE 13516.0 CEr 13864.0 riii 11308.0 11176.0 11524.0 idiot iitlinidhll11476.0 11924.0 IIn12080.0 2092.0 Mm 12148.0 111f1 io12344.0 12468.0 fuller nlhrtnllrrunit IUIlIntul12904.0 13332.0 tlj 13224.0 U13628.0 Onlottl UrlrlllOrilrulOnlottlHunt OrilrulImurtl 1136.0 11984.0 Hunt 111111Imurtl12416.0 111imlnrTnIk 12548.0 tindePalk 13080.0 12636.0 imlnr 1IUll1fltinde11304.0 TnIk Palk11336.0 11624.0 11760.0 abmit 1111111nlmtt11580.0 12312.0 hazing hnztllg12168.0 hnxll1 12816.0 12984.0 wllhwItli12708.0 13512.0 tnbtQelilti 13336.0 talwo tnhqtnbtQe14012.0 talwoMI 14008.0 tnhqI MI 11192.0 11216.0 mill all1lilti860.0 11948.0 gymnastic gymnnasmiesII12808.0 13180.0 Isnt hllltism1t13064.0 13620.0 III1n13500.0 13868.0 Ihl13748.0 theMian 14096.0 Ihloallll 14068.0 111s8 Mian oalllls8 11404.0 11244.0 11212.0 11784.0 lnss 11704.0 wilhnIIit11852.0 12348.0 Ihl12272.0 12572.0 12648.0 teal tost12988.0 IhIIUJ1I12908.0 13640.0 lvbith13592.0 whichin lvbithIIt 14092.0 13904.0 IIt11368.0 siinliits sIII1I111Path 11992.0 11696.0 1115 11720.0 12064.0 12136.0 12284.0 u12200.0 12444.0 12360.0 12604.0 lW v12772.0 12864.0 Knglnnd itimgliitli1IIla 13320.0 13292.0 tthiegecollegei tthiegefor 111228.0 11296.0 3260.0 1tatiIrti11536.0 11111111 put Ilutlint11920.0 a12592.0 masculine llIuMnllnl12464.0 -764.0 iscnihte 12716.0 13472.0 visitorYlill 13476.0 visitor visitoraid 13568.0 13700.0 ltll1 13600.0 ltll10I11 13936.0 aid Ylill0I11 11360.0 11288.0 11452.0 ilio Ilto11520.0 11480.0 elan11636.0 wllhtvitIi12076.0 bashful 12500.0 IIn 13156.0 12860.0 hrl1 12756.0 13252.0 tendencies ItIHIIWhl4tauhnltstendenciesI ItIHIIWhl4ItauhnltsI-800.0 14052.0 11172.0 wns 11204.0 11436.0 11528.0 11500.0 11668.0 nciir mica IIlI11996.0 11908.0 Iho IJ 12304.0 eulirgoIul 12900.0 12580.0 12976.0 anti12688.0 13248.0 13072.0 768.0 concluded lnllCll1hHIconcindld13196.0 concludedto lnllCll1hHInconcindldIli-768.0 14100.0 Ili11324.0 Mil hili11328.0 hlllttvu 11564.0 IWO11956.0 12068.0 birds hhltHhiiM12564.0 wllhivhll12452.0 13016.0 our13020.0 13288.0 stone 13236.0 13400.0 IIIIII 13912.0 13660.0 byMowing 14104.0 byvle1v41g h111 14000.0 Mowing vle1v41g11756.0 tliobuilding hulhtlllbulhllu11888.0 1111112696.0 calling 1llIIl1Jcnllbtg13052.0 13752.0 Oil8n13668.0 14020.0 a13924.0 afiirml nrlilIIII nfriiuti fiirml rlilIIIIfriiuti11688.0 IIn11516.0 11884.0 4200.0 Htitdiitt IlIlh1I1smtdenttliiio fiat12964.0 12608.0 13084.0 lit12920.0 tho111113232.0 13708.0 saint snumisaintUnit 14059.0 snumithii 13860.0 14032.0 13964.0 Unit 11111thiipresented lnoPrntrll12516.0 12624.0 myself mrwlfInystIf13228.0 nl13140.0 13484.0 thothe13376.0 13824.0 hall IIntlhallwhoro 13828.0 IIntlII halltvkrre whoro tvkrretiny11916.0 11t111l1frltudlived 12880.0 nnlittm 12884.0 nllll4584.0 sent 1IlIt13148.0 13624.0 111113804.0 mycard 14116.0 myearth card earth11700.0 Intellect 111111111111904.0 12724.0 tlleetotl mil 12912.0 looking InnklnIookiuim12916.0 13788.0 JhI13632.0 girlwho 14044.0 JhIwllo girlWhit wlloWhit11508.0 111392.0 11676.0 guess gllts11556.0 12188.0 1tii512084.0 WU it12400.0 12672.0 12792.0 student IIIUlltIItsiltdtlit13520.0 ushered utIllllImslmeretI13360.0 usheredmo ImslmeretIlilt5151.0 mo 1111liltloaf hiio1111011728.0 n11656.0 11800.0 5160.0 parlor ptmlnf11928.0 llm 12044.0 12308.0 12684.0 12508.0 12480.0 12764.0 left rt 12852.0 13100.0 5176.0 I1lmitemoI 13312.0 I1lI 11224.0 5380.0 11316.0 1found fnllllllfnu11dmrzI1fnlystlIIIlu12524.0 12760.0 13048.0 clIllIrenentr12892.0 Ilsernnni 13784.0 13888.0 lhlIlse14120.0 thoroom 14124.0 lhlrnll1 rnnni5587.0 rnll1 11544.0 wllhlviih11372.0 11960.0 11880.0 12128.0 door 11111112536.0 Ittit12680.0 IIht12804.0 IlIelfind13892.0 nil811nilIhl 811other 14064.0 14088.0 5747.0 other Ihl further IIIhlI 12108.0 IIllIn 12676.0 littit12496.0 1r12820.0 13220.0 loft hCtleft13524.0 13848.0 had 11111haulhaulJust 13852.0 hadJust 11111j14t 5912.0 Just j14ttlmo111111IDglance glanco12324.0 12472.0 1I1O 12840.0 around arouad12720.0 12844.0 5956.0 13380.0 12944.0 rfl11l1 wlll1lwhtn14040.0 ayoung 14128.0 1Inll 14076.0 ayou 11184.0 Inll 11548.0 11448.0 11612.0 nunmtllIlIln 12160.0 CO 6156.0 canto llllt12380.0 iuie 12620.0 lu12828.0 nttit13108.0 thothl13040.0 13412.0 rlgllt13416.0 llh 13772.0 13844.0 antltnssrd 13716.0 11111antlandpassed 11111lnl tnssrd6360.0 11740.0 me IIIl1nu12088.0 12412.0 wlhtvitllanIntent 11I1t13076.0 13816.0 look Innlionic13676.0 lookwhltli Innlhh ionicwhhli 14072.0 14080.0 whltli whhlihh jllt11976.0 oAoapcd evtapedI111ell 12024.0 6503.0 IHIlIJ12568.0 13120.0 n13280.0 stare slaro13208.0 13284.0 lImI 13664.0 Sho HhtShuShodidnt Shudidnt Hht11hlllt 6715.0 didnt 11hlllt1I1t11stilthmlimitdisappeared IIIlnlllllI111dlsnppenred12372.0 thrfluhtlirouglt13408.0 throughthe thrfluhI tlirougltthe 111101loot11292.0 nttit11736.0 Iht11944.0 12248.0 hfl12164.0 12784.0 AlInl1lIlmaul 13136.0 13492.0 followed rol1owlllFOulOVilfollowedami rol1owlllnnll FOulOVilDud Dud aminnll11460.0 nllolhllutnther11364.0 nllliami1Idually nally12540.0 tlllntl 13012.0 hey12612.0 13104.0 t1lI 13432.0 13300.0 11111mime 13672.0 14004.0 InIna IIIn iiin 14136.0 a11276.0 regular regninr11912.0 procession proeessilu1IIII 12700.0 12488.0 ll1u 12296.0 12928.0 1IIIlIt13608.0 belltvrIhtit 13612.0 bellovo hlIIIIbelltvrbellovothat 14148.0 hlIIIII 7448.0 hltIhtit7503.0 11412.0 11492.0 111111136.0 11732.0 11mny11644.0 1II111 persons 12552.0 nlll4 12888.0 eould 1IUlllronlll13368.0 be1I0uwllhousedIn 1I0uwllInhousedhimhimlIullllhlIwltl1llvlca12836.0 13176.0 size slrotllw13572.0 oC13464.0 Ihntthathall 14160.0 Ihnthnll 11120.0 7875.0 hnll7872.0 nllelmitt11388.0 7896.0 limit11964.0 n1 12292.0 12392.0 sure 11111suit12812.0 Ihnthint13216.0 7840.0 IIC13928.0 thotimethoyoung tillrlllJ timeynuug 8099.0 rlllJynuug11672.0 1vom11itOlllln 12300.0 Jlnssllpnastd12208.0 IwllItwiet1s13308.0 13692.0 8067.0 llIlhemrh13720.0 eachwont llIlhWI1I1 14156.0 emrh11vnt 11124.0 8220.0 wont WI1I111vnt11572.0 11744.0 11824.0 lhl 8280.0 gave govta12728.0 glanco Ilnlllglnnc12640.0 whlth13212.0 13836.0 took loultonic13744.0 tookIn loulIII tonich III11352.0 8451.0 nil11220.0 I1C11532.0 11856.0 mlnu11768.0 rwmCrumtlioIht12512.0 part IlIut12832.0 flC13544.0 13456.0 hair hairto 14168.0 hairIn 14024.0 111In11568.0 11628.0 style stylo11716.0 11748.0 12048.0 or11952.0 leyshoes alumsshoesl alumsIty lhlll lhllln 12876.0 11400.0 Ity 11484.0 11111nod11560.0 12072.0 12252.0 wljon wlllll1tllrn12156.0 12936.0 everybody 1lIholhtrtsryhndyIhnt13736.0 thatcould IhntIoulil could Ioulil11664.0 alarmed nlmllIlllnlnnmed11828.0 12712.0 hall13112.0 Inspected luspteted13960.0 1111numooften 1111IIfftll nutuft 14132.0 IIfftlltuft eu Inou1o11ennnghmay12132.0 12432.0 flll11l12244.0 cane13116.0 13424.0 13488.0 down IowndnwnIliMrniil Ihnrlllllhnt IItnrued 14164.0 liMrniil Itnrued932.0 hnrlllllhnt 11692.0 Ihult12288.0 hnllhullbeen 111111peen12556.0 13056.0 suffering HnOIIIIItfftrimug flollfromui flollI anti antiono 11111ui 11496.0 9616.0 9631.0 tillcollcgfrnhItuslnnisIlllom She Slit13644.0 hltlJedJednot 13908.0 hadnot hltllint 11148.0 lintretvlved reeiivett11464.0 9835.0 lII 11788.0 hl1I 9823.0 111111nnlll13348.0 9803.0 IIIrmayInspec luspceInspection luspceIhum 13792.0 IIII IIIItliln tion tlilnIhum10027.0 IIM nhoulnbnutended C1lllIIetlictl13096.0 12868.0 13244.0 IhnulhtIhnugltt1I1lone13840.0 onoInspection 14188.0 1I1lIlIslllltlnll oneInsptetlan IlIslllltlnllInsptetlan12012.0 nf12264.0 mC12484.0 wnullvanltl12340.0 10156.0 satisfy sntlsty13036.0 IIltIlr ttllmtlitmthemand tlitmlumd 11144.0 10387.0 1111lumdIcalled tnlittignin 12120.0 again 10undergo 11hrf11nudrgn13504.0 tliothe13808.0 samo Hnml13739.0 samonrdeal Hnmlnlltll smi 13980.0 13952.0 mimentdell nrdeal nlltllntdell11868.0 12332.0 hmrv 12376.0 havo hnIotiut10547.0 acquaint IIlqunllllncg11nhn1acquaintances IIlqunllll11H11 ncg11nhn1it11ttlt ances 11H11it11ttltthltlPIhlI nllllI1111InKlilt511111nil0513124.0 13604.0 1111t 13820.0 ap 11113976.0 Illpears 10919.0 pears 1111111IIIhttill11111hut12112.0 10951.0 slop Ihlllstillhem13428.0 nlll nlnke13652.0 makelier 14208.0 mnl mnlhlr nlnkeher 11160.0 lierhlr11488.0 talk InllImilktn1o12104.0 I1IumoIInlll12748.0 11164.0 fIIIIfrirntt13696.0 11140.0 camsThe cams rnmcsrl111HIrnmcsTho rl111HITIll 11312.0 TIll ThoThe11355.0 telor teortetec11344.0 tote tItlletcdoesnt Ihnfnl11335.0 IIInlthotlit13680.0 proces IIIUNprncrPprncrPsion 14180.0 11504.0 sion 11111111539.0 huhum11527.0 12124.0 relievos relieyrs11512.0 IhoIli13364.0 embarrass UmhlllIliSemilbarrmssembarrassmont -804.0 UmhlllIliSI emilbarrmssmetitNIw 1012.0 metitNIw 11739.0 mont -1008.0 11724.0 Yhrk York 111112692.0 11719.0 SunWISE Sun HUIIHUIIWISE 12059.0 WISE 12644.0 WORDS WORDWORDSAvarice WORDMlcl WORDSIvntlce 12367.0 Avarice IvntlceMlcl 11900.0 Increases InrrlnNI1IInetnseswltIt12668.0 12732.0 13068.0 12352.0 incroaslng hncransingincroaslngpile 14236.0 hncransingVila Illcrnlln 14232.0 Illcrnllnplio 12539.0 pile plioVila11540.0 oCgnidluvennI gnidluvennIGetting -1112.0 -1108.0 Juvenal JuvenalGetting Getting OlllhlJ12016.0 11110lulndebt Ileht12763.0 11412744.0 13088.0 celling t1UhlJntltngInloaalatiglcsomc 14223.0 ntnuglrsoua 12952.0 latiglcsomc tnuglrsouallJhl 13007.0 net 12240.0 Franklin 1runhihtFranklinGood 1runhihtflood IU 12955.0 13060.0 IIl0I1I111tlnnH 13207.0 flood936.0 13199.0 l0I1I111tlnnH actions 13184.0 ennoble IlInuhll13340.0 nUll13204.0 Wlwe13996.0 nlOmearctho nlOthl methe thothlsons HunR11420.0 fir12096.0 um12364.0 floods 12736.0 IhlItieUllIlllll dtedslervnutet1352.0 IhlItieUllIlllllolhlll -1404.0 dtedslervnutetNotmimug -1352.0 Uervanton UervantonNothing -796.0 14212.0 13623.0 Nothing Notmimugolhlll 13647.0 sooner 1I00IIIer11836.0 12652.0 13603.0 overthrows Olrthlot12544.0 13635.0 13712.0 13832.0 weak wInleweakbond weakhcmul bond 1111111hcmultllInIhnuopinion 0111111011oplulou12824.0 13803.0 urnulliorhySir nulliorhySirI -1136.0 authority llutholItSir Hlr14016.0 ISidney Shimmer11256.0 SidneyTho Shhl Shhlflw ShimmerOle 14211.0 14248.0 Ole Thoflw14243.0 certain llrllllIeertnhm12336.0 14268.0 tvny12236.0 14272.0 12740.0 he13128.0 14224.0 cheated 1IInllllehentcd13900.0 14216.0 14228.0 13932.0 tofancy 14240.0 toflmcr tonney 11196.0 14411.0 14448.0 flmcr14475.0 nney 11752.0 14472.0 oneA14431.0 Helt12660.0 14455.0 1111110nunu12528.0 14420.0 cunning cUllllluJctumllugthnl1Ihnuthanothers 14244.0 thnl1ot Ihnuat 1288.0 14632.0 14635.0 14647.0 at11348.0 hlrsChn htrsCharro11 Clmrron 14655.0 111111 xmlns:ns7 ID23 13352 3232 11172 14859 ns7:type Decision nlCIHlulI1teislutiI1fcharacter chnrnclcrelumrnctor15031.0 15068.0 15091.0 nn11356.0 Inferior Illtlrlorhiteriur15044.0 mind mlmJcommand C01IIJIIt1cuumntid15056.0 ur aMimMtv 14264.0 15063.0 1h1lt1 aInv 11208.0 15236.0 h1lt1 MimMtv Inv tyeW virt WrWirtWrc Wirtt virtcondlng 15359.0 15368.0 iu1tmnMtt allrtnartnIM IMcending 15452.0 hcmlllnJ 15563.0 condlng cmlllnJcendingmn15556.0 views 12176.0 llwl frulH15580.0 rout thy Iby13168.0 13616.0 hand hUl111humid15571.0 noworthty 14276.0 noortht 15751.0 worthty ortlmly15787.0 ortht 11320.0 15748.0 action nctlol1064.0 dOlleHomrt dOlleHomrtHI -1064.0 Hobart IlobartHobartlie Ilobartlie 15967.0 HIhnR16007.0 never J1lI12848.0 denied IhlIllllhlntsif hlmlrhlntstt15972.0 Corfortho CorIho forthe 16164.0 thoIhosake snlco16211.0 Rn 16176.0 or16172.0 giving glvimigIIUHInns13132.0 13188.0 glanced 1oInlllI1Ilitattho atlimo 16228.0 limo16371.0 Joys jURJoy 11804.0 charitySwutchlne charitySwutchlne11cry -1532.0 charity -1528.0 l1l1rlt SwcUhlno HwllchhwSwcUhlnoISvcry Hwllchhw1Cly 14372.0 11380.0 16588.0 16600.0 ISvcry 1Cly11cry16595.0 tlmo tlinet1m 16624.0 n16620.0 mnn1111111smiles ImlllHslmlile813496.0 1I1HIantlmH1muchmore 16612.0 nn11 mH1Inure uimmure 11240.0 16775.0 16824.0 Inureimmure16787.0 wllllI12256.0 hlliltlaughs Ilu 12872.0 hH 12752.0 IIlldH16812.0 summitsummitdoing 14200.0 16972.0 thing doing11640.0 16992.0 hilifragment fruguuntfrn 16987.0 IIlIt IlfIlflfmS 13256.0 Sterne SterneBlessedness lmIII lmIIInhlillhWSH 14056.0 16999.0 crime crimeIssedness 17203.0 17211.0 Blessedness nhlillhWSHIssednessCOIIHIHIIeoliSiHtsIIIhttho1111113756.0 17228.0 accent accom13648.0 accomplishment 17231.0 accent11151m 14084.0 14284.0 Iptlllhmcllt 14400.0 17391.0 17408.0 plishment ptlllhmcllt11151m 17411.0 nett 17403.0 fit17428.0 OIJ011117396.0 desires IIIHIIIIdishesIIntltimidIn17415.0 IIUttiltourhaving tiltrotting 17432.0 Ihnln 17588.0 17595.0 having rottinghnln 17592.0 12092.0 12356.0 rculluregtmiudC 13556.0 1196.0 desiresInglis desiresInglisline -1196.0 Angus Angusline 17792.0 lInclineihmerever lIncWh 18004.0 Wherever ihmereverWh Ielr 12232.0 roufind fllllilnd18011.0 patience pll limit ltnce fidelity IldtslityIldtslityhonor fidelityhonor h1tol1t h1tol1thOIlO1 18196.0 honor hOIlO1klndiiesH Icindurssncll IlSII truth 12704.0 18240.0 rl1 hl1U13548.0 13732.0 fJU Had Ihlll11udHadrespectability 11udrespectnJility 11252.0 18388.0 respectability respectnJilityIlMl 18444.0 cctn hili 18423.0 12140.0 however hOWeIIhonveverobscure nhlllIJlohsetirt13872.0 andlonely 14252.0 1lonuly lonely lonulymen 11Ilnmny Ulny11mnybe12520.0 lIeI1 II18592.0 1YBocchcr HecclllrIleecherBocchcrHim HecclllrHh 12008.0 Him 8118Hh 18991.0 IMtltit UIntIIItItstHen HIllHi 1itrli IjuhIitrls1itrliA 13540.0 IjuhA Iitrlsit itW011lnllwouumlInbtiod hibtiei112184.0 19191.0 12796.0 nilmilltillfluirun irunNew 14288.0 19211.0 run ruorunNow Ilew -8.0 14404.0 19371.0 19395.0 lewNewYorkers YOIklIHYatkerH19391.0 Innate InnlltuInnntu12932.0 19383.0 lovo 10Iino13296.0 Paris 1111111Iurls13448.0 13988.0 paid Imlllpaidher Imlllher paidhot hot11600.0 first tlrHtvisit Ifilt tnhilt19592.0 bewildering IwwlJl1lIlnJhewllderingcitythis 14296.0 citytltis 19752.0 tltis11632.0 19784.0 autumn nltu11Inaltulnu12428.0 19772.0 HheHho12220.0 went weilltveut13240.0 19760.0 tvlth13656.0 ncouple couploCUUIII1couploto coupleto11272.0 whom wltoum12028.0 19964.0 nitKuropo JolrollUmmrope19955.0 III13324.0 1111ohl13880.0 story 8011storyTho fltfU fltfUihe 8011she 20156.0 Thoiheheroine IHrollloot20144.0 tills thlxthlH20147.0 sad IUIIItalc tnletitletwentyone twenty 14260.0 20151.0 tWln tone 20331.0 20351.0 liar llorHcr20339.0 traveling 20356.0 trn cllnlt companions cOlnlmnhll11conipnninns13948.0 were wereboth 14316.0 wereJOth 20516.0 20535.0 both JOthovcr0111608.0 fifty I1rt 12456.0 20531.0 HheHhocamo CIlIIOcaulO12956.0 20519.0 IwnwionnIns Insweek 14048.0 Illstlastweek 14320.0 Illstweek 20711.0 20732.0 20723.0 Well WllI11660.0 12436.0 1111enjoy euJoyflljO 13796.0 yourtrip 14312.0 ourtrip 20900.0 trip 20920.0 Cecilia CeclllnV askidnskl112320.0 12948.0 11it20903.0 CIINIIIsup IIUIIsumpsuppose sumppose IIUII1101l 20964.0 21087.0 21144.0 pose 1101l3audid 12316.0 eIhI21104.0 Iarls ParlHiaris828.0 thoroughly tholouIIIWhat Whnt11hnt13764.0 Whatdo 14328.0 Whntdn 11hntdo 21296.0 21307.0 dn21331.0 OU 11816.0 think thlllltlmlultoratitTile ItThe ItTim 21496.0 TimTile21491.0 liolH Hnllllints21487.0 IIIllrclt21484.0 nl1l1amid13560.0 21479.0 thotime13444.0 shops IIhulIIIshopsare IIhulIIInre shopstire 21668.0 nretire21695.0 lIot21679.0 bad hndhail21671.0 admitted 11Ilmlttelladndtledtho1110newly 1I0wlyar 111mtr14028.0 mtrrived arrived 111rll11 21723.0 11284.0 21851.0 21875.0 rived rll1121871.0 Awltad21868.0 thotheLouvre Iouvre21892.0 01110 13304.0 21860.0 lino nnlIlnlnlliltimidandNapoleons 14324.0 nllill1l11fl1fons 21855.0 timidNnpnlmls 22047.0 22063.0 Napoleons l1l11fl1fonsNnpnlmls22060.0 tomb tOlllh22072.0 bum 22055.0 III1522052.0 12856.0 IherlthenBu1ullintfrankly BuI 1ulIrnniciy 14220.0 22227.0 22259.0 22252.0 frankly IrnniciyrrlllllI 22247.0 etlehlt22279.0 HCI22240.0 Iarls1arlHatniltill22232.0 nilIIlmllly 22235.0 Isimply 11280.0 22419.0 22444.0 IIlmllly22435.0 couldnt coulllllt22427.0 tllosethusouleloldBlanks ulelJllnlllcs oldllinlilcs 22636.0 Blanks JllnlllcsllinlilcsBlanksCouldnt JllnlllcsCfJuIlIIIt llinlilcsCouldnt 22803.0 Couldnt CfJuIlIIIt22851.0 sea scoReo12460.0 12896.0 22807.0 Why Whr11hy22839.0 toydear tlullrCo CICeCocilia CIclllll 22988.0 23015.0 cilia clllll23040.0 IIU 23035.0 wmo22999.0 Uteru12656.0 whudewholemouths 13876.0 whudenmulhs lulu lulu1I1011Ihll 23203.0 mouths 1I1011IhllnmulhsmouthsYtM 11848.0 1I1011Ihlli nmulhsYes 23399.0 23395.0 YtM111123392.0 IIlIldsail11780.0 23380.0 Cecelia CercllnCecellawillinvllh23412.0 a13452.0 sniff fllllnsnitToCofunutterable oCulIuttruhll 23371.0 ofunmutterablt unutterable ulIuttruhllunmutterablt23607.0 scorn IWnrll23572.0 1I1If10111WI23595.0 vere13584.0 13812.0 III23587.0 111111111ourbeds 14336.0 111111I11I4 1111beds 14308.0 11300.0 23752.0 23779.0 beds 1I11I4mood23771.0 1I1II11111I111 asleep asleeii23791.0 every evely23755.0 bloKsed hIIHCIIbletscl13704.0 nhhtIltatten IlttCII attell 23931.0 ten tCIItell23963.0 oclock oluclc23956.0 oeloelcSety 23988.0 oV 23947.0 lollTurk23935.0 ConunercitiAdvertiser 13276.0 Commercial COllllucrclulConunercitiCommercialAdvertiser COllllucrclulAd 24155.0 Advertiser AdvertiserTrrn Advertiserlren-816.0 24159.0 Ad crtlscr crtlscri crtlscrlrr11188.0 24363.0 24488.0 24508.0 Trrn lren24515.0 lrr 24503.0 Crlntirultm CIhmll1l1Crinbrnlas13028.0 its13268.0 24491.0 Iiiltllrr dnhllnndnhllnnfie 13316.0 IiiltllrrThe lIhll lIhll1lIe 11432.0 24648.0 24668.0 1lIefieInstance lusttiicoJaL11aIlCO12060.0 24659.0 or13264.0 thfbutternut hutternlltbutternutnr hutternlltI24899.0 whltwhUI24855.0 walnut Wllinuttree l1cuIvet13328.0 North NorlJiorlh 24843.0 Amer AtnerAtnerlea 24863.0 IIIlI IIIlIJell 14256.0 24892.0 25059.0 Jell icaleaproducing IlrollllchllprodueingIrult trultIIIttnglund J1IllInclIsnglunilban hnithasbanjust hnitjllt hasJust 25212.0 25247.0 jllt25244.0 helJllrecorded reclrlllll25215.0 tilltheMlddloton 111dillttnnMlddlotonLancashire 111dillttnnLnurushirci 11l11i1t 25235.0 wlI wlIJnllullhlrel 25424.0 Lancashire JnllullhlrelLnurushirciBotanical 25415.0 110111 lttaumI13092.0 25439.0 12924.0 13200.0 Society SocietyThe HOIIt HOIItI SocietyJImu 25587.0 25619.0 25623.0 JhuJImu25628.0 true tructree25639.0 Willilens25635.0 one25599.0 oCseven UCnsuvenplanted 1lnnHIIplantedat 1lnnHIIatplantedal25776.0 25828.0 alJarslang arslcmmg25831.0 I1IH1I1I1 25803.0 sixty lXfv ycnlslIl1H neither fllltJllrucltlwr13636.0 neitherof fllltJllrorucltlwrof14340.0 26007.0 or25995.0 11472.0 111111hill12616.0 111111112476.0 thlHyen 11l1Ibeenfruitful 11l1ICrulHul beenviii 26151.0 26180.0 fruitful CrulHul26187.0 viii lfuh 11592.0 26175.0 ThoJlw12532.0 WowllrCultvunderfulHUllllllfrsnumumrinduced inIhlCCl1 26155.0 indiced 26207.0 26331.0 diced ducedIhlCCl1onoor12100.0 thotlwwlllll26343.0 walnuts wnlll11111lvninus10collclcolCM lclJrl1te eelerratu 26571.0 erratu 26603.0 CM Jrl1tesixtieth HlxUuth26564.0 uar 26559.0 Jr benrhig benrhigfruit 14348.0 bearln JcnlIIIbearlnfruit JcnlIIItrult fruit trultfruitTho trultI fruithe 26939.0 26943.0 jll authorities uthorlUelfnuthoritles12664.0 836.0 26907.0 Kew Icw26936.0 IW 13468.0 26904.0 11Ia26927.0 response rlIIIIOnSOresponseto rlIIIIOnSOto14352.0 27083.0 11552.0 27160.0 aletter JutteroutiletimeIulljtct27087.0 HhltCllthatthey thatI 27271.0 27320.0 27308.0 hudlIoerseen HCCIIecn ic 27279.0 ottill27276.0 nuts outsnutsThey outsThey 13984.0 nlt nltrhc 27455.0 rhc requested 1CII1lstcllregnenledthntIla27459.0 specimen sJlcclweuspeclmeuhebeforwarded 14360.0 heforwnrc1ctI 27635.0 forwarded forwnrc1ctIwltb27655.0 80101127643.0 branch hrnnch27639.0 otthotime14036.0 thetree 14356.0 thotree timetree 27823.0 27872.0 tor27895.0 n27847.0 permanent pcrlDnnrmt27831.0 record rc corll Thiswas 28012.0 28096.0 accordingly accordlngl28039.0 28019.0 cJoncLoDluu doneLoudon13044.0 Mall 1111xmlns:ns8 ID24 13052 4384 14328 1632 ns8:type 16700.0 MILE1 MILE1A 17119.0 14540.0 1192.0 14764.0 lilhD 14560.0 15956.0 15392.0 15487.0 LDfE 16328.0 N 16288.0 16580.0 16496.0 Saf 16748.0 f7lr 14408.0 10l 15503.0 UIJ 14968.0 16200.0 15952.0 16455.0 2172.0 oU 16280.0 oUG 16791.0 14880.0 G Q 15072.0 QJ 15768.0 15912.0 Iff 15448.0 16116.0 J0 16880.0 15008.0 15112.0 15175.0 15200.0 15304.0 15296.0 15384.0 15944.0 15560.0 15971.0 16040.0 Jg 16003.0 JgIB1 16432.0 16400.0 17700.0 x 1260.0 16439.0 14444.0 IB1 14724.0 16388.0 14844.0 rUII 16436.0 3252.0 z 1292.0 14888.0 15019.0 15132.0 15412.0 15116.0 15648.0 k 15732.0 16092.0 15876.0 18180.0 14592.0 t1t 18372.0 15216.0 15308.0 Itryn UIIitrA15844.0 1Totlicr11y 15848.0 Motlirr Iulhtr1TotlicrMotlirrMy Iulhtrh 14556.0 My 11y14648.0 14780.0 14852.0 mother lIIotllllutnther15456.0 sirs xluVlIItI15347.0 15860.0 15916.0 goad15995.0 16140.0 16380.0 10In16648.0 mf 111mcmfKl 16840.0 111I mcIt 16807.0 14572.0 Kl It14720.0 I14716.0 14920.0 VIIH WII4nsr14840.0 gnI 15180.0 15244.0 KHOI 15564.0 its15516.0 15960.0 eanldIs 15963.0 tHiulil ulIlll16516.0 16320.0 IKI 14584.0 I14699.0 1I1I1Iitceullut14616.0 hIheiu 15680.0 HIWI 10111111116016.0 16260.0 16060.0 16264.0 16444.0 16416.0 4188.0 16447.0 16556.0 airfirCant 16732.0 IIlri airthat 16788.0 14568.0 4331.0 Cant that14944.0 +15040.0 15100.0 iiy uy15076.0 15264.0 15331.0 15167.0 hy by15424.0 jy 15572.0 In1 be15576.0 15796.0 KI 15716.0 15864.0 IIHIII gtstd15979.0 16104.0 16244.0 Mas16132.0 hel16392.0 herSho 4284.0 herSlit Slit Sho011114892.0 4608.0 loves lams14820.0 15228.0 IIIItime15004.0 15552.0 whclIwhetIm 111lInglad glul16212.0 16627.0 nrmail 111111hindmailSln 111111Ih 18671.0 SlnIh14792.0 4808.0 14788.0 lovtM lare 15191.0 4799.0 1111nawluMi wilimvhee1nlnod 15592.0 11116584.0 16276.0 gootl 16204.0 16352.0 nr16860.0 hulhII16799.0 hulAn hIIA 18687.0 tAn 18711.0 14936.0 whats 14776.0 wlllt vint15276.0 14980.0 15460.0 4895.0 15500.0 15736.0 finmiist 15640.0 15740.0 iIlUllit uunle16304.0 16248.0 16299.0 thill Phe16632.0 16820.0 17020.0 17079.0 say 16988.0 saySho 17304.0 soya soyaslit 17380.0 17084.0 MSh 17212.0 5023.0 5060.0 slit Sho14824.0 14896.0 IOVCH111cII14744.0 5087.0 111omewhelllchcn16000.0 IIIII sit15928.0 16068.0 16220.0 16291.0 puniitno 1IlIilhopunidltus14600.0 14728.0 dont 10111dnnt14636.0 15164.0 likoltk 15492.0 item hrr111115328.0 15784.0 10to15712.0 punMi 111ui putt 16283.0 16256.0 ih 16232.0 16520.0 111incmoThat 16708.0 111lht incThat 16672.0 lhttlnut Ilnntfirmthurt hllrl15344.0 15823.0 hilIlimit15700.0 16112.0 hurts hurlll16635.0 16764.0 5491.0 ace AOCAOCHer 17108.0 aceIler 16968.0 ce 14612.0 1111Iler14924.0 iry emy14863.0 15320.0 Xtn Nimm15036.0 15596.0 15684.0 IIrrryut 11115651.0 iiiij oe1116272.0 iiiijWe 11l1 oe1111e 14596.0 5764.0 We 11e14828.0 14796.0 15204.0 15636.0 lItbe15788.0 16120.0 nood guod16064.0 oocl 16508.0 anninIIltnillanninSho 16864.0 IIltnillhc againShe 2676.0 Sholave lovwIOIA15324.0 1110nitwltoM nhen15520.0 15708.0 hlI1lu 15936.0 16224.0 ruts cuteIIf 16568.0 16619.0 ami111111sews CVH11111sewsI 17016.0 CVHMy 14696.0 I14908.0 liltlo15104.0 15316.0 coat cont15208.0 Ol1t 6215.0 ami11111Sunday Sinnliiy15920.0 16100.0 IIIIIIII clothoH clotllltIclothes16428.0 clothoHAn 17072.0 clotllltIII clothesAn 14740.0 14812.0 14928.0 6375.0 wliiii wllllIeirn14808.0 15360.0 6404.0 uty6407.0 llt 15675.0 Iit oomoi Ollll conu16252.0 16323.0 tinino hlll1lehnnte16168.0 16752.0 1016680.0 6356.0 ton tea16884.0 tonSho 17164.0 teaSit 17087.0 1Iw 17111.0 Sit Sho14860.0 14712.0 14640.0 lovtHWCII him hint15696.0 marl IIKHI11I tlM stdlilllcbts IIIl1ch16696.0 6535.0 111116640.0 16904.0 Iite16844.0 moSho 17103.0 16908.0 IIIho IiteShe Sho14707.0 IniiRhs Innghd15355.0 15212.0 hM nmlnlill1t1I1tdlahintnllllll1itl 16564.0 nllllll1itlAll 16756.0 FoalmidAn 17040.0 All14620.0 41 grab cralwIrlhlltat15651.0 15584.0 1111111 15880.0 no16156.0 pats 16036.0 mv Inv6980.0 16716.0 16796.0 huudhOlIlIhuudAn hOlIlIAll 14624.0 All11114960.0 ling III1Jhug14988.0 horhlllu 15604.0 15664.0 15815.0 hiii hilIhuitnn16180.0 pa paAit 16668.0 paAn AitlovemumJllltt purt15528.0 inrt ni nigh lIithmilchnilas16712.0 16980.0 I1Inmil16916.0 nmItiillii 17176.0 milCalla 15060.0 7567.0 Calla Itiillii111111anilIUlIl15839.0 Itoit 1t11Itrd15764.0 1iKRTHollo 16184.0 1iKRT 1111lemgy16616.0 1111Hullo 16660.0 lemgyItollo 16611.0 7772.0 Hullo HolloItollo15024.0 111ls15027.0 7796.0 n15659.0 puppy lI1111Wn16504.0 big hll16315.0 mastiff 11utstiiTmastiffnippy 17407.0 1I1I 11utstiiTIuppy 17076.0 17184.0 tlrr tlrr1111I11 17412.0 14416.0 7919.0 nippy 1111I11Iuppy15080.0 Ho 111lit15400.0 dyedht15760.0 7939.0 110Iho16460.0 clI willitvIth17324.0 7951.0 n17204.0 aMr 17404.0 17352.0 14387.0 8163.0 Mr t14456.0 I1 14736.0 Illflnntl14548.0 15011.0 11rsinutes I1H 16052.0 James lnlUcf111111nodtlwhllttlu tllllulittle16928.0 llttlulaughter littlelit 17044.0 tlllluIla laughter 14524.0 15052.0 migllltr 14552.0 8375.0 14748.0 Ittssleii IOKslo IttssleIOKsloMr lll 15280.0 lllIt iifllflnett14691.0 15364.0 InlllMmeshOllhtIhougltl16759.0 nmm17000.0 grrtmtgrrtmtlenl 17004.0 greatleal 17364.0 17332.0 tIIt1I1 8720.0 leal IIt1I1lenlor14976.0 Itollo Bullo15468.0 fIl15688.0 8704.0 hoy15692.0 16008.0 15756.0 15724.0 16080.0 cunlll15892.0 11evtr16479.0 11n16976.0 17052.0 17216.0 havolintl 17240.0 ye yemini 17340.0 Ihllli 17368.0 lintl hllliminipntltuct14644.0 tllll 15000.0 will15380.0 16020.0 8887.0 fOl16832.0 puppies 1J1llllhHputples16704.0 puppiesim putplesire17420.0 9136.0 im 111ire14604.0 callable rnpnhictiC1Iudlmischief nilPChief16348.0 II1 lhltr 17127.0 lnllnullandyoung nulleuuitg lnllIIUll euuitg14468.0 IIUll Itnllo BulIlIItollotvns15628.0 9303.0 1111naoxci 16084.0 xctlltlon 16296.0 Xlllll 16923.0 16603.0 itlon 16540.0 lilli 17196.0 lItIliIliIteimitd 17423.0 HosiiMiicd lItt1lultll siiMiicd t1lultllIteimitddetermined tlrirunillledIuI11Imy16096.0 hlHIIIPteeth 11thIrtIi9451.0 flUInd17156.0 onIvcrythlng flUI Indvtrythhig Ivcrythlng vtrythhig9675.0 14848.0 hUlhlt15704.0 htst wllll1tvhcn16532.0 Jlrslanltvt Jlrslanltvthegaa IItI Jamott 111111114Jamottbegan 17431.0 16971.0 1111111141I1 14392.0 began hegaa9855.0 14836.0 tlltoreel 1111tech9867.0 11115720.0 15831.0 15896.0 HIIIslit15752.0 cuultl16143.0 IIl1lnut17012.0 1IlHhtouchmuchlonger 1IlHhIUllgl touchluugei longer IUllglluugei10047.0 1vteyvnlmum valuable 16360.0 16384.0 hitarlklo IIlldunrtlile17291.0 11117436.0 Int 111the tho14440.0 14732.0 houtl15252.0 chewed chctvrll15372.0 15508.0 UII16236.0 10195.0 Hhlsirhit liltUIIIII17348.0 u17251.0 ufunny 17444.0 nlUI1U nfunny 17439.0 lUI1U funny 14932.0 plan IIlnllrillfurmanaging 1II111111J11Inuumgimg16463.0 hllllAlaihimII hllllII AlaiII happened 1IalllllIII11inppenrd14652.0 15540.0 IlmiIhmtlII15828.0 10600.0 uutyUI dull Ilull16188.0 rflrfurIIIIlnlittle1osslo IIIIlnlh4411 littleltessk 10791.0 1osslo lh4411ltessk10771.0 h1hind15568.0 jU1atrt1edwllllhvhihi 17168.0 17032.0 17288.0 su Hitsitsupleased Hithll sitplcmtsctl plcmtsctl15108.0 Item horhll14972.0 10956.0 flinttho15976.0 16135.0 olllolt 16424.0 favorite rll fitvurllua fitvurllualoll udoll 14412.0 11111.0 loll doll11111111tumultutred 15600.0 lliiiincl Ilun11rlIIll WWII niulnllil16944.0 lIallollnamedlied lIalloll11t11 nted ntedlteii 14516.0 lied 11t11lteii14916.0 Peggy 14800.0 Ieggygmiermtlly 15616.0 lay Iny16412.0 neglected IltgllCtUlIuegleetudneglectedAs IltgllCtUlIIIIuegleetudIii14628.0 itCUIIlIIcornerAs 15268.0 14 14900.0 HolloItollo14760.0 fitssettling IIIt setillig Ihughimself ihasrifIII1wl 16596.0 11687.0 11707.0 oat nl1lomitomittlny 17464.0 17200.0 oatclay nl1leln clay tlnyeln 11931.0 lurlletyhm 15495.0 15624.0 11936.0 11943.0 11892.0 15656.0 16192.0 16312.0 11879.0 stocking HlIltlllllstutlchlgStmts16955.0 Stmtsfttitits 17132.0 MrsJames 12116.0 fttitits14460.0 14912.0 tossed IUI4iCI Ited itlllItttl12079.0 ttggyIIInllltotvruth17140.0 hint hllllhinttolling hllllt11111 hinttelihug 14428.0 tolling telihug14432.0 t11111 hlllldntluIn12271.0 bite hllobitu12268.0 teat tiuittllalIrIt16404.0 hlhe16692.0 musk IIlUlLmustmuskItlto 17484.0 12251.0 musthit Itlto 1I111111t sniumetsomotnlug somotnluglrom 12495.0 lug lugIiuut 12675.0 lrom 110111IiuutIlmiI14996.0 15120.0 12655.0 HeI ItcIHe Ieggy17192.0 wasadopted 17488.0 12643.0 tva tvauduitrtl 17392.0 17320.0 IIIIltllllttI 17388.0 12815.0 adopted IIltllllttIuduitrtl15300.0 15376.0 12847.0 tlloilieOlll nutstiff12859.0 16767.0 16372.0 IIH 16548.0 HIIle16744.0 cmrcarried cmrritt 17232.0 12835.0 14436.0 ried 11111ritthllwllh13024.0 hlttmIhlllltniuat16656.0 limo17008.0 huuHhnusuhouseoven huuHi hnusurill 17399.0 13187.0 13271.0 oven 14532.0 rill 14784.0 13231.0 1001tunic1111hem15188.0 sometimes IWlIlltllllIHOlllrtlimits15511.0 1016592.0 16996.0 OUthuthe11elghburs thuneighbors 17316.0 17283.0 hlUIIhllfllti 13367.0 neighbors UIIhllfllti11elghbursami111111wunltl1vouldcarry 16151.0 CalI 16643.0 13411.0 army 1111hie Ituwntiuitdownstreet 17064.0 ItuwnK tiuitstreet 13559.0 ttllt13655.0 15048.0 13615.0 15404.0 watched wntcheiitchlll Hollos Itullostullo 17068.0 remittreatment remitiimcI 17384.0 Iot iimcI 14452.0 ment 13795.0 ot14832.0 15196.0 hUlIlltlnot13751.0 greatly JrclltJ1111111011ImproveItcd 17492.0 1111111011Itlll Improveltld 13995.0 Itcd Itlllltld14855.0 Peggys IeggyH13963.0 looks 100111louleahutJolttnitt tllllttout1I1Ilhmule16724.0 17312.0 IIUtie17220.0 nodUYoronco IIUIlIIY1UI1CO tiedllltaeucu 17500.0 dUYoronco IlIIY1UI1COdllltaeucutuhllllhinm110IIu14123.0 Boomed IWIIIICIIseecued14135.0 tll16892.0 llkutikIliketo llkuto tikII 3160.0 14364.0 play Ilh1 14347.0 wlh14344.0 hlK14327.0 doll Ilotl15780.0 itsIt14307.0 huIC it14583.0 15232.0 14527.0 1stead IstradIHtlHlllt 15856.0 itdog dug16240.0 OJ xmlns:ns9 ID25 15352 4644 14424 14687 ns9:type 14687.0 14751.0 OIlUOnuWhll15172.0 hDha14692.0 hmlbud16124.0 16608.0 hI1114931.0 hlKhitstittle14688.0 15220.0 companion cOlllllllnlonconlpttllullILIOIJlollg14876.0 Unto tll1l17036.0 firsMrsJamoa 17172.0 firsdcunes 17256.0 lrH lrHT Jamoa dcunes14488.0 14956.0 15147.0 nmmt 14535.0 Knhlanal15103.0 15776.0 111mreproachfullyhU reprnnelifuJly11hy1040.0 reproachfully lIIlOnlhCUIlreprnnelifuJly-1004.0 lIIlOnlhCUIlWhy 17468.0 11hyhullo nolto15251.0 hbw bbiv 16032.0 15940.0 16127.0 llo do111U1H mhuso16572.0 1100117100.0 11001u yourm17532.0 IHollo 15744.0 17764.0 15467.0 rhli rltollo Hollo ltollolIIHll raised 15527.0 imIiI 1Irtli 15539.0 tTnnll 15559.0 flntt foolcll foolced15551.0 titIds 17560.0 hU hliIdsmistress mllltruHIIaminute ndrmite0116528.0 trvo15731.0 UHeH17180.0 If17372.0 htlilt17296.0 lilt1vlru 17552.0 howero 15719.0 htru 17555.0 15903.0 wero 1vlruru 15948.0 thinking Ihllllthl 15964.0 ovorOllwhntwluttshoIIho15911.0 hud hindIIIHll1nltl IIIHll1nltllhcn sold saidsoldThen saidThen 14476.0 16095.0 16152.0 Then lhcn16147.0 lu14871.0 15224.0 ti15092.0 repentant lelllntl11ltrepcnttumtwilytie16828.0 110hebegun 110Jun heglum 17508.0 16287.0 gun JunglumHImil15124.0 16332.0 lick 1l1luck15016.0 16319.0 hlHIlulldullJlO1dillliii16295.0 IlllieKtol8111stopuntil 17544.0 Ktolulltl1 8111until ulltl116519.0 huhllllhind15096.0 licked IIclellIicicctl15444.0 ll1JahetIInnil16507.0 001lhntlluttThatis lhntI lluttIs14496.0 16755.0 nailojs 110sot15532.0 kissing 1IKKIIljklssilgkissingAnother 16684.0 1IKKIIljAllothll klssilgAuolitr 16847.0 AllothllAuolitrlimedomeHolloltollo16859.0 trotted hottc1OC tovisit tc totIsll tIsllneighbor 1111hloInrighbur17088.0 across 1IIOlill17051.0 thothusttlutstreutOf orOfctiurse 17540.0 17039.0 Ofcourse 17536.0 ctiurselJl1rHl17272.0 Hod HlllitdJ1 17284.0 1ve1116072.0 Wl11 looduo17235.0 ThuJlInThuman flatmnn 111111mnn17479.0 15136.0 wholllvhmomn17487.0 tnsnH paying pnyltig1lie16816.0 visitwlahcd visitwIshed llIlt llIltwllihed 17600.0 wIshed wlahcdwllihed15160.0 10Inscud uendIWllelpaper JII1IH1ovir01117615.0 tulu17160.0 MrJames rhomes 17787.0 homes14520.0 17888.0 Ines 14668.0 15156.0 nlllamid17816.0 IhouhtIhought17812.0 wuuhlliitvti ha11lutvuliitvtiHollo ha11tolto lutvuJtollu 17975.0 toltoJtollu18051.0 curry Clrl 15388.0 Su1111he17992.0 toultnult17984.0 IkdHCIIcggyPeggyaway 17979.0 Icggynw 17116.0 17999.0 tY tYn 18152.0 tromFromm15436.0 thotlm18188.0 IIIIIHtlrt18176.0 laid 11111118167.0 heron 18171.0 hlr17224.0 18191.0 17300.0 thothostop 17548.0 18156.0 timeslap 1mIIllIll 18267.0 nw ny 18344.0 IIllIllslapPutt putting IIIIUluhug 18391.0 tillThuIlI1lwtttper15807.0 18356.0 IUHtllIel18351.0 Hol ltol17480.0 ltolIDs 14508.0 18528.0 los 1011IDsmonth 1II0111hutuutIiIhenlien18563.0 18555.0 htm 111mhhli18560.0 clllryIthomo Itlie homoItollo 11018824.0 1I1l14680.0 1I1lHollo mimeItalic 18912.0 Italic ItolloHollo15032.0 19004.0 n18940.0 tlcgnlricd tllnlllHldegniled18959.0 wag wnJ18923.0 uftho18915.0 1w millendof 19112.0 oChlH19156.0 tall tnll19144.0 111111amid19127.0 hottctl19139.0 19119.0 gate tatcgatewhore tatcwhmo gateivhetu 19292.0 whore whmoivhetu19344.0 hu19327.0 stopped HItIIIH1Hlopped19324.0 IUIIImd19307.0 tholJhltiuttgimlnmm111111milluto 111111UI1 mu 19295.0 iiimite 19479.0 19551.0 mite utoUI119536.0 1hlll19528.0 19516.0 IlIhlhind19511.0 dn11n15932.0 19496.0 thin111I1t111111andwont 11111wunt 19484.0 andtiveut 2720.0 19683.0 19740.0 wunttiveut19711.0 straight HtrnlJhtstrnlght19703.0 hllcleinchtorRod 19696.0 HIt lli19731.0 leggyleggySeveral PeggySeveral PI PIeverlll 14672.0 19912.0 Several everlll19903.0 attempts attemlltH19880.0 Nllh1euded19875.0 iii16856.0 timeIInlnUsimimmosamoway 19883.0 IInlnUWIY simimmoway 20035.0 WIY20104.0 20095.0 lust laRtlast20083.0 Ihu20068.0 20092.0 trims wns20040.0 carefullyraped 16872.0 carefully cnreCulIy17563.0 carefullyrolled cnreCulIyrolt11 20228.0 20295.0 rolled rolt11raped20287.0 ht14964.0 20275.0 thllthit1IIIIIurpnpor20247.0 20264.0 WIIKwnsthulllienlienglveti thengiven thullJlvcn 20484.0 Jlvcnglveti20464.0 Ruhlu20447.0 willimrillm20439.0 tiu20432.0 sharp HhllIlorllcrorderJo 17520.0 orderI 20659.0 20679.0 Jo 14752.0 honwhunuthomeHollo 20668.0 honwHollo hunutItollo 20860.0 Itollo15148.0 20839.0 truttlllIroned20856.0 ownyaivny20807.0 quickly quielclybut 16268.0 11lelel 20804.0 hltwlInwhenho whenlie 20979.0 21055.0 110lie21035.0 reached rlnllllll21031.0 tliothomiddle IIIhhtloullddlu21008.0 or20996.0 thttime20984.0 road IOlldhIhehodeliberately 17568.0 hIdelllmrnllly hedellerntcly 21159.0 21223.0 deliberately delllmrnlllydellerntcly21215.0 lulll21208.0 dowlIdntvn21183.0 hilt17024.0 bundle hllllflllbundlepoked 21163.0 hllllflllJIkl11 bundleisked 21419.0 poked JIkl11isked21415.0 hlH21439.0 nom 1I0Ktinse21444.0 21400.0 Illto21392.0 21375.0 21371.0 hllhu16848.0 21355.0 COUlHIhll4itshisbeloved 17576.0 17360.0 hll4I itsJelovetl 17571.0 14424.0 21535.0 21676.0 21612.0 beloved IlIlovcelJelovetl21592.0 HodHldIcggy21595.0 21567.0 lifted 1It11121563.0 horIwr21555.0 Jutnullthen 17188.0 111111nullandthen 111111tlWII 21804.0 tlWII21823.0 ran 11111rul21764.0 triumphantly trlllll1phuntlyIrlumplmantly21752.0 IIOIIWhouue21732.0 wHhlvitlitiertierleaving 17528.0 herI herlenvlug leaving ItHlIIIHlenvlugIhoImlwr21956.0 IIItliotherUlIIlroadIn rUlIIlIn 22171.0 Cnct22195.0 11022151.0 22156.0 1011 nHas22136.0 122131.0 Ikmew 22127.0 knew ImewItollo22095.0 lienever 17308.0 heliehonever hefWr 22395.0 fWrwJul1obey ohly15904.0 22296.0 ollHIIIIII1c0Ittunmul16148.0 whlthwldchwhichforciil whlthorel1 wldchforced 14543.0 22483.0 forciilorel122535.0 hllllhlnm15476.0 22523.0 myhiliIrisIhlIrtltctrHlllltetileggyPeggydown leggytintvu yl1IU 22656.0 wlUrowberu22659.0 houust homust hIII1UHt 22691.0 l1IUtintvu22752.0 ourHCJ22715.0 lu15968.0 22723.0 15872.0 16340.0 place IllIwIpiece22932.0 II1UHtuust22915.0 leavo ICIIIIlenvn22900.0 horhcr15924.0 22875.0 Iwllirlflieitud16420.0 16852.0 tlLlHthiswayquite wayriuitt 22880.0 nIlultl 23031.0 Ilultlriuittoutdoing lIultlnlllJnuttlning23072.0 JllliuJlrl23052.0 him17259.0 lou lovolovelovofor 17264.0 loufur lovefor 23212.0 fur23287.0 bishlff23264.0 tlollHoso IlolIHoROdollltosuThorn jhorl23252.0 horn 23227.0 illhi17148.0 Little LlttlurIUluLittlebulls LlttluIolUs rIUlu1olluI bulls IolUs1olluI23732.0 Munhronin 1lullhrnolllAttuhrontn23747.0 Culture CullUfn23739.0 UyAnt AnIAntIn AnIIII Anis AnisIn 23875.0 23944.0 III23939.0 thothuAllwrlclIlIAuerlenu15183.0 23887.0 Naturalist lItlrnllbtnllrnhistProfes lroCIR1rofrsProfessor lroCIRHili 1rofrsSot24059.0 24168.0 Sot sorHiliWheeler Vluwlerdescribes IltHicrl1JcH24123.0 a24104.0 lIewnemvgenus fIJIIUHguuusofInsect fit17579.0 fithUlcct 24323.0 Insect hUlcct24308.0 living IhllIJltvhg24271.0 eominemmlly COllllnIIHnllyconuneusnlly24255.0 wltlm16552.0 emtnlucertainantfl emtnluIIl1t certainmusts IIl1t musts antflflue Thufhu24467.0 genurnt HUllcr1geuernl24456.0 reader relldcrrenderhowtmter howover howUII 1184.0 Interested IIIIere 16936.0 tId In111littho 17584.0 Intill 24723.0 UIItmter24683.0 he24719.0 specially fiIICfIIIIIspeidly24815.0 thothe24911.0 14772.0 socalled HIIClltll1124867.0 cIhh mushroom lIIuRhruolII11sluraolilgardens slrlclllgnrileimsgnrileimsforamd gardensformed slrlclllf1J1Ull1I 25000.0 25067.0 formed f1J1Ull1Iforamd25063.0 15084.0 tlwtints nlllllsnitsIii25011.0 quesllouIl11 tI Itappears It1I11111IIH Itappeus 25283.0 1I11111IIHappeusthllthum Ihc nUllamidtransport trautpolttrctusporttrctusportlute -716.0 transportInto trautpoltIlltu 25372.0 25451.0 Illtulute25436.0 tlltI1thilt1004.0 subterranean Hu1JlCrJlllWnllsuiterrenenn25379.0 cel1rllcelilrslargo largu11I1sUlargupieces largopieeH 25571.0 tllllOtherodi tlidltlilIllel dlvidetl pieces pieeHot25616.0 leaves IenveHlUll arc25819.0 vided videtllIllel IIIIu25791.0 smaller HIIlIlIfrfragments trllJIIClltfragumouts25751.0 nllllamidulihim ultimately 25808.0 26020.0 ihim timately tely 14904.0 25979.0 reduced ICIIUCCII10t0atllleIiue25951.0 pulp 111111lhlJThispulp lhlJIIulll 26135.0 26199.0 IIulll26192.0 Is26171.0 heaped hllIlWl1beeped26195.0 nllllHOUlIscoutbecomeii lIrcollwlIbecontenbecomeiiInvaded lIrcollwlI11IllIllll becontenIuvniletl 26315.0 26372.0 Invaded 11IllIllllIuvniletl26367.0 thu1I1Umycelium lIIcclhuumyeciluul15728.0 26327.0 otafungus CungufungusTito 26319.0 fungusfie 26491.0 aseptlcally UlUlltlenllyaseptlcaUyaseptlcallyclean aseptlcaUycleani UlUlltlenllyI -784.0 26579.0 fie Tito1IlltlulIIrmmycellutnIHiskept llltkipt26692.0 26767.0 clean cleani 26795.0 26739.0 free trcotromall26695.0 species llccleloffungi 17611.0 oftunul 17608.0 26879.0 fungi tunulIIIltlstdUVUIItrom26895.0 bacteria 1044.0 IJl1cterlnnUlI bncterfnand17328.0 Indiced Induced Induccl 27075.0 27135.0 ducedduccl27131.0 10grow 15480.0 IOW 27103.0 ht11116024.0 abnormal ntJllormnlnbnormnlwayby wayh 27247.0 swellings sVclllngllswellingswhich 27251.0 sVclllngllwhIch 27303.0 bringing hrlrlJthlHbrlugng27283.0 forth torth27436.0 constitute constltutlttime27463.0 oul127451.0 food fooettood27447.0 orthutheant 17616.0 27439.0 thunlll 27628.0 27715.0 ant nlll27687.0 colony 14816.0 27663.0 Moller likens IIkellsthese tlllSCswellIngs swell swellIn8 27891.0 Ings In827843.0 kohlrabi Ikohlrllbior27835.0 tuothoQcrtuau GcrwlllQermauQcrtuaukltohoti 17619.0 Qermaukitchen 27827.0 Gcrwlllkltchcn kitchen kltohotikltchcnaardeat cnrdcna UardCDs28139.0 28103.0 19036.0 28123.0 17688.0 28611.0 17727.0 18796.0 28875.0 np 18924.0 28911.0 18448.0 29463.0 29599.0 17640.0 29623.0 1164.0 16476.0 18055.0 29608.0 18112.0 WjY 18436.0 29951.0 jY


xml version 1.0 encoding UTF-8
mets TYPE urn:library-of-congress:ndnp:mets:newspaper:issue PROFILE urn:library-of-congress:mets:profiles:ndnp:issue:v1.5 LABEL Gulf Coast Breeze, 1901-03-22
xmlns:mix http:www.loc.govmix xmlns:ndnp http:www.loc.govndnp xmlns:premis http:www.oclc.orgpremis xmlns:mods http:www.loc.govmodsv3 xmlns:xsi http:www.w3.org2001XMLSchema-instance xmlns:xlink http:www.w3.org1999xlink xmlns http:www.loc.govMETS
!--METS HEADER--
metsHdr CREATEDATE 2006-07-25T03:26:44
agent ROLE CREATOR ORGANIZATION
name University of Florida
!--DESCRIPTIVE METADATA--
dmdSec ID issueModsBib
mdWrap MDTYPE MODS Issue metadata
xmlData
mods:mods
mods:relatedItem type host
mods:identifier lccn sn95047266
mods:part
mods:detail volume
mods:number 4
edition
1
mods:originInfo
mods:dateIssued iso8601 1901-03-22
mods:note noteAboutReproduction Present
pageModsBib1
Page
mods:extent unit pages
mods:start 1
original
mods:physicalDescription
mods:form microfilm
reel number 00175042635
sequence 623
mods:location
mods:physicalLocation authority marcorg displayLabel University of Florida FUG
agencyResponsibleForReproduction FUG
Present
pageModsBib2
2
00175042635
624
FUG
FUG
Present
pageModsBib3
3
00175042635
625
FUG
FUG
Present
pageModsBib4
4
00175042635
626
FUG
FUG
Present
pageModsBib5
5
00175042635
627
FUG
FUG
Present
pageModsBib6
6
00175042635
628
FUG
FUG
Present
pageModsBib7
7
00175042635
629
FUG
FUG
Present
pageModsBib8
8
00175042635
630
FUG
FUG
Present
!--FILE SECTION--
fileSec
fileGrp pageFileGrp1
file masterFile1 USE master
FLocat LOCTYPE OTHER OTHERLOCTYPE xlink:href 0627.tif
serviceFile1 service
0627.jp2
otherDerivativeFile1 derivative
0627.pdf
ocrFile1 ocr
0627.xml
pageFileGrp2
masterFile2
0628.tif
serviceFile2
0628.jp2
otherDerivativeFile2
0628.pdf
ocrFile2
0628.xml
pageFileGrp3
masterFile3
0629.tif
serviceFile3
0629.jp2
otherDerivativeFile3
0629.pdf
ocrFile3
0629.xml
pageFileGrp4
masterFile4
0630.tif
serviceFile4
0630.jp2
otherDerivativeFile4
0630.pdf
ocrFile4
0630.xml
pageFileGrp5
masterFile5
0631.tif
serviceFile5
0631.jp2
otherDerivativeFile5
0631.pdf
ocrFile5
0631.xml
pageFileGrp6
masterFile6
0632.tif
serviceFile6
0632.jp2
otherDerivativeFile6
0632.pdf
ocrFile6
0632.xml
pageFileGrp7
masterFile7
0633.tif
serviceFile7
0633.jp2
otherDerivativeFile7
0633.pdf
ocrFile7
0633.xml
pageFileGrp8
masterFile8
0634.tif
serviceFile8
0634.jp2
otherDerivativeFile8
0634.pdf
ocrFile8
0634.xml
!--STRUCTURAL MAP--
structMap xmlns:np urn:library-of-congress:ndnp:mets:newspaper
div np:issue DMDID
np:page
fptr FILEID



PAGE 1

FPiNKHAMHANKFUl1100MUwebnvedepoeltedwiththeNatlosalCityfinkofiynnIfoeew-hichirt-wCompoundPositivelyVegetableMRSOOOOOooooocaooooncoaoooooWooooo0Pinkhamsbuatncs-uuarrativoindianapolisProvingOgetab1OCoaipoundandbeforeIlentWomansMedicineiO0sgUgllEqualCOASTLydiaLettershlOIITngrlculturo1000000uaooooBkeptCltAWFOR1YIi4LEttupruvemnen-tsfreWinstoaaFLUltilA-FntOretitherePURVEYDRGrtnany-feafmnteeriteAmeri-canYoChlcnsoSANNmanWhy1tfLDHOBRB11CTltODit-canlparntlvelysuitChicagoSupplyheavy-weightacknowledgedtrnnsportntioutroubledCompoundenoughveroitcithatlunAu1uELK8ItGLCiSocensionallyImmediatelyoIC1ItiiIIATuoMrsoNtstruatlonswero1100000-0h1oconsiderablyExperleucedprofitslIJrJ1JTo10lJllorlltaI-UDLlSIIPDdevelopmentbe-grownwithoutwithoutEUQREMaccessNeerridiculouslyitfuorhl-couipethngPQtasVcg-etablomtltbrecdsgom1-1cnttleCompoundaroBlloclall1lnex1emllturefurnishingInrnfU1rGratefullyBODG-EAnIonlutlarmaatioaCompoundgwislnuioro-reHlrletedcompetitionoxperlrneedcoulbiuntlouInqulslUvoonthoincreneeinleucorrlneaMessengerPROFUSEIlls1VyomhmgnhlrtyR1tatioucnvltllUstaVegetableOhellpncrfrlleolllIostockingImprnvementsproductio11FAVORITEfoundationsAmericalargeteethlnqeoftenIMITATIONcompositionanythinggeologicalultimatelyonNhl1t11-MyesterdayPnrngunylutportantPotashremarkablepercentageanythinginllhantsnavigationarrived-theImportantVcgo-tablo1ennessuecommencedInducementIarngunyextraordinaryAr-geuthaerCnlrJlllParaguaydescendedCotvboysometlmesloucorrhoeafatteninglnIthutJonpackagesArgentlnNoportunttyboundarynavigableAmnollcnn1IURbUneighbor1turntshcdPI1nJuncuraboutRrGUAVANforPostolilco1araguttyrecommendNc1i-eArgentinealongsidePERIODSZE-rcowboysUruguayhouseworkmedi-cineMIllportalarmingcomparedParaguaymlIIODranchingPinkhntnslinlchll1nMrOwi1tHParaguayroulsll1unUruguayPinkhamsInrtiruatCUANGIIndustrIesExcellentnttltlonnltclnrhlJcrailwayshttabandsconductorpromisesscRroolyperceivedhu1l1RtrJmnscullnopracticalhouseworkappetiteproducershllllnjhusbandadirectionsullgrtitedterriblyconcludedIaragunATnErecommendedSquaro-cleragtinypufleredAmerican11U11UY8AmericanbalconyncqulccdDruggIstfavorableBRDWJOOOOOOOenlargedslightestAll1hnnutsulpllcdhmduslryexpmtedcowboysproductHalreadyweaknessintluHtricsforhilladevelopluorcnsoHIJURhIlSHSpringscommandEnglaulduactlcaltogethergroWlllmomentsPztra-gunybearingpxtCuslonexpensesI8rn-gunyfSS11OihundredsceremonyIl1clensclireportedAmericaBrazilianNortherninvestorsOOOOOQOrepublicsensationalreadydrugjtsFEEBLEnnoVIL11brigadepbTstrlanefticllltlesexcellenthrouglmtarngnaySouthernpoullieuColoradohealthfulobtainedenoughgauchoscoulltllcKfattenedenoughdcsthteclindustryiu-centivegauchosontl1lmquestionforelgrexpensesespecialuukuow11troubledtcountryprofusoLydiafoolinggrazingChangebedroomrelapsetemlnlllbedroomgroundsOIilletlollthslIn1frllsroc-IIIgenuinehllrLnHlelIIRluJSanKFrolthoughtmedicinertipldlyltlo-rntuloAmericaSnnnUvcunlmowlIstomachUolllngdetainedbrIgadeexpensesyourGrippen8tnllLIIIUlllhlIHcostingcountrycowboygrazingFtpOE-NasadjoinslOpcrnalwaysfallingAmericaLtvingclearedwillpatientvomitedttor-OneraisingtakingwithouttoturfregionsOregondemandchemiseBolivianforeignyourtl1ldngregionspitcimedreadilyraisingpurposesinWIClEJudgrdinstancestomachsimplyNorthetwindowlargelytidl-Fyears-agoMnnagrexpenseInstnnceanimalsraisinghusbnmOtrmnn7llIeIollurInteriordlsenscHllnvingtilougitbetweenfattenedoccurredpublishedoll1tlmoDIApealingcurtainsremovedraisingcapitalclaimedprefershOlllhtpuriaU1etdaringstomachtodnyprairiesfavoredortamiceWnRhluboughtsufferedexpendedthighscropanotherraisinghllncltncapitalAmertVIUDA-YyremninaAtizonnopenedhlnntlondoctorsraisingGERMANTIASwith-outredtursl1ollJhsonentlonsingesAMLnICANREEFNevadaweighraisingftodresseddescentlUAUBodkinspruperttowheth-erherselfarrivedlivingsocietyfi0aeeeeadescentgroundsexceptthoughnunmlmrbeganregardcr8ngoLydiaclimateleaguesupportoutsideopenedas-SlntcswantedhlcoIIlclothedlongerarouseduocoutlloaaromabeganS10Pminitactntuil-onett-etan1ehotimesaboututilizedprnlsoregion810500cropUnitedShRQubooaUnitedtnNsotsfriendsriderIdiscolorwundrfulhardlypeopleCUlllltybAdlyWIu1lntroubloifexlcoherselfo-ERbeforeexpressbottlesflowedHlniiltirUnitedpretltolthamsoothlnlflungsn-1II01llh45000-IbreedsneededUnitedowingdollarsexportmOnUllva-rletyChuraof-hlaclcregionArgen0A-raOhacochildrenandlcavo-thesnulueorandbottlesreallyaccountlungecheaplivingOURtable000000givenfortuneleaguecattlecheapUnitedCOrDICKSOUnitedborderGrossocontrol11C1riltcseldomabroadarrivalVnHoclo0tcloacdeasilyPepsintomatowinterRecorddoctorsFORKSwillstreamsummerItOIloofpossessnstreshealthStatesCOWDor-Lcannotprnctlbeing410110amongshouldtrulywouldcannotTheretncllC1aaaytedpersonnnntetlManysmalllICTIfollowof-heatgrasseshandsSlatesFrank11nativetRlx1exassweptfortilucannotovertrangesStatcHaboutnoticefriendAlauyLtzziraChllcowhichStatesbeforegauelimonthSouthObacofortydoctorsleepcannotnickelfictionPotsmokeICNIHVcgolargeOAUCUOmoneycattleCImcowhIchmoneyworthStatesErayedashcalveswhIchBrazilJoyfulrangeswomblerfulfencesMrslplaceCrawinvestTJjisbetterwombspentOrlxlsattainunderwhIchwhichUrctlltrclStatesLongStntcaloxnHSoulhlargeChacowagesCattleTcxnathinkplacemoneygoodiEH1111VtrmuchsteerswhIchwouldbatsoI1IIImannerwouldallOlItANNIzOrganIdahohousethanRomafalcongoodbottloliablestreotS1000bottleSouthStatesaboutwhicheitherwomanstorycattleIlICEcattlecnttloParIsaboutjohnsabouttakencalledgooddaysj5yearaskedcattleworlllcattleLIFEstolencagedwagesgoodpaIncattlerllhLweakdowncattlelittlebrokestreetcnttlustreetaboutwombpricesisterstillercattlopared11lhgoodsgreatSouthSouthSouthcattleSouththemt1ocattlelongrnugetlllcnEditorknowbloodwroteWushtakesnorthRiverherdsIU1dHwhennaecattlecattlecattleweakportsfully118113oInKSSouthyearsAdnmsericaa-headcurativeRoonCIPressWhatsavedcattleladyyourssavedtheythoygooddaysreducerThouuntilMANcoulllcattlevolumeHtlutllstockPariscouldt-Fiitheroprovereltableanlfe-rrtheyladyAfterworkmulchlandstlllcbentaboutsavedeverygladfishytlllXmadegreatffSlateulneoyearscurddownPresstheythesewhatwhatMllesStatesmellYearsuitslandsgreatuluclmsmallIdghiCostlyonlygreatblazewomanaleNowhatdressnorththeseParismilesonlyotllClPruttlbundsincestockTnr1l1TIIlrattlenugcuttiverItheyladywomanEditorofficelabornltedlahotpaidonlycoursemeanstheirthereyearswaitwithlandsheadthlttthere0onlythesesouththeirunclewhenlittleSOUTIIhavegUilTdonopubULCTTEnlJManyseasonnhougunywithpereoneUtnhworstthererlecstheretradepstheytheylittlecTltowithhead1250riverfro10goodSweatdyedmAilonftyearsthemYorktinyf-MtramstenowithPArapledWaterwnrmidealetrCIAUgrowbackstockthNnitertheirpaidNewcornergoodexcelwithbeingCoolrivalYorkwithfrontPinkaUafLumenwithtimetheirways010tiredhavesanghaveOhio111011canworsew-1IjustgoodlandwideheadtimebeenwithdonetrouthavehaveacrossacrossthanbeennrnmowdonoTICSwanthavehavethanullcdtimewithwithbeenwearshavetulrcfourhavetherebeenhavewithOhiotimeNowtimestartwifolLiltPostallyWashavechowbeefhavewithbeyearwithwithtlwllformfootlcoststimekayoverytimetoeshavehavethou0needbebottleverywiththatlandtreesyourHedeIsntwborejoinoftbeeftlumneCrlossskinsevendoesthenthatthatcrossthatDQrumyearAalnlInndheysuch4sNYbeefwhollrcayearthenTheretrollholdthenfoodncdasearsickwithfourbeefpoorsickeachhavolamsbeeffieldfourhaveeasylifecladthatJustneverputLifehaltdealsaysbeefT2500himanyTheMen1000binslIOliEwestfifthnercuwhofretfirstfilethiliMsaidhinthowFosseyearthatMyMyMnsroperoanIntoTHecasesIhatwillcoldthatnoneprayjustCompamironywriterfootlentcettHilid1000all-overnlsoitintndrycasesmoreroombestItoUnitThewillandYostTimeandSixTtXAS4311wllltoweralsoroomMywithCancentfewArkhadfilerthcrangwillmillS1meandlUllhadhadandandintoCuItIntoThegotacUonworldcoottho-ROnomorncoldhallwillandJhotillsfewTenhaditaEthinlieuhadandandmutebIgMrsMute410HotandlhoureafindlastfairlimeandknUllstillboldlh-InsonicratetrycostitemallhadlouanductodhadandandandwillthismillUIuandandtwoglutsumscxaslaybutandnudandlowcomenoneandthlHtlOI1fruitfeelandandamidlandgethadmoroitsHeAr81111tillsiaTlegandThelowrudyouandandandf1vohadwillShetryIlanlullwIndyet1-HeEATtwolifeYorkmenandandandVIieraintimidandtheputStZyettulCrubhusandnullfeltj80heriumfbutfindandlIarbnvoceunullseenbutherfivefeelhasherpatdtimidsheshenlaanotethethez3hasI1ctsYouhMsellhitsdidfireherUesanythehotboycoUetivorthehiltnotbutsheherwilltheherttySLYnowrUIIIIByagoagotutsamidLyOPtellthethefiresayhiltagocostownintuithasfiresaythethebutthehotnottheforthethetheturnnowcropsbuttthebywillthelIfothenththethedidthethe5thlimetiletimeseensoresu8notlimonotlimoshehermythethemythethothethethetimethetillthethethethethethethewasthanwasleethemanthothelUIIIIwonthohuttinetheforthenowtheforthetilethethethotheforthetimethotimelamathetimethothenowownownsellthethetheOlrlwaseatthefornrdlnandwasmypanmymythethethethethetimetHethethethethethetheforfortheFVhmythethesawnottllltimenotthetlllsftermyenttimeforthetimetheforthethethetOOthenowforfortheneedhiswast1OperSulthemyurunotoutbythenowbyyoutheomiemytheoldtheformeatforAllforthewastimeforyoutimeforformygreforWUftoldforforJ1jnotnotPOIKtnlivesfirthetheforIllthefornotforbymyforforforTheandforwasown8cateattenthecntIvofornil1t-LliontontimetitevereonlitAllcnnonearenotcnnJmnIlcatnvntintaleallNonrrffltieallciteLotAtemitaUimUrecancanmotcanyc-Itief-Jy7VQttiealloneolinusecanarccanPaItscanrillnitdonUarenil4tiAsandarearclirelanarewereareitsOaretreenutoretIeandmooretoouptuucnnlsurevasdonitHoeearupuptipti0rrlldocanburtarehoSo5Eand7ihooilhouptintanynUtdo1111InbyehboziponohohocdcarcenSohoitsophehetututilttrInInorntmeamGtnymillnrosexdohaaaltitbeDmoftothoAtetoohesumy1Y1I14tICtBI<=IIIIIIIijt


xml version 1.0 encoding UTF-8 mets xmlns http:www.loc.govMETS xmlns:mix http:www.loc.govmix xmlns:mods http:www.loc.govmodsv3 xmlns:ndnp http:www.loc.govndnp xmlns:premis http:www.oclc.orgpremis xmlns:xlink http:www.w3.org1999xlink xmlns:xsi http:www.w3.org2001XMLSchema-instance LABEL Gulf Coast Breeze, 1901-03-22 PROFILE urn:library-of-congress:mets:profiles:ndnp:issue:v1.5 TYPE urn:library-of-congress:ndnp:mets:newspaper:issue
!--METS HEADER--
metsHdr ADMID digSig CREATEDATE 2006-07-25T03:26:44 RECORDSTATUS Validated
agent ROLE CREATOR ORGANIZATION
name University of Florida
!--DESCRIPTIVE METADATA--
dmdSec ID issueModsBib
mdWrap Issue metadata MDTYPE MODS
xmlData
mods:mods
mods:relatedItem type host
mods:identifier lccn sn95047266
mods:part
mods:detail volume
mods:number 4
edition
1
mods:originInfo
mods:dateIssued iso8601 1901-03-22
mods:note noteAboutReproduction Present
pageModsBib1
Page
mods:extent unit pages
mods:start 1
original
mods:physicalDescription
mods:form microfilm
reel number 00175042635
sequence 623
mods:location
mods:physicalLocation authority marcorg displayLabel University of Florida FUG
agencyResponsibleForReproduction FUG
Present
pageModsBib2
2
00175042635
624
FUG
FUG
Present
pageModsBib3
3
00175042635
625
FUG
FUG
Present
pageModsBib4
4
00175042635
626
FUG
FUG
Present
pageModsBib5
5
00175042635
627
FUG
FUG
Present
pageModsBib6
6
00175042635
628
FUG
FUG
Present
pageModsBib7
7
00175042635
629
FUG
FUG
Present
pageModsBib8
8
00175042635
630
FUG
FUG
Present
amdSec techMD mixmasterFile1 NISO still image NISOIMG mix:mix mix:BasicImageParameters mix:Format mix:Compression
mix:CompressionScheme 1
mix:PhotometricInterpretation
mix:ColorSpace 1
mix:ImageCreation mix:SourceType microfilmmix:ImageProducer University of Florida; iArchivesmix:ScanningSystemCapture mix:ScanningSystemHardware
mix:ScannerManufacturer IImage Retrieval, Inc.
mix:ScannerModel
mix:ScannerModelName Next-Scan Phoenix Upgrade,SN# 0249-001
mix:ImagingPerformanceAssessment mix:SpatialMetrics mix:SamplingFrequencyUnit 2mix:XSamplingFrequency 300mix:YSamplingFrequency 300mix:ImageWidth 4889mix:ImageLength 7634mix:Energetics mix:BitsPerSample 8premismasterFile1 PREMIS object OTHER OTHERMDTYPE premis:object http:www.loc.govstandardspremis premis:objectCharacteristics premis:fixity premis:messageDigestAlgorithm SHA-1premis:messageDigest d39fb83bb698f273613ab6892a8c852654132476premis:messageDigestOriginator Library of Congresspremis:size 37323654premis:format premis:formatDesignation premis:formatName image/tiffpremis:creatingApplication premis:creatingApplicationName iArchives, Inc., 3.129premis:dateCreatedByApplication 2006-07-14T22:37:13mixserviceFile1
34712
488976348premisserviceFile1 SHA-18f56168b64fcab003d2795cd9653ee35b821bf76Library of Congress4666508image/jp2premisotherDerivativeFile1 SHA-10569e7fbaf0001f93dd977aa9d7b212cb545ef5cLibrary of Congress1438014application/pdf2006-01-24T19:09:34premisocrFile1 SHA-17b40bdb4f88fa05d5bf65b386fd816a308615ed3Library of Congress717182text/xmliArchives Newpah v2.32mixmasterFile2
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300485074258premismasterFile2 SHA-16a3a88e4e23c6a7c70495c51f28927395d5d31b0Library of Congress36012278image/tiffiArchives, Inc., 3.1292006-07-15T06:48:33mixserviceFile2
34712
485074258premisserviceFile2 SHA-129c44f6847f538139553841572f309424316f129Library of Congress4502574image/jp2premisotherDerivativeFile2 SHA-1fb8a528249ac54d2710e34f88195e6e8084fe833Library of Congress1511379application/pdf2006-01-24T19:09:56premisocrFile2 SHA-1293be258e0b8f305d46838c711483f097564c427Library of Congress1281101text/xmliArchives Newpah v2.32mixmasterFile3
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300485075998premismasterFile3 SHA-15a061e2d3177764e114c52a81d2f311ef9cef821Library of Congress36856178image/tiffiArchives, Inc., 3.1292006-07-15T06:50:43mixserviceFile3
34712
485075998premisserviceFile3 SHA-11e3749935a59be2ac560ae63fd218eb8a85d9db4Library of Congress4608044image/jp2premisotherDerivativeFile3 SHA-19c145a1d17735a1474f30b5388d1d8deb38ca925Library of Congress1493682application/pdf2006-01-24T19:10:10premisocrFile3 SHA-1c4e3d0bca9ed4d33571f05259d086da812d46c96Library of Congress1404053text/xmliArchives Newpah v2.32mixmasterFile4
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300486173458premismasterFile4 SHA-17a28609aa06b8275b52f7e4a42157a1bbdd7de6bLibrary of Congress35705073image/tiffiArchives, Inc., 3.1292006-07-15T06:48:41mixserviceFile4
34712
486173458premisserviceFile4 SHA-128bd0233758e9fc65e7664042ae0bdff7459c95cLibrary of Congress4464185image/jp2premisotherDerivativeFile4 SHA-13d0c67419726e974925990ea402241c7fd33ef4aLibrary of Congress1593670application/pdf2006-01-24T19:09:52premisocrFile4 SHA-11c42e269487b144a8ae4381d6f6d2a03b04b21a8Library of Congress1084078text/xmliArchives Newpah v2.32mixmasterFile5
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300486274988premismasterFile5 SHA-10aa84ed21fb63a5599337797323d403d9743a0caLibrary of Congress36456304image/tiffiArchives, Inc., 3.1292006-07-15T06:50:53mixserviceFile5
34712
486274988premisserviceFile5 SHA-10fa84d3fb2a64b200f4c6328c9bea5d5c5c458c2Library of Congress4558084image/jp2premisotherDerivativeFile5 SHA-1e5a345c694139616d42b0fa91db04e2cee8acadcLibrary of Congress1622799application/pdf2006-01-24T19:09:55premisocrFile5 SHA-102cdd116f0f994bdfdc0dd8332fa7ca0e72e0749Library of Congress1102352text/xmliArchives Newpah v2.32mixmasterFile6
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300491475338premismasterFile6 SHA-177b7b88d98d4360913d618cdbaf481858350460aLibrary of Congress37018190image/tiffiArchives, Inc., 3.1292006-07-15T06:48:35mixserviceFile6
34712
491475338premisserviceFile6 SHA-1ebb179407920d7e6f31ecaceddf3c10fc88d29e8Library of Congress4628329image/jp2premisotherDerivativeFile6 SHA-1edce3cf8d27690db18d6b7d65f49e496bb2aeb97Library of Congress1556314application/pdf2006-01-24T19:10:06premisocrFile6 SHA-1f328033c65402c9f8901883980d32f20adaee3bfLibrary of Congress647257text/xmliArchives Newpah v2.32mixmasterFile7
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300485475538premismasterFile7 SHA-196d486d6094ba1071e8c68956f9ceaf643c5b9dbLibrary of Congress36663290image/tiffiArchives, Inc., 3.1292006-07-15T06:48:27mixserviceFile7
34712
485475538premisserviceFile7 SHA-1443d53d074039eb7f8dc8e99f3db2dccebcfb227Library of Congress4583964image/jp2premisotherDerivativeFile7 SHA-1d197a6279388de857d0261b15eafb97039dffc19Library of Congress1511546application/pdf2006-01-24T19:10:23premisocrFile7 SHA-1386f0f4ffa24ccdd3e4778ceae60e3cec500fa61Library of Congress833845text/xmliArchives Newpah v2.32mixmasterFile8
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300506175568premismasterFile8 SHA-14480393df6e35fee7124d46438428e1ab6a9fa1aLibrary of Congress38241944image/tiffiArchives, Inc., 3.1292006-07-14T22:31:06mixserviceFile8
34712
506175568premisserviceFile8 SHA-158f918d24ce8c88b831056a4cda9ee4e80e4be46Library of Congress4781298image/jp2premisotherDerivativeFile8 SHA-15699755d21e9b8a20cb6766d0d179cf23fca7275Library of Congress1427308application/pdf2006-01-24T19:10:26premisocrFile8 SHA-124ba15d2255aa3fd643bc36f82c0695593b65520Library of Congress981316text/xmliArchives Newpah v2.32digiprovMD Mets record validation signature XML-Signature Signature http:www.w3.org200009xmldsig# SignedInfo CanonicalizationMethod Algorithm http:www.w3.orgTR2001REC-xml-c14n-20010315#WithComments SignatureMethod http:www.w3.org200009xmldsig#dsa-sha1 Reference URI Transforms Transform http:www.w3.org200009xmldsig#enveloped-signature DigestMethod http:www.w3.org200009xmldsig#sha1 DigestValue ScaeHRjLPpXftyaz4dUM+m4MSH8=SignatureValue VqgPzsl//C7hLvaGItuu/uo5gLciqY3BC4V6X2Y8fE6gD7WBsorA1A==KeyInfo KeyValue DSAKeyValue P /X9TgR11EilS30qcLuzk5/YRt1I870QAwx4/gLZRJmlFXUAiUftZPY1Y+r/F9bow9subVWzXgTuA
HTRv8mZgt2uZUKWkn5/oBHsQIsJPu6nX/rfGG/g7V+fGqKYVDwT7g/bTxR7DAjVUE1oWkTL2dfOu
K2HXKu/yIgMZndFIAcc=Q l2BQjxUjC8yykrmCouuEC/BYHPU=G 9+GghdabPd7LvKtcNrhXuXmUr7v6OuqC+VdMCz0HgmdRWVeOutRZT+ZxBxCBgLRJFnEj6EwoFhO3
zwkyjMim4TwWeotUfI0o4KOuHiuzpnWRbqN/C/ohNWLx+2J6ASQ7zKTxvqhRkImog9/hWuWfBpKL
Zl6Ae1UlZAFMO/7PSSo=Y mXOVPGlCNaLDDWsM5jfj5TvDmTxvJIvexBgDXCPi1M/4zBF2NEYJxfSw0wCSiKF+1UZ3rED0LI+C
ASWBos3yGoRXHjIwmeo9TJbIbxvRA7yA+errdOypRTefDs0JjDcdV9Our0FbPNmWV5TfDd2M/Kby
bvq8naha5mdcWiCaZ1Y=KeyName NDNP.2.2
!--FILE SECTION--
fileSec
fileGrp pageFileGrp1
file masterFile1 USE master
FLocat LOCTYPE OTHERLOCTYPE xlink:href 0627.tif
serviceFile1 service
0627.jp2
otherDerivativeFile1 derivative
0627.pdf
ocrFile1 ocr
0627.xml
pageFileGrp2
masterFile2
0628.tif
serviceFile2
0628.jp2
otherDerivativeFile2
0628.pdf
ocrFile2
0628.xml
pageFileGrp3
masterFile3
0629.tif
serviceFile3
0629.jp2
otherDerivativeFile3
0629.pdf
ocrFile3
0629.xml
pageFileGrp4
masterFile4
0630.tif
serviceFile4
0630.jp2
otherDerivativeFile4
0630.pdf
ocrFile4
0630.xml
pageFileGrp5
masterFile5
0631.tif
serviceFile5
0631.jp2
otherDerivativeFile5
0631.pdf
ocrFile5
0631.xml
pageFileGrp6
masterFile6
0632.tif
serviceFile6
0632.jp2
otherDerivativeFile6
0632.pdf
ocrFile6
0632.xml
pageFileGrp7
masterFile7
0633.tif
serviceFile7
0633.jp2
otherDerivativeFile7
0633.pdf
ocrFile7
0633.xml
pageFileGrp8
masterFile8
0634.tif
serviceFile8
0634.jp2
otherDerivativeFile8
0634.pdf
ocrFile8
0634.xml
!--STRUCTURAL MAP--
structMap xmlns:np urn:library-of-congress:ndnp:mets:newspaper
div DMDID np:issue
np:page
fptr FILEID


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\spin01.iarchives.com\scan1\jobq\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01343\ocr\0408.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:7973
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.3612
splitwords:0
ScansoftOCREngine Character Count:8821
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:10891
Abbyy6OCREngine Character Count:7865
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;7865;2841;41.8787;66.6535
language:en
ScansoftOCREngine Predicted Accuracy:46.47%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:4216
ScansoftOCREngine Character Error Ratio:0.6324
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;10891;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:66.65%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:66.65%
ImgPrep Component Range:5995,7973
version:Newpah v2.32 RoundBox
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;8821;5578;0.635869;46.4655
noPunctuation:1
ImgPrep Component Count Low Estimate:5995
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.32Styles TextStyle ID3 FONTSIZE 10.0 ID5 29.0 ID6 13.0 ID7 12.0 ID9 11.0 ID10 5.0 ID11 9.0 ID13 16.0 ID14 4.0 ID16 14.0 ID17 15.0 ID18 22.0 ID19 34.0 ID20 35.0 ID21 25.0 ID22 32.0 ID23 56.0 ID24 50.0 ID25 8.0 ID26 18.0 ID29 17.0 ID32 19.0 ID33 7.0 ID34 20.0 ID37 33.0 ID38 41.0 ID39 28.0 ID40 30.0 ID41 26.0 ID42 46.0 ID43 31.0 ID44 27.0 ID45 21.0 Layout Page ID1 HEIGHT 30536 WIDTH 19556 PHYSICAL_IMG_NR 1 PRINTED_IMG_NR [1] PROCESSING PrintSpace 29683.0 18984.0 HPOS 0.0 VPOS 392.0 PC 0.66650003 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 3268 17672 0 392 ns1:type simple language en TextLine 152.0 40.0 17632.0 String CONTENT WC 0.8095238 1I SP -40.0 17672.0 1Sri 128.0 100.0 928.0 544.0 1316.0 16588.0 816.0 1248.0 828.0 824.0 I STYLEREFS 60.0 1564.0 01 736.0 36.0 2376.0 1652.0 i 756.0 1620.0 320.0 224.0 5120.0 1192.0 t 2708.0 2412.0 1308.0 444.0 9476.0 I4 4132.0 5344.0 96.0 44.0 9840.0 1044.0 J -80.0 9920.0 116.0 24.0 9888.0 856.0 9884.0 396.0 172.0 16416.0 1000.0 Sri 0.95238096 6504.0 9912.0 728.0 7860.0 2052.0 1416.0 188.0 180.0 1752.0 lf lfi -180.0 2232.0 lfr 216.0 9696.0 7464.0 1168.0 14592.0 1656.0 1944.0 288.0 104.0 2768.0 800.0 360.0 1808.0 r 48.0 1760.0 984.0 840.0 2592.0 2016.0 G 424.0 2168.0 84.0 3264.0 2396.0 SUVAi -168.0 3432.0 888.0 2472.0 3496.0 2096.0 ULF 192.0 3304.0 912.0 712.0 7000.0 2136.0 1032.0 5968.0 896.0 752.0 7808.0 2160.0 7712.0 872.0 624.0 9792.0 2144.0 1232.0 8560.0 1152.0 4872.0 11376.0 1960.0 BREE2iE ALTERNATIVE BREE2iEO960.0 10416.0 1048.0 BREE2iEWaUVAt -4872.0 16248.0 80.0 16192.0 3068.0 O 16232.0 3071.0 < 164.0 1292.0 13716.0 3104.0 124.0 212.0 3144.0 168.0 14392.0 3120.0 464.0 13928.0 14884.0 324.0 14560.0 248.0 14752.0 1680.0 3216.0 68.0 52.0 3312.0 2424.0 3283.0 > 692.0 1732.0 144.0 432.0 2456.0 3288.0 rrWa 2452.0 140.0 684.0 2620.0 3292.0 WaUVAt -268.0 2888.0 120.0 596.0 4536.0 3316.0 EDlrlt 328.0 4600.0 3272.0 n1r -532.0 5132.0 5040.0 3328.0 112.0 4928.0 184.0 13780.0 3280.0 V 8700.0 5080.0 284.0 Vf -172.0 13952.0 196.0 14164.0 L 14064.0 88.0 14584.0 3352.0 14336.0 f -36.0 14628.0 15000.0 3336.0 372.0 15004.0 3236.0 N -48.0 15052.0 15188.0 3252.0 15168.0 16384.0 1136.0 15248.0 tJM 16432.0 11124.0 3340.0 108.0 3436.0 292.0 2420.0 3416.0 JM 1452.0 968.0 660.0 2448.0 tMaor -264.0 2712.0 3176.0 Ta3108.0 3300.0 3356.0 + 3276.0 204.0 256.0 3396.0 it -20.0 1576.0 3552.0 AtgrlriATSttnrnlt -100.0 3652.0 3768.0 3440.0 qo -1360.0 5128.0 4072.0 3952.0 4236.0 Tg 4124.0 76.0 5792.0 3584.0 hi 1344.0 4448.0 344.0 6304.0 3348.0 CR 5944.0 552.0 CrA -344.0 6648.0 628.0 6668.0 AVF -188.0 6856.0 220.0 6952.0 VFRDVILL 7296.0 268.0 2608.0 7492.0 RDVILL1lfLAAY -1036.0 8528.0 8616.0 3428.0 -1484.0 10100.0 8872.0 3392.0 1tIr1 8648.0 236.0 364.0 9736.0 3372.0 AY 400.0 9336.0 608.0 10344.0 11uc 244.0 640.0 10468.0 3368.0 IAHCU -484.0 10952.0 780.0 11272.0 221901 0.96825397 11108.0 xmlns:ns2 ID4 8028 4184 580 3720 ns2:type 568.0 3720.0 4r 272.0 1700.0 3884.0 -328.0 2028.0 472.0 2908.0 3803.0 LOCAL -272.0 1972.0 LOCALExemulifying -2908.0 4608.0 3740.0 -2648.0 512.0 2352.0 3872.0 0.82539684 1992.0 404.0 2408.0 2356.0 OCAL -508.0 2864.0 OCALEI -2408.0 4764.0 384.0 504.0 2960.0 3888.0 C -1804.0 592.0 3912.0 A 3464.0 AExemulifying -592.0 4088.0 2872.0 1860.0 4548.0 1072.0 Exemulifying 208.0 EI -1072.0 2932.0 148.0 416.0 2172.0 4556.0 mullt 2068.0 240.0 2692.0 4560.0 lng 2588.0 2988.0 4564.0 duty 156.0 3028.0 lu -320.0 136.0 y 3184.0 3504.0 4568.0 la -116.0 3620.0 h -32.0 3536.0 492.0 3752.0 4572.0 better butter3580.0 352.0 4376.0 thnu thnnthntt132.0 4244.0 thnttexphinhlg -352.0 4728.0 4380.0 4580.0 thnuxplulning -348.0 thnnexplnlnlug 4732.0 1060.0 1664.0 4756.0 852.0 xplulning explnlnlugexphinhlg2600.0 ItMr 2516.0 2604.0 It -120.0 2724.0 ItTnlfulnidtfcu 300.0 1816.0 232.0 5224.0 1lt Mr2152.0 5212.0 ErFurbnr 2048.0 2156.0 5228.0 Em -836.0 2992.0 2488.0 FurllM 2428.0 5272.0 3032.0 420.0 3088.0 5188.0 rondo hindc3160.0 3508.0 3564.0 5292.0 a 3204.0 452.0 3712.0 5248.0 firing flying176.0 5256.0 trip 4164.0 4596.0 to 64.0 4532.0 tollruhllj -152.0 4748.0 toTaltuluusee 1980.0 1640.0 5363.0 920.0 5376.0 Tnlfulnidtfcu Taltuluusee532.0 1768.0 llruhllj -792.0 2560.0 72.0 5476.0 e 2300.0 228.0 996.0 2624.0 5404.0 InatMondny fnat3fundny2468.0 5444.0 InatMondny34r -996.0 fnat3fundnyfi1r 2760.0 5464.0 lit -860.0 2912.0 5400.0 2972.0 -8.0 2980.0 468.0 3152.0 5448.0 undy 3092.0 undy1vJr -468.0 5868.0 160.0 264.0 5876.0 34r 1vJrfi1r1328.0 2176.0 F0yiiliamion 2024.0 312.0 5892.0 FO -1328.0 2380.0 5900.0 -108.0 900.0 WiiUllmilon YillhtmAun2492.0 3668.0 5924.0 of or776.0 5920.0 Voodvillp Woodvf1Irwoodvltlo3824.0 Woodvf1IrIIPllI -776.0 4664.0 woodvltloapeut -780.0 4668.0 724.0 3944.0 Voodvillpapout -720.0 2364.0 6100.0 436.0 6115.0 apout apeut356.0 6136.0 IIPllI -436.0 2056.0 2008.0 1976.0 760.0 2120.0 6104.0 ycdterdny yeatertlny304.0 2216.0 6124.0 edte -664.0 2880.0 6152.0 ny 2520.0 2952.0 6112.0 in 3156.0 tho 3100.0 tI -240.0 3324.0 6160.0 o 3260.0 520.0 6108.0 village lIlugevillageKav -520.0 3984.0 villageat4v 428.0 3556.0 lIlugev -428.0 6560.0 336.0 Kav at4v2004.0 6604.0 v -84.0 2088.0 884.0 2236.0 6564.0 ETricoof E -884.0 408.0 6572.0 Trlco Trico2964.0 6580.0 ur of3196.0 Tulluhusauo Tulltlhussou276.0 4224.0 6624.0 was 4108.0 W -276.0 4500.0 4436.0 6628.0 R 4336.0 6587.0 inthe -136.0 4704.0 Inthu 2564.0 1608.0 6736.0 200.0 thu 252.0 1612.0 6748.0 the thu-252.0 1864.0 508.0 1936.0 6768.0 vllluUe2504.0 6776.0 thin thlaLhis2444.0 92.0 2752.0 6820.0 2788.0 2836.0 6784.0 weok weulf3048.0 6827.0 u -192.0 3240.0 3284.0 6824.0 on 0113124.0 3528.0 busincad lJUlllncssbuahteed3460.0 buahteedItjiti -640.0 4168.0 3532.0 busincadiltini -636.0 lJUlllncssiw 4172.0 2968.0 1720.0 7172.0 7176.0 iltini 7224.0 Itjiti 2080.0 iw 2148.0 7212.0 Mintoateiil n -1060.0 3208.0 2256.0 7344.0 2312.0 7208.0 Aintii 2296.0 2344.0 7231.0 lln -440.0 2784.0 2612.0 ti 2528.0 376.0 2832.0 7228.0 steal sllul7284.0 1388.0 1111Icspt1chdly upincspedtills3384.0 upincspedtillsf -1388.0 4688.0 3524.0 pin -1164.0 772.0 3916.0 especially 3760.0 2680.0 1580.0 7380.0 1532.0 Jliruuiiiydlainond 7408.0 JHrrllliJI -1532.0 3112.0 7436.0 2292.0 576.0 7384.0 fChtsn 1712.0 700.0 7432.0 diamond dlulUoml3172.0 7443.0 uttachetl uttacheduttnchud7472.0 3856.0 4152.0 7452.0 h4064.0 itIoni 4260.0 itn it1uor 680.0 1716.0 7940.0 7960.0 Ioni 10111736.0 7963.0 1uor 616.0 2192.0 7980.0 ouokiritf euotihig2112.0 cClokfn -616.0 2808.0 2916.0 7983.0 hUll hua2696.0 ha 3180.0 656.0 7988.0 wrecked 3096.0 368.0 8024.0 WCC -656.0 3932.0 3748.0 7972.0 3644.0 4048.0 8036.0 many mnnyninny3936.0 mnny4onh -452.0 8044.0 nitlonui -76.0 4676.0 ndurn 1528.0 8147.0 8180.0 durn 1548.0 8223.0 4onh -372.0 1920.0 -424.0 456.0 1616.0 lonui 1624.0 8228.0 ic lc2072.0 2212.0 8232.0 c 556.0 8184.0 gHipuu 260.0 dlii -556.0 440.0 mtul 2632.0 8208.0 rutt -232.0 3012.0 8195.0 tho11102904.0 972.0 8188.0 matrimonial lUutrhllunlulntatrlutaniul -972.0 4324.0 4388.0 den lIeadenT lIeaf-236.0 4624.0 8248.0 lIeaIt den1t 4460.0 8252.0 eu -164.0 euU 8364.0 T2976.0 1688.0 8619.0 U It1t1956.0 8644.0 lout dontdurst848.0 8636.0 loukmuch 2332.0 8640.0 look -844.0 3224.0 2792.0 much 2700.0 788.0 8647.0 1UlIclaJlku 3228.0 8652.0 like -288.0 3636.0 8695.0 wo -216.0 3852.0 3692.0 vo -156.0 3848.0 8704.0 are aro8667.0 going gohl4160.0 goingto going2I-420.0 gohltl 1544.0 8852.0 tl 2I1668.0 1780.0 lihvii Ifvii2200.0 8912.0 2140.0 8888.0 I6UjDllrlll1 8892.0 auy 8884.0 eliring 8896.0 l -412.0 2668.0 2664.0 316.0 2716.0 ritig 636.0 8864.0 wttuther Yeathur8900.0 w 3736.0 3308.0 uthot 3212.0 3880.0 8868.0 thlat3708.0 L1I -284.0 4096.0 8932.0 4056.0 340.0 4272.0 8907.0 year yeur4128.0 yeurIr -340.0 4612.0 yearr 4372.0 8920.0 01br -212.0 4584.0 4068.0 580.0 9303.0 9364.0 9311.0 Ir brvr1104.0 2020.0 9316.0 1912.0 2244.0 M H112092.0 9320.0 Hunt Humllunt2384.0 3000.0 9348.0 10 In3004.0 620.0 3188.0 9331.0 hopping pupping3036.0 IU -620.0 3808.0 3380.0 9368.0 ll 796.0 3616.0 9340.0 JlHurouml 3516.0 3864.0 uround uruuua-548.0 4412.0 4468.0 9371.0 OJIop4408.0 oniliret 4648.0 OJItbrli opthreti 1540.0 9512.0 iliret tbrlithreti308.0 9548.0 Jetn JtJ1itegd2400.0 9540.0 ilii Llllli thtd-204.0 2740.0 9536.0 week creek2688.0 uk 3132.0 3256.0 9571.0 trill wiinWiL 3596.0 3656.0 9596.0 b a3488.0 3660.0 3696.0 9616.0 3784.0 9588.0 oet 9591.0 4016.0 3948.0 3896.0 -72.0 4204.0 4192.0 9580.0 4184.0 tchu 4308.0 388.0 ldtlitl ldtlitlttf -388.0 4320.0 9560.0 om 4604.0 lJdpuitt -44.0 1508.0 9735.0 ttf 1744.0 9740.0 chu tllu1684.0 2076.0 9768.0 rnulUluthilU rtwttuutI1984.0 9788.0 -88.0 4352.0 10043.0 Ii IiMrIII -68.0 4420.0 4304.0 10128.0 4660.0 10131.0 rItiedsrd 4680.0 4296.0 1676.0 10199.0 564.0 10247.0 Jdpuitt Itiedsrd1696.0 10252.0 MrIII -544.0 2240.0 J1 2480.0 10255.0 2552.0 liumll IlurrelllJ -580.0 10260.0 r1llIuml 2820.0 280.0 und and-280.0 3680.0 10268.0 TV T 3956.0 10264.0 3816.0 4216.0 Mbrlt 4084.0 MbrlteptUt 4640.0 4220.0 Kiwi Kiwij -368.0 4588.0 rJJtu -96.0 4400.0 3148.0 1484.0 10456.0 10500.0 j 10492.0 JJtu eptUt-60.0 1568.0 1672.0 10467.0 ieuiliu 944.0 luet5uuduy 2204.0 1996.0 Jol -940.0 2936.0 10487.0 2288.0 10472.0 Sunday 2316.0 2476.0 10464.0 umluYLlJl -464.0 2940.0 296.0 3008.0 and3376.0 Alunduy MumluyNuuduy4120.0 10476.0 inhe 4000.0 inhet -512.0 4632.0 inheirqf 10480.0 In 10515.0 4264.0 10459.0 iletheoLI -244.0 ilelrup4Ii 976.0 1492.0 10623.0 10668.0 oLI lrup4Ii -220.0 2036.0 10671.0 Jch -52.0 JchJ -364.0 2180.0 city cityrrut 1560.0 11143.0 11287.0 +irqf rrut1600.0 1748.0 -292.0 2040.0 1964.0 11148.0 1792.0 tf 2284.0 2388.0 2280.0 2460.0 V2556.0 332.0 11180.0 uinp usup11184.0 -332.0 nl 3164.0 11151.0 and umlanti3080.0 11156.0 wile wilo3452.0 11160.0 uiid11196.0 IUl 4196.0 4256.0 11164.0 Mru MtdMrdMruJF -296.0 4552.0 MtdF MrdF 11343.0 F JF11360.0 vjjuvn 1tuuru1636.0 11383.0 uUu -396.0 11355.0 iiivl ttu4j11380.0 d 732.0 11368.0 uiinghtor uuughLcruutghter3796.0 11408.0 upent luurapeut3648.0 4364.0 tin tlwtinJaitei1 tlwlaucl -196.0 tinJattlI 1444.0 11547.0 Jaitei1 lauclJattlI11603.0 1948.0 11595.0 1un -324.0 2100.0 urt 2392.0 11572.0 uf Ui2328.0 2536.0 2580.0 iu 2540.0 t111t -132.0 2804.0 -64.0 2868.0 11584.0 wreck week3052.0 ttk 3320.0 11612.0 uc Yt11620.0 Io -160.0 652.0 iutiucva lallnnl3424.0 11575.0 luu -652.0 3980.0 11623.0 utd 3876.0 4148.0 11628.0 xmlns:ns3 ID8 17904 4340 256 11880 ns3:type 1348.0 11880.0 2920.0 1648.0 12080.0 12084.0 Mr 1988.0 k1880.0 2208.0 DB12087.0 JqujiolJ VflulolJ2324.0 484.0 12092.0 Joupcl 12095.0 left lufthit3024.0 12100.0 last lallt4004.0 12108.0 3904.0 SundayuiJVsiiniOixwJfiiru -564.0 Bunda BundaIOlUhIU 4488.0 3116.0 1456.0 12279.0 IOlUhIU 448.0 JurA -760.0 1516.0 12448.0 II 1904.0 1500.0 12296.0 uiJVsiiniOixwJfiiru 1588.0 12320.0 huulr -1056.0 3044.0 12344.0 2432.0 476.0 2568.0 12332.0 WJUhJ tvtpru12307.0 hu hawill wIU688.0 12312.0 probably IJrubably3756.0 probablyj -688.0 probablyuvetlla 1428.0 12488.0 12528.0 528.0 ovntii uvetlla12539.0 ot -528.0 1908.0 12496.0 11111 2228.0 12511.0 family 1l1U1lybunny12516.0 ItttBron 2720.0 ItttBronA -608.0 3400.0 later fat -384.0 12559.0 un unr -184.0 unz 12968.0 13024.0 z1728.0 13004.0 chic uiuu1692.0 704.0 ulunwho 2132.0 WllU -312.0 2512.0 whuly -308.0 12983.0 11 ix2736.0 13031.0 708.0 12991.0 qupptwld -28.0 -628.0 3448.0 2824.0 1I1 2900.0 3016.0 purtd ld 3444.0 3548.0 13019.0 tu3764.0 13000.0 knowbay know -708.0 4472.0 4228.0 13048.0 111 13016.0 says -248.0 4476.0 saysL 4028.0 13152.0 13208.0 1400.0 13155.0 Jib Jtia860.0 540.0 13160.0 JlI -256.0 1068.0 13168.0 UtiiorjJiaifV 13183.0 tJ -1068.0 ba 1804.0 13212.0 tur 1888.0 13188.0 tlJrtllf 2196.0 2360.0 13192.0 satr -260.0 13195.0 Idea iduu2744.0 fii -336.0 ut13203.0 beauty txutybetuty3408.0 4100.0 Ujii 4024.0 13216.0 lat ld-360.0 4276.0 Vi ViJy ytu ytua 4456.0 4496.0 13296.0 13356.0 13412.0 1412.0 Jyjcui 876.0 536.0 13360.0 Jy 1940.0 13404.0 strut 1584.0 1644.0 iCLt11 13387.0 Ki 13375.0 tUap 2188.0 tUapI 2748.0 tUapMr 13536.0 13647.0 Sr 2276.0 13576.0 2496.0 2628.0 tMr 13740.0 13751.0 2928.0 13872.0 13924.0 13927.0 1844.0 13912.0 JnhK Jtha1040.0 Jnhr1tfrclt ftiovcf 2644.0 13980.0 uvc -356.0 13960.0 Cnrrrtbelle ofCrrbellCnrrlbefeii4156.0 Uvia 4528.0 Irhllth1K iirhitingfrienda 1432.0 14132.0 588.0 14136.0 rhllth1K 1440.0 via 1172.0 rhitingfrienda 1632.0 Kin -960.0 2616.0 14147.0 friend Crlendtutdr 2532.0 2684.0 14155.0 tuidwii 2780.0 14195.0 14212.0 3192.0 14160.0 ltitivea 460.0 14172.0 tlvei ILIl1J-472.0 3728.0 mar 3716.0 IIlU 4136.0 neuv 4044.0 14184.0 here herek 4524.0 hereA lu1 14316.0 dtta Hitt1832.0 14331.0 utxk utxkx -400.0 14396.0 CJ 4144.0 14468.0 +2984.0 14652.0 3332.0 14768.0 k 14844.0 14896.0 x 14859.0 1572.0 d1108.0 584.0 WHijfiMt 14876.0 avil -584.0 2336.0 l1 ell 2224.0 14912.0 nyn 2308.0 1520.0 14864.0 ya4abwhclIio 14871.0 baolicli -1172.0 4080.0 -576.0 3484.0 3472.0 14932.0 2996.0 14927.0 3592.0 14887.0 Hr 3828.0 lifo 14904.0 IIIit14944.0 4312.0 nJJ0i 4508.0 nr n3tuiti4eiull 1796.0 15068.0 15080.0 1660.0 3628.0 924.0 15240.0 15472.0 Jt 1392.0 15283.0 1128.0 15252.0 3tuiti4eiull 1464.0 15275.0 ii -676.0 2248.0 1724.0 15515.0 15272.0 aiJil 15328.0 tt 2252.0 2484.0 15300.0 15260.0 jtJP 3168.0 15316.0 2840.0 15280.0 3704.0 3456.0 tr1ttiiwtrli 4008.0 15475.0 4212.0 4052.0 4280.0 4520.0 15416.0 4504.0 3860.0 15560.0 1356.0 15631.0 15639.0 p 3632.0 IC ICIi -56.0 3688.0 1052.0 r1ttiiwtrli 15752.0 2660.0 2184.0 15760.0 ft 15800.0 15740.0 rl 115843.0 15735.0 Md -16.0 15775.0 -208.0 3772.0 15732.0 mg fg4232.0 ytd 4140.0 ytd14astR -224.0 15780.0 hQWt 1320.0 15919.0 15939.0 QWt 14astR1324.0 15952.0 JJ0i -404.0 1424.0 15932.0 tHitiecflcl 916.0 titeaebarvdttt -1268.0 3064.0 676.0 e6ttaot 2884.0 15927.0 rE nmk4ht 380.0 mki 3812.0 16000.0 15956.0 ltr 3960.0 15992.0 man tnnn4368.0 IK IKih -148.0 4516.0 4392.0 -124.0 Ibe1Irat 4432.0 4396.0 UfieBrat -92.0 3076.0 1364.0 16120.0 16164.0 be1Irat fieBrat1368.0 16171.0 ih -684.0 tltet 2104.0 tto 864.0 2108.0 16123.0 tontliiciie tonrltJcilnrlticlso -644.0 16191.0 an 16204.0 3232.0 16136.0 jUiJ t1 3684.0 496.0 3588.0 fiaing 11rIing3512.0 3836.0 blg 4180.0 garmeat gar lfar4440.0 garsnent lfarD 16391.0 meat snentsnentMr meatv1r 1376.0 16411.0 D 1828.0 JJt 1556.0 JJtMrT 16727.0 16883.0 MrT 16891.0 v1r1896.0 1788.0 16880.0 1JMnshhn Ir-896.0 16951.0 al -12.0 1436.0 AMnahthnabottght 16936.0 -1200.0 716.0 bhftbot bought 16888.0 ht -176.0 himself himaelfhlm elf elffh11111 4424.0 16931.0 afHeimr 4512.0 3136.0 17052.0 648.0 17083.0 fHeimr fh111111404.0 fiminrMfrulra 2012.0 iMJvulpB 2772.0 rlf 17088.0 JPI 17092.0 dndnIl 17128.0 17131.0 vra wiwnwn 3776.0 17140.0 g 3868.0 17135.0 andwill andW1I 1380.0 17256.0 17300.0 W1I211117348.0 4I 17320.0 Actm 1900.0 17360.0 17355.0 17340.0 17343.0 move ritOtorrabt1Ihl mvn -1576.0 17284.0 toCnrrubelle toOnrrabelie2704.0 17304.0 where wherelie 17292.0 where11e wherehe 17507.0 17516.0 lie 11ehe1704.0 17512.0 ntthdK nttfldh17535.0 1It 2060.0 1852.0 17527.0 2500.0 17519.0 run rani2436.0 2828.0 nflrny 2764.0 nflrnyTliH 17547.0 iJm iJmI iJmfill rirny rirnyrha -376.0 17804.0 17963.0 17976.0 TliH rha1596.0 fill 17968.0 EniNtnn 1820.0 fol -552.0 olt 2264.0 18007.0 inn lnnluok2944.0 18004.0 17971.0 onthr onthe604.0 rnthf fnthera1004.0 father1face -600.0 4116.0 father1facewhen -1004.0 4200.0 17979.0 face facewlwn 18011.0 act acthtll -228.0 1396.0 18160.0 18180.0 when wlwnhtll 1876.0 he hCgives pivenJriltI18175.0 his 2596.0 bl 740.0 tlmighter dnl1ghhrdnughter2856.0 18219.0 away nwnyny4360.0 18203.0 At 4284.0 Attho atthp atthe 1408.0 18383.0 18387.0 thothpmnrilM mmIIIHI mnrrisa-504.0 18428.0 2576.0 nltnr altarIe Is664.0 amusing amutingumu -660.0 lns 18392.0 whenone 4092.0 wb1-416.0 wb1one 18587.0 18635.0 one 1764.0 recalls roenlbrocnlid2340.0 18592.0 how huw2268.0 612.0 18595.0 anxious lIlxloU8hafin18599.0 had hndfindboon beenboontorrid beento 18640.0 ln lnto 18796.0 torrid 18811.0 -740.0 18824.0 get 1800.0 1868.0 1924.0 rid 18804.0 orather 2756.0 during durlng18799.0 past lI8t18819.0 ten tenye tene 19044.0 ye 1504.0 19047.0 tn Ifllirs19051.0 tnMr IfllIr irsMr 2956.0 19587.0 19591.0 Lam Lumfum2348.0 Harroll narrcllHarrell19632.0 81182924.0 19627.0 we3900.0 19596.0 mndo tnndnmndoI11I 19639.0 amlsta ainidtat 19791.0 19799.0 mlsta inidtatI11I 19819.0 tl1 1592.0 1892.0 19831.0 1840.0 19839.0 Ja +2320.0 2404.0 19836.0 Wetl 2844.0 19803.0 wlwn whenwesaid 3600.0 SAid nfd-300.0 4040.0 19808.0 that hutthatlie thathe hutJle 19952.0 20008.0 Jlehe20000.0 hnd had19995.0 ordered oNm2508.0 20048.0 2640.0 2544.0 20051.0 2892.0 grind Rrhidorgan ornn 20011.0 20059.0 Rnam Ran nm 1384.0 20192.0 20248.0 m an20212.0 nkpy IIkfl1nkej1552.0 20207.0 but tuatutho mltnit admita2728.0 th -460.0 20215.0 itl Chllt20220.0 3568.0 utartcd Itartcdatarted3732.0 utartcdtoordur Itartcdto atartedto 1132.0 20415.0 20435.0 644.0 toordur 1604.0 CJrd 2044.0 urdor 20460.0 20419.0 them tlwm1204.0 themTILE 20959.0 NOTICE TILENOTICEiftjierf -756.0 20967.0 -716.0 3296.0 TILEla -112.0 TI0E -496.0 TI0ERII -456.0 21199.0 21212.0 iftjierf 21215.0 -536.0 RII 21252.0 ers ry 2116.0 given Rtvn21219.0 tint thnt2776.0 thntBOdayn -316.0 8hJ 8tlduya 3604.0 21224.0 1fro 3832.0 from thothodUjMVfJ thed the4t 21351.0 21379.0 4t dUjMVfJ 1480.0 21447.0 -492.0 2032.0 21431.0 21459.0 21419.0 nnd-128.0 21455.0 2672.0 21424.0 tni21467.0 3128.0 8th Ilth488.0 6thdn 3576.0 21404.0 dny Jnyuf3892.0 May MiiyMII1MiiyA 21623.0 21643.0 21727.0 4 21628.0 1496.0 1708.0 21636.0 21667.0 21647.0 1208.0 Orinvfonlvilie OrnVfnrt1vIUtOrnwfnniyuleFlorldn eFlorida3844.0 orldn 4240.0 Inr IKIliy1 21792.0 21828.0 KIliy1 21823.0 -448.0 21820.0 1836.0 21840.0 -24.0 21815.0 UetfJon tplicnfon21835.0 cntion 21859.0 anlion HM3344.0 John 3724.0 JohnM 21848.0 11f 4416.0 21843.0 VM 4444.0 21984.0 22063.0 22043.0 22027.0 t1tt 22088.0 r1t 22071.0 1756.0 22035.0 -104.0 Jptlte ifl 22083.0 lo 22040.0 ot3140.0 Olrr OIrtult Otreult22047.0 uit 3788.0 Court Oourt22060.0 4248.0 ofthe ofta 22191.0 22267.0 ta 22272.0 22283.0 Wond at 1848.0 22292.0 22244.0 cand Jm2 Ju 22239.0 Judicnl JmHcnl22224.0 Benl 2896.0 560.0 22232.0 Circuit OlrculOheuit22235.0 22252.0 3780.0 22255.0 nd 22264.0 fur rrfurWnkiiUn rrW fore fore11ulnltft 3020.0 22431.0 22444.0 WnkiiUn 11ulnltft1784.0 22487.0 22451.0 Oumty CmlntyGmnty1856.0 Florid FloridiiFl 3468.0 rhl 22519.0 3608.0 far fdirdr3972.0 22459.0 aM22464.0 dis dildfedfeuharg 4188.0 disdmr dilchnr 22628.0 22656.0 dmr chnruharg 808.0 22696.0 iwuMgnee tauadgnet2124.0 2812.0 2304.0 22699.0 lUgnc 2164.0 22668.0 for ror22631.0 furJohnf Juhn22635.0 22639.0 TiiwleH TrlwicilTdwleeTiiwleHS TrlwicilJTdwleeJ-540.0 804.0 22871.0 S tiie GlJetaiedtiieCrnwfordvillc GlJeAlliin 3420.0 taiedAswinee 23075.0 516.0 Alliin AlliinCrntordm -516.0 3672.0 Aswinee AswineeCrnwfordville -704.0 23315.0 1096.0 Crnwfordvillc CrntordmCrnwfordville23319.0 Fin FIRFlu23327.0 April AprUAprllOth Otll0th3640.0 348.0 23340.0 1901 10011001A 1901A 1244.0 23971.0 2464.0 23976.0 BIG aIG2848.0 23979.0 DANCE DANCEThe 3500.0 DANCETh 24431.0 The Th -304.0 1088.0 Crawfordrille CrafordfiUeCran -1088.0 672.0 24435.0 tordrille 24443.0 BMC BMBae24448.0 Bell BaDBall24455.0 Club ClobClobrill Clubwill 24635.0 rill 11124640.0 giro glTegire24687.0 big 24643.0 dane dancedn 24683.0 alas24655.0 OoonCoartCourtHome OoonHouser 3968.0 24799.0 24847.0 Home HouserHouae1080.0 24875.0 next 24844.0 Friday Yriday24855.0 night nillbt24864.0 March Mareh29 2029All 29U 20All 2732.0 25064.0 25091.0 All 25087.0 aretaecdi4ily 25135.0 -1000.0 2852.0 25127.0 rec r4laly riilr25099.0 inr In4ttl invlltedted 3480.0 25152.0 3700.0 25119.0 attend UtMattendThere 412.0 UtMThe 25339.0 480.0 There 25344.0 -480.0 wiltboa wffl wntbe 2368.0 25351.0 acnko 25392.0 cake cnkc500.0 25355.0 raflrd rri25359.0 n1I -500.0 3840.0 25364.0 ofp 25367.0 o125371.0 aadaadthe anda 1Id 1Idtill 25551.0 25563.0 tilltIit25583.0 yuung younglady IMy2652.0 who wlrn25599.0 re neel reeelrea 3412.0 eive -392.0 25591.0 tM tae25607.0 4032.0 4112.0 25595.0 Most isrttMostTOtM isrttr IyoJ4 25759.0 25839.0 25783.0 TOtM yoJ41024.0 Tot 25799.0 wilt 25779.0 RfrtiIitMt iIun ithunt 2948.0 25980.0 25983.0 hunt 26023.0 unt 26043.0 26003.0 fdl fwlftdl26035.0 2220.0 26048.0 ci ewue aJmeo26051.0 ue 26015.0 Tb ToTasisIt 3544.0 26063.0 -380.0 3924.0 3800.0 26028.0 it26031.0 ml triDw714316.0 beto 4492.0 26135.0 26359.0 26151.0 26212.0 toregnitit toregnititp -856.0 26227.0 -852.0 26260.0 26231.0 regret r1JtretitThe ItThe 26443.0 26463.0 Htunll HfUDU26500.0 su 26507.0 all 26511.0 n8 26483.0 naoat oa tuIt off eIed26480.0 It26495.0 eta etsdsiD wHl rstfbr itbrelmi 26548.0 26667.0 26675.0 elmi ehaehltR ed ell2128.0 olu biLPIII gefttlciMtt Ittltle -848.0 estleaaet estleaaettLa -752.0 26684.0 tLa Lad Id26727.0 s 26695.0 wfll wfllbo wilthe 26859.0 26879.0 bo hendmlcted Iehntutdntltnitetd26883.0 Ire tnvIrtltnvdrunken IrtlThl Iret IreTiiu 27103.0 Thl Tiiu27131.0 dour auur27136.0 garner lletVeL27139.0 tsnA 27159.0 Sot fIOtfIOtIIrUllkPlLft 3560.0 atiarit 27179.0 clang clanggruttkeSLFr 27283.0 880.0 27339.0 drunken IIrUllkPlLftgruttkeSLFr27379.0 or dittfCtPrt diuttnic2548.0 onre 3040.0 onreaMwl 27343.0 9 524.0 27328.0 rsarutK 3404.0 27387.0 r10M 3940.0 27399.0 1448.0 27435.0 27459.0 7J 7JCOUlIltIt 1200.0 27595.0 27611.0 COUlIltIt crnnntttet27631.0 vviI 27599.0 nytcitrt 27643.0 27608.0 acid aodaodillltl acidi 27783.0 aMwl ftrlyd27800.0 illltl 27803.0 by Irrthw tlllltheiL 27859.0 3360.0 27911.0 2656.0 27831.0 27811.0 1p1 27851.0 27855.0 Iltr IltrOIthr 27868.0 lr 3056.0 27939.0 28003.0 teal 1472.0 28027.0 28032.0 1524.0 28012.0 order OIthrntrier 28051.0 ciu IIIItnmr2796.0 28055.0 28007.0 Sid Ill 27995.0 elljny eJrAY1216.0 ennytlnraelf -432.0 ennytlnraelfy4 -1216.0 3820.0 nrrJcJf 28679.0 28771.0 3 y4 3220.0 y4t y4viY 29087.0 29207.0 viY 29679.0 xmlns:ns4 ID12 7856 3292 4760 3851 ns4:type 5352.0 3851.0 DOES 5888.0 3928.0 IT 5828.0 6084.0 6164.0 PAY 6540.0 6280.0 6240.0 6416.0 Y 6400.0 TO 6944.0 ADVKU ADVEUADVE1tADVKUTISE -648.0 7592.0 ADVEUTISE ADVE1tTIKE 6228.0 4176.0 TISE TIKETISEUo 6644.0 TISEWo TIKEVo 5108.0 Uo WoVo4699.0 sometimes aorrotiniesBonothnrs6412.0 hero here6296.0 6860.0 4712.0 merchants nlcrchants6756.0 7784.0 4760.0 soy say7688.0 soyit sa 8032.0 sait sayt 4932.0 4984.0 4940.0 5048.0 5092.0 does duesdo 5380.0 4976.0 5284.0 5500.0 4964.0 not 4980.0 no 5764.0 pny 5692.0 4956.0 advertise tondortfslndvertise6308.0 7288.0 7076.0 7696.0 4968.0 if 7556.0 4972.0 ffft 7816.0 ffftIOI 7912.0 itloos itInes 4952.0 5171.0 loos InesIOI 5184.0 5136.0 5316.0 5636.0 5232.0 pay 5580.0 5912.0 6004.0 5204.0 why 5768.0 6380.0 dolS6324.0 6840.0 6728.0 6916.0 5260.0 Q7104.0 5252.0 7004.0 7392.0 7548.0 7640.0 5264.0 free mcrmerfreennta 8016.0 7644.0 mcrMIIIU merllIIta 4944.0 5436.0 MIIIU llIItannta5360.0 5312.0 5736.0 business bUBlnell9buaineds5640.0 6448.0 5496.0 men uten6396.0 6828.0 5460.0 7132.0 5456.0 h7020.0 Adver Advor7248.0 Advertising 7948.0 5468.0 AdvertisIng AdvortisJng 5556.0 7944.0 4904.0 5671.0 tising tisJng5680.0 has hMlifts5348.0 5712.0 5688.0 been becn5660.0 5704.0 6076.0 6636.0 5744.0 812.0 6876.0 5716.0 oyerKalnoo cverrdlnaooverlalnoo6808.0 7752.0 5724.0 thollrat 8008.0 thoHut thofirst 5903.0 Hut llratfirst5280.0 5951.0 newspaper nowspRpernowspaper5216.0 6260.0 5988.0 6692.0 5960.0 printed 6556.0 5972.0 7260.0 5976.0 ndJf 7744.0 ndJfIt 7888.0 ifit 5980.0 4896.0 6156.0 6172.0 did aid5012.0 5408.0 6204.0 6220.0 5672.0 6232.0 5592.0 6200.0 6012.0 wbydo whydo6444.0 6488.0 6684.0 6208.0 7044.0 6224.0 people peopJe6980.0 7632.0 keep 7544.0 keepit keept7996.0 4892.0 6432.0 5004.0 5056.0 6456.0 up 5492.0 6436.0 Suppoao Suppoe5244.0 Suppoaosovoralofyourflfonda 6140.0 Suppoaosovoralofyourflfondawas -2496.0 6188.0 loveralof -1800.0 loyor 6904.0 6700.0 lor 6476.0 yourf you1lron 7424.0 rion 7760.0 7804.0 6484.0 dxvris 7896.0 ds dsrid 4884.0 6656.0 6683.0 xvris6688.0 5164.0 5428.0 6720.0 como COntocome5372.0 5936.0 6704.0 5840.0 6144.0 you 6092.0 6544.0 nnd6640.0 6816.0 6964.0 6716.0 ask aakallk7348.0 6760.0 7216.0 7756.0 7636.0 foruelp forI forlClp 8052.0 forIeIp 4876.0 6912.0 uelp lClpIeIp5308.0 6928.0 would 5776.0 6943.0 help hall6960.0 thcm7240.0 7016.0 7496.0 6976.0 7404.0 wouldyou 7964.0 wouldy wouldym 4860.0 7180.0 7196.0 ym5200.0 go JO4948.0 7183.0 nnd and5388.0 5784.0 holpHnnother hell9nnotherholpannothor5728.0 6932.0 7251.0 ono one6832.0 7368.0 or7204.0 7604.0 your 7528.0 yourfiiendujwhotdld yourfriends 7704.0 our ourfLlllId4whoUd 4848.0 7395.0 1280.0 fiiendujwhotdld fLlllId4whoUdfriends -1280.0 6128.0 wlto 5392.0 5864.0 5808.0 6196.0 7468.0 nnt6508.0 7456.0 fisk7500.0 6764.0 youAdvertise youAd 7476.0 5008.0 7668.0 Advertise Ad 5240.0 7680.0 vrUde lot Jet6440.0 peoplopeollo7120.0 knoV7008.0 7723.0 thattthatyou 7728.0 thattyou 4844.0 7932.0 7952.0 5208.0 want wnnt5664.0 their thnlr5604.0 trade trndutradu6064.0 6744.0 7956.0 and6552.0 tell 7024.0 7552.0 tholn7420.0 themwhat -408.0 themwhutfoi tholnwhat 8172.0 what whutfoi 8212.0 7OL5544.0 5656.0 hnvu Juwolavu6080.0 8220.0 got 6040.0 6404.0 8204.0 ror6344.0 sole BilleLot Let6988.0 7480.0 8243.0 7276.0 thenthenstraw themknow themlhlV 8236.0 4840.0 8416.0 4864.0 8452.0 straw lhlV8428.0 thnt8472.0 gnu5648.0 8480.0 OU 8483.0 arunru8448.0 still stlU6284.0 8455.0 6652.0 6920.0 8464.0 the7220.0 8468.0 btisinew bIl8Inclbusinead7164.0 btisinewIf busineadIt7880.0 bIl8InclIe 4988.0 8672.0 If IeIttt5384.0 pays pnya8724.0 P1 5752.0 5804.0 6044.0 advertisa advtrtfsolnadvertieo8708.0 7028.0 8760.0 7192.0 8715.0 7116.0 7576.0 cityvhy 7872.0 cityhY8IOUJd cityvlty 8904.0 vhy vlty764.0 hY8IOUJd 5140.0 5196.0 should -524.0 5720.0 5788.0 8940.0 8952.0 Dot5908.0 6288.0 8992.0 6236.0 6660.0 8972.0 6936.0 8960.0 advortiso advcrtfeoadvertieo7772.0 8980.0 inIruwlordville -140.0 InJrnwlord inlruwlordvtlio 1028.0 4888.0 9167.0 Iruwlordville lruwlordvtliolruwlordvtlioVe11 -1024.0 668.0 9176.0 Jrnwlord -1020.0 1020.0 IruwlordvilleU 5560.0 9187.0 vlUe 5916.0 9700.0 4780.0 9860.0 5072.0 9664.0 Well vellVe114900.0 5696.0 9659.0 9668.0 Bryan 908.0 9672.0 Bryanis -668.0 6592.0 9679.0 is 6996.0 9692.0 defeated de1cat -916.0 9676.0 defeatedwe 7656.0 dwe 7928.0 9932.0 We ITWe 5096.0 4804.0 9995.0 we 9952.0 bow 5756.0 9972.0 5628.0 9976.0 5964.0 win6472.0 7188.0 9987.0 7572.0 10000.0 thennjority 7900.0 theunjorityand thenajorityand 7920.0 10232.0 868.0 nnjority unjorityand najorityand-868.0 5732.0 6452.0 6796.0 offer 7512.0 10348.0 7280.0 youbargans 7884.0 youhargana youbarganr 4800.0 10532.0 844.0 10540.0 bargans harganabarganr5644.0 6060.0 10548.0 Drygoods 7268.0 10572.0 Shoes 7100.0 ShoesHats -612.0 Shoesslats 10812.0 Hats slats10840.0 5300.0 5520.0 10832.0 Caps 1372.0 11176.0 6512.0 6708.0 6788.0 7148.0 Duval Duvalr 7776.0 11544.0 11615.0 fl xmlns:ns5 ID15 16931 3244 4640 11920 ns5:type 11920.0 Sny 11928.0 11971.0 JOU5652.0 11940.0 please pleaie6000.0 11948.0 6528.0 7084.0 11944.0 6972.0 7444.0 11960.0 place prace7336.0 placer placeto7848.0 praceLosct placetoget 4692.0 12135.0 4744.0 12156.0 Losct toget4708.0 12160.0 12140.0 value valuer12152.0 lor6056.0 6392.0 12191.0 yogr6492.0 12200.0 6576.0 12196.0 money monev7448.0 12168.0 IB Isit7332.0 7684.0 12220.0 7564.0 12188.0 rt rtDuvall 7840.0 12236.0 to7768.0 tDuval toDuvalf 7236.0 12352.0 12375.0 DuvalfDuvalIcarry -560.0 7796.0 Duvall 7700.0 Duvalltbaaas 5088.0 12640.0 12680.0 tbaaas 5112.0 tbaaasI -816.0 7508.0 6696.0 ql -812.0 qlIcarry 2860.0 12872.0 12903.0 Icarry -728.0 5684.0 12923.0 carry 5028.0 5780.0 12932.0 large 5896.0 12908.0 assortment 6516.0 assortmentof 13180.0 fine 4924.0 smileswlth smiles smi1es-1188.0 with 6812.0 which 7596.0 13240.0 togreet toI 13243.0 7876.0 13548.0 greet 13556.0 myustomers myustomersF -1324.0 13596.0 my 956.0 5812.0 ustomers ustomersFV -956.0 ustomersF 1212.0 6500.0 13864.0 13867.0 FV -144.0 6804.0 AV W7032.0 13879.0 Dnval Dnvalhand Dnv DnvalI 7536.0 7672.0 13887.0 IJ IfI 14432.0 fI I14684.0 QJp 5016.0 14672.0 line ine5856.0 7340.0 14692.0 ofr 14796.0 7624.0 14667.0 fg 7800.0 15179.0 6008.0 5584.0 7568.0 6096.0 Attarn 15159.0 15371.0 rJ 5236.0 6360.0 15388.0 6332.0 15263.0 892.0 7272.0 15596.0 IIs 15704.0 tarn 15727.0 sal1Ya 5288.0 a1 -1156.0 16012.0 5772.0 832.0 6256.0 aJS 1184.0 6600.0 15803.0 jsgi -488.0 7088.0 jsgirand -1184.0 15815.0 qQ qQhand 4696.0 16287.0 hand rand16335.0 5880.0 atp 6632.0 16340.0 atF 16823.0 p16911.0 4992.0 16840.0 Duva DUfaDuvcDuvaWith DuvcWtth-1232.0 7232.0 16948.0 3Vlth 7664.0 17708.0 548.0 With VlthWtth5540.0 17719.0 each 5472.0 948.0 17728.0 purchase 7140.0 17716.0 7056.0 bfSOc ofSOc7396.0 bfSOcworth ofSOcworth 50c 50cworth 632.0 worth 5320.0 5884.0 17999.0 Tobacco MiltwillMilivr twillgive 18228.0 18299.0 give tfivp4796.0 18312.0 ivr 5064.0 5676.0 18347.0 box 5548.0 6132.0 18335.0 6520.0 Liberty 6316.0 Bdl I3Mt18324.0 Bdlnuff 7792.0 18256.0 mtt mttnuff I3Mtnuff 1tfivp 7824.0 18623.0 nuff 5180.0 18643.0 5044.0 18736.0 5356.0 7096.0 Duvals DuvatDuvalsEngine 7708.0 DuvatEngine Duvalst 7608.0 DuvalsEn -632.0 18844.0 t18852.0 4832.0 19079.0 19215.0 Engine En 5032.0 19084.0 gino pll 5516.0 oil 01119223.0 40ct t0ch5740.0 Octl 6320.0 19256.0 per pcr19220.0 Gallon Onllon19236.0 7136.0 atWW atW atW11 1360.0 6368.0 19460.0 WW W116848.0 6680.0 19471.0 6532.0 19468.0 Wnlkerla 1Vnikera1Vnikeraapayrnaai -712.0 WnlkerlaPATENTS 7092.0 Vnlkrr 7660.0 19508.0 IIa 4752.0 19760.0 20167.0 4936.0 20200.0 PATENTS PATENTSr -2624.0 7560.0 4824.0 21000.0 21007.0 apayrnaai 21012.0 6184.0 21003.0 ru 6068.0 952.0 smaaIikh smaaIikhrtbett -952.0 1r 4880.0 21116.0 21127.0 rtbett 21147.0 hole 6024.0 21151.0 768.0 6192.0 21136.0 piM 6480.0 MW1iIY 6408.0 21123.0 21119.0 now floe7264.0 nowt 4820.0 21240.0 OM Ul 5412.0 21235.0 111141 21243.0 MM n4rnKa 6568.0 n4rnKaon 7352.0 21179.0 7 7360.0 21260.0 7416.0 1ruL 21336.0 21356.0 ruL5340.0 5160.0 hft 5424.0 5480.0 hoot lrtil5620.0 5800.0 21359.0 ttnu warm 21371.0 tftf 6052.0 6244.0 Sit 6420.0 21376.0 6356.0 Ctf4 6664.0 f4 6836.0 Mlifntonl lifntonlIninrlm Iuun Lnkn LnknrmR 7600.0 uun rmR5364.0 21464.0 LArrur 5304.0 5528.0 wTnt 21475.0 6464.0 UAU 21472.0 6872.0 nausea raaticL6620.0 nauseaAII 7620.0 raaticLu 2440.0 4828.0 21583.0 21699.0 AII AmP 5000.0 21588.0 6364.0 5992.0 21715.0 932.0 7124.0 rr rrftrn 4788.0 21783.0 Ininrlm 21811.0 ftrn 5192.0 Mks Htitntt ntte5220.0 tUit brr5928.0 uaM uaMw 6272.0 21883.0 21927.0 5168.0 21936.0 940.0 5872.0 SNOW 21931.0 COPATENT CO 00CORemember 00PATEInLAWTI 22159.0 1140.0 22176.0 PATEInLAWTI 5552.0 22207.0 PATENT -1136.0 696.0 uwtitj uwtitjOp -696.0 6896.0 22343.0 22383.0 Op 22348.0 Lth4Nt 5024.0 22388.0 MMINTIM ba11lf 22391.0 7520.0 22355.0 ttRemem 23080.0 IRemem 23419.0 Remember Remem -1152.0 23436.0 berI 23491.0 er 23428.0 23499.0 23496.0 23511.0 7320.0 onecan 4652.0 23716.0 23775.0 can Baking 23723.0 Powders PowdcrgPowdcr6176.0 23747.0 iree freeireewith freewith 23991.0 24011.0 5148.0 24019.0 24016.0 6780.0 24035.0 25c 2Sc2k7156.0 25cSOc 2ScSOc 2kSOc 24291.0 SOc 5176.0 24352.0 5020.0 5616.0 24307.0 100 24311.0 6900.0 6800.0 24319.0 flourF 24315.0 flour ftou 7584.0 24387.0 rF 24587.0 24595.0 6300.0 7048.0 24604.0 DavalDuvalCigar -624.0 DuvalCigars DavalCigar 25576.0 Cigar Cigars25627.0 25604.0 let Jet6880.0 25663.0 ocay OIIeasy6732.0 25672.0 ocayterms -840.0 7720.0 OIIeasyterm 25683.0 ay 7128.0 ayterm 25932.0 25943.0 term terms25952.0 5276.0 720.0 Durals DVYaJsDiivals1300.0 DuralsLadie DVYaJsLadies DiivalsLadfetl 4656.0 26491.0 744.0 Ladies LadieLadfetlShOe SboeShoes6336.0 26527.0 5026539.0 6672.0 26607.0 upat 26856.0 DuvalLotrftat -604.0 26904.0 Duv DuvalLout 7316.0 a1Loof 27495.0 Lout Loof4808.0 Lotrftat 5268.0 27527.0 5564.0 27535.0 vaf mrinp27507.0 Ifoc lfncIfneelf6216.0 Chinaware 6548.0 Chln 7484.0 27579.0 27540.0 beT0yoi 7780.0 beftC1OUobtJ beate 27707.0 ftC1OUobtJ 27739.0 ate -944.0 4724.0 T0yoi youtruy 5588.0 5336.0 27752.0 27743.0 uj 27715.0 ekcwhcre eldcuhere27755.0 -788.0 27724.0 ewhcrr 27727.0 27735.0 f8is6712.0 27731.0 finelineP fineF lineF 1008.0 27979.0 P27987.0 6852.0 7168.0 7068.0 27984.0 7304.0 27991.0 DuraJ OllYaDuralOllYaJ OllYay28411.0 28575.0 28675.0 28751.0 xmlns:ns6 ID27 7900 2868 8056 3872 ns6:type Nn 8404.0 8500.0 8688.0 1JEVELR 1J 8216.0 JEVELR 8344.0 JEVELRS -1132.0 9352.0 8440.0 -912.0 600.0 8752.0 r4R 8800.0 r4Ri4tokpk 8496.0 8860.0 APL APLnnd 9412.0 APLn 8340.0 i4tokpk 8984.0 8948.0 9152.0 9048.0 9300.0 9248.0 nc 9384.0 1e 9480.0 10088.0 4868.0 10052.0 10424.0 4843.0 moot 10360.0 mootnntl8 10796.0 8192.0 nntl8 8728.0 5055.0 h4 8628.0 9092.0 5103.0 mu muanlled 9732.0 rlt 9992.0 10240.0 5036.0 10120.0 10584.0 5076.0 goended 10736.0 ended anlled8740.0 5267.0 lwe1r lwe1rhaln 9252.0 Jewelry 9892.0 0000 9400.0 watch 10256.0 watchchain 10800.0 8176.0 chain haln5488.0 8600.0 8832.0 9028.0 fire firc8968.0 9360.0 5524.0 cc9304.0 athna 9520.0 10208.0 Jewoky 9500.0 Jewokyhas -596.0 10804.0 hna8488.0 come8436.0 9044.0 9344.0 9200.0 bedNS 9776.0 le 10068.0 article 10564.0 ofdreas 10816.0 8160.0 5883.0 dNS dreasdreasYou 8568.0 dNSYou 8332.0 You 8712.0 6143.0 9004.0 9060.0 buy liessot less 10200.0 10020.0 10288.0 10592.0 peo aeo10404.0 peochnt aeothat 8164.0 chnt8552.0 6384.0 6372.0 got8836.0 6355.0 wha 9144.0 9204.0 wI 6352.0 ptsy 9380.0 6375.0 6340.0 far10420.0 whel110316.0 whel1Ii 10808.0 whenyou 9904.0 6496.0 Iiou 9928.0 2676.0 8152.0 6584.0 ou huy9008.0 Ynu 8792.0 9148.0 6608.0 9424.0 9796.0 rb 9492.0 9804.0 6596.0 9956.0 10084.0 of9864.0 thlll this10236.0 10720.0 6536.0 if10620.0 Ityou 10828.0 ifyou 8144.0 8520.0 bay6772.0 of8824.0 9104.0 Wo 9024.0 6779.0 9280.0 6752.0 Oj 10028.0 SopchoPIIY SopchoppySopchoPIIYliII SopchoppyFla-796.0 10824.0 6956.0 6968.0 liII Fla8516.0 6971.0 8408.0 hnl hna6984.0 toJ ful9296.0 tnwl1t tmrnt9552.0 10352.0 of10216.0 10596.0 thr10496.0 thrw thett 7155.0 8304.0 8456.0 8264.0 8460.0 FMAIN 8676.0 MAIN 9156.0 00 COIvory 9452.0 10060.0 ery 10292.0 GrtlolcGrtlolcIIr articleat10836.0 8136.0 7367.0 7388.0 IIr at8336.0 8284.0 these 8592.0 7428.0 so 8744.0 8796.0 Hoooabfl goods 9592.0 9256.0 9488.0 7400.0 9720.0 7376.0 ranted 9940.0 ntlti 10408.0 tu bt be10556.0 bttCllotly beexuetly 8128.0 tCllotly exuetlynfe na 9392.0 9240.0 7588.0 tepr 9508.0 7648.0 9572.0 410040.0 9816.0 10280.0 IJrlntc10148.0 printedguarantee 10284.0 IJrlntcRIUr 8124.0 7836.0 RIUr 792.0 7819.0 guarantee 8588.0 ntco 8916.0 tothis 9136.0 9288.0 hls 9504.0 9748.0 9996.0 Rfvrl19808.0 10392.0 withlnrh 10504.0 witheneh 8120.0 8011.0 lnrh eneh8532.0 8000.0 nrtfcloot 8476.0 9132.0 8028.0 8051.0 8 s10072.0 purclm8cti pureltased9968.0 purclm8ctiI pureltasedat-768.0 8215.0 nt at8328.0 8276.0 8768.0 store 8716.0 storeW 9164.0 storelV 1296.0 lV8420.0 8632.0 8475.0 9188.0 9128.0 COT COEnatern 8272.0 8720.0 Enatern 8400.0 nRtcrn Fnetor Fnetnry 9484.0 1endslip 9568.0 964.0 9900.0 fllnd8hh11I1 fllnd8hh11I1tIdy -964.0 10864.0 filleddy 1928.0 8096.0 8924.0 tIdy eddy8564.0 8936.0 Sts 8944.0 Provide 9896.0 I9564.0 1WCliternFnotorr IWeatnrn 9023.0 9112.0 Weatnrn 1340.0 WCliternFnotorr -680.0 9096.0 aotory 9764.0 9192.0 9124.0 rarest 9824.0 9868.0 9184.0 10136.0 10080.0 9119.0 tJcflry JevralrytJcflrylIctoryl 10868.0 JevralryIidctorytn 8088.0 Iidctorytn lIctoryl 8812.0 tlut 9084.0 vof 9224.0 9416.0 9856.0 at101 InwnOft 10440.0 OftIl 10716.0 City CityIbwa 8080.0 9528.0 Il Ibwa Over 9563.0 oOo 9064.0 9324.0 OO 9576.0 9752.0 door toor811nce apnce10312.0 811nceBt apnceBryan 8308.0 10116.0 Bt 10091.0 c1 8964.0 10151.0 9328.0 9456.0 9440.0 9780.0 dI bu 10276.0 10111.0 10368.0 thatfloes -444.0 10900.0 hat hatdoe 8056.0 10320.0 floes 8060.0 doe 8596.0 10439.0 10340.0 notc4q 9056.0 10419.0 cb 9544.0 q prIce 10008.0 10192.0 10396.0 rice 10680.0 10391.0 ofgooc1sIat 10696.0 10904.0 ofgooc1sllt 10908.0 gooc1sllt gooc1sIat10112.0 Dnvats DnvalsDnvatsIf DnvalsIf11276.0 11332.0 11340.0 arc8816.0 9236.0 11295.0 iii itf9948.0 Of 9436.0 10484.0 goad 10604.0 obd 10916.0 8804.0 11519.0 11552.0 roadwg road 9644.0 11592.0 wag 9196.0 ar 9620.0 91 10168.0 any nny10108.0 10528.0 kind xmlns:ns7 ID28 18135 3220 7928 11776 ns7:type 11776.0 11784.0 hiccle 11804.0 call 9496.0 11827.0 -4.0 nuvals nuvrslsnuvalsBitU -588.0 nuvrslsBig 12208.0 BitU Big 8784.0 12287.0 12211.0 8976.0 df 9556.0 fi 10004.0 12284.0 Jf 10308.0 12224.0 hoo 10544.0 10648.0 ks 10664.0 ksrindliilreti 10660.0 11116.0 12256.0 Jnnd1 8004.0 12436.0 nnd1 rindliilreti 9036.0 rj 9000.0 9212.0 9464.0 12552.0 9396.0 ivcd 1VCd10372.0 ttl 10624.0 12508.0 8020.0 12716.0 12768.0 8732.0 9632.0 12788.0 IoIo 9652.0 12819.0 oIo 9292.0 12892.0 H 10144.0 Duuvs UUUVS10936.0 12935.0 t10784.0 tits 10984.0 10940.0 vfor 13052.0 1N 9800.0 13268.0 9016.0 13372.0 its 13420.0 9268.0 13380.0 tH1ghecr 13516.0 H1ghecr 9760.0 13551.0 1064.0 prlceatd 9852.0 prlceatdfor -1064.0 10976.0 7976.0 13895.0 13904.0 8368.0 skins sikin8280.0 aftdfits 13900.0 1tidf 9828.0 13975.0 13907.0 atKQTK 14139.0 10064.0 14232.0 fluya1 fluya1nOTI 14339.0 14639.0 9012.0 14516.0 8072.0 9376.0 14735.0 14828.0 KQTK KQTKil 9624.0 nOTI 9244.0 TI 14839.0 rLequttt 9872.0 10164.0 10932.0 15020.0 15032.0 Ijt 10964.0 9848.0 15099.0 jt 8756.0 15172.0 Lequttt unCUf11tI 15247.0 9924.0 wft 10056.0 15268.0 11004.0 7936.0 15343.0 15407.0 ftlfiJ1 by3let11101and 8692.0 15359.0 Jn -1364.0 15364.0 8988.0 15356.0 1001 9660.0 15351.0 tngc 10296.0 10448.0 qc 10600.0 10860.0 15376.0 nil 10968.0 10920.0 tM1u 11048.0 15520.0 15571.0 il 1u 8064.0 Hlth 8148.0 8156.0 ithe 8544.0 15552.0 undcrnlanndnnd 904.0 8604.0 umfcivlgnoi unttcritlRIICld-1292.0 9628.0 15555.0 15528.0 nolsettled notsettlcd15591.0 15576.0 et 10512.0 t1lRi1 byiUll 11036.0 bJo 10956.0 byIrlll 3084.0 Jo Irlll iUll 8324.0 15783.0 hot it48392.0 15763.0 wiirb dltLf ttiirbe15744.0 placed itlacedjlaced15795.0 mthd9916.0 10328.0 Imiidn lutlnbllnndr10124.0 10896.0 ol atolan atan 15936.0 16007.0 15972.0 ofllcer ollicer8084.0 omc rwltiifuJllnstrtlctlolht KldHull -1748.0 sslh 9160.0 15967.0 tull 936.0 instructions instrtictlotw9432.0 10552.0 15995.0 15947.0 toeol 10708.0 toeollect 10748.0 15964.0 col collect lloct 16035.0 16187.0 lect loct16363.0 r16376.0 16371.0 FW 9072.0 16380.0 IW9988.0 10376.0 DuvalLeftmfcm DuvalLet DuvalLetmm 2876.0 16719.0 16759.0 Leftmfcm LetmmLet 16832.0 16800.0 rl1 8828.0 9272.0 16835.0 16772.0 aure40Ur 572.0 a4ar4 -1140.0 10412.0 9844.0 16767.0 cigar cigartaste 11072.0 cig cigtate 17055.0 17095.0 taste tate17072.0 17060.0 Vl11tvi118736.0 9388.0 idtfff 17067.0 good goodfit 11032.0 fit r8140.0 9408.0 17464.0 9080.0 V4 10092.0 17332.0 u17335.0 10300.0 DuvalIf 10972.0 DuvalI 9308.0 17940.0 18036.0 18044.0 18047.0 ybu 8388.0 9140.0 18064.0 9812.0 tbargana 1bargnnbargans18148.0 -892.0 10704.0 10856.0 inDry 11024.0 inDTJtc 18107.0 InDry 8132.0 18363.0 18367.0 Dry DTJtc 8524.0 8696.0 18443.0 ct 18435.0 cf cF 1036.0 9600.0 Groceries Grrocerieso 10636.0 Grroceriesoto -1432.0 10928.0 0oto 18716.0 18748.0 10228.0 Duvalb Duvaib8168.0 Duvalbt DuvalbIDuvaibt-724.0 8048.0 19092.0 2816.0 19203.0 19251.0 Afun 19259.0 AfuU 1ti1-568.0 8788.0 1in 9120.0 or9448.0 Drugs Drttge19248.0 10032.0 10644.0 Pat PittPattent PitttentMedicinesjuat 7984.0 19420.0 3072.0 19531.0 tent 19435.0 tentMedicinesjuat 19500.0 Medicines -1304.0 19463.0 Mcdicincsjum -904.0 19495.0 jusl 9656.0 19548.0 tcc TerTc 10140.0 ived ivcd19523.0 10508.0 andfor ad adnr 19723.0 19763.0 Sale dale19776.0 11e 8356.0 cheap cbeap8620.0 19892.0 10332.0 19751.0 Duyals Duyn1sDuyn1sDont 10336.0 DuyalsIDont DuyalsDorit 20275.0 1084.0 20280.0 IDont DontDoritfo 9420.0 1236.0 forget 10184.0 forgetDh -1236.0 10948.0 20288.0 ttri 20551.0 tri Dh20568.0 p1Lw1100.0 20588.0 tojct tojctyour -1100.0 11028.0 -1096.0 10384.0 20604.0 10324.0 getyourr 20831.0 1056.0 20851.0 yourrhousehold 9020.0 householdgooclts3 -1584.0 11016.0 20843.0 Inou -1580.0 hOUe 10048.0 hold eholdeholdChco -700.0 11020.0 holdgboc1a 21159.0 1276.0 21187.0 gboc1a gooclts3Chco 9460.0 che 10248.0 21232.0 iF 10792.0 iV iMy isat 21512.0 8256.0 21763.0 21780.0 F8772.0 21775.0 I7uve 9216.0 9372.0 Duva1ta -1032.0 Duva1taMy -1560.0 21772.0 L1 10760.0 3My My 8580.0 22375.0 motto mottoon cnlly onlyooe 9708.0 22408.0 YOIJe 22411.0 quali quaHquality quaHi quaHty qualitytlle 22620.0 22731.0 ty tytlle 8584.0 best bestIt 22847.0 rW 10688.0 22991.0 23011.0 WIhttal WIhttalIt -888.0 10684.0 23039.0 tal talIt 23592.0 23620.0 23615.0 23663.0 oar 8660.0 busintss9088.0 10212.0 23675.0 gs as23688.0 10432.0 23640.0 Wellas 11008.0 ellas 23895.0 23987.0 as 8288.0 well wen23928.0 38a923948.0 23911.0 pleasure pJeauretoshow 11012.0 tosbow 24175.0 24215.0 show sbow24247.0 yoti9032.0 24236.0 Hue24191.0 Joods10176.0 goodsWhen 10924.0 Joodswhen 24491.0 24507.0 When 24531.0 yoti24503.0 come cope8996.0 24523.0 co 9604.0 24516.0 se 9944.0 24499.0 town 10536.0 dont dOl1tdontfail dOl1tfail 24739.0 24779.0 fail 8380.0 24804.0 24756.0 caUittib24767.0 add10196.0 24819.0 nee 10304.0 24839.0 ee 10520.0 10524.0 mygoods 10996.0 25043.0 25075.0 before belate8540.0 yon 10n25059.0 troy9724.0 else visaelsewhere visawhere 25335.0 9744.0 r8608.0 25443.0 tVJuval I1uvallyuvalI1uvalt9OO 10992.0 8092.0 25935.0 t9OO 1000000 8412.0 8536.0 25960.0 YF YEARLY nAR11YAnLY taCftrfstert C1traferr-924.0 9404.0 25995.0 9444.0 25987.0 C1 25955.0 rtstett 26000.0 rltan26008.0 rf 10844.0 orwrotnwj orworn orwomaf 26167.0 wrotnwj womafworn 26203.0 Co 26223.0 26172.0 leokalter afterslier9068.0 aurcur9908.0 26187.0 growing 9836.0 26220.0 RroW 26183.0 grolrirMXimsi grolrirMXimsineaaiM4his -1008.0 hnsi 1m1hnsincHsiMhl 1m1nCBi 26356.0 26363.0 ncHsiMhl neaaiM4his26407.0 nCBi 26391.0 8260.0 26379.0 hl aid aIMaddadjoiningr adfoining101111n 10224.0 26384.0 Coftfrtfes oofrtrCoAtttiesf10012.0 CoAtttiesfto -800.0 26387.0 Coftfrtfesto 26439.0 26427.0 26619.0 26616.0 net nets 8384.0 e1 26635.0 B 26575.0 Manors MatiHrtMnf19356.0 26603.0 9648.0 Nl 26579.0 Corrpofident CorreapotdentCorrpofidentwork Correapotdentwork26583.0 COlTH 26623.0 OfI 10272.0 10676.0 26627.0 ent 10560.0 26767.0 26799.0 work 8376.0 26819.0 cuff cartcat26787.0 done 9116.0 26808.0 De 26815.0 Jour26795.0 Koine 1toAMls9960.0 26828.0 Ufe Enclose EnClose 26963.0 27011.0 close 8352.0 26992.0 seIfi 8312.0 aeIr selfnddreMed 8624.0 8808.0 26972.0 Wre cfrncetf 27015.0 26999.0 sUnped ItApedathtepalenvelope enrelapeenvelopeor enrelapeoreJpe eJpeor 27164.0 27263.0 27199.0 particular pal1lcuJJfrfpaniculrrru27204.0 toK lMk 27184.0 AfSfeernifltj 27247.0 erman 10616.0 27207.0 tfcn ttnhntfcneralMnnnger ttneral1tfnnn hnoral 27419.0 eral1tfnnn oral 1016.0 eralMnnnger Maonger -672.0 27439.0 cr 9100.0 Corcoraa OorCOJallCerconh27407.0 lhtiiainK 27415.0 ylJ 10016.0 4ing 27424.0 10756.0 27464.0 op Optoppoiiie Optpoll opposfe 27575.0 27623.0 poiiie posfepoll 27659.0 27583.0 United tfnlterftfnfterStale StltteStates27603.0 Treaw 9524.0 Tte Tres 27627.0 Viuh WitillWaallWitillCgton Waallington 10580.0 Viuhfngton 27827.0 fngton Cgtonington8548.0 27815.0 17 11l78776.0 27807.0 Op10036.0 Iio 9832.0 28628.0 28659.0 io 28847.0 29663.0 1t 9584.0 29719.0 29767.0 29775.0 29779.0 8576.0 29839.0 xmlns:ns8 ID30 8168 3164 10984 3748 ns8:type P 11304.0 ROFESSIOL ROFESSIOA11240.0 ROFESSIOLN -2564.0 13868.0 13624.0 LNR NR 11140.0 11292.0 11488.0 11672.0 Walker Waller11464.0 WalkerAttorney 12584.0 11676.0 WallerAttorney -908.0 11432.0 4836.0 992.0 Attorney 12424.0 atLaw 12696.0 atLawCrawfordville 13248.0 12760.0 Law LawCrawfordvi11e 12308.0 1264.0 Crawfordvi11e Crawfordville13660.0 Fla13572.0 13204.0 1A 13236.0 12644.0 7160.0 12520.0 7516.0 12568.0 12624.0 tG 12484.0 12772.0 1TIM 12904.0 12992.0 7867.0 12048.0 TIM 11892.0 el 12136.0 9419.0 12088.0 12376.0 12340.0 12592.0 KI KItlVE 12676.0 cle 12792.0 cleLIv 11096.0 tlVE LIv -1372.0 12480.0 12744.0 QAK 12060.0 QAKWHBSKEY -1400.0 14144.0 QAKWHKEY 11448.0 10679.0 WHBSKEY WHKEYWHBSKEYPTII WHKEYFTENED-2320.0 13768.0 11504.0 11320.0 PTII 1252.0 FTENED -808.0 12920.0 MY 12756.0 13128.0 13332.0 13472.0 ACE AOEAOEwarded 14096.0 13476.0 ACEwarded 11172.0 11744.0 warded 11756.0 11728.0 llId 11680.0 11872.0 sld 12068.0 11711.0 Me4a1 d12268.0 12856.0 11700.0 Atlaabt 13432.0 LeeJtln Expaeltlen13352.0 xmlns:ns9 ID31 18004 3176 11164 12072 ns9:type 11216.0 12072.0 4the 11472.0 12120.0 11908.0 tb 11800.0 12024.0 belttud bentutd12028.0 12104.0 beat rand 13392.0 12075.0 purest pUlcatpluoatpurestRyt 14180.0 pUlcatWhllkq pluoatI 2372.0 11388.0 12380.0 12604.0 11532.0 Ryt S11416.0 12412.0 WhUkcy WhllkqWh4kCI12000.0 13292.0 fold lOWfoldintht 13760.0 lOWIn 034 13756.0 034ifl 11896.0 12728.0 12751.0 intht 12764.0 ifl12576.0 12572.0 12688.0 South SQUt1L12440.0 SouthP 13396.0 SQUt1LhDAIX 13340.0 13144.0 13172.0 hDAIX 11500.0 11616.0 13175.0 BALD 12176.0 12384.0 13163.0 12616.0 12540.0 13056.0 Pr ptkfioc ptkfiocCiN -744.0 13147.0 ton tonCINCINNATI 14140.0 11764.0 13428.0 13443.0 CINCINNATI 13468.0 CiN 12800.0 12056.0 12368.0 NAU 13435.0 U1 UA 13256.0 UAItS 13492.0 13364.0 As 13672.0 ItS 11364.0 13720.0 eati 11444.0 12132.0 13712.0 11956.0 13723.0 sMr 12428.0 13732.0 12664.0 13688.0 fcM IIM13680.0 tftM atIo13664.0 watt Wtltwln13552.0 WtltUHpvara 13948.0 14048.0 hII 14204.0 13836.0 NaN 13839.0 w1MNN 13304.0 13704.0 ttt 13896.0 13844.0 nse 13848.0 nseF nseIn 11220.0 114 11512.0 aer 11348.0 14748.0 14868.0 13644.0 14924.0 13744.0 13700.0 13920.0 14980.0 13791.0 14328.0 15119.0 15195.0 15331.0 11636.0 15292.0 11832.0 otherpolplnn 11736.0 12784.0 12884.0 12944.0 15323.0 12916.0 13368.0 15340.0 4ara 13096.0 13764.0 15308.0 ilIIPanH 13972.0 15336.0 inppcarrt 15487.0 UHpvara 15532.0 IIPanH 11820.0 nppcarrt 11856.0 15523.0 4W 12040.0 12260.0 15503.0 dtdrtissamet14 -200.0 12460.0 12560.0 rtjjome 13328.0 ttumeiHJ 13148.0 4f 13656.0 jjtf 15543.0 15492.0 woiJ woiJier 14324.0 13932.0 15568.0 won wottwonk 14244.0 14252.0 15600.0 15724.0 ier 11244.0 11372.0 11404.0 15788.0 11528.0 boat 1J0 11916.0 boekof 11708.0 11952.0 or12240.0 America Amercapuff pul12912.0 13020.0 pu 13508.0 jWfluiiof jWfluiioftho 14320.0 fnblor fnaayoffnaayoftha 13684.0 fnblorrlu 15944.0 rlutha15959.0 11468.0 11516.0 15975.0 aert 11640.0 aelrifor 11812.0 11964.0 thooompllen thoconipllerethocoinpllcraand -1048.0 13224.0 13336.0 13620.0 printers printoreprinterst printersCprintoreyt14300.0 11296.0 16144.0 16184.0 yt 16156.0 11456.0 11548.0 16159.0 Where whoro11440.0 llCra 12012.0 16151.0 mechanical mechanIoaJexcollunceliter 12948.0 excollunceliterarjpofeetlob -1252.0 12996.0 oxcollonce clcnlJancel-1248.0 liter Jfttlrliteritr JfttlrI11208.0 16343.0 16404.0 itr 16360.0 Jttj arjpofeetlob 11480.0 11508.0 perfection porectto12360.0 12456.0 12740.0 thn16351.0 zenith Ionlth12984.0 13636.0 16368.0 uf13892.0 16399.0 accu Recuaceu13784.0 accuV Recuor aceuratty 16535.0 16572.0 16595.0 ratty 11280.0 16600.0 yy 11540.0 11600.0 16575.0 or11792.0 16560.0 detail dctaUdotal16580.0 arc atoate12248.0 12608.0 combined 12564.0 13480.0 13608.0 16616.0 16568.0 volume volumeof 14295.0 13820.0 alum -476.0 alumnr 14208.0 11212.0 16828.0 16855.0 over ovore 11760.0 nvor1900 11788.0 COO 11980.0 12096.0 pkllcs pltlea16820.0 tat that12536.0 12988.0 16815.0 soils letlrolls13388.0 13324.0 the13540.0 13959.0 16863.0 pop popWo 14236.0 popItaf popIar 11224.0 17027.0 Itaf 11316.0 Iar 11536.0 17032.0 prla pr1e17044.0 enta aenta11884.0 aentaSVo 12864.0 entaW 17219.0 SVo17239.0 11624.0 17231.0 refer 12172.0 12244.0 17236.0 othe 12392.0 thoNew 13264.0 York 13124.0 13800.0 1Vurd7Umanse 13804.0 World WorJe1VurdWorldAlinansti WorJe1llnd 11200.0 17436.0 17448.0 Alinansti 1llnd7Umanse12036.0 11888.0 Encyclopedia Eno11uvedla12324.0 13812.0 17439.0 hotter butter13588.0 hotterJ butteripown 14000.0 ttCr ttCrJ 17663.0 17731.0 11192.0 ipown 17815.0 11704.0 17772.0 nown 11284.0 own HI IUas17703.0 Tho The12684.0 Statuary StoiiflaryStantiry12544.0 13528.0 17739.0 Amoricnn AmnrlcAmoriennAmoriennannual 14280.0 748.0 13532.0 AmoricnnAnnual -748.0 17792.0 IInnllal 14284.0 17903.0 17943.0 Annual nnllalAnnualAnd 11768.0 annualAnd 11328.0 nnllalAnd 18115.0 18143.0 And 11740.0 18196.0 so18155.0 t18152.0 fa12512.0 12276.0 12720.0 18168.0 Is 1812656.0 more 12836.0 18183.0 13348.0 13736.0 Amery AmeryAnna 14264.0 Amcri AmellAmcrirnna 14216.0 Amellnn 11204.0 18355.0 18395.0 Anna rnnann than 12008.0 1sIVhittakera -1212.0 12292.0 Whit 12044.0 18360.0 Whittakers 12700.0 Inkers 13384.0 13603.0 18375.0 tholint llritUrltllritThe 14220.0 UrltIdh 18380.0 lintbill 18559.0 bill Idh11352.0 19059.0 19067.0 11696.0 liuliwi JuliNhdioa11648.0 12532.0 19071.0 Wnkulld WukuJlWukulla12396.0 19095.0 county 14008.0 19124.0 aro nrunruInformed 14256.0 aroInfotmtd aroinfofined Informed Infotmtdinfofined11972.0 19276.0 tlint11904.0 MOCA1 12348.0 19271.0 McOAtrMAOAsiNfti MoCurMAOAlIM12852.0 19372.0 -1012.0 12896.0 tMA0Aanlrl 14032.0 19283.0 IhcthehnttdBcJncjt 14275.0 Ihchattdlomelt thehandsomest 19480.0 handsomest hnttdBcJncjthattdlomelthome hume12124.0 19491.0 and12628.0 fnnliion fnaltinn13040.0 llhlon 13244.0 13880.0 ning nlnRningiuinein nlnRndne ningnxine 19687.0 19703.0 ndne nxineiuinein 11604.0 19700.0 nxlotencc oxftltcncnxidtcnce12964.0 19692.0 Thin Till12752.0 13444.0 cwlubrnted cetohrntcdcelobrntedcwlubrntedmagaxlnd cetohrntcdnllagadtlt1 -804.0 14248.0 celobrntedmagazfnooflcrabeautiful 3060.0 19887.0 1952.0 magazfnooflcrabeautiful 19895.0 magaxlnd nllagadtlt1-1948.0 19904.0 offers orfrB11936.0 12464.0 beautiful bCRuilful12400.0 19907.0 prfinluma prtlniuma19947.0 JJr -764.0 14020.0 I11lum8 14120.0 19923.0 toall 14268.0 toII 20056.0 20119.0 11384.0 20116.0 whonlNo whoraige11836.0 rslno 12204.0 20104.0 club clulJtclltba13104.0 illuntratts fIIultrntc13036.0 11Iui 13448.0 tratea 13400.0 14016.0 thtthefamousMcCbut 14260.0 thttmoulMcOALf thefamouRMcOALtUAZAIIP4Tren1ra 20271.0 1224.0 20323.0 famousMcCbut tmoulMcOALf20308.0 famouRMcOALtUAZAIIP4Tren1ra -1224.0 12432.0 12492.0 nAU1JrEn 12612.0 AtunT -968.0 13580.0 13232.0 20344.0 reEMn 13140.0 13968.0 rhlTile20319.0 Thepremiumi Tilepremiums 13988.0 rhlIm 20515.0 20535.0 premiums premiumi20571.0 Im -772.0 mluml 20523.0 offered oQered12660.0 20563.0 arc20528.0 thehondsoniCBt hnfubnluchnrtdsotnosthondsoniCBtin hnrtdsotnostin20720.0 20752.0 20732.0 11484.0 11652.0 20723.0 world worll20740.0 contains containuaontalnatorlca torie ItorJu20735.0 literary 13808.0 14012.0 Ut14188.0 UtlrlIY 20811.0 20932.0 20992.0 erary lrlIY11724.0 20947.0 articles rUele 12300.0 12408.0 20944.0 npdtlet 12692.0 12776.0 handsomd ltandaomu12780.0 haml 20972.0 oma 13692.0 20935.0 eolnml fuJnrdeulorteolnmlfiwhion 14240.0 fuJnrdtlUlhlon 14152.0 dfltshion 21164.0 fiwhion tlUlhlonfltshion21156.0 plates IIttopltoa21144.0 7ho1lao12404.0 13008.0 publliheri pqbJhltlpubiiaherawlrti wl1WidIwlrtime wl1tl10 WidIme 21343.0 21407.0 me tl1011588.0 retrrncntntiva reJlrllenlRUfereireeentatve12832.0 12972.0 12888.0 12868.0 13080.0 21387.0 every Or1 13500.0 13616.0 locality Illcltltylocalitynnd 14200.0 IllcltltyIInd localitySind 21551.0 21575.0 IIndSind21560.0 wlJl12064.0 21568.0 wn4 21563.0 HIMlmCrutlens 12232.0 td -1228.0 13460.0 imtrngtlens 12524.0 butrt -936.0 13084.0 tlsna 13544.0 freotreefreeprize freoIlrz treeprize 21760.0 prize Ilrz 11580.0 11632.0 often offmodea11492.0 21795.0 Co12328.0 21803.0 12280.0 8nylad 12648.0 12980.0 wJU13856.0 21800.0 monmen13728.0 mantion montlon mention 21959.0 21995.0 tion tlon21975.0 this thfi11660.0 r1l 11876.0 22012.0 piper f1per11816.0 21972.0 paperantf 12416.0 12704.0 ntl sendher sendhet13504.0 22004.0 nanaeand nanaeandnddro 14228.0 13696.0 n1e 13828.0 13956.0 andnddrcuw ndnddroks 11188.0 22184.0 22199.0 nddroks nddrcuwnddro 11968.0 22187.0 ttoTnx 22204.0 McOxtT M1AtfMefIAlrr13164.0 COMPXHT JOIAJlTCnurAllYHi lH14413852.0 HiWest lHWed 1441Veat 22335.0 West Wed1Veat14th 12052.0 Street 8Ircf11992.0 22379.0 Iew22416.0 eW turkYurk22371.0 Ofly011OflyBig CityBig 14332.0 IBig 14340.0 22767.0 22779.0 22792.0 bargan batganbargarr12844.0 22815.0 13132.0 22775.0 13488.0 13996.0 13860.0 bybuying bytbu1in 11232.0 23067.0 buying tbu1in12032.0 23123.0 cu 13012.0 13108.0 23087.0 waut 13724.0 23083.0 13632.0 atPuvals atDuvals 23352.0 PuvalsPuvalsMcfli -736.0 14148.0 13440.0 DuvalsMen DuvalsMens 11412.0 24044.0 Men McfliMens24027.0 tanHdrtrf tad 24075.0 12192.0 24095.0 12128.0 Mndr 12356.0 12808.0 shirt fliltl24155.0 forTjout for25c forZScts 24359.0 24392.0 ZScts 24411.0 11712.0 13464.0 24420.0 1332.0 018 018J 018Doftt urr ls lsDort 25027.0 25095.0 Tjout DofttDort11976.0 25039.0 admire tur13176.0 signs 13112.0 ign gtftf 13612.0 ttidttndttndforget andorgetmr ttidjforget jforget11264.0 25407.0 orgetmr 11900.0 25419.0 mef mer25387.0 25440.0 12452.0 dint 12548.0 25423.0 1t1t 25395.0 jfdt1etrich fidh13416.0 25432.0 ch 13584.0 13984.0 011onadmirations 011admirtiotts onachrfstiofls 25703.0 25715.0 admirations admirtiottsachrfstiofls12580.0 25763.0 lydivide 13748.0 25755.0 yautyourcash yautcashw 26071.0 26076.0 cash cashw 11644.0 11720.0 Witktlt 26139.0 wemetoveis Fr WI W13156.0 Duals DunlDunltov DualsLov6s 11400.0 26944.0 toveis Lov6stov labor Jabot11780.0 lost losr26947.0 13196.0 13936.0 bjr btbq13520.0 bjrsmoking bt9U1ok bqsnlok1ng 14176.0 27239.0 27303.0 smoking snlok1ng9U1ok 11808.0 27348.0 ng bad 27315.0 cigftffef ctgarr12796.0 dg -732.0 13252.0 13116.0 27267.0 13452.0 goodJgars 14224.0 27319.0 goo gooigJR 14112.0 gooddgzus 27615.0 dgzus Jgars igJR11228.0 27636.0 nlway lwayfalwaysrh ftfi 12952.0 27687.0 12956.0 27619.0 ldldn ldJ 27943.0 1111324.0 28235.0 28399.0 13916.0 28699.0 29211.0 flflr 29863.0 30027.0 xmlns:ns10 ID35 8268 4804 14180 3772 ns10:type 14463.0 3TAr 3TAT988.0 D1VIE1 15471.0 1188.0 15824.0 MENT 16548.0 MENTillcuUter 17012.0 16632.0 ITMadcunder 14360.0 4340.0 Madeunder illcuUterMadcunderSec Nec15303.0 15836.0 4404.0 34 15664.0 16203.0 chapter 15916.0 16983.0 43Ji 43Jiixws 17324.0 432 432awn 17244.0 4636.0 4720.0 awn ixws14588.0 14528.0 14816.0 Florida 14744.0 15572.0 allowing abowlngahowing15412.0 16320.0 16260.0 16696.0 amount lln10unt17695.0 4716.0 iLr17316.0 kcharged 17768.0 iLeh rehrgcd charged ehrgcdeh 14824.0 14388.0 ugcd 14356.0 15112.0 4911.0 15048.0 15448.0 Tax 15363.0 15920.0 4891.0 Collector CoUcctor15776.0 16704.0 16656.0 17016.0 Wa Was16868.0 Wakulli 17328.0 17264.0 WknU 17156.0 18936.0 Skulht 4060.0 14192.0 kulli knUkulht14656.0 14596.0 15200.0 16004.0 15876.0 16296.0 5151.0 16612.0 collected collccttd16479.0 collectedfor collccttdforItor 18252.0 5324.0 tor14480.0 14424.0 14792.0 current 14732.0 15436.0 15392.0 1900 15812.0 16308.0 16760.0 tbe16712.0 5420.0 ap apportlonment 17276.0 ap1ltUollntent apporttonntent portlonment 1ltUollntentporttonntent15264.0 15204.0 15484.0 15420.0 name 8lIne16324.0 16212.0 16532.0 5668.0 sever 16792.0 severnlfunds acver1 aevcrlacver1nlrunda 17339.0 aevcrlnlfunda nlfunds nlrundanlfunda14860.0 15556.0 15536.0 auch luch16388.0 taxes taxea16244.0 16944.0 wcr 16812.0 wcrlevied wert wcrawertleled 17336.0 wcralovicd 6028.0 levied leledlovicd6163.0 including 14680.0 15656.0 16024.0 6168.0 tax tox16328.0 16284.0 6148.0 countyschool count countlIohuol1nd countysoluwi 6423.0 6428.0 school soluwilIohuol1nd 14720.0 lIohuol1ndTtat -932.0 15160.0 14776.0 fundTaal 14779.0 fund fundTjtal 14352.0 6724.0 Tjtal TtatTaal14784.0 l110ll1taccount14724.0 chewed cballc4cttrged16824.0 fdMOJO fE6808015867.0 fdMOJOAPPORTIONMENT 17352.0 fE68080old te 17188.0 17220.0 mo old 14804.0 14564.0 14872.0 pd 15120.0 15016.0 15288.0 TrutQ Troato15244.0 15928.0 uafb 15807.0 Nahb 16344.0 16396.0 6991.0 316496.0 JOl iI16452.0 16992.0 1411 g2o4s16720.0 1411Mtc31 g2o4s7o32 7524.0 Mtc31 Mtc31APPORTIONMENT 17344.0 7o32 7o32APPORTIONMENT 17828.0 15092.0 7743.0 APPORTIONMENT APPORTIONMENTConnljr APPORTIONMENTCODnlAPPORTIONMENTC-1396.0 16488.0 14376.0 14380.0 CODnl 14384.0 Connljr 14760.0 14472.0 14848.0 14631.0 nlr 14544.0 proper pixiixifProilCl15400.0 8112.0 tutarttartotaud 15616.0 16915.0 W37W W37WolaBd 17372.0 8372.0 olaBd otaudoludPIto 14952.0 15124.0 ltoTro Ito 15628.0 15380.0 Tros 15784.0 8359.0 10to15688.0 15955.0 War 15904.0 16228.0 01oludPIto 16084.0 NIHCb16311.0 8339.0 16440.0 219oj 2 16860.0 16544.0 16499.0 16684.0 9or 16576.0 17008.0 0474 3441344122iWi1 17356.0 3474i 3474iJ 8748.0 221087 1812.0 221087annty 17379.0 22iWi1 22iWi1Dnt 17376.0 221087aonty 14408.0 annty aonty14488.0 Dnt School gchool14700.0 8c oo 14992.0 Ta 15232.0 TaCol 15516.0 Tart Tla16932.0 3OWW 3O1D3m15608.0 3O1Dco1 17392.0 3mtrot 17396.0 trot Colco114604.0 14512.0 pJtoiTr pdt 15464.0 15164.0 toTraaq 15024.0 Trel 15699.0 9399.0 15756.0 15968.0 9351.0 Narcb15884.0 16436.0 2t9oi no10116508.0 42170 421702665ii0 17036.0 17171.0 43 17096.0 17624.0 17755.0 9472.0 17655.0 260560 2665ii0260560Fl 17416.0 266 2665ii0Tana 17108.0 17240.0 ro rorI 18763.0 Tana 14428.0 rI14728.0 aulllorflture add -920.0 15072.0 forfeiture orftltnrtnVoMU 1023n1o2J1115864.0 VoMUCol 17404.0 1o2J11ofandp4toTretoMarcttlIvel 14308.0 10400.0 Col 14404.0 ofandp4toTretoMarcttlIvel -2136.0 16740.0 15144.0 10411.0 15044.0 Trci Tru15768.0 15612.0 10371.0 toNarcb 15892.0 16336.0 1lvOJ 10363.0 1l 16700.0 16564.0 17068.0 1M7 t3717076.0 t37d84F 381t 381t884111f 17424.0 16968.0 6841 d84F6841AitiitJM 17299.0 884111f 17312.0 884111fAtiI 17432.0 d84FAttest 11132.0 AitiitJM Attest AtiI15787.0 15496.0 15564.0 15672.0 15896.0 11136.0 Towlt TowtnToe1eTowltClerk 16356.0 Toe1eClerk 16288.0 17228.0 11267.0 11307.0 Clerk 16304.0 CIccuU ClrclIlClrttt16795.0 CoartCOllrt16747.0 17216.0 Ol l717160.0 Oleaaonable 17444.0 cReasonable 17308.0 l7Reaeonable 3388.0 14536.0 11779.0 11840.0 Reasonable eaaonableReaeonable15796.0 profits 15584.0 16680.0 Reliable Rchab1Reliabls17896.0 11848.0 17524.0 xmlns:ns11 ID36 17792 4620 14352 12087 ns11:type RI 14856.0 R1ht 15220.0 15368.0 1164.0 tii three 14524.0 14736.0 bla 14808.0 15256.0 Rs 12335.0 15544.0 12364.0 16200.0 house bouse16143.0 bouseFV 16707.0 18192.0 12383.0 wF 18276.0 16160.0 12556.0 12595.0 FVDead 16636.0 12600.0 16996.0 ova 18024.0 eDead 18084.0 14552.0 Dead 15196.0 13316.0 wens mcnsmens15856.0 13231.0 Rood15668.0 intentions ustcntionsintetitions16291.0 intentionsnever 17472.0 ustcntionscte intetitionsclever 14368.0 13539.0 never clever13579.0 cte 14688.0 15012.0 13524.0 shelter ehcltcr15644.0 16252.0 hotnolcss hotrlelesshonieless16076.0 13483.0 nor norfeeds 17480.0 feeds tbe14832.0 13771.0 hungry htttagty15184.0 13776.0 15508.0 ngty 16092.0 Goodacts tGoodnctsoodacts17040.0 17144.0 unfailiuglj 13743.0 unfaiU12g11 unfailiugly 14031.0 failiuglj faiU12g11failiugly14011.0 produce 16240.0 16055.0 13963.0 ood 16667.0 results rcsultsresultsOarloadelBftitJuitreoelved 17412.0 rcsultso resultsv14271.0 16168.0 16552.0 Dlva1s buvale16620.0 buvalelarload 17399.0 14319.0 14500.0 14379.0 tJrood 14799.0 15424.0 17359.0 14568.0 17916.0 14611.0 rOar1oad 17951.0 14707.0 OarloadelBftitJuitreoelved 14788.0 Oar1oad larload-2448.0 15296.0 14780.0 ef et15531.0 Malt 15852.0 14743.0 lust jUltreaelved 16364.0 16512.0 14704.0 atTENTS ah atv 14972.0 15524.0 14975.0 14668.0 14967.0 16196.0 14960.0 tN 14964.0 16448.0 16608.0 15056.0 16788.0 14955.0 WiltCf 16672.0 14940.0 17364.0 r17552.0 18088.0 fj rVplw 14440.0 15467.0 Vplw 15379.0 17136.0 15399.0 17120.0 17148.0 18176.0 18144.0 tTflAH 18236.0 15540.0 nlIMIAIIt 17567.0 16088.0 TENTS TENTSTMAM 16900.0 16903.0 TMAM TflAHIMIAIItMAIM MAMMaalttr16624.0 MAIMvmnmi MAMD MAMAMMln MaalttrC MaalttrIRfIt 1256.0 16008.0 17199.0 17124.0 17211.0 16128.0 17388.0 AMMln 15348.0 hh 15816.0 ani dMeftllUoa dMeftllUoaal rI lidI 15312.0 17471.0 17476.0 oltr 17459.0 neon nlln16280.0 16348.0 16484.0 16627.0 17468.0 16584.0 16732.0 hftber hftberUynlfl 16920.0 17456.0 ul uldons 14456.0 17499.0 17587.0 Uynlfl IRfIt 14580.0 17600.0 vmnmi vmnmittonittrllt 14888.0 Sir 15511.0 17580.0 Ibl1 14996.0 16963.0 17555.0 lIaI lIaItlcn 17560.0 17691.0 ttonittrllt ttonittrlltMnt 15088.0 tlcn 14936.0 ut 17696.0 17683.0 clerll 15432.0 16032.0 17671.0 nail 16216.0 17680.0 011 tt1 tt1Si 17204.0 IIf IIfN 17812.0 Mnt 17827.0 14708.0 dons 14572.0 17759.0 nrfr 17824.0 Si 14660.0 14648.0 17807.0 ff fr 14852.0 irVl 17784.0 15408.0 rifn5rfop 15504.0 17795.0 IUa 16236.0 rnorifu 15860.0 Jor 16183.0 17787.0 16152.0 ciiri 16536.0 iqjNanu iqjNanuU1 17164.0 16980.0 17779.0 huI14nUl nepMrsetteetvlllodtrat 17043.0 17880.0 17908.0 I14nUl 17895.0 nrOll11 16080.0 17888.0 MU 16272.0 16892.0 reeec reeectiiti 17176.0 14452.0 1488.0 epMrsetteetvlllodtrat -1380.0 15940.0 17991.0 14624.0 MUM 17996.0 trlUoot 15804.0 ebthtm 17984.0 IthI IthIckhhfr 16647.0 lh lhScKttttflc ScKttttflc ckhhfr14947.0 tiiti -820.0 1m 18100.0 Hitttrtcanhkndimnitr Hitttrtcan fmtricaw17112.0 fmtricawA rial rialA 18448.0 18499.0 18476.0 hkndimnitr hlndttIttJ114548.0 18524.0 15320.0 14676.0 18483.0 mdenf 18456.0 drtltaskatd llhntrMH 15988.0 15404.0 18463.0 18451.0 jrtrtljf 15476.0 alt 16459.0 taricatelN taricatelNii Ije ratlr17020.0 16895.0 HIIMton till tillealadolt ealadolt 14532.0 18627.0 IMton 18575.0 15175.0 18607.0 18612.0 18584.0 icltnttoa 15491.0 elntlIJ 15980.0 ttttu 15908.0 15840.0 16163.0 16072.0 18579.0 ottniMi 0111 18572.0 Terwi fenn16268.0 17080.0 18564.0 13 P17003.0 13rt 17208.0 PI 7x 17063.0 lszi 16935.0 lsziCdr 15912.0 vI4D7 1196.0 ntkiii 18615.0 18663.0 14892.0 18695.0 Araoniu 14772.0 OfILU 15736.0 mbai 18683.0 18675.0 wiJ lM 16924.0 lMJust 11No 18711.0 18807.0 1111 CII Cdr Cdrill 18855.0 ill 18835.0 riw ew 18787.0 Ynrk Ynrktff rk rkJust 18968.0 19076.0 tff 15716.0 19056.0 15468.0 15764.0 et19031.0 wwt 16424.0 dJust 14416.0 19624.0 Just Arrived ArrivedThe ArrivedT-1784.0 20187.0 20223.0 15696.0 f5j 20203.0 lineof -572.0 17504.0 14412.0 20672.0 20704.0 nice 16208.0 20692.0 Jewelrythat -1276.0 17484.0 1272.0 jewelrythat 14448.0 21227.0 21291.0 15104.0 wee wts15592.0 21280.0 ever io16940.0 iothis inthi inthis 21695.0 21707.0 thi 21724.0 tiownDt 16908.0 buyelsewhere buye18ewhere 22080.0 22163.0 e18ewhereuntil uDtl116864.0 yousee 17023.0 roul roulsee ousee 14372.0 22575.0 22659.0 see 15624.0 linet 22999.0 F23027.0 W1 W23095.0 ala alara 23019.0 lFREE 23835.0 FREE FREETO -3032.0 24299.0 jALL 24400.0 raraALL -828.0 16456.0 oALL 15352.0 ALL ALLONE -1052.0 25203.0 rONECANOE IONE 25463.0 25508.0 ONE ONECANOE -1104.0 ONECANOEB -3116.0 15636.0 25499.0 CAN -1872.0 16848.0 OFBfI 16852.0 OFOpWorlb 14640.0 26091.0 26124.0 BfI 26147.0 14976.0 4K 26111.0 JHg gMQ15135.0 26103.0 OWDI POWDL16872.0 18680.0 fith 18708.0 itb ithMdh 15100.0 15224.0 pfffnh pttf hlsr 16300.0 26543.0 ts 26555.0 26515.0 tJf ofitf 16644.0 sti 17408.0 stiWorn 14400.0 26871.0 Worth WorlbWorn26891.0 toflrW fioWtf15984.0 26915.0 26895.0 titaft16808.0 27079.0 27111.0 18548.0 oJ 16844.0 27147.0 Duvaft 17836.0 27223.0 18096.0 27167.0 17960.0 18552.0 27235.0 18151.0 17900.0 27351.0 27383.0 18452.0 17956.0 18632.0 18520.0 17712.0 27487.0 17928.0 yf 27492.0 18692.0 27451.0 18900.0 27479.0 18776.0 pSchool 27567.0 book boobs15360.0 27711.0 820.0 ldonly oldonlyfe feJ hthtDuvakls Ji 17544.0 18336.0 18116.0 17467.0 27823.0 18444.0 17564.0 jtasn 18495.0 27896.0 27923.0 dash tasn15040.0 27964.0 ftt14880.0 Duvfell DuvatDuvakls27919.0 Duvfellp 17536.0 28143.0 28147.0 r28171.0 18528.0 Tr 18436.0 18884.0 28151.0 18951.0 28355.0 tor 18648.0 28467.0 17848.0 28623.0 18891.0 17883.0 28803.0 28715.0 28687.0 1176.0 28731.0 28767.0 JI 1JI 18447.0 JII 18304.0 28903.0 28931.0 ifow 18756.0 29007.0 29072.0 ow 17832.0 29019.0 17872.0 17863.0 29052.0 17912.0 JV 29171.0 17876.0 29219.0 29251.0 18199.0 29235.0 i3 29239.0 18272.0 18356.0 18396.0 29227.0 18427.0 18823.0 1268.0 17704.0 29395.0 29443.0 17803.0 29463.0 17732.0 29451.0 17843.0 18040.0 29535.0 18156.0 18816.0 29407.0 18124.0 18416.0 29599.0 29640.0 18712.0 18475.0 29603.0 18743.0 17852.0 29703.0 111J 17920.0 17764.0 29819.0 18136.0 29799.0 18172.0



PAGE 1

WeddingTabithas1JESTERGown-ByTIAuntTImEDICINEmlddleof-tliecuiituryfavorltojSHlhibjrloeixlnpplliatlonsRatherSPRINGChronicleTelegraphptttehe-sFnther1iytoWashingtonilyln-rexpresstrainSllksAmongfrl5n3ahnVdlyworldlymindedinrcforjHfiesImpressioncommitteewomenbee-nuirtrowao-uianyDetroltAuntWashington-DGreenesNervuraunhatchablenessinaugurationMargarethealthgivingClubbirlyiBESTwonderedgrandmothersdlsjolntedlyneighborhoodpinkcheekedfigurativelyroInvigorntoPhiladelphiabackgroundappropriatedOccasionallyoldUvntPhiladelphiagrandmotherstunt-TahithnHhousebreakersubscriptionIn-BrndstrectshushauulIdemonstrateddangersignliotiustavlnuprescriptiongreatdlmicrtabliPhiladelphiaunchangingWashingtonmanufacturedfancyworkthreateningprehistoricexaminationexperiencessuddenly-roselAvorytownCompanionresponsibleTablthrisphoto-graphcorporationinvigoratesdaughtersKomcthligkind-TakingdisappearedHampshirerecommendedrocncrglzcshalfheartedrenunciationAiJiUasAnclloollrreturningprehlntorlostrengthenequivalentapproachedPortsmouthdepravityIllustrationCompanionsomethinglaughtersmanufacturetestimonialsstockholderanythingPittsburghlUMUltycausodnewspapersanl-Ucrtlwssecondhandsomethingexplainingpoltub-otmmietPeopleAverytownadvantagetrimmingexperienceproprietorvolunilnouHcivilizationcarelesslyalterationsShadysldcwhisperedcommonlyThousandsu1ultitudittcautiouslyprovidingdownstairsevidentlyharrowingIilstliugcommitteedaughtersremainingresemblanceeverybodydaughterseverybodycarelesslyalto-getherponderousfestivitiesinvitationsrecognizedreceptionstctvtnbjoproprietoryouthfulanythingImportantDaughterstriumphsaltogetherdreadfullyunbleachedItHhnplnsspreadingRailwayhappenedCertainlycollectionlanguageoversleptanywhereDecidedIeudTltdyspepsiaJapaneseresurrectedHundredssomewhereappearedConvictionexcursiondoesCitplratlonspromptedPearso-nIcommercialselfishnndcrumpledBloomlleldstoreroomreturningwas-anotheroutgrowncertaintyanythingTnblthnscivilizationConsumptionmcaiftilphysicianWomansstoeooornkneelinglicenced-plbucsplanningwlc1HngexpoctedCarracrosslotting-outattractivelaughinghorriblydiscoverymorningdaughterrevitalizesneighborwnndrinjssuggestedweddingofficiallystoreroomanythingweddingbrought-InprobablyCarracrossGluonun-usuallyAntllllISeaboardremotelyteagownprobablynecessitylaughterpassen-gersheadachescon-sideredthousandssixteenthdriftwoodMedicinebuildingforgottenForgivehundredstairlrlsSpringanythingsubstitutecon-structedliterallyInactive-InmurmureddancingprovidedBunchGSeventeenupstnlraweddingordinaryre-quiringst-PerhnpAmericanprivilegeengineerregardedgarmentspreciouswalkingtraditionsClevelandgarmentalterationunhappyTabithasMedicinesufferingslightesteroachuuerejectionap-proachivjcnuseboslircwcdattractionWithoutweddingwith-drawsome-thingdroppedBufferinghoweverWouldntmeaningfingeredstoreroomlaughtercherishedaudienceYlnlngsany-whereMeantimeguiltily-Ientirelydiges-tionItillhcllllsharplytogetherimproveoomnutlcx-nntineietcNewmiserablerosebudsNATUREdroppedmorningsluggishconsultedPalmmiserableheirloomCayenneansweredIndeedItBellellcldthoughtGreenssamplesbuildingsymbolsstayingCheapattentionde-spisedafternoonSupposebrighterfarfamedafternoonreadingcomfortsremanedshouldntbuildingtho-Kustnchlanagainsteeadhigelghteeubuildingdancingcenturysyllabicancestralwakingmeetingflippantcom-mitteekldnoysbeneficiallustrelessGrandab-sorbedputtingadditionsubjectsmedicinewearingalreadyescapedancestralvonstltu-tloiialmedIcinepossiblepopularJuryYlnlngweaknesseveningNervurathoughtarrayedalreadysluuuberpresentmakingattentionNorvurapriestsalreadyhealthyHus-bandalwaysfoolshincottagehappilyrustlingGreeneschangesgarmentremediestunlnuI-tmeetinglaboringkneel-ingrosebudsremediesthingsmedlclnocouldntYlnlngoriginalnothingeveningcontentsmakingthoughtoutlivedKUllleleutNervuraabstruseattendeddreamedHUMANpleasedYlnlngwouldntthoughtskatingrosebudschickensthoughtconsump-tionbecausefeedingeveningtalkingBcawnahopebusinessYlnlnginterestproductTodiiypressedproverbsewingGreenesWesterntwentyGregoryslurrieddaintiestremedyremedypoultryCnesaiwhandledreunionthoughtplcturoChicagoremoteststrictlyfamilyIn-ventedalwaysstomachwhethernealu-duuthusheddis-favorlustrousdanc-inglookingcallednartlnclalartificialpatternalwaysIhroiiRlioutlinedwithoutilhuhagallottedmakingmischiefluhcibmerrilywithoutWesternremedystationsRevivalregularenoughswellingalwaysregularcompanybelievedregardsfnmllygirlishBelmontfiguredvolumesapparlremedy15500000TaffetasluingduringfinishedownedpartiesGustavode-privestomachalwaysreunionremedyremedyLolbachPrncKluKWhertjtroubledYlnlngAtlantaCondensedclothesenoughbecausesymboloccurredronowcdSpringAugustboughtbakingthoughfathersabusivereferredTaffetasupposequicklyduringBelgiansweotnaGreenesthoughtheathenflowersloweredsociablewMhiinlongersewingalwaysancientmaterialfashiondoctorsrelativeiuado-uPYlnlngen-tirelyYlnlngmomentbrlghtJosephalwaystenehcranothercapitaldaintiestcathodeaccountnaturalGreoneshear-ingstayedcaughtaroundNorvurasocietyalwaysfinallyaccountmothermarriedpresentYlnlnggowiYpurifieswritingamiableminutestestingwonderBe-yotdChinesemoundsreticuleopenedprovedYlnlngchangeNorvurasupposeYlulugpoundsperfectHUMORpinkergirlishduringfallingheathengownidYlnlngfashionInkingquotesVlnlngbeamymyselfYInlagsupposewithoutancientYouthsYlnlngfishingarousedYlnlngathleticfishingDawtonplentytakingtowardrelaxedtroubleschoolsperfectaroundwithoutherselftakingexceptbarelygentlyNoahsspecialtaughtrumblingsystemfamilythoughpurposereunionearnestherselfNoalmstroublereunionalmostfiguresstayedthingsspringgnspedPearsonsuitabletroubleperiodnpleeepoundpoetryvotingDochKdlthsservicemonthsspringspringpoetryticketsdoughEveryYouthsstayedspringseriousvillageCincinnatimothershelvesalmostsystemJerseyWhy1quoteswantedtryingthingspeoplemothermottihaventteemedfashionlessonsmotherexactlymotherschoolsIrelandtodaybe-tweenScienceBostonThatkitchenspringpoetryTheoughtArtificialtaffetasspringexceptspringpickedmotherInsteadarrivedpublicalmostchargegrandpro-ductitiipvr-IrotwinternaturalPEARLpeoploappealsuhurlalmostKINGSmo-IIIlUtcarriedspringbrightstartedliningseverallessonsmotherdressedherselfoftnlrsinstinctwordstnnuhtvisionslovelierprettyAverygivingmodestfineryluckyspringshroudtroubleanotherHawAveryprettyMarchMarchciablesmothermonthswinterwishesinsteadprettytryingoughtlookedmotherstreamreunionclotheschiffonstartedmotherdiscussexistedcreatesmuslinhumbleprettyhappyBeingfineryre-doundseveralvestryborrowf-ialmostBerthaRomanarticleBloodtaffetasstartedtnfieillJapanclothesmannersllorrowgrowngoingstudygoingclothesclassKingsbesidesdoesntIndotdwinteractionknownDrnfneatprettyguiltyformedforeverreallymarbleletterspeopleChicagoshrankBerthamotherchurchtaffetawintergenerousGreeneIowneyardsdotteddottedfabricKllensNoahsndiiptslooptrunksroasterseasonstniTitnindeedexhibitItoprooclothesAveryNoahsshouldbroileralongpotatoordealIndeedchurchmotherclothesaccountyardsJonessselfishtoothierbottlesgrandAveryshouldDealerslimedrosebuwouldcaseinremediestaffetareallylikelypledgeslightdottedcheeksrem-edyDenfnemimuslinbowolsAveryblacknightknowssummerbeganfancydottedWorldfancybowedChanceCaseinafraidcoursesvioletslove-lyCtilcacaamongfnhrlcmutedsquareIndeedRecordbroodsshinybeingnroundtherolaffairsworldsgoingVillageInchiididntttirnulwhistmonthhealthbeforewithinWhichtimberbesidehealthbeginmonthwhereurgedweaklosingawnggcrtaffetagivenwithintaffetanightlookedruiilttfknownTheyreturnchoicebaklntrbottlesllundrodaboutgoodsalbumlnttghequalbotherwhichcreponbelowPrnlmmsomeonerItnmakesdlcatceightdaintyOCteclIincaseDatesmusictaffetawholewasntmirnljrchostHnshnrtcircularsWevelordlyCouldAvn-andfoldedthrustbrainsfortyrockybeforestarveownersGoodhousesecondquiteWhllocannotWheregreatgownsfenceswordshealthprettyeithergeltinaboutagafciDinglemoneygownsvigorcunUltlonconditiontennisseizedInfantgownsanswerfellowglrlagownsgownshoursgoodenrichNcrnlchwouldeitherdidntwoottlabouteventscousinlargecaseinTheygownsratherbroadquitethatswhendozenaskedpainswhereyoungponcenervouswoundwhichbetterpupilwhichnuaslnrnaboutexrrptBtroycdyoungyoudWhatdo-nnygreatFareNorthnervousconditionbreastpaperSwissbookswhichwhichremitwhichwhichTnpnnsuccorsactiontimeswhlthgownsmountbooksaskedworry80400nightdownworthwouldwomanTheresolvesDnnfnoMwhenbrcnkmuchweekstrucksocialGraceothersItselfravedsoundInsideestimatecottoncrepteightFamilyrightheardbloodstreetblackwaisteverygownsnldfcnicestEarthwhichbottlestyleUioddayslnteimutinymakeCatarrh1700000wouldfinnydowntheywhileawfulaboutItselfLongheardstyleaskedeldestwomandecidedcrankllItttowouldflocksrectorportionhugsWhydownnannytrunkuriesglasseyedwhendoubtaskedfoundNlyloIjfiiillieacodLettersrAeroundGraceyoungPressrabbitWhatofnllrondobloodairilythereaboutselectOrncegirlsRomansleeppaperGreatstyleholybodygownknowgownMeowwhoanightfunnycoursetrunkReneweveryoldesthouselettercaponnnntybelowChlciBOcnusmldinglovedgreattherepen-nydaysthenthoseThenalonedrossbloodthereplacediversknowachessoundstylenarrowpowerhousetheirbusydidntthatsbrakedozencousinpearleyedwritefoundbloodvoicemiNIAuntthinkgirlsgoodtnuleeverywhileneedssincethesetrunkGreattintnervesEdithknewcouldthinkEllenmilesknowgirlsgirlsthesutheretherestoolyardgoodLinetrunkSYIbuilthavecoulddownlat-terlittlewhenwrapolderthereconstaboutotherletterlonglongmaketurcdletterwhenotherbloodcouldpartspinkregalpilesgirlsbloodWhenthinkFirstCilRNEToperasownHurfncesnothingwhatchiefcouldcouldbloodtitterwritethoseawayawayminethemheIbroadPress5o-llftUilongtheyonlypinknorvestirountillivedDeepgirlsgirlsgarbPlainttmtcnnThenawnsDrwhattherewordoutfitblackwhatwhenpoemWithhintwhentherethornmanygoodcourserestoredplaitspiesthesegirlstheythoythinkthreemuchawayknewgownhomenotesthosewanttherekeepgoodlearnThenwhatHavebusymadewhenknowMftploOnceyearsmoneyrntnyearslittletearsoftenwhenkeptonlyUsinggirlstheytheyonlykepthomocouldthemThentheregracePressdontAunthandusualmaImkeepfoldstheirthemthoselittlebackPressmadeExcuseCannotgiveCityjollyworkthreeThenworkdontpithfromvoicedresstheseworkgownliencooksseasonwnvyonlygownlittleacrossdonttonicwhatthreetiimerstockhoveleavebusyroodtheymusthensAuntblackstoremollfromThatonlypainfoldsTohntheypunkonlytheybarrelsboatsacrossnorronlonlyleastIdealtheirpearltheygirlscouldwhatFirstwantearththeylongwidegownmoneycAusedwithweektherewroteoceangownThenthemthemCityThatlatergownonlyTatetrottheyonlypolicetheircantPuckhavegownThenHavenpangwhatforceWifestoretheirmineleastMissstopWithcornerthendontbavolittlehnndwaystholrliverknowfromdrewotherlittlehavewantmrpnlyearsmeanswellhavewishwithDollarwiththornfreshgownlurebeengaveavailawaypolosaidgivetheywhoonlytinywaysfoldsuponJohntowndontmeanshavewhyatticlittleneedneverfromwithtinesmonthmustthemtablefreshwontlookslittleYorkborngivejusthelpwithhavelittlefromEvenbeencoostinydugputapagespickbookgownboorthetallnlQRManordontyourtearshavopartyoursbeenhavehavofavortriedshall171000CrluteFretpnlogownwantgownswithmirewithatticbeenwiththanCAtarrhbuiltontnrrhcastegowntinygownTHEMoortookIIhutbeenthenusedhavemustfromAuntntvnvuntiltheirlunarlossynevergraywithwithdtnrfloorlistshavemilkjustglvowonteachgiveclassToledohellobentreathavebelcfrontfornvcrtheinnttonmustuntilheadthenwithseethesfinalThatfrombeenaintnamedtriedfromlegsUnwedthatthatstoppoetscantrnsnofwithformfromclothevenMissneverwithJusttimeWhothancorkmoistbeentheirJustbeenHotwithbeengraytheygoldtriedwithQnincdtrimpentwithbothhavesuchbeenwithsuchwithwithMisssuchMrsneversecrettinednttloclubJustmostwithgraygraygrayuponsteptwMresuchsuchwithwithtunawithneverthantintthatniuotntytellsAGshallhnllsII-IfreggsNowheroIsntWelluncutfromneedthanborejustbeenthennextthatneverdogfromlit-tlebeendearbeenrivalboonfromslatwayTHEimamneverwithqulsheadboatrushtenetwithtintworeWhnnhardcastsdoorservoThisusedthanhowwithstairdealthatIsntblueNewthatbeentookcrime-IOnecuredwnonthatbestwontthatMrsmoltsateVintwell14ththatwhohintwhorookwifenextbeenfowlmusedrushtriokcountyeartidesthatTHEAboutthatthatwithlackbnkolipsnervehersthatbestthatHallssaidThodaynevernervewellthatthatdealeyestinyingthntStarCuredyearthatDAYthathowwhoThepurecowsusedthateachwaylustthisfactboytinyutilrmdulytakeverysentthatthatthatthatsilkgaverendveryeggsthatthatclubthatthatstoneworntakemucouseveverysceneballIveTheAndthatwithArcdaycarnewilldiedthatthatTanfarosideneverThornwouldthatBitsmucouswithaweAndroomnonewayIntoThoofactthateachsaidthatsoldthnthnrecakenervethathowsaysused1200nervevegethatthatArkthatsaidroomroomwhoYinsaidtootWasfactthntInslastandseemwhichbutmorowereeyestoneArkIntothinherethatYouwellfirstIntolovecoverswhoDEEsaidTnllnicetintsoldhindbirdwearsonicthatwhothatAndthathadejvs1710thatThoMrstenssizepoktinesomecomosoldlacesaidsaidTheBitshutivnMrsThegonegoeslureloreKIllTItForlastnodYouArklastthisThehimluterearUwsaidMrsteastimeweremorelovewelltoreoncenrlnRwestMrsTherateseemthiswillsillandIntoIntoMrsthisandlnsttwothiswhothishimOHMfactandMrs1lrsthatlikehimtheRoundTitreadlookbentwereroomrisentoldtideleftSholaidballandhindandcomowerelintSEAMrxwillButthatMrsMrsettatnkcnandrichAndsellratesaidMrsOnewereanewForMrsandthiseggslateKCKhadhudantiYouJmsilkhadhadandhindlikelikemillfemlikeShohutNotsailtillsthisMrseyeshogIrMiMrsMrstwosentovergrewandmidbilkshehadlikelaidhadhindlendtiredWasandthatsilkandrthdIIIHIandViaandandandnndamidthisRutliedfeelsomewerowasluteOnoHutAndllfolngoncellnroloafnwornteaspertLifeandandThesilkInstYinandhumidbyButandnailantiyouandandsaidthisherAirnearoverandsoulluckanywere1711truecannotnowgotMyfreeovernuthailHailUselovoandnailandandbedoddcomeandoralearlandnndlullandsilkandsilkandandandandhimyounailhasliwiandandandIllyshefindeverandandandandandraiduntogirlHurlevenhimeversillthemudandnowhadnndandandantiwereInsthadsilkrentsheandluauihieJandhershonmlwasoverlordhindandButboxMrsnutyouSotwomayoveroverthetheandandhadultiBtheshenewandandandnndandrenobbigandandandsilkhadsilksilkForsholaceshemillandanticudandthoheryouanyandworeovencaretwoyousilkandtopOththeJilssourIlihadtutuintoloudandandandandsilkyouAriendsoilthisherliesyousheshehimyouantihindsureshefluethuanyanyonceonceCureloxbiggotsheherfeltandshesheandcamebutnewandyoutwonUllsilositethoherbutsheownnodhitsthotileImshethohadsituherthethepsdsourSendownrarethorolltheveerthemmeyearsshethocarerailbuttheyounothasbusbeensheVesandcasemanCureherthoImshethothetheTotwnswastosomethetheyouthefiethemusichasNinosilkmetownWIttumidandnotshethoslithersitetietimeshecourtrhefluethetimethethetheyouthethethethetillthethetunymeetthecareevernnnruinmannotwaswnswassobnotsicbutcnlvshenothasthcthesheshebuttittheandfellthoherleertheherwiniiidtheherlifedottitsthothetheeuroeasewusforwasthetunemantotewasshebutherbuttreeoutherthetheyoueggnotshesitusheherouttheItsnotherbutforforwasthissinethetillthethethethedidtillthetimethethoraythonotrIwaitoldthetottheleftoldwaswaswassawnewtiltthetiltgetcareforforhernowtiarafarnotthewaswasthothepliothesayhershenotnotoutthothethethethoredthethonowwaswasthethethethethethethethethethothothotimeTillsforaidntH1thethetheforthenowwasforWnswonragforforthethehotnotthemanfallnowlastthethonewItsthethesilkherherthetheIts337thethethetilltillthethetheoldthethothothethomythooldthehuttheOnthoforthegiroforthecarewasoutthebythethetimeslitthethetheoldnotcareThotilltheoutAllthethethethetimesatoutactX4wnsthethesixthefortheuerwasnew0371wasnewbeertheusetheyesoutouttooflierthodidthetimebedhcftatethetheforforwaswaswaswastheforforoldoldwasthewasbybybythenotoutsatwastwoforrilesawputIUSRltdwasMiuforoldtheforforOnlIeSoldbynowgotrajtoohisold1sttrybybybymymythefurthemymymyfurItsmyforfortheforforouroldWJnilovertheVawasone1IrthewastuhneattoncutmyliftfhisoneforforsixforseeliebyforthetooMrbyXoIllIllhiswaslunooattoofaronopinhrfreetheMrdidforliecastmiuforDosetfornowhislollOFbybynotHebestnotonoforareforfornotHehisOnooldallfatFornotsirrobarehitmantdforBINSforoneIdforcanairseesatlidforAtforoneIIIrisfairHintTobylieallcuecanonoI111lUllouroneAtIfocononeareironuseAttillviehisToeaseswhoonetestseeusoareallletthatItsourwnjrAnDrticAndcancarendofallDenilupallIris2dCHIPDrcanwillToarenodthisanddin3dDrtillToupWowillanyarejydoOfupDrToItbohesurewasmcmeStupuphewehlcloftilltintglitsseervoseeholiddodohobeyouwohiltwomyWalldohoDrDrItsliefirheweAtnilammehehehetutdotincurewJhobutboupnd14meuptintthinamoCbotheholindooflLuptutuupofbvInhesethobeupagoAstenbodocanupuljivJuofinofInbeInormontthemytinhoofhehehottuofofofofofofofofofofInofatofwofofofdethoNnincHHforofIfofatHofbeoftheatorofofotofoferetheInofofofatofofofofofofforIn-CnfofofinofgofurtotocdIntotoofforannoofatofofinIIIatofofofofofofofofrtliTofofofofofofofofofofofthnatoutbythefltatoIninofatofinofatofoftototooftoofbyofofofofoftittoofgobyofnotno35ofatnoortoItInInoftoIninInInuatotoantoatatoftoofoftoofoftotonrticnucrtonnarearetennnInInoneInIntotooftoIntotoInInInontoinoftotoofInoftototototo1itoEtooftobytooftonnntbyIsonaninnnilasalinInIndoorFOinInInInInInInItInItInintototoirInoftotototoInhtininIIIl1inintotototototoonontoCooutonastoanntatInIsanofintoInntoIttototoIttoInInisisPinonIIRastototoorInRIIHascnrastonssnrasSfLfnoonanasasasaslaIthiInintoInJIIinistoInistoititfnasPInit0anastieasnm11IsitisisAIn10isinA=toJistotoasasIftotoassoassotoinLassotoJITrtvboisInsoorasisassoIsItAstAisissoItititItitisissoasIfisniItonasastousorrefoAisisisntIttoIsIsIsIsitItititNitItItsoInItIkItItItsoorbtsoiIOtbohrIIIItAorIsisItItItItIllItItAisisItitIsrJJIIPlofItt1UItItto1wisoaItItIttoItymInboInItInIntoInI-eiyrItlitlisisInInbenoofitItitnanANisInItrtnilbItufoftsofitUcoluasasInTJNInItoycstorfIsUIntillitY4yYistoIsIsYttotrItwIITIali=nI1inaainttrainUaItpdannaaannannnItFnnanI1dnInannnaIIannnannnanaunnntEanannannaaaannItIInvananna=aaIIaIIftnifaanaaIII1IuWnaatno0IItijaaIaIIjannInIaIIIIIIttIe1JIIvIIInIIII1IjnIAItnI+IiUinNIjrtlIVtPatNhIIIldjIa+>rIIII>Ilirnrrit4tl1tIqIji1IF


PAGE 1

yiEYESIGIICENfGUYIthlngsPhlllutolphlnSAVAGESIreshnllLnWhycrCdwiiWh-yorthatYoungwlhr1VhatcontemporaneouslyONIEIZSo-fspeciesthatniotlonClrnmbern1rayYnungtvlt0lIYIIIMI1IIIWlnllllllIt4IJeliowerlJecll1l8oItnprovomontuProtclIsorWlmtbailor-ElectricityEnglishmanhydroKraphorllwellunderstoodusShakespeariangeneralizn-tundisembowelled-nsThlullllf-arenceeptlonoipnphsimprovementPROFOUNDLYunexpectedlyphotographyconvincinglydiscomposurerimes10ruidboarding-housestoantengineTommyPopa-gamekeoperconnumpUonapplicationsracesLondoncapitulationsteRmonlnointernationalimpassionedlibridizationapplicationsattractivenessin-auguratingoxtolographozcluaivolyUramadororarchae-ologlstII-rCllItllrluThllphilosopherIntroductionapplicationsopportunitymathematicalgamokeopernpptlcntlonMiltons-groatattendingconstructionpracticallygenerationsprecautionsclnsslfica-1lonnp-pllcatlonRatmusllhorehandwritingpopulationsSCIENTIFICnecesnarilyImpressionhallucinationslnipllclt3-ofvolopmontseverythingarchaeologyAngelinapreventiveformsanddrunkennessImprnnnivqtremendousdiphtheriainvestigatednecessarilyon-gagenwnttelegraphypenetratedntmoapherouloeptorArohblshoprepresentedresponsivearistocracytele-grl1phedapplicationthonsolvoscommercialthroughoutmcperlencointerestingprofututd-lyeverythingvaccinationonvorsationhnttllNhlpsdevelop-ingtelegraphyspellboundtelegraphyBluhhsItKmanufacturegeologicalIncapacitylIthophorevengefulhopelesslyGeographyImpossibleinterestingtelegraphmeteor-ologymanufacturecommuni-tiesexceptionsCumberlandtrmnondou8habituallypllcattonsbOilnnlnghabituallyHUMOROUSclvlllzntlonllirteronco-otabandonedelectricityrestrictionscapriciousexpandedprominentDnrlinglunInstrumentStrangelyinpartnntsomothlngtele-phonesIllmlllttodlIopOllltCiIeloquencerefreshingmanutrtllroformationsunderstandrevolutionsmemorableImpotuuntintroducedtelescopessurroundedmiraculoushappenedsmallpoxadjoiningvegotabloadvantagoclvlllzntlondlsregarllastronomyswimmingdestroyersromomhurchemistryde-pendentcomposedalleviationaccustomedunderstandSUPERIORastronomycomparedcivilizationgeologicallocomotionpracticalSynuningfollowinggenerallyutnmlJlngsubstancescivlliza-tionconferencesomethingantecedentrevolutionrucordud-byimprovedItnnatloncampaignhullomypracticalAllowingnstronptnyundreamedcontrastedchemistrylocomotionrepeatinglngll1kohappenedastronomypoundingcertaintyFaradaysnaturallyrealizationeccen-tricltydeductionsuhalancnntreacher-ouswerecornanythingtelegraphabolisheddlmlnluhosupOrlnrltydetectingmidnightdesporatocontinuousindividualthousandsgeologistwatchingtttlcu1111011talockyer-KconditionsSpectatorKluglakuIntroduceddopond-edo4lblemnlllUcRgradu-atedpricelesssupper-timehoundingtotescooutrlmontBprobableCIVILlZDdifferenceremembercontlillonsforgottenothorwlHocultivatedFreshmanboardingmidnightattributedseafaringthousandslIIlOrlllllimmortalmoulltlnRdetermineJnIlIlIlUlchlgdomdifferenceseagoingCaliforniaattendantRudyardsplendorcoveringopera-tionsstatomontcultivateseighteenlanguagequestiondovelopsintensityrUlllacoltgrandmaulnughtertloatblIkoUllliur-WMerpro-ductionListorlsmscientificIn-quiredliteratureequalledAmericanboardingproperlypleadingordinaryfoot-lightsformerlyCelestialmovementphysicalparticlessuporlorlwlIlIolmorningproductsterlcallylandsmaninterestedformationawakenedtnrllllrlythoughtpossiblesuperiorUIturblneInvonUontogetherrommysevolutionpeacefulavailableimposereferenceconditionossontlallevolutionapplyingehwr-Ilethousandwarningsfollowedawakenedourselvespar-ticularstrIkingspoilingpromisetempteddisposalOpuralnreacutenesscontinuedsteadilythoughtafternoonacquiresoperatormorningtogetherthicknessremainedactuallymlRhalDtrainingacquiresUll1gllonGETTINGpossibleabstinentDI1BWerlJlIolslghtattentionstrangertracklessbreakfastNlurtcntlltexamplemountainCheerfulRud-donlyPerhapsevolutionadvancesuluJrllhnotoriousMedicineansweredindustrynecessarysclenco-atvictoriesmedicineindustryhundredskeennessansweredopeningrunningthoughteveningthoughtperhapschemicalhundredsufficientornltbololllrnlnemotionsshippedDarwinschurchesshowingutallnoBsextendedIloAltionmankindtravelerscenturystoppedpracticethroughdroopodsufficientTlialconrattentionnttractudthroughwalkingllicntinnsafflictionIsdontlendingmonkeychippedperiodscORmlcRIStocktonTommyansweredalreadyathleticsjuvun-IlecenturysuashinoweighedoutstrippresencefurnishesachievedIludloncoreadingplungedChicagoachievedtriumphexistencecustomerleeonncliBdiameterpeciallythoughtmakingJourneyKlpllngthroughstrikingevidencerelationssclen-tlficthiukiugpositionbroughtthoughtfollowedrecordedartificialhusbandcenturyin-stancesOlasgowreferredInnocentstructurel11-oSuleproducesharplyrailwayorganicgradualgradualltrstorywrestlerbroughtawardedenginesbroughtoCluhw-ostrikingnnlmalslllllInrlllllprogressportenteagerlyhnlllIcllllstrumuntonenrofanimalsrustlingUodveracivilizedgeologySundayrlllglnTommyrendingmerrilyoyoballcoldnesstrain-ingcouldntthinkersclvlllzOIIHllllllhiliOpresentTommypercentresearchdrownedusuallyventuredrendingdifferentsurfacesabstractnulsnucuguessedcenturycivilizedsavagerybelongsgreatergoltlestlaughedItoeord-itnreplied669303-anrenntnscenturyringingmarchescivilizedcouldntunderlieolvllizodnothingenoughagainstimnionnodistancedoubtfulincreaseloAusuallyrelationalliancecharitydespairdrivingclllIzedtiny-11Ithclvlllzodbusinesstoroboreanimalsbelievedtho-woratlllllcnBosprivateobjectsclllIzedworthyagainstpresentpresentolnntlydistanceminutessteamersmarkedcoptlonTontuyWI1-llowsprogressPasteuraffecteddis-tnnccbeyondcenturynOltvorsdemandmomentsdistancememberenoughretllietipullingdrivingfreedomslumberhistoryflirtingpullingrailroadbeneathrecklosshimselfrepliedInstinctcontoursop-eratorstuccoedfatiguemightycurrantsnttlntluncloselythoughwhethersecuredopticalalwaysreplied11lJ-4talllemassiveinclinedanimalsharriedsurfacesbecauseminutesIssuinghecarnoswritingcenturyevolvedanimalsprovedheavensInclinednumberfeelingeconomywithout10-terrodcpmmonoutwalkweightmyselfKanakacurrentslargestfacultyutterlyprosilyrailroadgoologlhybridthoughcouldntpredictnumberbenefitscoveredexercisewithoutbeyondcILrrlolJtaus-jti3ttinetlyPeoplealwayswithoutwlrolo8i1DarwinillusionsciencesstrangemillionswithoutlIlIrldll11progresswithoutbenefitstouched0redngreedyhistoryminutesbecausehavingelectricthoughbeggarInterestbecausebecauseanotherweightweightgroundenginepausedalwaysmusicalDOUBTenableschildrenspringInlllniocollegenearlyslowlyallowedbecauseaccountstlppcalofatalistequatltdepthsnddtlonsecuredscloncoKolokolwithouthearerslearnedworsesoformedlarllol1treachesFloridaslowlysupposeJour-nalmusicalbetweentractionanothermomentprovedmodernsciencefrictionAfricanbecomeelectricvonturopab90ddiseasebreathspeopleVERIESaverageAfricanmonthstubularfavoredmodernhu-wasnttaughtsystemJamessappearsItillonsahimselfnaturalutlllllOlcaughtnoblestpatentprovedHAPPYbarbersteacherhi-calledfurtherfurthertroubluplantsemmipirowesternsalarylucllflluwondorcreasedshowedhorizonnneientwiselysavingdoublynaturalper-hapsevidentfataliststrokodcuriouschartednumberremarkbeingspubllclovelygentlytontiontroubleSeriousMurlennnlmlllmethodnaturalsittingcnrrlolltaughttrainedfartherDarwinGuianarlru1copositionolectnlcdoetJlltreturnappearssurgeonravagesbelievewalkedmarinecausedWlnUUHremarktrainedscluncodistantgeniusgeniuschieflycallousneitherpartlygentlefinallyclvlllzauxpurtsurfacehumanOFretainscertainlosingpeoplerrl11l111sprettyndmiracurtaingils-IItbesidesdeathsstrongtrainedexpertduringBritishalmostmothercannedsalientstudiosonllnoagreedmentalsoundstrainedilritlshanimalthanksKontluclose-lynightsroncopogentlewrittenAtkinsWattsworldscarefulseeinghienkonativespupilsopticstrickleyouthchancon-greatSMILEalmostunusedFrancocarefulcarriedbroleenChlcnlopatentpJ1ttspoilssinewstudy-ofchancelrraanaeriesJonnergoldeutsciencedistantextinctMarionlaunchsklllodsettledchurchregiontoilersbeganhumanminutecitizenTrulttIsvisitedworldsfamoussoldiertransittryingmightreallyhumanhumanWhichwnl1t1nbottomwishesprettygrapheludesSlobbavisitorcitizencannotbrokenhumanoriginmightworldssoldierstatedwhichcaratsDuttonhumidbarberla-sevonhumancausedtoonthschoolgazedsmokebeganbratodpowersdoubtshoundlowestnoughpowersspendhappyalmostdemonchurchvictimSfvngoParsonorangethlnlestnakorromancenatureturnedThatuoutrungoingrecordaddedRocketknownunlessstudysavagefollowhabitsover-sawWattsshoulllcausedonlycitizenIlenvunbeforewithinmatterstudyAgainbodiesstudyhenceknownheartsbeforestudypowerspowersitissinrousedgoingspeedhetoromarchAfricafutnoknownuuukesIndianAnnllsurwhichstulypointbettorhlllJedWorltlTherequarrymatternightenemynotiondrivesgivenyonvosavageIUlJItIlspeakhealthratherratherschoolbeforeway-IledortulsavageknowsslaveswasntcoppermoneydrawndrawnOceanratherquickJlnrlzullwhichstoredhoursstudybeingsavagebeingthingknownTHATtrainswhichwhichwhorewhichnubtlopointpolitecannotsavagesavageratherwasntvcntterdreammakesboastsstudyfrienddreamnativeIntentwhichbeingdropsagaintalkedschoolwusntpaintwhichTHATsavagedreamsightsightquintquietbettorWattlhaltedwhichllalfulstormsagainIndianbotiltdwhichDli817studystudydefectwhichnightdesertactualcountslongsListenbeforebetterfatherporcopeitherretainwhichextentwhntadreambrutesfollowwhichwhichSouthrnIBmlNorthClydewasntsavagebettorwhichwhotowherereplydirectaskedpowergermsshowsbeforemoneySIlagescatterearlyresultwholeclosedresultbeforefuturepointsignspointlossesthrowentirewouldwhichwouldwhichwhichsllltorsavageThoroquitewhichdidntsoundunderbeingltFlungswouldwhichwhichwhichwhichwhlrhweeksknotsWITHgivesSouthwholeaffordaboutadmitsisterwatchgrantencuunsignssignsalongmannerthrowwholeauthorwhichTherewhichescapenightretusonoticewhichgreataboutwouldunderlargodrankWhatmuiketlSouthburnscreditaskedgreatna-welllargeCuluuodoubtsailorWhenwouldmusicwhichwhichYoamCanalKingTheyspltolionseartistfostersulliessoundpartywouldcalledWerosandstuneslatterBlackstrictcheckslnn1powertribesaddedhenceklltllelaboutsightsightdirectsomo-oftakenneltdwhilesodsstagedealsBoerswhichanswerpassesofficer1revertaskedhouseunderbringglassfruitsforesttrackgreatgroatthinktribalpanedltnl-tiottbreastaskedrornrtwhichbuildscalledbooksabairpowerglassmuchthinkworldworldWhatbe-ingsteamshoutthoseIndica-longlargestandhoardunderfoundUsheraffecttullmglarewaterhouserighteffectWhyWhypowerpowerroadsworldEdithtakenHAVEna-turePlaceMuchlatterForth01-1fllIlIITyarbasedgownswhilemadeknowworkvaluehorsebutternearersmellwomenmarrymercyagileothermuchslicesbodyre-centlabortherechordSniUnhlpl11orashootresistwhilerondoboatotherotherwhilelinllnPOOLmuchnobleblockworldfoundaboutlearndaysnturyotherlightstreetsteambrainclockhOIJOcouldcouldpassedtimesbearsWIFEVhdlorNeublackdifferotherotherpinespornothosewhenwhenanusesknowrockhabitvotedorganladymuchthosecuulllcoulllloftyThatTICKknowt-shomadewhenmilesthososincemuchknowAfterthoseotherhomootherwaterstormwhenboatsthreeoathcouldtherepenultshowlightcouldshallwhenestedthosomademodeboatsmademuchhomomirthrunnersillltylighttheydiffertherothosefavorthreeWattsmellbriccsinceeverylikedgoodwaterovarymanylongnegrohelptheretheremuchhoteltruthwurlllLandtherethemblinddontspheyearsnoblemeetgonecreasegoodsteamcloutfiendmanyottenextramadfencefacesknewdowntulwsonlyonlypainonlylongthornIuulwcoursecloselongcarryyearswhenonlyhighmanytruthwhatWisetherehnnltCOUlIIOSourcewhatwhatYorkwhichWattWiththeyThenwhenlittleskullYorkwhatshiptheyyearssourcewhattheirthemswimgreestherechowThencleartruthhotelrotortheirforthoftenMoroteeththirdstaidturylItttokeepoceansmanycarryyearsAfter111111110playonlytheythemminethornasidecourserightnuturLionslogosworkminedrewwhattribenamesyearsgiveMANbollsdrawmustcoursetrainmapsoctalScottMugcoursetheywhattoothhaveBurlsmapsmanyDoorThatworlenieansstoreThatmeanswalkhavelongplaycoursepondmindhavehaveSuchmoatwhatmapssolidbuiltstatetownmostmustafterhavebouleawaygivegivegivecausowalkawaylittlehaulfronthavehavefromhohavebowcomolongtheylivedlinoswalkaftercruelwalkbeenfromridThatMENwrapsdWlfKolvbeenhavehellsnovorpealactorlivedwhatboonhavehavegameacrossdowtainthellsdiveoc-cursInterThatLiterworkfactsmostafternaluUthomleantlinenloraBonomonttramtheirjustDooryourwalklittleseamswenthavetutcltrammosthaverinKthanrivalboonsnndpartmennnlittleslowThisbeenhavewithjustjustpartpoetEngthanjusttimejustallyaftermusttrambacktramcallshavehavetatemostodorcallstimeputsVhyfloorNoctclllnacomeswithhondwithleasthallsheronovelthenthentramuponStonymosttramjustgrowgivethanthanwithshooThinsllolcdonstrambackstopwithwiththenthenseemsdocsdoeswithtimekindwithtramafteruponrantstrlllljustGuytramthanthanthanhearviewboontheseheadsanduponmoathourtlmotheirseemsjustmailsuchhavebollsneveracrossthanwithbeentimewithbeenfrommoattramtramtrummosttHEtimethanhaveyoursandwithhillsthenmanslaysnovorsnorethanthanwiththenyourgulftriedwithwiththenwithnextkindwiththatcivilLIFEThoulandmeetuponkindlawsspanUI1OI1NandifrostwithwithheroworkmileThinwarmthinusedthandearwithdearbarnmostneversomabeenWJlltmostretortwiththanthatmincivIlOURrudebothllulbothusodblocausenevorwildveryIdeaboonyourtlmotakethenScnsthatusedtriedthatthouthathorsIlionmorelookteollbothhubsavebefniuaaheonoceanruingHowtimewellthatwellthanwUhTbothanwithdoesdaywallablebetirgavewifethatnineuponthatthatwildthatthatthatthatthatgavebuzzthatthathintverygiftlandNowsaidmeanthatnever1899whothatwellhillsdollwellthatthatlookrungnextgonouponthatwallwan20th1893took1802doesverycanonnextheellookableSilllococamesconestillhaltdaythatthatwholandyearraysvastwhohowsamewhothatthatwallfirstthatthatthatwanwhothatwholandgistdireHadherethatsnlllstillthatverywallhalfcoolthatfirstwellscenoshyplIsJustthatveryvotethatwhoTheThefirmwhothatthatthatfirstthatthatmoroliy1836thatIdolthatwallnextdogsensecomoverypacenexttaleThe1fIthowthatsnoretlonhowNowmooswellIronfirsthalfThehalfthatThealsoIronfirststillsatothatmaywho1829AnddiedracermorestiltfirstslonwmthisthisSIIIIIIdeatourtonsHuntthatThuTheliesFIJIdrycameThewellsalllTheOnoTheintoworewhocasesvery=snoretilesthathowBaysmaynJ-heRnnretonboldcolenullmayfactIntoAndhimnUltsomefirstaidewhoTheIzodwhorealalsoTheTheIdeawhoTheInescamesamebyenosteyeseyesalsotilutwellYouwillnunswaysomefllco1800thatthiswilllikehimantiIntlheyNOwlllhimrealmoremoreThetollThuwullcomeTheTheThemny1663sentTimthatTheThewaywilyIzodhadmattwillfindnaillikemoroand1lIlccandhimthisShemetlikeThehimlintOurfeetfastsomeconyYouIntothatsumtrueroomroomhadfindhaltrulethisNorIntothistoldMrstwilltutulikehimYouA1typutmonoroomIngtlrstThewOfsomemoroyouandandsilkwhnnandandandandwayfactSunhimandworemorolintandthislastandwillliketickfeettorsmoreweanwereyetvotetraceoversailantimoroButandwillandlIkeandandandwilljoytorowilljobtoleandInIlllendohohimNotSheandfeetSheandandnUllandoutlastandU-BothimOnobigwereenorovertworerhoandtallandhadhadandwillandtoldhadthisandwreswerefullhertactandandandlossandandbollandfoulInsthadandandantiNlde-twerecallandfeelwiltandyetandandandandanylikeandandandandxnclhadandandandandantiweroandtwofewherandandnullandlifeevenandandandButanyHutgotButgotfate1ItlendendhasgotandandandandandandandandandandnailandcallhadantiFlueandhashadtheht-tonailhasandandcostevenhonandanyandtratbiganyoverracelineruleduoherhimfelthlwanaandoddhadandandyoumanwillhayshoendbellhaddochashindbanyouUulheranyanyandandandandhadandyouhindfoilerredoveranybuttroutherhasthelintherhadantithefullhasthinCllltandherthetheorblifenodbutanyhashashasthebutsheyouanyovercareandtwoanyanyanyanyusesencoyetonceandbutbutthothetheshesheherhaslineoverovertheandanythelifeherherbutherthehergotthebuthertithiltITSthethethethethethethetheeverMyyoumoncanemonnewnotLetbutbutbutsullsheendhasIllsshethethebutstunhorIsonmanbutshebuttoothethethethethe600eyeshehasbutthetheshethethenearthethethethethethethetheloftthemananyduimanseasmannownowmanthethothelifethethethetheyetbutbutthelifehershebutherhersheItllthebutthetbothethethethethethethinthecltlthethethethetliothetltobutshesheandthethethethethethetheherthethethethethethethethethenesslifethethethelotseesnowmanthethethethehutbuteyoeyenotnotopthethethethethethetimthethetellthethethethethinthethethethethethethethethothethenutthethethethethethethethehermonthethethethelifethethethethethethethethethethethehanthethethethethethethenowliltseesmannnusoulthethenowthethelifethethethethethenotthethetheoyonotnotnutouthatoyothethethetiethethethethethebutoutthethethethebutmannessmannowthethenotnowownnowthetheredthethethethethetimethethethethetellthewnsnianSirtlloonrnotnotnotlirenotthethethethethethethethethethethethethetimbutnowtheIncthethethethetheoldoyooutthethethethothethethethethethethethethethethetheseesmanthelilathethetheItsageagothewaswarnewtillhislifesoonmanownnownowthethethetonhasthethethotltonaythethuthehisblsforfortheoldnotthehisoldwaswasthebinmennowWlUWMlifenelyWntlhistheU-HItlhttThomysaynotnotthethethustillouteyethenowvinowonshehlatheIiitheagotillthethewashisoldoldtheOurhisbythisnuthistheformyubtforthefortheOnonotwasforledTOforsayMIthehisONhislIthiswaswanwasprocomThotonmymymywastarwasbySirforsclforthethehitsItohistillforfluewnswasnflynotwaswaswasmymymymythecalboojtarMrforfornuthislifehisWIUIbywaswanWASwasNotillonebywanliebitairwanonomymyforfortorwaswaswaswitsforhisforderMrwashisforfarpitwasWMtctwaswentOFinnNobyAhatiehisbynothybyforpalwnswaswaswasbyfortarforonoonl1NutlieHosirwaswasHeairIlecnncnnforAnsun1111mymYbyfluebywaslieforwasbybyoneforbylietheIleMrbynIlonowinsonecnnwastrotartconcanouruseforlieOURbybycancnncnnmybybycansontinMOseeThHoArtareonoonoconconcanourbycannotoilallItoallbytnkghIR-nthnfornIlonooneonotonstearearesnoAstintcnnonocansonforallononIlconbybyOnanbyallanawlcalourus-aournilsuotwoarearebyareupItsuteSoallAllcanAllareourarein-aaredoalldodoIJOEDareallboseedototuseItshodoantnutetcourhohoodartntllhoItsdoItsorsInnallOtliehonorlIoliebohueseecorhIhoholItfilltilldehohobudohohomotllowoconutuparearebotipmoupalitdometWtmeseeOUImuweupraphoofwobohodobYbouphoboas-aofmweheofheotmebebewemecatwoweITofsouotorotorothohnwohoAllomofototoforotIliweIllotororotofofoforofotofofotototwoofwoorofototototofof36woofotottoInotofInofofotoftoofofotofotofotutoforofotInInofofototofotototofofofatatof16otIt-tInofofot1oheanInInInInInInInInInorottotootofotofIntotootofotofofInofotofotototInInInInofofotofotofofoturoforofotofofotallofotofotoftoottoofoftoofatofntofoflitototanntntororInInbeInotInInInInInototorInInInInInIntoofottoInInTitootofonofinofInInInotortotooftotototototooftotouttoofottoofatofotototIltotofototofIntoofofofofofnttootofotuttotoottoatntotoftotooftoatannoanInInInInInInInInInIntoof16nonnUlInInInInInIntoorofInIntoIntotonttotoInnt19intoInIttototooftotootorofofanunUllononononnononnonInIntoatInInInInInInInInInIttIStototototoutotortootottotoInIntotonoannoannnantoontototototonoontotolitnoonononInInisInonnnonontutIsItisInInasnssotototototototototunoosexnoonHOnsassoIsItItlitoxItIsIsInIstonoassoortoasororaonsasasORdIsIsItItItIsIsitIsIsIsIsisIsIsIsIsIsItIRisIsonIsIsItItorasnRastoacassoastotoJtorasororusustoorasasItOrosnssoorororsoorIsIsIsIsIsIsItIsIRItasnoIsItIsasI1SIsIsitItIsItIslaItisItItItosIsorasorornsAlaIsIsItIsItIsIsItItItItItishitIiiifItIttoU1isasasItIntoosWIItsoasnoroEItItOorIsItItItItInItIfItIsItusIIItoisItItItItreItIttoCCItItBItItItItItofsopofIt1111nniftortiillIfisOItAIt111AwIIfIyAdIn>rhlbraanana1naaannauaaanaaaaaaaaaanaaDaarnnnaaaannaaOnannaannuanaaaaanaAIIIaanaaannuaatnaaaonttawaa111aIIIajI1I0IAIlieifIIItIIfnIItaIIInfIIIIIIIiIIIlstIItIIIRIIIIIII>li1III1IrIIItIIfiirt1+ritIfttcoIutrt>IIIiIcILtIri



PAGE 1

BREE2iEOQAK-WHKEYULFWnl-kerlaPATENTSONECANOEFREET-OLOCALExemul-ifyingKI-tlVEIa-tTENTSROFESSIOL-NGArrivedRDVILL1lfLAAYhousehold-gooclts300OarloadelBftitJuitreoelvedsal1YaI4rHitttrtcanPitt-tentMedicinesjuatelsewherejsgiAMnahthnabottghtDuvaJewelryhandScKttttflcforget-Dhnotc4qJustt-H1ghecrDuva1taLawC-rawfordvi11eprlceatd-forQJpALLl-frFTENEDline1-WCliternFnotorradmirationsks-rindliilretiJEVELR-Splacet-r1ttiiwtrlit-he4tF0yiiliamionWhUkcyya4abwhclIioyourDrygoodsAPLncwlubrnted-magaxlnduiJVsiiniOixwJfiiruustomer-sFVassortment-ofuntiltHitiecflclMcOAtrMAOAsiNftiotherpolplnnRememberpurchasennjorityAttorneyCorrpofidentsmokingGroceriespleasurepurchaseInatMondnytanHdrtrftbarganaPOWDLf-gWalkertownWIhttal-ItdontcheapbusinessUtiiorjJiaifVReasonablebargansMENTGoodactselse-whereretrrncntntivabuyoldonlyTnlfulnidtfcupurestIruwlordvill-eUBakingtiie-CrnwfordvillcIDontAmPselfnddreMedyouhnsi-ncHsiMhlSNOWdefeatedEncyclopediaforgetholpHnnotherat-PuvalsAtgrlriATSttnrnltumfcivlgnoi4thethooompllenbuyingnicentatrlutaniulPowdersaftdfitsTobaccoAPPORTIONMENTCigarthnu-xplulningStatuaryquali-typtkfiocCINCINNATIthatThebusincad-iltiniOrinvfonlviliebarganjWfluiiof-thoDuvfellfamousMcCbutSopchoppy-Flaportlonmentn-3tuiti4eiullocayadmireintentionsVoodvillp-apoutpfffnhsmaaIikhr-tbettthis3TATpureltased-attoCnrrubellefailiugljAfSfeernifltjSchoolproducetaCftrfstertoxcollonceluet5uuduyBryannrrJcJflineapayrnaaitontliiciieeralMnnngerftC1OUobtJcigftffefeolnmlf-iwhionlineSouthatinthtAdver-tisingparticular221901toregnitit-pReliableadjoiningrDuralsW1IcarrysignsnolsettledCrawfordrilleLeeJtlnhotnolcssLadiesIperfectiongoodsiMJvulpBpublliheriCapseverACEWorthLibertyCnrrrtbelleespeciallygood-fitcigarunCUf11tIadvertisaBALDftiovcfuwtitj-OpnlwayErFurbnrnewspaperlargeDuuvsFgoodshondsoniCBtadvertiseJgarsidtfffgefttlciMttinstructionshandsomesttlmighterDuvaftweeprfinlumaCoftfrtfestbaaas018-JDnvatsrandMadeunderViuh-fngtonbeforeDuvalbfluya1getycdterdnypllhungrybookoyerKalnoopremiumstJcflryYEARLYmyblaincludingTulluhusauodividesmilestoflrWilluntrattswDuvalShoesDlva1sprobablylhtiiainKmechanicalwhichChinawaretorridgoodMMINTIMJHgDuyalsShoesdrunkenprofitsworthJqujiolJgreetYnrk-tffmerchantsrifn5rfopenvelope1endslipFloridDuvalqupptwldhandsomdbe-exuetlya4ar4Rytf5jCorcoraanytcitrtbtisinew-IfAVFuiinghtorekcwhcresometimesJHrrllliJIalaonre-aMwlworthgoods811n-ceBtrt-DuvallMenIAHCUI-KIliy1givesUnpedFnetnryJewelryJuvalAdvertiseshirtcombinedDualsAlunduyAmoricnnguaranteeZSctsadvortisortwttuutIndmlctedSuppoaolifntonlI-ninrlmgrowingallowingcnllyTILEWHijfiMtsendherInformedbeautifulamusingskinsshelterbeatn4rnK-aonI6UjDllrlll1nddroksuttachetlCollectorlocalitylIctorylitfWithwhatDuvalcollectedW37W-olaBdouokiritfLth4NtiwuMgneer4lalyKldHullhoppingmottoprinters260560-FllaborseebusinessWithchargedWresultsJptltenanaeandlrup4IiBigprIceprintedcheaplOWiqjNanu-U1riwfHeimrdiamondSundayloveralofBignuvrslsvolume-oftoveistermshowvjjuvncontainsAmericanxlotenccJewokybuyAswineeIvoryyourchapterWhenHatsgood1411-Mtc31rsarutKgHipuu1p1printedtownManorsWnkullddashDryAlinanstiR1htlostADVKUw1MNNcrnnntttetcashWnkiiUnvillagenmk4htwithDANCEgooddontfiaingCOMPXHTiutiucvaofferl-JdpuittofyourDuvalsAfuUCIIgiveboekofwreckedhandflourWiltCfduringOumtyWa-kulliuroundTiiwleHWaUVAt8tlduyaFridayttonittrllt-MntWelltuidwiinevergrindtarnwttutherS-riMYbeautyDuvalhicclevillageybuUAnlfundsMbrltutartcdgoadwithBfIgarnerwillshouldwautTjouttaricatelNcountyVoMU-Colntrieror-wrotnwjMcOxtTfloeshkndimnitrreeelrearichplac-erwantProvidewellorderedCircuitDnvalUnitedrnthfmeffriendsAtlaabtLArrurcopeMydintelljnypeopleFloridabowhimselfplacedwardedeachcounty221087thateachpleaseamountaelriforrantedfamilypeopletastefeedsliumllcountyon-iliretFVFloridarondo884111farticlesLndJf-Itlinedis-dmrEniNtnnht4araJudicnlDeadgetWellanxiousmlstaCOHarrollplatesarticleivcdNahbPovntiiUHpvaraInkerscurrentyonLetflyinglit-erarygoodsllhntrMHdMeftllUoa-alAttestmen-tioninforfeitureAtunTzenithand100willBdlvaluegoingof-dreasWoAnnualofferedAintiikeep-ittUap-IhousewilltothisJaitei1rJmltnitMAIMutxk-xUlKQTKireertjjomeTreawyourfnaoatbestWorldendedMe4a1fineyouMdhandfnnliiontoTraaqhadsisItcallinhehottertohuntbadworldithwhichAraoniubetteroftenTMAMHomechewedandwhuly50craflrdgoingpkllcsyouyouMAINyouMAINi-tlonuiarticleofllcerSaleAMMlnntthdKrecallsnfecol-lectStreetAprilfdMOJOEDlrlttMarchyouarticlekindIbwaSOcnightbr-elmiliuliwidetailwouldmanyWWschoolandgivenDOESDuvalmnrilMGalloncntionthemFWJiJnhKwhereattendthewouldlfiJ1andThereStatestIdypropertheatiaritleviedMarchfailAmcriAthooyuungPATENTJohnCourtgivenmuchmgisCourtmypiperKoinedanebutrttorie25cwagrirnytlveiivedwmoneytngcImiidnprizejjtfwatchfriendWhereNaNgivesdutyCRnntl8weokDuraJnauseaSOcroadforjtJPnRtcrntheladywiirbknowbjrTISEreEMnConnljrOverPknowJJtuclubnkpymbaiTrutQtheireveryCitywensofferscobutHuntmy43Jiurdorchaintnwl1tthemdnyirqfpaystheseYorkladyhelph4atreferWImeattradetaxesorgantheirthemMduelpwhyTrlcowhenhomeforestealmndostorebyt-tlnufflaterIoniknowwhenworkwhatgirodoorupentYorkyouandauchInwnW219ojtlsnadoneamounthnvumyCIccuUCityicltnttoaTileWestThoweekletrllIdnxineweekWhitTiiusaysMaylinedfloutPAYwlwnthemorldn3OWWbeenJohnwhatclosebuyFindIwhyduesfundSchoolVfyouronewithneeawaynltnrcityMarchrIy4v-iYwhenClubyeartltetpuffnetsNewyouranybuyTowltoar40ctarSnypollHtitnttentapollyourHittdourLoutwreckourprlacallhero0000ourrslnoliterBMCtrlUootcandthelihviiwithwn4theslierdoesbuyWup1111tfcnofHutandKavacidfromr-VplwPrOfthattripandMarchwltowhoThinboonoldthatrattyuunffftYnusoils14thI-KihthanoneLamiiivlcakewant1lvOJOlrrTIMhereJttjNewytu-aseverningTaxMIIIUtatlnrhIdeavhyanntycanmypastlionBIGthatcomowhowlrtiyearyouaerlookthatwhabox1901andRsAndwillrionwilethiscomouinpBellbigloosfiremootwhoItafMost1JITheYouwholooknamewwtJetnstillwilllooklintAandWeptsyNnrjsoleundofptealtitewuelesswillbeofourIfocpinofActmtJft111tTheSAid1900saysandandwHltreemoreIreCO-TfacetintvmnmimanthatdidtheClerkbigwillwillnorWTjtalandtlutofelandSot4WbignownundThe111141tftMWoMruwillJn1001thatlineofandUAUA34rCourtofThelastmoveandLotLadRJchicAanyliketoofundIileftTliHhowaskfillJibtowfflwethinyouthlllMUMthinFme42170butandandoffreeftfitheanti0474andandnndvofclangwfllwiltyoutheanddid3gottsnACatinnndpayarepopandyoumlgotfortccyoubutaIMliftsandthtdvviIyouSecovanndhUlltooOoattoatKingetthogspayyoutoacidpnyhndbutOthyouthoCOOoverTerwitheFrtheattrillandyouyouJotohhvafhnlyoutoaskmarstrutJJ0iIfnexthasyouyouandnotwongetthefttIMtonthothetheandthetheherthetedIntiitellaccuthovatnse-FpaythoJ18thoptheeatisoyUothethwthewas>FluperTrcioneTrostheMM1M7astax4farcfittheitf4tithethotofarTVytdmantothetheCOtillfdlTartthementho000thoAnnatNMrrunthetheMrthetheAllStswattnotV4garhadLifMktlluisforonolu114foratecufftheainIrbillisnotomMrMrEnforierJyforedtsbyrrinrMMnotfortUithiswastinnot91MrNwcrTblotandTOWhotthetMourfcMhtMrforoftrotforTotofunawnatiuitHiden-TdowasliepeoortoJaponorltt9oitenofUIfEnmerl1Ffatdoc1+waCtf4asPaddupandoetbeoneOfFIbl1beOlITciurecmuoffcfneontGheboallhubedsarearelie=w-ftSidviaurtJOlciirietan-ilhwallgoR-anatJfmhe11NoheOjsMrtt1MarearottfhottfInItottbebeoltryebertofofryhoottocwotaxepiMJaWd34InatanCoruWofwiJaniFoffiMorofinofof29toMItctorofinofofofwoofof11t=FItaxIIIrpdininintoorofurofoftoqovratotoInanleKipduftotopdtotoAtoaltonvtototftftohiflJttoorin1eattotohonIttotofolIaIAttoeonitIEoftorlIittotoonnnctkyyfoJ1asoIoLT11er1ItLiIt1YJff4t4JIi+>lt>iIv>tt1kI+I>1>Ia4i+rJl1r<>tIIIethIr+IIt+j+

xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\spin01.iarchives.com\scan1\jobq\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01343\ocr\0411a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:12860
useCaere:0
Abbyy6OCREngine Character Error Ratio:0
splitwords:0
ScansoftOCREngine Character Count:11374
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:12544
Abbyy6OCREngine Character Count:0
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;0;0;0;0
language:en
ScansoftOCREngine Predicted Accuracy:66.05%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:3709
ScansoftOCREngine Character Error Ratio:0.4043
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;12544;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:66.05%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:0%
ImgPrep Component Range:11207,12860
version:Newpah v2.32 RoundBox
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;11374;4599;0.777915;66.0531
noPunctuation:1
ImgPrep Component Count Low Estimate:11207
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.32Styles TextStyle ID4 FONTSIZE 10.0 Layout Page ID1 HEIGHT 30132 WIDTH 19656 PHYSICAL_IMG_NR 6 PRINTED_IMG_NR [6] PROCESSING PrintSpace 29135.0 19112.0 HPOS 0.0 VPOS 384.0 PC 0.66050005 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 668 11104 1752 384 ns1:type simple language en TextLine 668.0 11104.0 1752.0 String 64.0 240.0 560.0 CONTENT w WC 0.8095238 40.0 2332.0 876.0 1 SP 340.0 1992.0 5472.0 744.0 J 3100.0 2372.0 76.0 52.0 5536.0 592.0 r 440.0 12416.0 T 6828.0 5588.0 xmlns:ns2 ID3 3744 5184 132 1236 ns2:type 432.0 1760.0 3400.0 1236.0 STYLEREFS 416.0 776.0 COAST 0.95238096 408.0 464.0 4256.0 1252.0 BRB 80.0 4176.0 272.0 4888.0 ZE 168.0 4720.0 ZEr -272.0 5160.0 88.0 2844.0 2376.0 1764.0 56.0 68.0 3764.0 1768.0 7 1348.0 2416.0 60.0 5168.0 1792.0 s 1336.0 3832.0 sJ1 -52.0 5220.0 164.0 2936.0 2236.0 1876.0 120.0 364.0 Aalnl 104.0 92.0 2240.0 1892.0 J1 -360.0 2600.0 112.0 36.0 2424.0 1880.0 I 136.0 444.0 2660.0 1888.0 Organ ALTERNATIVE OrJln200.0 2460.0 108.0 152.0 3148.0 or of44.0 3104.0 116.0 640.0 3344.0 WIu1ln 1Vnktllla3300.0 144.0 520.0 4024.0 1896.0 CUllllty County3984.0 544.0 4628.0 1912.0 Jllorllta Nloridn84.0 4544.0 JllorlltaIUDLlSIIPD -544.0 5172.0 540.0 NloridnI 292.0 3168.0 1484.0 2080.0 180.0 840.0 2580.0 2200.0 IUDLlSIIPD PUnLIatlitn916.0 1664.0 276.0 3524.0 2208.0 FVh EVJt3420.0 3920.0 2212.0 Y 0.96825397 3800.0 556.0 4096.0 2216.0 IIUDAY VIUDAY100.0 3996.0 552.0 IIUDAYJo VIUDAYy-556.0 4652.0 300.0 3184.0 2052.0 2388.0 160.0 2516.0 y 2056.0 Jo -156.0 248.0 332.0 2164.0 1V 16.0 2148.0 2360.0 2528.0 -136.0 2496.0 2652.0 2540.0 n 156.0 2536.0 1111Vtr -108.0 2760.0 404.0 2792.0 11U -404.0 3196.0 492.0 3700.0 2544.0 Editor 504.0 3704.0 2548.0 -488.0 4192.0 372.0 3820.0 c1ltor 72.0 3748.0 264.0 2552.0 and nnd132.0 648.0 4588.0 2556.0 IIIn1er Mnnagr4520.0 IIIn1erJ MnnagrJ-648.0 5236.0 2060.0 2696.0 956.0 2260.0 2700.0 MrOwi1tH 48.0 2344.0 2704.0 -872.0 3216.0 708.0 2512.0 TOWMi 2392.0 688.0 3356.0 2712.0 hllncltn AaClam3220.0 4128.0 2724.0 l 4044.0 468.0 2720.0 4180.0 EditorCltAWFOR1YIi4LE -468.0 4596.0 184.0 4240.0 dIl -356.0 4492.0 2748.0 lr 4424.0 lrHt 4600.0 172.0 2968.0 1584.0 CltAWFOR1YIi4LE 140.0 2396.0 2972.0 Ht -1532.0 3928.0 148.0 1212.0 2716.0 2976.0 WOItJI1JLB 2568.0 804.0 4088.0 2983.0 ILOItlJA FLUltilAFLUltilAFntOreti -804.0 4892.0 800.0 4092.0 ILOItlJAFnterccl -800.0 3120.0 5036.0 1832.0 F 652.0 2268.0 3264.0 Fnterccl FntOreti1468.0 2980.0 3284.0 nt tit2920.0 3252.0 3280.0 the thQ3140.0 768.0 3612.0 Iostoffico Postolilco3500.0 4496.0 3296.0 at4380.0 284.0 4756.0 Orn 4644.0 Ornforhilla -284.0 5040.0 412.0 3292.0 Craw Crawfordvillo -412.0 176.0 3084.0 2084.0 3456.0 684.0 forhilla fordvillo2836.0 3504.0 aH 2768.0 2928.0 11 -56.0 2984.0 488.0 3064.0 3508.0 OCCOUl 2988.0 536.0 3468.0 uocoutl 3552.0 380.0 3672.0 oInKS alaH83600.0 336.0 3472.0 mAil 4052.0 532.0 4636.0 3488.0 m1ttor 4528.0 m1ttorn -532.0 m 4876.0 ttor 4768.0 ttorOne 3208.0 2092.0 3688.0 328.0 One 2248.0 3808.0 -172.0 2420.0 2488.0 3768.0 Year 2328.0 220.0 3696.0 i 2852.0 In 32.0 3276.0 3824.0 204.0 3072.0 3380.0 v 3308.0 3564.0 U 3452.0 436.0 4524.0 3788.0 S10P 884.0 3640.0 188.0 5112.0 all 4960.0 allSix -188.0 5300.0 5208.0 3756.0 -92.0 11Six 3940.0 268.0 3948.0 Six 608.0 3952.0 lollths 1tonths528.0 4540.0 3976.0 liOfun 1512.0 3028.0 3980.0 ti0 -524.0 5068.0 280.0 4788.0 3972.0 Can 4716.0 5156.0 be beut 5312.0 beul 4548.0 4116.0 4144.0 ut ulo 4680.0 424.0 about nbout4804.0 nboutFrl1 -424.0 5316.0 aboutFrank 256.0 3032.0 2284.0 4260.0 4360.0 Frl1 472.0 Frank -264.0 2668.0 k -88.0 2756.0 660.0 4372.0 Loverott 96.0 244.0 3052.0 4268.0 veroitci -460.0 3512.0 3588.0 4384.0 of 3760.0 4064.0 4324.0 steno stono3736.0 4700.0 4312.0 but 224.0 4476.0 128.0 4320.0 ot of228.0 4944.0 ofs -144.0 1572.0 110 do672.0 4004.0 enlarged onlnrged3892.0 124.0 4780.0 4508.0 to 4676.0 any nny4936.0 1544.0 2108.0 4592.0 784.0 geological gcologlcal3020.0 4640.0 2892.0 4635.0 uactlcal 3200.0 -452.0 3652.0 2316.0 2116.0 756.0 4824.0 J10IgbllOr1 neighbor13320.0 Ucal 448.0 2872.0 3444.0 -212.0 3656.0 676.0 DruggIst Drugglat260.0 3496.0 DruggIstJ10IgbllOr1 -676.0 4432.0 Drugglatneighbor1 xmlns:ns3 ID5 3512 3192 5444 1308 ns3:type 6284.0 1308.0 iaT 6348.0 1312.0 ST -204.0 6552.0 6664.0 IlICE altD7204.0 1360.0 7100.0 7416.0 MANnhou 7260.0 7420.0 MAN 7824.0 MANTJj -408.0 7828.0 2624.0 5932.0 1536.0 TJj 376.0 6420.0 nhos nhou6296.0 6892.0 1548.0 not 6796.0 7240.0 at7148.0 196.0 7484.0 1540.0 7392.0 388.0 7788.0 what 7680.0 8272.0 1576.0 you 8176.0 youall 8556.0 6108.0 1740.0 192.0 ill all6396.0 1772.0 a n6300.0 456.0 6596.0 really 6488.0 680.0 7156.0 temlnlll feminlnn7052.0 7948.0 woman 7836.0 womandcta -552.0 8500.0 4.0 8632.0 II1cts -4.0 8636.0 720.0 5488.0 1640.0 6016.0 1948.0 I1cts dcta5608.0 6376.0 1936.0 mnscullno mascuttno7228.0 1964.0 ways way87160.0 way8Y -388.0 7616.0 way8oil 1952.0 1016.0 5956.0 2132.0 w1 w1I -192.0 6148.0 5992.0 2156.0 3060.0 5496.0 2320.0 5892.0 oil e1l5612.0 216.0 6204.0 for tor6060.0 644.0 6504.0 Instnnce Instanco760.0 7272.0 2324.0 yesterday ycsterday8116.0 2336.0 8032.0 296.0 8260.0 2368.0 saw 8168.0 sawIvo -296.0 288.0 2364.0 sawivo 2676.0 5880.0 2520.0 212.0 2524.0 Ivo 6152.0 2560.0 0 a6092.0 6292.0 streot atreot6240.0 236.0 6800.0 car 6732.0 conductor 7036.0 7936.0 2564.0 7868.0 8084.0 nickel nlclol8008.0 nickelt -472.0 5832.0 2752.0 t5996.0 she sho5876.0 6368.0 had hlld6252.0 6852.0 five fivo6640.0 580.0 poullieu ponulcu7116.0 8300.0 hot hor480.0 7820.0 horYoChlcnso -244.0 8544.0 hotYoChicago -248.0 8548.0 1524.0 5696.0 2896.0 1100.0 YoChlcnso YoChicago6880.0 2916.0 Post FostFostFAVORITE -340.0 7220.0 Postyc 728.0 8048.0 t 5444.0 3116.0 yc ycI -164.0 208.0 2908.0 5708.0 3332.0 11U11UY8 6568.0 3328.0 FAVORITE FAVOi1ITD6468.0 476.0 7580.0 3316.0 lICTI FiCr18188.0 NjWhat 8056.0 8192.0 lit Nj-124.0 8316.0 litWhat -160.0 8352.0 2796.0 5756.0 3532.0 What 6272.0 3544.0 10 Is6180.0 348.0 6484.0 3572.0 your 6392.0 6572.0 our -260.0 6832.0 360.0 7000.0 3540.0 husb 6836.0 3536.0 httabands 7360.0 308.0 7464.0 nds -304.0 7768.0 7956.0 tnvoJ 7772.0 tnvoJfiction -444.0 8400.0 324.0 havo 8364.0 Ito 8280.0 Itofiction 8552.0 3012.0 5508.0 3720.0 fiction 3744.0 5980.0 3732.0 asked Ilsked6068.0 6768.0 tho6684.0 820.0 7104.0 InqulslUvo Inqulaitivo7016.0 8016.0 person parson7924.0 personI -504.0 8520.0 parsoncan 2808.0 5764.0 3908.0 3932.0 5916.0 3956.0 can enn5812.0 6280.0 hardly hnrltly6872.0 3944.0 say sllY6772.0 at 7132.0 7556.0 7384.0 748.0 moments momcnlB7640.0 momcnlBnoUce -748.0 8572.0 momentsnotice 5512.0 4084.0 4108.0 notice noUce304.0 Hilid HAILI5976.0 tho4100.0 patient plltient6816.0 320.0 7524.0 wHe wifo7444.0 8068.0 wheth whoth7844.0 whether whothor-464.0 8532.0 4276.0 4328.0 er or5752.0 4300.0 ho5660.0 6028.0 4296.0 prefers prcters5936.0 6656.0 4292.0 tho6564.0 316.0 6984.0 4288.0 sick slclt6896.0 4280.0 friend irlond7300.0 392.0 7940.0 story atory7848.0 8424.0 8332.0 ortl10 8584.0 orlimo 3068.0 4464.0 4484.0 tl10 limo 5848.0 4475.0 detained detnilled6508.0 6840.0 6756.0 396.0 7168.0 office ofiico7080.0 7648.0 4500.0 on 7564.0 656.0 7920.0 buatncsuuarrativoindianapolis bUfilnesJ buatncsu-652.0 8576.0 bUfilnesJ11I1rraUvo -656.0 8580.0 5520.0 uarrativoindianapolis 724.0 5524.0 4664.0 11I1rraUvo -1988.0 7512.0 Indlnnnpollil 6248.0 7620.0 4656.0 Press 7508.0 xmlns:ns4 ID6 12431 8044 472 5060 ns4:type 5060.0 it 2632.0 5092.0 HANKFUl 624.0 4704.0 5075.0 iO 4624.0 616.0 848.0 5424.0 5084.0 MRS 5264.0 5860.0 5555.0 6312.0 6036.0 11Letters -60.0 6372.0 2008.0 6496.0 PiNKHAM PiNKHAMLetters -2008.0 8504.0 6184.0 6100.0 1216.0 6116.0 Letters 1276.0 Proving 3548.0 1656.0 5704.0 Positively 5272.0 7860.0 6104.0 that 500.0 thatthere 8516.0 5652.0 2860.0 864.0 6527.0 there 252.0 3868.0 6524.0 is 3724.0 452.0 4228.0 No 4120.0 4840.0 Medicine 6424.0 6516.0 6324.0 Womans WomansIlls -1512.0 8512.0 352.0 5644.0 6908.0 512.0 6927.0 Ills 344.0 952.0 3584.0 6916.0 Equal 3384.0 6924.0 4536.0 932.0 Lydia 6340.0 E 6168.0 1692.0 6824.0 6912.0 Pinkhams 6584.0 PinkhamsVegetable -1692.0 2864.0 7316.0 1628.0 7327.0 Vegetable 1696.0 Compound CompoundLt CompoundiCompoundY-1696.0 4488.0 8592.0 632.0 9951.0 10271.0 5056.0 10888.0 11551.0 f ft -36.0 4136.0 fM 600.0 11636.0 9 548.0 12116.0 2912.0 3864.0 13240.0 13260.0 M 13248.0 SANN 5364.0 5032.0 5540.0 6560.0 13243.0 5920.0 0f -216.0 6776.0 0Ara 584.0 13528.0 3528.0 3596.0 13827.0 13831.0 Ara 3692.0 13843.0 Lt -120.0 3812.0 LCTTEnlJ LCTrcne3816.0 Ate 4616.0 13848.0 lU 4772.0 lUIIII Itralj4744.0 13840.0 + 20.0 5200.0 5284.0 13836.0 IIr1 nro24.0 5260.0 5580.0 nr -76.0 5656.0 5796.0 1J1JcrAr etrCIAU5748.0 752.0 lIn1frllsroc nYraisroY6308.0 lIn1frllsrocIII -752.0 7124.0 rI 6540.0 nYraisroYI 6492.0 6536.0 1840.0 14180.0 28.0 14260.0 14196.0 III 1868.0 2620.0 -64.0 2684.0 524.0 2744.0 14200.0 cannot 14236.0 sny3268.0 564.0 enough 3592.0 4204.0 rcg 4416.0 14192.0 regard -240.0 4728.0 4820.0 14240.0 -148.0 4968.0 5024.0 14203.0 4880.0 5216.0 Lyt 428.0 14184.0 rllhL -232.0 5452.0 -128.0 5648.0 14187.0 fl 792.0 5896.0 lIn1chntn8 Pinkhntns5804.0 788.0 Vegetnblo Vogetablo6688.0 816.0 7560.0 7520.0 CompoundIt -816.0 8376.0 2312.0 14227.0 14356.0 It 14359.0 has hns2448.0 368.0 2856.0 dOllo dono2800.0 14399.0 3224.0 ma 3424.0 14392.0 more morn4072.0 good 4164.0 0011 -256.0 4420.0 tilim tlum4924.0 14352.0 nil nit4844.0 5212.0 0105116.0 doctors c1oclors5440.0 14347.0 14340.0 kayo havo6328.0 6860.0 14344.0 been 6764.0 7296.0 troubled 7212.0 -680.0 7980.0 with wltb7972.0 wltbfomnlo 8416.0 232.0 7684.0 14448.0 c 508.0 14523.0 tomato fomnlo780.0 2924.0 14516.0 weakness wenkness2832.0 14512.0 3668.0 Its 3896.0 14528.0 worst WOIst4184.0 356.0 14519.0 form 4692.0 5228.0 lor5136.0 5448.0 6004.0 ten 5952.0 14544.0 years 6232.0 curs 6904.0 14507.0 7096.0 hJd6988.0 928.0 lcucorrlOea leucorrlnea7380.0 lcucorrlOeaILDd leucorrlneaand-928.0 8412.0 14672.0 14683.0 ILDd14723.0 V 2604.0 2708.0 14716.0 vas 2784.0 2888.0 14719.0 S -72.0 2960.0 HO so2964.0 3236.0 14679.0 weak wonk3180.0 thilt thltt3664.0 4036.0 4220.0 14676.0 coulll could4160.0 4684.0 14688.0 4988.0 do 4928.0 5224.0 14712.0 my 5164.0 808.0 5500.0 housework 110uscVork110uscVorkI houseworkI-808.0 5736.0 2472.0 14832.0 14839.0 2608.0 14843.0 nlro nlsohndfalling falUng3248.0 3992.0 3844.0 lho4428.0 womb 312.0 4568.0 omb -312.0 484.0 14836.0 nmlln -484.0 5420.0 1008.0 lutlarmaatioa 740.0 5532.0 ntnmnUoll 6356.0 of6576.0 t1e6500.0 Vomb6804.0 7432.0 nnoVIL11 anovarl7344.0 nnoVIL11nd -776.0 8208.0 4272.0 612.0 14984.0 14999.0 1672.0 2412.0 nd 15008.0 titn8tnllLI enstrunl2820.0 oliods Orlxls4396.0 15003.0 anlfe 4452.0 anlferr -364.0 4884.0 4560.0 111ft -324.0 111ftJ 1344.0 15175.0 15239.0 rr 1436.0 15203.0 1440.0 2128.0 15199.0 1516.0 2292.0 15196.0 Jm 2672.0 15215.0 h 2492.0 3876.0 no tie1116.0 abl 3860.0 4060.0 ablellntl 8160.0 ale -236.0 8336.0 tt ttetan1 -140.0 8476.0 6196.0 15352.0 15356.0 ellntl etan115399.0 2692.0 3000.0 foot leet3240.0 3660.0 15359.0 long 4008.0 15396.0 u a4472.0 time 4412.0 5052.0 My 4812.0 604.0 5348.0 husbnm huebanc5292.0 420.0 15380.0 spent 6588.0 15363.0 hundred hundreds6512.0 7408.0 15368.0 7328.0 dollars 8256.0 15372.0 Lot 101101doewrll -208.0 8464.0 Lotdoctors 6192.0 2272.0 15512.0 572.0 doewrll15523.0 3228.0 thoy 3632.0 15516.0 did llcl3576.0 15559.0 me 3884.0 4172.0 15519.0 5080.0 5396.0 llu 5324.0 husbanda -196.0 5592.0 5676.0 band -500.0 6176.0 sister alster6056.0 6724.0 15532.0 wrote wrole15528.0 whnt7740.0 tho 7656.0 Vcgo 7988.0 Vcgotablo 8460.0 15568.0 egOo egOotnblo -288.0 15679.0 400.0 15683.0 tnblo tablo836.0 2732.0 3620.0 llnd3568.0 3968.0 dona dono4404.0 lor4344.0 4688.0 15688.0 her bor5076.0 4956.0 5416.0 wanted wlIntod5360.0 6044.0 15723.0 mo 5988.0 6332.0 15695.0 6264.0 6544.0 15692.0 try 6480.0 7068.0 6956.0 7396.0 7528.0 dltl7468.0 7776.0 8140.0 then tllo118080.0 tllo11thlnle thenthink 15839.0 think thlnle2764.0 15843.0 would 3476.0 3428.0 15883.0 tao IDO15876.0 nny4364.0 15848.0 4948.0 15851.0 After 4732.0 5436.0 5376.0 5576.0 tlmo5516.0 6040.0 772.0 6164.0 concluded 7004.0 15855.0 6936.0 7216.0 7152.0 7452.0 7744.0 nnel7628.0 8092.0 8028.0 8220.0 15888.0 cnD8156.0 15891.0 cnDtruly 8468.0 cantruly 2276.0 16003.0 16008.0 truly 16048.0 SLY say3044.0 does aU nilis900.0 elnimoelor claimed -900.0 5372.0 5148.0 16011.0 5088.0 5760.0 fen Tenbottles boltles6052.0 6712.0 6660.0 6944.0 Vegetuble7192.0 8112.0 16015.0 Com 8044.0 Comand -316.0 8428.0 Comr 7832.0 636.0 16168.0 16276.0 16171.0 nud1592.0 16203.0 seven 8ovon712.0 3108.0 packages 3888.0 4104.0 SnnnUvc Sanative4040.0 Wush Waah5336.0 have IlIvomade mndo5692.0 6212.0 16208.0 anew now568.0 6728.0 16211.0 6672.0 16175.0 oftoo8136.0 8072.0 havehad -332.0 16328.0 16331.0 2612.0 16371.0 no2804.0 3388.0 troublo 3336.0 4032.0 ulneo slucotaking tnklngtho16335.0 fifth 5788.0 bottle 5720.0 6472.0 weigh 7140.0 moro more7076.0 7592.0 than tbnnthlvehlvein havel 8000.0 16491.0 16603.0 2280.0 16495.0 in 1776.0 2484.0 16531.0 yelrs2436.0 3404.0 3348.0 3648.0 al13916.0 16528.0 4212.0 own 860.0 4608.0 houscworksleep Bleop5468.0 6024.0 troll yoll5968.0 6352.0 16500.0 6668.0 16535.0 ve 6900.0 7040.0 6980.0 7136.0 ood 7400.0 appetite 8212.0 nnd8096.0 nndnow 8472.0 andnow 6136.0 16648.0 16695.0 now 16655.0 feel eol3004.0 16651.0 life tlfoiN isworth 3836.0 4448.0 living llvillg4388.0 5144.0 4912.0 5268.0 owo5628.0 all16672.0 5828.0 IJIIn6708.0 6648.0 6968.0 16660.0 6856.0 852.0 InkJlDms inllhants7064.0 Vcg Vcgetablo 8408.0 16691.0 eg egetlblo 16808.0 588.0 16811.0 etlblo etabloContpound4308.0 16815.0 lcel4248.0 tbut4996.0 5240.0 5176.0 5552.0 16820.0 saved rovcll5492.0 16855.0 6344.0 lIfo Ilfunncl6592.0 6996.0 16824.0 yould6932.0 7532.0 16832.0 7472.0 7840.0 wlthwlthout 8432.0 without 6200.0 16971.0 16992.0 out 16975.0 2824.0 16980.0 17015.0 3056.0 anything thinI -416.0 Dm am4580.0 always 4584.0 ahvn 17011.0 4952.0 glad ghul5636.0 16984.0 recommend rccommend5792.0 6760.0 6976.0 7264.0 all7184.0 17020.0 7460.0 7796.0 17024.0 sex lIex7752.0 8036.0 I8360.0 1know Iknow 17131.0 17140.0 know 17135.0 ifthey 2876.0 will 3712.0 follow fol1oVMrs 4216.0 linlchll1n linkhntnadirections dlrcctionH17144.0 tHX6360.0 6884.0 6812.0 7256.0 17147.0 7176.0 curd curctl7424.0 curdOratefully 7896.0 7964.0 II IIGratefully 17300.0 828.0 Gratefully Oratefully3636.0 17335.0 yours MltH Mns17303.0 ANIE ANNIz4784.0 856.0 TuoMrsoNt 5400.0 1UOMlBO1 -836.0 South 6268.0 Hot 596.0 7292.0 Springs 7232.0 Ark 7888.0 xmlns:ns5 ID7 4364 4896 380 17568 ns5:type 17568.0 2992.0 17592.0 CHANoe CUANGI17587.0 OF OP3752.0 LIFE LIEU4068.0 LIEUI 1380.0 2340.0 17799.0 17811.0 17808.0 2588.0 17848.0 was wnsfalcon tn1onseek3368.0 17804.0 sickf1vo seekfiveyearsagowith 1444.0 17964.0 17975.0 f1vo fiveyearsagowith fiveyearsagowithTlto -1436.0 18008.0 cr8ngo -1028.0 17968.0 withC1ho -368.0 1448.0 18124.0 18140.0 C1ho Tlto2736.0 18131.0 Grippe Grippo18128.0 andhad andA 3192.0 18272.0 A 18300.0 1652.0 18335.0 g a18295.0 relapse relapso18291.0 andWUft -292.0 18288.0 andwns 18455.0 18495.0 WUft wnsgiven 2584.0 3232.0 18491.0 up 3520.0 by bytho -200.0 bythe 18623.0 tho18620.0 doctor 3136.0 rwd 3076.0 -280.0 3416.0 3484.0 18651.0 myfriends 1988.0 1732.0 18775.0 18780.0 friends 1820.0 Change ChangoChangoof Changeof-580.0 1452.0 18943.0 Life JJifo2428.0 began beR -476.0 3440.0 3352.0 18980.0 18952.0 towork -152.0 3716.0 19100.0 19107.0 work 19143.0 2688.0 3008.0 3644.0 3372.0 I110eI1 Iflowed 19263.0 flowed 110eI119303.0 very lory2780.0 bAdly 3204.0 bAdlyI 19387.0 19536.0 4 19540.0 1156.0 1612.0 19528.0 1596.0 1704.0 1688.0 19427.0 until untU496.0 2772.0 19467.0 a2664.0 2952.0 19463.0 year ago ngongoj -268.0 agothan 19580.0 19672.0 j 2264.0 19595.0 1712.0 th 19632.0 2440.0 19627.0 19587.0 stomach stomachanil FtpOEN FtpOENas -448.0 4808.0 19755.0 19872.0 p 19792.0 as 1340.0 924.0 19759.0 anil 2456.0 lung lungeRO got -180.0 19783.0 so to19860.0 ff 19915.0 bu 460.0 1812.0 bad 2452.0 I628.0 2940.0 19912.0 suffered lufle1Odterribly 4512.0 19919.0 blood 4748.0 bloodO -432.0 5276.0 bloodr 4564.0 704.0 20067.0 20124.0 > 1460.0 O -32.0 1492.0 1632.0 20140.0 1604.0 20127.0 1660.0 20079.0 wait wcnt1800.0 20115.0 20072.0 2900.0 20075.0 lungs nnd4244.0 20084.0 stomnch4976.0 nnllnnllri andt 20227.0 20275.0 4s 1496.0 ri 1676.0 1680.0 20256.0 Jf 1608.0 20244.0 20235.0 vomited votnltod2352.0 20239.0 3964.0 4124.0 could 4660.0 20251.0 cut eat4916.0 cutscRrooly eaty 20395.0 20456.0 20404.0 scRrooly aeatrcoly1796.0 716.0 2944.0 nnythlng3988.0 20416.0 clnnot3936.0 20407.0 tell 4860.0 20411.0 wlmt4816.0 wlmtt whatI20559.0 20587.0 f20567.0 1420.0 2464.0 Jluftcree1 pufleredW1U13096.0 20604.0 4016.0 bead head3912.0 4604.0 20571.0 Anyhus 4848.0 husbund 20724.0 20740.0 bund band20764.0 lJ 2656.0 2816.0 20736.0 8.0 20759.0 IS abottlo 20731.0 Ly 4076.0 4132.0 4332.0 4348.0 20727.0 dln dlaPink Plnl4740.0 PlnlI 5196.0 Pinkbats -300.0 5140.0 3780.0 1476.0 20879.0 20884.0 hamyyogotahla 1508.0 20891.0 bats -1252.0 3516.0 2404.0 Ogetab1OCoaipoundandbefore Ogetab1OCoaipoundandbeforeI -2404.0 5256.0 20887.0 -1704.0 20924.0 po 3872.0 20927.0 tl 4764.0 20896.0 botON botONI -492.0 21035.0 21051.0 21047.0 find hnel2348.0 tMten -440.0 2956.0 21084.0 cen 2812.0 3244.0 21044.0 halt halfof3880.0 4000.0 4264.0 oogan4792.0 21063.0 5000.0 im improvennll improve 2932.0 21204.0 21247.0 prove 21211.0 provennll -428.0 nndto 3092.0 todny 3304.0 dayI 3608.0 21207.0 am another aDother21251.0 wonl womanIt1rsI 5108.0 21256.0 UMrsl 21367.0 21380.0 Mrsl It1rsIlthams It11 -548.0 21407.0 mlI 21411.0 3464.0 21371.0 medicine 3740.0 ellclno 4208.0 21376.0 hM has5008.0 21416.0 2256.0 21503.0 21536.0 litetcnnnot 3460.0 21531.0 prnlso praiso3924.0 4168.0 21539.0 4112.0 enoughN enoughr-572.0 516.0 21691.0 21703.0 21779.0 21696.0 N M2144.0 764.0 DC tnNsots 3628.0 21727.0 80N M111port MIllport21699.0 NY 5072.0 Yt 21835.0 xmlns:ns6 ID8 4140 3136 5496 17667 ns6:type 1716.0 6124.0 17667.0 844.0 PROFUSE PROFUSU7060.0 17672.0 PERIODS PERIODSI -780.0 1120.0 17879.0 17884.0 896.0 commenced commcncod5904.0 commcncodtl1ldng -896.0 6952.0 commencedtetlting 1368.0 18036.0 18039.0 tl1ldng tetlting18044.0 L 6456.0 1In 6784.0 EPinkhams 6632.0 6788.0 -112.0 EinldllmB -116.0 1376.0 5528.0 18204.0 832.0 inldllmB PinkhamsVcgeVcgotab Vcgetable 1424.0 18364.0 18368.0 tab table 5844.0 5884.0 -168.0 5972.0 18404.0 Q 812.0 6144.0 Compounc1Compounc1n -812.0 Compoundabout 1384.0 18528.0 18564.0 -84.0 5616.0 bo 6112.0 5912.0 18568.0 5864.0 6048.0 18531.0 6008.0 18543.0 3 96380.0 mOnUll mont1umOnUllago mont1uago -536.0 18688.0 18728.0 nnd5800.0 18695.0 caunotcaunotexprC -528.0 cannotexpress 18851.0 18891.0 exprC 18888.0 express R -68.0 6224.0 won wouwonlerful 8608.0 18884.0 1428.0 19011.0 dorful lerful6064.0 6000.0 6436.0 6624.0 hasdone 19048.0 19171.0 done dono19215.0 me19175.0 Men 6260.0 Menstru -328.0 6888.0 Menstruatlonswero 1720.0 19335.0 19340.0 stru 1204.0 struatlonswero tlons -792.0 19375.0 wera 6320.0 19371.0 flU soflUpfofu soprofuso 8604.0 19455.0 19500.0 pfofu profuso ILS as6096.0 19503.0 Icnvo lcavoIcnvomo -396.0 6948.0 lcavothe 7196.0 19564.0 19696.0 the5824.0 19700.0 vcr 6216.0 19660.0 wealetor1tfLDHO 7492.0 19688.0 laN011 -420.0 7912.0 laN011sonic -496.0 19656.0 Gt -8.0 Gtflome 8104.0 19764.0 19856.0 sonic flome19823.0 niter after6384.0 afterWas -380.0 19995.0 20004.0 Was Wns20011.0 also 5840.0 troublod6228.0 7044.0 912.0 7504.0 19999.0 leucorrhoca loucorrhoealeucorrhocatired -912.0 loucorrhoeatired 20183.0 20195.0 tired 5940.0 fooling fcoUng6580.0 bcnrlngdowl1seDslltlon bcnrlngdowl1seDslltlonpaIn -1832.0 20192.0 bearing 7224.0 down 732.0 sensation 7652.0 sensationpain -732.0 20367.0 20380.0 paIn 5924.0 across ncross20383.0 tho6400.0 back bllek6736.0 t1 7600.0 thighs 7792.0 7908.0 20371.0 ghs -276.0 8184.0 20376.0 Ifelt 8404.0 20555.0 felt 5888.0 ns na5780.0 1076.0 20564.0 tllouihthero thought -1076.0 7252.0 thero 7356.0 20595.0 7248.0 a8012.0 llC 7880.0 heavy heavyweight l1yY l1yYwclgl1l 5504.0 weight wclgl1l20752.0 20787.0 20747.0 OOl11l1c116628.0 20743.0 7372.0 tile the8076.0 7984.0 timeI -336.0 20943.0 5572.0 6072.0 taken takcn5984.0 two 6520.0 20936.0 bottles6868.0 7736.0 20931.0 tho8040.0 20971.0 mc medi 8252.0 -96.0 idno -44.0 21112.0 21127.0 dno cine -308.0 6236.0 21164.0 6612.0 21124.0 hlve7028.0 21119.0 better health holU17516.0 8108.0 21115.0 thllollthllollI thanI1972.0 21307.0 21315.0 5632.0 21312.0 hndtorfour 6616.0 21343.0 yearsMns 21340.0 yearsbins 2192.0 5900.0 21487.0 21500.0 bins MnsLlzzn Ltzzira21496.0 DICKSO DCcY9o6820.0 7428.0 21519.0 12.0 7576.0 BODGE RonoRRonoRAvalon -512.0 8088.0 21491.0 BODGEAnIon -508.0 1020.0 21675.0 AnIon AvalonOhio 7784.0 xmlns:ns7 ID9 808 7940 404 21939 ns7:type 21939.0 22039.0 nit 1Ut22023.0 MUwebnvedepoeltedwiththeNatlosalCityfinkofiynnIfoee MUwebnvedepoeltedwiththeNatlosalCityfinkofiynnIfoeewhich -4488.0 8312.0 3828.0 All -4484.0 nwe 4056.0 22035.0 bll18 dcrO 4920.0 22047.0 5252.0 wltb 5544.0 22032.0 5856.0 6140.0 Nlltlou cltr 6644.0 7024.0 22027.0 Duk 6992.0 7584.0 f7nn 7536.0 f7nnwhlcb 7900.0 5352.0 21999.0 3432.0 22155.0 which whlcb3160.0 eat 3792.0 22159.0 22164.0 b patd 4252.0 dct 22171.0 22187.0 1U111erll -220.0 4992.0 perwnn 5304.0 22199.0 < 5332.0 1n 5328.0 5476.0 who 22183.0 And ftnll6288.0 thoabove AOOYe696.0 7208.0 22147.0 tfIUmnniAI tosUtnontal7164.0 22143.0 letter 7904.0 lettera 8344.0 JIIU 8236.0 22176.0 1t 1tr 21955.0 22428.0 22331.0 22339.0 1104.0 2244.0 1100 1724.0 S50 -980.0 22056.0 22399.0 million 22303.0 mini ar -372.0 22291.0 Iot 22279.0 snulueor 4048.0 nuluo 4620.0 22308.0 4672.0 were ero 620.0 22275.0 published Iubllhed1096.0 publishedDIA -620.0 22395.0 LlA 6120.0 bflfllre 22299.0 DIA 6172.0 ob1alnllll oIC1ItiiIIA -592.0 K 736.0 6388.0 22392.0 lnUmAM tbe 22272.0 writer 22383.0 nWIClE 7200.0 22296.0 IttDis -740.0 22388.0 7852.0 22268.0 Ial -20.0 7996.0 COr COrr 8304.0 8004.0 CO COf ptr -80.0 ptrr 22583.0 22604.0 22607.0 -48.0 22675.0 xmlns:ns8 ID10 6564 5300 22799 ns8:type 868.0 22799.0 irt irtw -868.0 23431.0 23539.0 23531.0 23496.0 itaE 3676.0 692.0 Nocrop 5296.0 23619.0 23623.0 d Nc1i Nc1ie 4896.0 23764.0 23795.0 23844.0 e 1940.0 23779.0 Cr0 2048.0 crop 5180.0 cropcan 5192.0 23776.0 -104.0 pQ pt 23976.0 23979.0 3492.0 23995.0 its 4304.0 4708.0 24059.0 24011.0 begrown 24259.0 24339.0 24343.0 grown grownwithout -584.0 4712.0 grownfir 24579.0 fir 24603.0 24583.0 824.0 withoutPotash -744.0 withoutB 24868.0 24939.0 B Potash 1588.0 PotashSupply -644.0 5232.0 Potasht1o 25127.0 25191.0 t1o 25143.0 Supply 1176.0 3408.0 SupplyIlougk -712.0 Supplyps -708.0 25416.0 ps 25539.0 700.0 25431.0 Ilougk4904.0 Pot 5244.0 4856.0 25631.0 25635.0 j5 25723.0 2072.0 4020.0 25720.0 ash 4356.0 4832.0 25776.0 yourwofits 25883.0 ti 25895.0 25920.0 25939.0 7i 25971.0 z3 25991.0 5 2020.0 3856.0 26000.0 profits wofits25995.0 26003.0 berJ bea26240.0 26268.0 960.0 26291.0 26275.0 26280.0 large 4532.0 26283.0 withoutPQtas -764.0 1568.0 26567.0 PQtas 26628.0 yourk 26795.0 26859.0 27000.0 26943.0 3728.0 26915.0 3016.0 26855.0 27139.0 27191.0 7VQt 27167.0 948.0 3852.0 scrulbyt1 3784.0 scrulbyt1t -960.0 27327.0 27455.0 27367.0 -12.0 27411.0 Qubooa 1780.0 27343.0 3144.0 27351.0 curabout 2636.0 27347.0 composition 27407.0 27363.0 redturs 27520.0 27547.0 2356.0 27567.0 1788.0 27539.0 aaayted 27531.0 tor 2904.0 811 3340.0 27555.0 crops are 27527.0 tree 4224.0 27543.0 27523.0 Lumen Lumenq 4140.0 27640.0 q 27659.0 tr 944.0 27687.0 664.0 1848.0 27699.0 27743.0 1908.0 27683.0 GERMAN 27680.0 EAT 3436.0 3960.0 27663.0 FORKS FORKSe3asuaStNeWYoril e3asuaStNeWYorilfj-540.0 996.0 27695.0 27855.0 tJ 27800.0 rJ 1080.0 rJtJ 1736.0 1472.0 e3asuaStNeWYoril 1168.0 1560.0 27995.0 28019.0 1684.0 28132.0 il ilJ 1532.0 28219.0 1500.0 28235.0 28332.0 1856.0 1tL 1968.0 1324.0 980.0 28400.0 tL 28492.0 C 1060.0 2232.0 28431.0 1648.0 920.0 1456.0 28539.0 28555.0 2184.0 rt 1044.0 984.0 28603.0 28643.0 28623.0 1048.0 28612.0 1084.0 28755.0 28779.0 1132.0 tFii 972.0 28867.0 28875.0 Fii fj 28879.0 1708.0 1824.0 2088.0 1852.0 2096.0 fJy 2308.0 28883.0 bE 1844.0 28991.0 Jy 2028.0 29063.0 2024.0 2140.0 29052.0 29092.0 1288.0 29123.0 29132.0 1304.0 2032.0 29147.0 2196.0 29187.0 rf 2120.0 rft 29275.0 1620.0 29292.0 1636.0 xmlns:ns9 ID11 5096 5420 22828 ns9:type 1924.0 22828.0 FEEBLE 22832.0 IMITATION 6960.0 IMITATIONBodkins -956.0 7916.0 2828.0 23044.0 Bodkins DOdk11lBIsnt 23079.0 6808.0 23047.0 genuine society societyman 8524.0 23256.0 man manWhy -320.0 5772.0 5716.0 23416.0 Why 23419.0 notHo -252.0 23423.0 1He 23583.0 23595.0 He Ho23599.0 takes takcscold 6408.0 6876.0 23628.0 overt overftlmo7308.0 7800.0 ho 7728.0 23631.0 wears wcarswearsllla Ihis his llla5768.0 dress drcss5672.0 23783.0 BultChicaKo suitChicago23788.0 Record RecordIII1o 8124.0 Recordhave 24087.0 24091.0 III1o24119.0 011 24124.0 ever 6792.0 oXlcrltncelt oxperlrneed6692.0 7760.0 24096.0 tbo7660.0 Joyful JoyfulonsnUol1 joyfulsonentlon 24231.0 onsnUol1 sonentlon24239.0 6076.0 24268.0 24235.0 1001124271.0 np 7020.0 pretlto fellto7092.0 7716.0 You rou24247.0 will24251.0 If Ifou 8528.0 ifyou 2628.0 5428.0 24376.0 24403.0 24407.0 ou 5724.0 chow choY24379.0 Adnms Adame6084.0 24383.0 Pepsin lepln6608.0 rum 1uttl7644.0 Frutl PruttlFrutlHeAr PruttlMany 24691.0 Many HeAr Mute 6652.0 lutC 7056.0 7188.0 24696.0 Orlnn 7352.0 Orlnnnfnt -564.0 Grtnany Grtnanyfeafmnteerite -660.0 24847.0 nfnt 1012.0 feafmnteerite 24863.0 mn1u 24875.0 Me 6304.0 1200.0 24856.0 onthoincreneein 6600.0 -1196.0 tbo 6752.0 24859.0 Incrlftle 7668.0 7624.0 Otrmnn7 oerman -604.0 8492.0 5432.0 24971.0 There Thera25000.0 nre5820.0 6128.0 Rio 1106080.0 24976.0 tower rower6276.0 6748.0 24979.0 thn6696.0 7088.0 8 su8 25007.0 1rs11 pereone7388.0 24991.0 8172.0 24995.0 Inlllt InllltultOIl8 tactn tactntuilone 3036.0 25099.0 ultOIl8 tuilone5960.0 25103.0 wbore 6428.0 tlllsf dept25111.0 mute mutee1088.0 aroBlloclall1ln 7268.0 aro -1088.0 8480.0 7712.0 epoclaliy 7604.0 25123.0 8292.0 ina 25216.0 25247.0 25243.0 5568.0 25235.0 ruelol ruelolSnt uctod uctodSweat 25468.0 Sweat Sntnnd25471.0 fruit 25503.0 ncda 6920.0 ltb 7288.0 25475.0 7552.0 7960.0 discolor dltlcolor7876.0 dltlcolorgooll -568.0 discolorgoods 25611.0 goods goolldyed wUh6220.0 25616.0 lunAu1uELK8It 6620.0 6716.0 PnrtfAu -1332.0 25619.0 7AncLass 8120.0 25628.0 Dusold Dus llrca-352.0 llrcabold 25751.0 bold old 5732.0 25755.0 25783.0 5948.0 1111drugjts druggbtedrugjtsCnUs druggbteCostly 26068.0 Costly CnUs1068.0 6680.0 I111prnrelnpntll ImprnvementsI111prnrelnpntllThe ImprnvementsThe-1068.0 7748.0 26223.0 The extraordinary flltrlordlhnr126255.0 Bum sum26231.0 fi0aeeeea 26228.0 OOOOOO Is fs26235.0 being beingflxltlndell beingexpended 3088.0 26348.0 expended flxltlndell26351.0 b1 by26355.0 thl thu26360.0 ptupto 6528.0 ItOIloof -376.0 7032.0 lee -224.0 7476.0 York 26363.0 tor26367.0 pubU pubtlapubUIlultuYOlnonla pubtlattupruvemnents -344.0 26480.0 IlultuYOlnonla ttupruvemnentsttupruvemnentsfreWinstoaa -944.0 IlultuYOlnonlareWIDalo1I -940.0 8588.0 26623.0 5620.0 26751.0 reWIDalo1I freWinstoaa26763.0 oothlnlf Foothtamr7284.0 26775.0 fJrup Fyrup7732.0 26767.0 tot for26760.0 children cblldren7932.0 childrenteethlnqeoften -560.0 26880.0 tuthlnf 1028.0 teethlnqeoften 26887.0 lorten 6464.0 26883.0 tilt tlte26911.0 iumf ume reducer nre 7804.0 26891.0 InftamblAe loaaromaInftamblAelion -688.0 8540.0 loaaromatloaatlays 26991.0 lion tloaatlays 5688.0 aUaf -400.0 6256.0 27007.0 rain 27003.0 palntureeWind 27031.0 tuu -636.0 wInd coUe coltc27011.0 cabottle 7688.0 cabottleCrub 7976.0 27043.0 8060.0 bottleCrltb 27255.0 Crltb Crub6636.0 Urctlltrcl trrchardWater WterWaterIs -456.0 3080.0 27415.0 Is5668.0 27419.0 need 5564.0 27440.0 27463.0 anllrecommended recoDlmtDlhdbr by7596.0 Pbllrlanl pbTstrlane7544.0 allallover 3048.0 27571.0 over 27563.0 ins Ie 5964.0 6012.0 world worltS6416.0 one 27551.0 tbemotle 7236.0 meat reltable 8200.0 IU IUIIYo lama lamalives 3024.0 5460.0 27671.0 lives IIYo27667.0 audpuriaU1et purgatlve6032.0 Ill 7120.0 lure surela7864.0 27675.0 tLl7808.0 acUon acUonand 8484.0 27692.0 8244.0 noa 8232.0 noaand 2444.0 27787.0 27791.0 5728.0 haa ha5680.0 wundrful wunderful27795.0 curative curaUre7280.0 properUo pruperttoxmlns:ns10 ID12 10608 3148 8720 1252 ns10:type 3112.0 8736.0 1272.0 0sgUgll 8968.0 8988.0 oooat 9428.0 10072.0 1300.0 OOOOOooooocaooo 00000000000000C9520.0 OOOOOooooocaoooo -1776.0 11848.0 11736.0 8912.0 sgUgll 9484.0 10016.0 1552.0 lUAU 9532.0 10388.0 10176.0 10044.0 10448.0 10556.0 ATnE 10532.0 10960.0 -100.0 11060.0 11116.0 BRDW 11120.0 ORO -480.0 11600.0 11504.0 1580.0 11420.0 11728.0 o11596.0 oER 11852.0 11732.0 8TEUDUR 9064.0 ER 10004.0 TEUDUR 9272.0 iEH -684.0 10688.0 10360.0 1884.0 OUR 10292.0 10748.0 5UPREM EUQREMD 11436.0 DQ 11856.0 DBEEF 8740.0 2044.0 9384.0 2204.0 8864.0 9956.0 BEEF REEF9488.0 10392.0 PURVEYDR FllRVEYO110332.0 11312.0 8liE 8732.0 8812.0 8860.0 9628.0 liE 9668.0 10444.0 1IURbU 10248.0 10588.0 DRbD 10992.0 2788.0 uaoooo uaooooB 9452.0 uaooooS -924.0 9664.0 9632.0 9964.0 2903.0 noooocoooooooooo noooocooooooooooINIen -1876.0 11840.0 ncoaoooooWooooo0 ra 2680.0 9072.0 3156.0 9240.0 So 9160.0 9976.0 erica INIen9412.0 dcsthtecl 10376.0 -632.0 11080.0 10624.0 3164.0 Htlned 10524.0 11140.0 11328.0 stiller HnIHl11284.0 HnIHlnlted 11752.0 stillerHede 9124.0 Hede 10032.0 nlted 10576.0 States StntcR10396.0 11224.0 UB us11052.0 11580.0 3364.0 11396.0 thehhn 11816.0 thegre gre 9996.0 filer hhn9356.0 10380.0 of10284.0 10632.0 beef bact10520.0 11152.0 tor11572.0 thl11380.0 thleh -228.0 11800.0 thetivor 11784.0 9112.0 tivor eh chi9416.0 10264.0 10196.0 10428.0 flt 10584.0 10644.0 Soulh Sottih10552.0 11160.0 America mQllclt11084.0 AmericalIncrense 11804.0 11296.0 mQllcltJOIlunca 8720.0 lIncrense JOIlunca ortamice10672.0 fiR as10608.0 10912.0 rival rh110840.0 11348.0 11268.0 11568.0 tho11488.0 thoR theUnited 8756.0 United 10068.0 S9280.0 10240.0 10132.0 10404.0 producer Ilrollnccl10304.0 11176.0 of11428.0 bCCtbeefThere 11764.0 11432.0 bCCtU 8752.0 9276.0 9204.0 10060.0 9436.0 10220.0 tlJII10136.0 10500.0 Argentine ArSCIIt1nl10424.0 Imn I8rn11244.0 ImnII 11744.0 I8rnguny 4468.0 guny 9196.0 4504.0 nut 9132.0 9424.0 ny fishy 10364.0 1111 10636.0 10736.0 OOOOOQO i000000110528.0 11520.0 11448.0 emit emitale 11740.0 ltt lttIIllrll 2996.0 8760.0 4648.0 9052.0 amid 8952.0 9400.0 9332.0 IIllrll ullcd9440.0 10472.0 Slate Stllic11020.0 HOOOOOO 1100000010860.0 HOOOOOOrom -736.0 11756.0 11000000h1o 8768.0 4828.0 h1o 9308.0 tiny 9212.0 9724.0 9556.0 10164.0 4868.0 rom 9764.0 rang 10740.0 o10452.0 10956.0 tlll the10816.0 11276.0 VnltClIVnltClIJ VnltClII11788.0 Unitedf 9220.0 5744.0 9792.0 10148.0 RrGUAVAN 9860.0 10864.0 5927.0 11248.0 11088.0 10120.0 6156.0 ShR 11696.0 1064.0 11492.0 11360.0 ru 11540.0 9736.0 6404.0 10124.0 9836.0 jk 10180.0 9828.0 11676.0 9852.0 hSm1r1 -28.0 11704.0 9696.0 7112.0 8836.0 +8896.0 7348.0 Sm1r1 8976.0 7299.0 11C1riltc 9140.0 9180.0 nNb 9172.0 9508.0 7332.0 tx 9500.0 9512.0 9560.0 9596.0 9600.0 9780.0 10096.0 ce 9804.0 10344.0 7364.0 10228.0 StZ 2476.0 8900.0 7459.0 TtXAS rexs9404.0 ono 9492.0 ND 9652.0 NDSllItcs 9700.0 9720.0 7567.0 9732.0 9776.0 -40.0 9816.0 10084.0 7480.0 9824.0 10324.0 nrnmow 10160.0 10884.0 st 11232.0 7456.0 asSlntcs 11376.0 8780.0 7739.0 SllItcs Slntcs9244.0 7764.0 nae 1148.0 rrll 11008.0 lIud nud10512.0 11408.0 11I0rc uioro10896.0 11I0rcrCHhlltell uiororeHlrleted 7927.0 rCHhlltell reHlrleted4A 9864.0 l10112.0 ear 9892.0 8007.0 Iur 10480.0 7979.0 thN thert10348.0 10964.0 8019.0 nta10828.0 11304.0 11212.0 11536.0 1ho11444.0 SOllth9300.0 AuwrJ9216.0 10100.0 8167.0 coulltllcK cotuttrles10872.0 8179.0 IHIlUed nnntetl10792.0 11468.0 Yost Yostregions 11556.0 ust ustre re 8296.0 regions 8920.0 9032.0 louH 9328.0 9444.0 flllitAlI sultel10040.0 9868.0 10208.0 fOl10612.0 8356.0 cattle caltle10420.0 11252.0 rn18111 11044.0 rn18111whllh 11680.0 raising 8776.0 8452.0 whllh9348.0 Itll 9232.0 bnv 9624.0 010 9608.0 10116.0 8560.0 liS ns8539.0 yet 10268.0 10460.0 ct 10596.0 10712.0 hacl1utilized utJlIzClI2076.0 8671.0 9192.0 8699.0 cxas 8944.0 9304.0 8704.0 tUK 9536.0 9768.0 8711.0 time9848.0 8728.0 tIUlInolonger 10111cr11168.0 10111crlOlun 11780.0 longerroan 8784.0 8828.0 8884.0 roan lOlun8888.0 0119164.0 9284.0 kept 9576.0 8831.0 ji 9900.0 9844.0 8932.0 nnget nugcu9908.0 8916.0 hilt but10496.0 8948.0 arc nre8924.0 prnctl 11196.0 prnctlally 11716.0 mct mctcull 11664.0 9036.0 9040.0 cull 8852.0 ally 9044.0 IWlIt 9656.0 JJe 9616.0 10092.0 9099.0 lUittllCS nstres9888.0 10820.0 9108.0 grazing Iln2lug11056.0 9208.0 9228.0 grounds grouudK9231.0 9392.0 bet 9271.0 IdOIlCll tcloacd9912.0 10664.0 10908.0 miles milcH10808.0 11404.0 9320.0 111011 11300.0 111011mllcs 11768.0 111011Mlles Mlles mllcs9296.0 oft 9176.0 9872.0 9504.0 a9456.0 10108.0 9952.0 10144.0 trees 9496.0 tf 10464.0 9471.0 lho 11o10436.0 11148.0 9476.0 oll1tlmo 11024.0 oll1tlmocowho oltl tlmuo 11372.0 tlmuocowboy cowho cowboy 9256.0 9680.0 9352.0 10088.0 9676.0 9796.0 hlcoIIl becolne10156.0 largely 1ntHcl11688.0 9699.0 n11532.0 ncite 8868.0 9784.0 fcl cite 9056.0 9148.0 9188.0 9364.0 rhlN riderI 9940.0 110056.0 9831.0 Uolllng trolling9960.0 10684.0 till time10604.0 outside outaido10924.0 11612.0 of9968.0 9972.0 ffl 8804.0 8940.0 8908.0 10008.0 i5 llIeIollur fuelosur10052.0 10059.0 Hoe Heo10516.0 10024.0 thnt10408.0 10944.0 10028.0 10836.0 11288.0 10036.0 fences fcnccs11180.0 fcnccsnro fencesarc 10191.0 10216.0 nro9084.0 10203.0 110t9020.0 brol 10064.0 10231.0 IWI1 nvn9684.0 10243.0 nUt nud 10668.0 10800.0 10728.0 tilO11108.0 11484.0 10224.0 cllt ent11416.0 cllttIe enttie 8764.0 10372.0 tIe 9012.0 are8956.0 9312.0 1I0t9248.0 hlOII 9552.0 10379.0 110419.0 ln 9648.0 rayed 10204.0 10400.0 ell 10484.0 10431.0 01 or10488.0 10760.0 stolen tolell10708.0 11324.0 10412.0 Nnl1 11204.0 Nnl1cowho 11656.0 Alauy Alauycowboys 8772.0 10560.0 cowboys 9252.0 9548.0 10563.0 Ju inmlgrntcd ullgrtited10744.0 11316.0 10591.0 11100.0 SouthJmcrIel1 -436.0 SouthAmerica JmcrIel19564.0 Wh 9800.0 10308.0 10544.0 10772.0 1111010416.0 11032.0 10776.0 tlllcn taken10803.0 UI1 up11452.0 UI1thclr -184.0 10923.0 their thclr9200.0 10928.0 10936.0 r1e fret 10948.0 9808.0 IIlon 10080.0 alongside 10476.0 10592.0 8hlc 10963.0 thu10991.0 nn nnthc -176.0 nntive thc tive9136.0 gauchos cnllehoH9948.0 11163.0 9756.0 9988.0 10000.0 10076.0 11132.0 tho880.0 11136.0 wllteswcpt 10300.0 wide -880.0 10832.0 11156.0 swept pam 1I11mpampan 11692.0 11179.0 1I11mpnfl 8744.0 11320.0 pan pnflpnflIn 8996.0 panIn 2868.0 11480.0 Pl1rn 11483.0 Iaragun 9528.0 9644.0 11528.0 un 9812.0 10020.0 11535.0 t10188.0 Imgo10700.0 11511.0 region called cnllCllcnllClltlJe calledthe 11652.0 tlJe9060.0 Chllco Chaco9604.0 hns Ilan9524.0 9936.0 just jlHt10280.0 heln11700.0 OllCllld opened10628.0 11332.0 tip 11240.0 11384.0 11604.0 11711.0 xmlns:ns11 ID13 3544 3064 8676 18147 ns11:type 1108.0 9588.0 18147.0 TICS TEXAS18152.0 COWDor CotvnorCOWDorL -608.0 10696.0 COWDorstock Cotvnorstock 8700.0 18303.0 8688.0 18396.0 stock 18399.0 rnlsln 9692.0 9928.0 18420.0 10192.0 18411.0 Ues 10572.0 10844.0 11208.0 north northwest 11624.0 18592.0 18596.0 west 9104.0 18615.0 cOlllcr corner9636.0 18599.0 of9572.0 9856.0 18604.0 Paraguay luraguay10720.0 between betwcen11440.0 thelIrlljuny 11672.0 the1aragutty 8692.0 18764.0 1aragutty 18795.0 lIrlljuny 9516.0 Hhw ttiver9408.0 10048.0 18820.0 lL a9904.0 18815.0 ll 10252.0 navigable 10328.0 10536.0 lg4blo 10996.0 strcamtho stream strcam-520.0 streamtime 18947.0 tho9008.0 rlleolllIo Pllcomnyo9840.0 18971.0 River ltICl10256.0 10616.0 11028.0 18964.0 Bolivian Bollvll1nBollvll1nbounl1nr -640.0 11668.0 Bolivianboundary 19128.0 bounl1nr boundary 9612.0 19152.0 fhe19155.0 climate cllmata9880.0 10932.0 19147.0 healthful healtbrul10804.0 healtbrulnull -696.0 11628.0 healthfuland 19319.0 null and19324.0 though 8960.0 thou 19331.0 9368.0 9832.0 19343.0 9744.0 wnrm warmm10580.0 therc11068.0 la10976.0 19364.0 sum sumssumIner 8684.0 19507.0 19524.0 Iner ter9068.0 9224.0 19515.0 19547.0 never neer9340.0 as19531.0 19559.0 10752.0 19552.0 10704.0 19519.0 Now 11264.0 NowYork 19679.0 9128.0 19691.0 last Illst9048.0 9464.0 19736.0 IIUUllller summeriThl 8824.0 19867.0 Thl19888.0 prairies prnhlls19936.0 lire are19900.0 clothed 19891.0 10716.0 19924.0 a11164.0 va varlety 11608.0 nrlet 20056.0 rlet rlety ofgOOlI9788.0 JrRsses 20119.0 grasses 10340.0 nndtho10756.0 11200.0 Obacolnntlfl Obaco ChacoChacolands 20232.0 lands lnntlfl20284.0 ore nre9076.0 1056.0 20263.0 acknowledged nelmowledged9376.0 20272.0 be11040.0 20267.0 10972.0 11352.0 best 11280.0 besttnttenlnJ bestfattening 20420.0 fattening tnttenlnJ20484.0 Hroulll 20463.0 20496.0 nU all10868.0 ParaguayGooll 11616.0 ParaguayCool 20611.0 Cool Gooll20616.0 IlIlId Innd20663.0 lan cnu20644.0 hobought 9984.0 20639.0 20635.0 Chaco Chacotor 11660.0 20632.0 Chacofor tor20804.0 1000 20844.0 9360.0 9568.0 20816.0 league INIue20835.0 20860.0 20820.0 lenguo11368.0 11308.0 willImlJllort willsupport 20995.0 support ImlJllorttOO 10021016.0 10212.0 21020.0 10988.0 21007.0 herds herdll21004.0 of21159.0 9096.0 21176.0 each ClIch21220.0 cnn can9420.0 21199.0 be9760.0 fattened tattcnell10852.0 21223.0 11124.0 21192.0 11336.0 21187.0 111 lu11472.0 nellr nsear 8676.0 21359.0 sear ellr 21423.0 9716.0 expenses Ipenses21383.0 oC of10764.0 mlslnltcat ClltClltI 21627.0 xmlns:ns12 ID14 240 15068 9948 ns12:type 15068.0 10104.0 xmlns:ns13 ID15 772 3052 11900 11128 ns13:type 12392.0 11128.0 TIIl TIIE12892.0 11139.0 TIAS 12780.0 12896.0 1I -616.0 13512.0 13148.0 11144.0 XAS 13076.0 13640.0 11151.0 mlIIOD MflIIODMflIIODcan 14440.0 13732.0 mlIIODcan 11904.0 11560.0 12236.0 cnllI 12164.0 easily 12576.0 12764.0 he 12680.0 13000.0 11544.0 hlotlht hrouglmt12928.0 13672.0 11588.0 13596.0 13920.0 11563.0 13852.0 14136.0 tho14060.0 14444.0 singes rlinges14372.0 rlingesof singesof14952.0 11900.0 12136.0 12056.0 12176.0 12208.0 hl 12376.0 12448.0 11720.0 CImco 12344.0 hnco 12916.0 trout Crom13452.0 tho13360.0 13772.0 Brazilian Hrl7I1I11113684.0 14560.0 1110 14464.0 11772.0 pray 14796.0 xmlns:ns14 ID16 244 2232 8980 25308 ns14:type 8980.0 25308.0 25315.0 THe THI25336.0 GLCiS 25343.0 GIUCi -844.0 10244.0 25371.0 11CTltOD 10540.0 25376.0 fyHOD xmlns:ns15 ID17 3012 2960 8704 26508 ns15:type 8708.0 26508.0 tic tie9000.0 26520.0 26575.0 nre26560.0 ridiculously 11t1leulouely10780.0 26523.0 small smnll10676.0 26555.0 com comecomlllrctl comepared 26703.0 26708.0 lllrctl pared26723.0 9116.0 26739.0 26783.0 expense cxIJcnSe26748.0 26731.0 UnitedSlntls UnitedStntca Slntls Stntca26951.0 mnu nlaa9472.0 9932.0 26979.0 canput 26927.0 steers 10548.0 26935.0 11072.0 11424.0 thlthllnnge thernuge 11640.0 8712.0 27080.0 27091.0 lnnge rnuge27087.0 9120.0 27099.0 InrnfU1r Inraguay9336.0 10236.0 27127.0 nIl allexpenscs11292.0 paid paidnt paidat 2948.0 8716.0 at8936.0 27291.0 a9080.0 27287.0 cost CORIof9704.0 27303.0 27307.0 80 9772.0 27323.0 27355.0 bond head10952.0 27280.0 10900.0 these 27263.0 hecnn hecan 27451.0 can27480.0 sell 1l when tvbea27491.0 27483.0 11096.0 1250 123011464.0 ahentl ahead 27619.0 head hentl9268.0 27647.0 Etprlcnce ExperleucedcaUll10152.0 men 11188.0 27651.0 11092.0 27631.0 thothoOhaco theChaco 27803.0 Ohaco Chaco27827.0 lJlle9156.0 27847.0 cleared clcared27883.0 al aa127852.0 much 11000.0 27867.0 us as27819.0 45000 11172.0 45000I 27815.0 5000 10276.0 28223.0 128387.0 71 29443.0 z xmlns:ns16 ID18 6728 3156 11928 1216 ns16:type 12032.0 co coI 1756.0 12000.0 1316.0 12036.0 12064.0 12232.0 12360.0 1328.0 first I1lst12664.0 12944.0 lm 13264.0 13116.0 13572.0 1388.0 an13440.0 1196.0 13880.0 ex1emllture 13968.0 XIHII1It -832.0 14800.0 14556.0 uro 14536.0 14928.0 1404.0 15076.0 15020.0 15000.0 11984.0 1504.0 SIO 810500 12240.0 12452.0 1520.0 12528.0 12904.0 12532.0 hey 13044.0 glut Imt13164.0 13624.0 III13524.0 13856.0 1556.0 S1000 13760.0 13964.0 14272.0 14380.0 14276.0 14700.0 land Innlt14604.0 11980.0 o0 12168.0 iOO 12404.0 12516.0 CorlItUo -788.0 13304.0 rattle 12744.0 13416.0 nlul tint 13688.0 13804.0 410110 13912.0 1748.0 1O 14228.0 14680.0 14568.0 lahot 14803.0 14827.0 1101 15044.0 mill 811112380.0 otllCl otiiet12268.0 12920.0 1928.0 lopcnRas12760.0 13860.0 lhln 13600.0 Ltving 14256.0 14480.0 1960.0 unll14363.0 14876.0 lit14752.0 14880.0 IIIJOI 15004.0 11996.0 2064.0 boy 12028.0 2100.0 JOI 12312.0 in12216.0 12540.0 Pa12876.0 IEUII 12728.0 13184.0 13372.0 13296.0 13752.0 2112.0 nhout13676.0 14264.0 onNhl1t oheeightonNhl1t11M oheeightna11988.0 11M na12280.0 11lh 111ueh12152.0 12840.0 2304.0 its12692.0 13128.0 12996.0 13132.0 13464.0 13592.0 13344.0 13904.0 13768.0 14168.0 UIl14036.0 14540.0 tul tni14408.0 14996.0 14808.0 2380.0 15080.0 15024.0 11992.0 StnllH13124.0 Jlttllhos13008.0 13872.0 nro13756.0 11111114116.0 14755.0 14992.0 n1II01llh 15072.0 15052.0 2640.0 1II01llh utonllt12580.0 2648.0 JI112468.0 12848.0 thu12736.0 13196.0 Chura Chaco13084.0 Iii13668.0 14188.0 tho14068.0 14764.0 item 14420.0 14852.0 flll 15012.0 15028.0 HIli Slates 12220.0 12248.0 hi 12544.0 2840.0 12548.0 12584.0 12616.0 12688.0 12864.0 coho 12868.0 13356.0 13500.0 1i 13568.0 13664.0 wages wnJls14224.0 mil use14128.0 to14900.0 15064.0 14976.0 11976.0 4311 12224.0 12336.0 a12132.0 12552.0 nn12428.0 12792.0 3023.0 11th 5th12676.0 13308.0 3040.0 Jho 1Iie13032.0 13792.0 3063.0 gaueli 13888.0 nuch 14696.0 food 14244.0 foodwhIch foodwblch whIch wblch12536.0 12436.0 RUI1IJllel sulpllcd12652.0 13480.0 13380.0 13712.0 him 13620.0 14472.0 Ii 13996.0 14628.0 allOlIt abcu3288.0 15048.0 11972.0 4ti 12096.0 3396.0 month 1II01ith12324.0 3412.0 COhO Cotvboys H 14316.0 furnlslwlt turntshcd12464.0 footl12320.0 12808.0 costin 12772.0 costing 13244.0 13420.0 410 13352.0 13519.0 at13680.0 nth 13832.0 nthlhl 14416.0 14172.0 nthVIie lhl VIiecnt110 atttle12964.0 of13188.0 Northet 13120.0 13316.0 orthel 14100.0 lIln arngnay 14336.0 14460.0 ulI 14728.0 14791.0 nro nrr14624.0 flmllm Hlniiltir12612.0 te 12512.0 12712.0 12860.0 tho12656.0 1cxntJ 1exas13096.0 13908.0 lUll tttk14368.0 IIlln of14772.0 fllll fully a84152.0 12588.0 12788.0 oolt 13040.0 Rlock13036.0 13764.0 01113548.0 14052.0 4188.0 mulch13940.0 14580.0 tllll 14468.0 tllllnnll toturf 11964.0 nnll 4352.0 none molo12888.0 lIIHII 12756.0 12972.0 118113 13224.0 13468.0 m13324.0 caged 11111114436.0 4376.0 Thou 1hOIl14160.0 14924.0 laj 14812.0 14972.0 4440.0 15084.0 thl1lUre12348.0 note 1I0W13208.0 11113100.0 13456.0 13584.0 4576.0 13660.0 IllU uru14268.0 IIItIIUII Inrtiruat14152.0 IIItIIUIICIIII 14904.0 Inrtiruatonly 11952.0 CIIII only 12400.0 l1ollJh cuough12284.0 13064.0 4715.0 mUlo12936.0 13616.0 fo to13488.0 13947.0 it4752.0 Hlllnll Htlutll14040.0 11960.0 hu1l1RtrJ hidtistry12716.0 tlwll thole12596.0 4908.0 IIUlllhlIH miili1 ms 13884.0 IIrorlllldlr rtipldly14120.0 14892.0 If14736.0 5012.0 elIIRluJ 12040.0 yrasln 11111 8111112488.0 13140.0 In13020.0 13396.0 tlllc three13272.0 13892.0 13788.0 14156.0 5115.0 ro 14048.0 14304.0 5152.0 14488.0 14456.0 11948.0 5235.0 tills tllJH12300.0 5248.0 1olonhiliM hhtIH13216.0 Clllr fair13144.0 13496.0 13780.0 13708.0 14004.0 tJll13932.0 thea cut1o 14616.0 rcms11928.0 5388.0 5456.0 a12120.0 great 12024.0 tllIt hc 12768.0 13016.0 IIIIIuHU industrytulrc 14864.0 ofitintn 2136.0 12080.0 Ihat 12804.0 12832.0 12940.0 5635.0 needed 5640.0 h11 13460.0 itintn 13816.0 11940.0 tie 12008.0 12432.0 IMln 12092.0 13776.0 lIh00Il111 13868.0 bent 14348.0 14432.0 14732.0 Cl1t cnt14664.0 12260.0 5836.0 12924.0 11I tidl 13048.0 tidlF 13200.0 13232.0 itfu itfuor 13704.0 1292.0 13720.0 14008.0 111111 lLilt14284.0 5944.0 ofofheat 11936.0 12148.0 ragtiny 12012.0 12412.0 6020.0 12296.0 nett 1036.0 if 12128.0 13056.0 6127.0 13060.0 1l11 OIillet 14164.0 14640.0 heat IIlOt12004.0 12048.0 ir 12496.0 lIO IO 12696.0 12812.0 pxtCuslon exteuslon13656.0 13536.0 13935.0 railways lnllwlIS1U1I114592.0 1U1I1tho amidthe tho12304.0 hllrLnHl fuerenno12184.0 ofriver Ihr13192.0 navigation lInI 14596.0 14216.0 6487.0 ntlnu 14108.0 14720.0 thlH th1HthlHlnn th1Heon 6647.0 eon lnn12316.0 readily 12212.0 rCIIIII 12844.0 12948.0 heobtained 13284.0 13404.0 tnlnlII 13864.0 JIIi 14387.0 6676.0 tho14724.0 6687.0 cnt11956.0 tit tieof12504.0 tholittle 12740.0 Interior Intorlol13204.0 13988.0 republic rlIHlhllc14608.0 join 12800.0 7012.0 thoIU1dH herdH13028.0 13644.0 13544.0 tlw13808.0 14232.0 7047.0 Argentln ArgenthieArgenthiefind 11944.0 7172.0 111111of12648.0 Uruguay U1ugulI13736.0 7219.0 fur11llhln furnishing -700.0 14760.0 thathewant tharelnHt 7376.0 want relnHtbce 12988.0 of011113628.0 13492.0 Englauld -516.0 13944.0 7404.0 llIIu1 thothoworlll 14988.0 theworld worlll world12480.0 7548.0 in892.0 7572.0 competition conipetltlontvltla13604.0 14148.0 7607.0 UnltllI14375.0 7724.0 Htnto StatcH12704.0 Excellent Bxecllent7767.0 stocking IIfjloeklnH13436.0 cuttJc14312.0 xmlns:ns17 ID19 7188 3104 11836 11904 ns17:type of11911.0 into utto13136.0 11920.0 Grosso Crosso13024.0 11923.0 13652.0 14384.0 adjoins ul1Joll1sul1Joll1sthe 14940.0 adjoinsthe 11892.0 12088.0 Iarnguny 12100.0 11Un 12960.0 12123.0 uu 12572.0 13052.0 border horllol12856.0 horllolCntUo 13552.0 borderCattle 12271.0 Cattle CntUo12592.0 dlsenscH dlseaises12492.0 13320.0 12288.0 lime Iho576.0 13916.0 12295.0 favored fn01clilams l11HI14492.0 l11HIot lamsof 12455.0 of12140.0 Inrnut1 Pnrnguny 12500.0 nro12880.0 13280.0 12476.0 seldom soldom13900.0 12508.0 seen IIcenthe110lth 14932.0 thenorth 11896.0 12640.0 110lth12368.0 12643.0 tlllX they12683.0 nro12700.0 13072.0 12660.0 u11I11on uukuow1113004.0 13984.0 12668.0 In14140.0 14520.0 south Houth14452.0 southone 11888.0 12815.0 12852.0 011012831.0 occnJloll1I1 ocensionally -828.0 13068.0 12871.0 rUIIII rtes13172.0 neross13608.0 14280.0 cases 14779.0 ofothlllcl 14784.0 ofhlaclc hlllcl hlaclc13012.0 leg 13055.0 hut butlou even13612.0 13027.0 thclI13540.0 14012.0 13031.0 ouly14411.0 among umongamongcalves 13067.0 umongcuhcs 11884.0 13191.0 calves cuhcs13203.0 nud13231.0 too 111013312.0 13227.0 lelCtmtu 13180.0 percentage 14076.0 13255.0 13220.0 of14572.0 suchcases 14576.0 such 14916.0 sucheUl 11880.0 13384.0 13412.0 eUl 13408.0 12076.0 es 12272.0 12564.0 13415.0 neCr ilevrralarming nlnrmlng13976.0 13403.0 loss Iossof14320.0 14644.0 14564.0 eattie 14872.0 13424.0 uttIo 13560.0 tIo12144.0 owing oWlrlJ13580.0 12608.0 tho13212.0 of13516.0 13824.0 winter 13744.0 or14332.0 13627.0 adr adry 11876.0 dry dr season 8cnson12732.0 unlmowlI tmkuotvnunlmowlIIt tmkuotvnIt-704.0 2848.0 12016.0 12620.0 ho13975.0 HeCll13951.0 thntNorthern Northcru14500.0 Fura PztraFuragtln Pztraguny 14860.0 14144.0 gtln 12252.0 12460.0 on12824.0 ideal Idenl12724.0 14132.0 place llnee13176.0 Cor14064.0 tlJl13980.0 14396.0 14147.0 14300.0 raisingor raisingof11864.0 of14307.0 nttlc12836.0 As 12204.0 13152.0 14328.0 3et14323.0 of13392.0 course cotlrSC13728.0 theseSouth 11872.0 American AlIlcrlclln12308.0 14504.0 1111013800.0 1I0t14252.0 thothofl1cllltles 14920.0 limofticllltles 11868.0 14667.0 fl1cllltles fticllltlestor12932.0 14695.0 trmU trnnsportntiou 13336.0 lJottntion 14684.0 14707.0 t1O t1Ou 14740.0 io ior 12228.0 14947.0 14935.0 12292.0 14883.0 Unit 14888.0 Ktn Htntrmt Htntrmtpossess 14919.0 Rpossess possess 15039.0 butt12424.0 13156.0 15043.0 13276.0 13812.0 15079.0 13716.0 gwisln Cuesl1 14656.0 15055.0 oftlrnl 15015.0 oftime tlrnl15220.0 whcn15224.0 13256.0 wlll will13648.0 15232.0 1Iao14112.0 15236.0 them 14016.0 15243.0 nndnndthcu andthen 15403.0 thcu15436.0 12196.0 15408.0 tllO15415.0 StntcH15420.0 hold holl1ItaItaown 14912.0 itsown 15587.0 15620.0 12276.0 lu time12408.0 15603.0 export 13376.0 of13300.0 15596.0 heet15608.0 Just 15639.0 15636.0 nown nowa15772.0 15808.0 a936.0 comhluntlon coulbiuntlou15784.0 ofcapital cllpltnl14088.0 13959.0 15792.0 said snhl14204.0 14776.0 15799.0 tohave 11860.0 15959.0 1111015992.0 nec1utc ncqulccd 15963.0 practical prnctlcul15971.0 control conhol13724.0 14424.0 15980.0 time14584.0 theTCXI1f1 timeTcxna 16144.0 TCXI1f1 Tcxna16147.0 Cl1ttloIndustrIes ludustrles12872.0 16159.0 If16156.0 this tl1l1116187.0 coot cootbinntlon 16192.0 comhlnntlon 14868.0 hlnntlon binntlon12628.0 should 8110ull116347.0 16368.0 13924.0 16340.0 16344.0 price Irlco16352.0 ofbeef 14767.0 ofhect 16516.0 hecttnert12748.0 16519.0 16523.0 13400.0 16556.0 13472.0 nunttltlonnl ndditlmal13748.0 iu14612.0 Inccntlyc 14848.0 iucentive ccntlyc centive16704.0 tor16700.0 thodevelopment doclopl11ol1t16719.0 of16716.0 tHe tHeSouth theSouth 16879.0 16884.0 12384.0 Amcrfcnu Amnollcnn16891.0 cnttla13108.0 1111ulltr108 intluHtrics13632.0 16900.0 Time fheTimeSouth 14896.0 fheSouth 17064.0 17067.0 Amerlcnn17072.0 field 17076.0 17112.0 17116.0 zipnpIlenlln 14844.0 zippealing 17251.0 pealing Ilenlln17263.0 12816.0 17255.0 cntt1c12684.0 17288.0 turn rucu13828.0 17260.0 14092.0 a17295.0 manner manUlrmanUlrwhich mannerwhich 17436.0 17439.0 lrornlllclI promises17444.0 tbe13432.0 17476.0 mar mot13364.0 Important huportnnt13696.0 14704.0 17484.0 rc14636.0 rcsuits 14708.0 resuts 1240.0 17604.0 suits suts17620.0 ultimately ultlml1teb17623.0 ultlml1tebOhellpncrf -784.0 ultimatelyCllettpness -760.0 Ohellpncrf Cllettpness17815.0 ofproductfon productio1114024.0 17820.0 14524.0 17823.0 thelcthereis -384.0 14908.0 thelcIs 17987.0 12044.0 18023.0 an17992.0 especial el -596.0 12900.0 leclnl 12420.0 12980.0 17996.0 Inducement 18004.0 13876.0 17999.0 investors InestorHInestorHOno -692.0 investorsOne 18175.0 18180.0 Ono Onetoes does18187.0 12624.0 13092.0 18183.0 naCd13564.0 18192.0 I1na18223.0 l1el1tl1el1tdenl 18208.0 greatdeal 18359.0 deal denlof12180.0 12484.0 18392.0 mone money 12884.0 18371.0 12976.0 13268.0 18375.0 start Htnrteither 14056.0 18383.0 ItIs -132.0 Itis 18580.0 pIneo18547.0 18583.0 a12992.0 poor loor mllU18587.0 18575.0 account nccountnccountot accountofof12112.0 tho12444.0 18731.0 low 18759.0 WnjeK18735.0 18771.0 13956.0 18768.0 intuit lUan18743.0 Ith 14820.0 a18783.0 neupltnl acapital 11836.0 18912.0 eupltnl12456.0 18919.0 of12352.0 12796.0 18915.0 2500 500 has13588.0 an18924.0 excellent op 14660.0 xmlns:ns18 ID20 1564 3120 11804 26407 ns18:type 26407.0 11808.0 portuntty portunity26515.0 lay 26511.0 thafoundations CountlntlollB26527.0 of26551.0 afortune fortune fortuneMany 26671.0 Mllnypeople Parngunyl1avo14496.0 26903.0 gom11 gom11cnttle 26899.0 goodcattle 14856.0 27063.0 cnttlell1uds12956.0 12776.0 27071.0 14080.0 27108.0 tostock Istock 27247.0 thcm13168.0 27251.0 13088.0 27259.0 27267.0 willsell 27427.0 27435.0 12124.0 cheap chenp27431.0 12568.0 27447.0 grentle13952.0 demand 14632.0 tortormoney formoney 27615.0 27623.0 12644.0 invest Incstlu13104.0 ranching rnnchlni13328.0 27635.0 14104.0 PAra PAragUilT Paragun 27835.0 gUilT 27831.0 gun 12192.0 12084.0 but27807.0 cnvltllUsta capitalfetecommand comwl1ndxmlns:ns19 ID21 4336 3704 15148 1388 ns19:type thtlr15664.0 OWll15604.0 rJlC8 rlecs15972.0 16652.0 nru116544.0 1356.0 16991.0 ometlmes Hometlmea17871.0 get tet18176.0 nB an18107.0 15231.0 hlh Idghi15671.0 nhlrty 16027.0 1624.0 WrtJ 16428.0 16536.0 16395.0 16792.0 1644.0 fort 16692.0 16796.0 forty 17080.0 17296.0 per PC117180.0 17636.0 cett 17532.0 18104.0 tor17960.0 15219.0 tlwlr15804.0 oi olin 15916.0 16407.0 1816.0 CnlrJlll Carrying16068.0 1112.0 17220.0 forclgl3 forelgr17892.0 1872.0 cnttJu cnttlu17763.0 15520.0 16080.0 1996.0 AmcrJen15956.0 16852.0 16720.0 17104.0 cross cro117612.0 wJlh17496.0 18080.0 tine tho17956.0 15240.0 2180.0 n904.0 15384.0 mtltbrecds 15276.0 15388.0 16288.0 2172.0 hlcedH 15611.0 2188.0 IH Is16527.0 already nlreudJ16472.0 17172.0 n17323.0 2220.0 bIg 17256.0 17624.0 2224.0 IJURhIlSH 1lusbless17564.0 15416.0 hull lieu15812.0 thu16164.0 native nntlu16056.0 16760.0 breeds 16868.0 2400.0 tcdl 17380.0 IIl17736.0 Fosse17619.0 18136.0 2432.0 cd 18116.0 15228.0 15707.0 2576.0 at15580.0 15932.0 foreign tOIhn15796.0 16596.0 omie 16476.0 16600.0 16864.0 16988.0 tho16772.0 17356.0 cattlo 17227.0 cult 17780.0 17904.0 2644.0 grow lOW 18299.0 15204.0 illlllt largetnUll and16204.0 attain nUnln16084.0 16788.0 uncle thoh17275.0 lull full17156.0 17655.0 develop doololl17536.0 15180.0 15360.0 ent 15248.0 RoonCI HoouerRoonCIJlllt HoouerTimm 940.0 Ilent Timm 15472.0 Jlllt 15719.0 3124.0 glont16268.0 lnnd16200.0 of16895.0 16828.0 enl 17148.0 tlo 17120.0 17416.0 3188.0 rnn ranges 17847.0 17912.0 18035.0 3176.0 tho15336.0 IgmHhw rgenthmetclnrhlJc liepubilc15976.0 16844.0 3324.0 16732.0 16847.0 16883.0 3360.0 IIH nH16960.0 17268.0 Inlgo17196.0 17720.0 17652.0 17928.0 urea mpn17856.0 15284.0 s15468.0 hentnky JcnhI 16236.0 1ennessue cnncNRu -672.0 17272.0 17516.0 All1hnnut Alatbanma17192.0 IIsKlssI11I t1SSiSSipl16244.0 3680.0 roulsll1un louisiroul16039.0 17212.0 3708.0 loxnH 1exnH17844.0 OIlu15176.0 Roma homll15800.0 ontl1lm mlontnnn15584.0 1Vyomhmg 16431.0 16604.0 W -756.0 17359.0 OI11IrIJ 16776.0 17520.0 3904.0 Colorado CoIorndo17308.0 CoIorndoow 18196.0 New 15308.0 ow 15524.0 15640.0 hxlco ifexlco16332.0 AI1ouu Atizonn16172.0 17096.0 Ulnh Utnh16919.0 Nevada Nomdu17460.0 15171.0 4196.0 Idaho Iuho 15764.0 WnRhlu Nasldngton -576.0 16460.0 ton 16684.0 16840.0 O1l Oregon 17108.0 17215.0 17388.0 17492.0 timid17876.0 CuIt Cuil15168.0 fOlu1I fortilutogether tOlethel15623.0 16484.0 timid16356.0 16764.0 how Ulllth uluclm17164.0 17748.0 ur of4460.0 tho17907.0 tholollntl 18232.0 thecountry 15148.0 lollntl country 15656.0 4612.0 15744.0 15828.0 MIII still15712.0 ICl11nlrlH remnina16116.0 nuJluhllJ 16816.0 17600.0 17184.0 liable 17691.0 17751.0 4675.0 17984.0 ox cc17880.0 15183.0 4755.0 15272.0 R1tatiou 15872.0 15952.0 irony U1n be16572.0 4795.0 JUd 16515.0 Judgrd 17012.0 17168.0 front 17100.0 17244.0 10111 17524.0 17608.0 time17528.0 4835.0 filet fact17840.0 filetthnt 18215.0 facthint 18751.0 3556.0 15192.0 hint thntolr 15504.0 onft 15856.0 15996.0 4964.0 J1j 16120.0 16220.0 4984.0 91t 16404.0 4980.0 tRlx 16548.0 Aix 16916.0 5020.0 POI percent cnt17160.0 of18028.0 tty 18032.0 5016.0 ItJOOOOOOO 18119.0 15288.0 JOOOOOOO 1000000015252.0 16104.0 acrclJ nercu16020.0 16584.0 16503.0 oI1III 16740.0 16823.0 nlll 17044.0 5188.0 civmljrTe 17424.0 5184.0 lIJrJ1JTo10l lIJrJ1JTo10llIJrlcultllreIiOOOOOO 18236.0 18016.0 lot lotngrlculturo1000000 lIJrlcultllreIiOOOOOO ngrlculturo100000017032.0 rmciesIs 16940.0 17036.0 5380.0 11l -668.0 17703.0 5392.0 ICNIH 17203.0 under underlnIthutJon 18263.0 undercnllitatlon lnIthutJon cnllitatlon16232.0 lho16587.0 mine volume16512.0 17060.0 of16996.0 17284.0 animals unlultIs17224.0 andxmlns:ns20 ID22 2780 3084 15108 10083 ns20:type 15140.0 10083.0 tlwhII1ol111etH productH15508.0 CXlOIted expmted16240.0 17088.0 17124.0 tho17676.0 Ar 17588.0 Argen 17868.0 Argenthin 18056.0 ntluo 15136.0 thin tluoluorcnsoH hcrenses15428.0 16280.0 at16212.0 10283.0 16436.0 10296.0 rate rnte16748.0 17200.0 of17428.0 uhollt115124.0 000000 10499.0 ft15676.0 15884.0 cnl 10471.0 Urugllily 16320.0 UIu -664.0 17000.0 10508.0 lIar 16888.0 17448.0 thollJh tilougitit17976.0 aeom1 18191.0 itcanlparntlvely 10652.0 eom1 canlparntlvely 15492.0 10680.0 -724.0 16228.0 15544.0 nrl1t1l 16316.0 10656.0 I1lI1nll10692.0 16724.0 10659.0 uution 16979.0 17003.0 tlOI1 17419.0 hllR tutsexcelbut excel 10831.0 lent but15628.0 tu1ln 16099.0 10843.0 15991.0 16308.0 lOUlUIR 16972.0 10848.0 nud17352.0 17232.0 17772.0 yearsago 18184.0 10892.0 cml cmln 15120.0 11031.0 11048.0 15195.0 15312.0 15496.0 wn 15896.0 reported lOlwltol116636.0 11064.0 asllnving hnln 17504.0 fSS11Oi 17320.0 fSS11Oihead 17648.0 SSIO SSIOIwall 18100.0 11203.0 Iwall15556.0 of15484.0 enttIc15716.0 16292.0 11243.0 Oil on11216.0 16464.0 lnuglol16728.0 17431.0 11259.0 17299.0 17596.0 11228.0 ntllUhlt nunmlmrntllUhltwhleh 18179.0 nunmlmrwhich 18160.0 15116.0 11388.0 whlehhits hll911400.0 Il1clenscli ihcrensed16060.0 cousldarnhl cousldarnhlsluce 18071.0 976.0 considerably considerablysince -976.0 15112.0 since slucesluceSouthern 15500.0 sinceSouthern 2884.0 11763.0 Southern Brazil Bmzll15948.0 16632.0 johns jolUR16532.0 17584.0 time17472.0 17932.0 11791.0 AI Ar17816.0 AIcnthw Argeuthaer 15108.0 11951.0 geuthaer 15207.0 cnthw 15736.0 PI1nJun Parnguny15680.0 11991.0 tutu 16628.0 11963.0 17208.0 17048.0 Uln 11968.0 hlIncomJJotln 18172.0 hlcouipethng 12135.0 comJJotln couipethng15908.0 16443.0 tlloVnHocl Unheml16676.0 17383.0 12156.0 StnhlI17952.0 12160.0 fOl17852.0 fOltho forthe tho12323.0 cllttlu15340.0 15968.0 12328.0 trade trnde16592.0 12332.0 16364.0 the17176.0 State Stntc17084.0 17664.0 tit17572.0 12340.0 Hlo ltloltlorntulo HloIlIndo IlIndo rntulo15780.0 12511.0 do16063.0 Sui Sul16419.0 tho16300.0 16756.0 12520.0 cnttloh1l1ulitr hmduslry 12560.0 17936.0 18047.0 12523.0 IN isINnlrcndy 18052.0 isalready nlrcndyImpollnnt lutportant15700.0 rl111 rud16620.0 12708.0 groWlll growing17368.0 xmlns:ns21 ID23 120 1956 15572 21487 ns21:type 1956.0 15572.0 SOUTII AlIEnICL AMLnICAN16936.0 OAUCUO xmlns:ns22 ID24 7696 4104 15008 21747 ns22:type 15040.0 21747.0 21764.0 every ovcry15552.0 21771.0 yenr1ho15904.0 16488.0 16400.0 17376.0 21767.0 tn favorable favorablefor 17631.0 21776.0 ornbIu ornbIufor 21919.0 21927.0 cnttlc21931.0 rnl 21936.0 lng 16440.0 16575.0 labor 17068.0 21947.0 17287.0 21952.0 cl1cnl17828.0 21959.0 unll17727.0 21964.0 unllIhlng 18112.0 andliving 22099.0 Ihlng22124.0 costs COstR15488.0 16075.0 22119.0 1Itt1 22131.0 compared compnred16448.0 17400.0 22136.0 wltll17859.0 lh liv17744.0 lhIn livlu 22287.0 22319.0 15144.0 15279.0 15659.0 16012.0 Unltcd15900.0 22315.0 Stntes22324.0 Tnr1l1 Lnncl17883.0 Cor17760.0 Corcnttlo forcattlo 22475.0 cnttlo cattlo15563.0 22484.0 15476.0 16188.0 22519.0 purposes llrp05e116952.0 22531.0 enn17304.0 22508.0 he17576.0 hOlllht bought17480.0 hOlllhtlow boughtlow 22651.0 15440.0 22668.0 nnd15852.0 22684.0 ports Ilorts16372.0 22679.0 tor16804.0 shllllnj shipping22699.0 17467.0 cattlenbronll cattleabroad 22844.0 abroad nbronll15647.0 22884.0 nro22891.0 easy cny16388.0 22868.0 of16312.0 22903.0 22875.0 accessNeer 16708.0 16799.0 coBS 22908.0 22915.0 17500.0 17724.0 22887.0 17628.0 YorkPress 23028.0 15635.0 23251.0 15364.0 23383.0 At Ap23388.0 AmerIcan 23404.0 Olrl C1r116892.0 Snng 16712.0 SanKFrol -348.0 SanKFrolA -716.0 Frold FroldA 17708.0 23543.0 23555.0 remarkable rcmnrknblc15292.0 23567.0 16264.0 instance 16580.0 23571.0 tnuce of23611.0 sang 23588.0 fmDJrrohl fmDJrrohloccurred 18092.0 fro10 fro10occurred 23736.0 occurred 15768.0 15984.0 23743.0 Paris 15912.0 a16392.0 16608.0 23755.0 few rcw16539.0 days dnY823804.0 17452.0 23811.0 says eoyseoysthc saysthe 15036.0 23908.0 the15344.0 23919.0 FarIs23927.0 Messenger Mcsscnger15748.0 23951.0 16640.0 fire 111016955.0 17347.0 23955.0 broke blole17775.0 outabout 18095.0 24111.0 24143.0 a15616.0 24155.0 ahouse housoof16948.0 17239.0 24139.0 17548.0 24148.0 Squaro Sgttaru17552.0 24151.0 Squarocle 24279.0 cle le 15200.0 24287.0 lOpcrn 1Opern24308.0 Long Ioug15864.0 24311.0 before betoro24327.0 24324.0 24359.0 17560.0 arrival nrrlnlnrrlnlot arrivalof18088.0 24471.0 of15267.0 24475.0 15188.0 firc24487.0 brIgade 15836.0 16563.0 24499.0 tho24503.0 hul lady 17292.0 24515.0 17688.0 24551.0 oceu occu17616.0 occupled 24651.0 pled 1lel115424.0 24663.0 15740.0 24699.0 room 24675.0 JmllSI1cll16479.0 herself hersclt24711.0 Sh ShWI1S 17988.0 S1me S1mewas 15032.0 WI1S15400.0 aroused nroused15328.0 16087.0 24903.0 16272.0 24871.0 smell smcll24883.0 of16907.0 24891.0 smoke 17696.0 shellcrcehd 17832.0 sheperceived 25031.0 perceived llcrcehd25040.0 the15752.0 16176.0 25056.0 curtains curlnlns16092.0 25063.0 fin17132.0 25068.0 tbe25108.0 17364.0 25087.0 17835.0 InIt 18076.0 25211.0 a15216.0 blaze blnza25231.0 nnd15599.0 16132.0 16032.0 25240.0 Immediately IrnU1el1lntely17540.0 25275.0 opened oJeneil25395.0 25403.0 bedroom bellroom25419.0 window 15988.0 16780.0 25435.0 nnd16668.0 25443.0 17052.0 25459.0 thothoslightest theslightest 25583.0 slightest ceremony cercmonyIJltchel1 pitcimed17407.0 Into 25647.0 tlmtlmstreet 18068.0 timestreet 25771.0 street 25779.0 15452.0 15920.0 25788.0 clotlles ehotimes15820.0 16688.0 25807.0 She Sho16452.0 25816.0 16964.0 25828.0 simply Rlrnpl17395.0 Rlrnplclnd 18064.0 25955.0 clad clnd25967.0 11115728.0 hCr16096.0 25979.0 chemise chcmlse15979.0 descended elcscentlcll26019.0 17643.0 26143.0 26155.0 15260.0 26160.0 15960.0 26200.0 means menns26179.0 of16943.0 26219.0 rope 17027.0 fllJO15016.0 26335.0 tncllC1 tacimed26343.0 15756.0 16135.0 balcony h1lcony26375.0 of16736.0 26388.0 bellroomBy 26543.0 16024.0 firobrJ brigade 17128.0 ndl 26583.0 arrived arrivedthe rrl 26588.0 lltbe 26699.0 tbe15332.0 Indy15760.0 26711.0 h1tl15668.0 16123.0 26727.0 dressed 26743.0 Imerself26791.0 26803.0 wasnona 17756.0 wasnone 26920.0 nona none15444.0 worse tor16196.0 16560.0 26923.0 16871.0 descent 26963.0 except 17440.0 exceptsoro 18059.0 exceptsore sore sorohands hnnds15324.0 tram from27115.0 27123.0 16928.0 17344.0 27135.0 skin 17768.0 27148.0 hacl15464.0 removed remocd27295.0 daring 15304.0 15840.0 27471.0 27487.0 question qucstlon27535.0 an17508.0 27503.0 Amerl Amert17412.0 AmerlCAD Amertcan CAD can27655.0 hall 1111116496.0 17136.0 17455.0 27703.0 ParIs 27747.0 27843.0 28367.0 18987.0 29347.0 19076.0 29367.0


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\spin01.iarchives.com\scan1\jobq\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01343\ocr\0412.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:19863
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.4458
splitwords:0
ScansoftOCREngine Character Count:12233
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:21868
Abbyy6OCREngine Character Count:6896
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;6896;3074;39.7325;56.5081
language:en
ScansoftOCREngine Predicted Accuracy:30.87%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:6022
ScansoftOCREngine Character Error Ratio:0.8139
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;21868;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:56.51%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:56.51%
ImgPrep Component Range:18816,19863
version:Newpah v2.32 RoundBox
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;12233;9956;0.512221;30.8728
noPunctuation:1
ImgPrep Component Count Low Estimate:18816
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.32Styles TextStyle ID4 FONTSIZE 10.0 ID5 19.0 ID6 14.0 ID7 13.0 ID8 11.0 ID9 9.0 ID10 5.0 ID11 3.0 ID13 8.0 ID14 4.0 ID15 6.0 ID17 16.0 ID18 7.0 ID20 17.0 ID21 23.0 ID23 24.0 ID24 22.0 ID26 12.0 ID27 20.0 ID29 29.0 ID30 38.0 ID31 32.0 ID32 15.0 ID35 21.0 ID37 28.0 ID38 18.0 Layout Page ID1 HEIGHT 30224 WIDTH 20244 PHYSICAL_IMG_NR 8 PRINTED_IMG_NR [8] PROCESSING PrintSpace 29643.0 19399.0 HPOS 0.0 VPOS PC 0.56509995 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1420 17412 0 ns1:type simple language en TextLine 672.0 7512.0 String 332.0 CONTENT I WC 0.8095238 116.0 36.0 7476.0 516.0 1 SP 7144.0 1180.0 13940.0 3472.0 240.0 212.0 T 68.0 10388.0 1268.0 6704.0 3684.0 17343.0 716.0 C 6936.0 10408.0 xmlns:ns2 ID3 13320 4892 676 1876 ns2:type 64.0 3892.0 1876.0 r 104.0 2420.0 2020.0 STYLEREFS 112.0 2148.0 o IEo -104.0 2524.0 76.0 2428.0 IE -96.0 180.0 2320.0 1784.0 2328.0 2396.0 a 172.0 4040.0 2180.0 1860.0 264.0 1212.0 3352.0 2496.0 100.0 40.0 t 120.0 52.0 3956.0 2640.0 p 564.0 3392.0 196.0 192.0 4116.0 2508.0 w 108.0 4008.0 56.0 60.0 4420.0 2604.0 It 4308.0 4532.0 2556.0 4480.0 Ip -32.0 4564.0 Il 4436.0 2772.0 l 300.0 4240.0 1328.0 2840.0 2944.0 V 2660.0 2864.0 1224.0 1436.0 156.0 2888.0 2848.0 2696.0 164.0 3172.0 5 0.82539684 228.0 136.0 48.0 3328.0 2860.0 92.0 3236.0 88.0 3464.0 v ALTERNATIVE t3376.0 140.0 128.0 3604.0 2872.0 A 3552.0 Afjuri -128.0 3732.0 84.0 3612.0 j -120.0 72.0 3696.0 2940.0 + 568.0 4952.0 2924.0 111111011 1220.0 111111011f -568.0 5520.0 440.0 5080.0 2968.0 nrtfou -440.0 5540.0 2988.0 > 2512.0 2680.0 3120.0 f 2936.0 3168.0 J 216.0 2720.0 168.0 3716.0 TI 732.0 2984.0 232.0 460.0 4504.0 3128.0 1cffir 620.0 3884.0 5136.0 3276.0 4 4964.0 4l -56.0 5192.0 3812.0 3388.0 h 236.0 2652.0 2596.0 3436.0 144.0 96.0 3439.0 2692.0 152.0 3312.0 3496.0 011 648.0 2664.0 244.0 3576.0 3484.0 the 0.95238096 80.0 3644.0 -176.0 3820.0 4152.0 3544.0 428.0 3724.0 348.0 4180.0 if 224.0 4392.0 mn -136.0 4528.0 4544.0 no -72.0 4616.0 132.0 4808.0 3532.0 at 4696.0 148.0 4812.0 -148.0 4960.0 5068.0 < 5076.0 Gat -60.0 260.0 3060.0 2424.0 3628.0 248.0 464.0 3640.0 fjuri 176.0 400.0 torllr fordr-464.0 2536.0 -288.0 2824.0 3020.0 3688.0 e 0.96825397 436.0 2584.0 160.0 3156.0 na as3096.0 n -160.0 3316.0 544.0 3380.0 3672.0 Mooud mwaoud3700.0 HOOU -544.0 3924.0 380.0 3988.0 3676.0 elate elnsaclul3816.0 276.0 4512.0 uuj 4368.0 324.0 hail -276.0 4788.0 -28.0 4836.0 536.0 4948.0 3728.0 laattw uaattl1tnattorlaattwOM -536.0 5484.0 532.0 tnattorSIx 288.0 960.0 3936.0 OM 272.0 1OM -324.0 2744.0 2804.0 3904.0 1184.0 3012.0 3908.0 tit 368.0 Rin -156.0 2052.0 3204.0 3948.0 lii 584.0 3460.0 3928.0 Attvonu ttIUICt4396.0 7 352.0 4044.0 4828.0 4012.0 81 4496.0 316.0 4940.0 100 -52.0 4992.0 4020.0 00 5256.0 3116.0 2416.0 4120.0 SIx Bix920.0 SixtJl1fba -244.0 560.0 2776.0 4144.0 UottiliS 11oQtIiH-560.0 3336.0 496.0 4516.0 4200.0 GO 5012.0 4932.0 O -80.0 444.0 5088.0 4204.0 ConU ContaConteConUFRIDAY -444.0 5532.0 ContalilUDA ConterI 200.0 896.0 2752.0 4688.0 FRIDAY lilUDArI -896.0 3648.0 3064.0 4712.0 IDAY 2976.0 3480.0 4724.0 Y -168.0 1664.0 3800.0 4740.0 March MnrehPdarclt188.0 4552.0 22 4384.0 44.0 4896.0 M -188.0 4656.0 4892.0 4632.0 376.0 1901 4736.0 1901AVII -376.0 5464.0 1901t 1901UtTI1AIU L 5288.0 Ol 5168.0 OlI OlUIx0lttt 2460.0 5112.0 296.0 3256.0 1208.0 5196.0 944.0 2472.0 5272.0 UIx0lttt 1240.0 1232.0 712.0 2476.0 UtTI1AIU -940.0 3416.0 336.0 5312.0 AVII 124.0 3188.0 -336.0 3560.0 5320.0 U 5328.0 tftti 3692.0 -364.0 4056.0 268.0 3780.0 5332.0 IAK 3744.0 384.0 4080.0 5340.0 ttac 4048.0 3344.0 2040.0 5348.0 5416.0 1064.0 ucqjOrIC 2044.0 2076.0 UC1J -984.0 5184.0 624.0 4760.0 5368.0 roxtcts 4580.0 roxtctsOIICM9dettlttt -624.0 5384.0 5300.0 5392.0 -84.0 8elMlliK 256.0 2068.0 2592.0 5572.0 1048.0 OIICM9dettlttt 448.0 3196.0 5648.0 elMlliK 5700.0 or 684.0 3976.0 5692.0 ur11f0li nlarrlnaott3872.0 3980.0 5708.0 II -680.0 4660.0 5680.0 636.0 5724.0 00tUlMfo 5740.0 -636.0 5444.0 pQlllafa1y -68.0 4876.0 4956.0 tttAh1I -584.0 2996.0 5792.0 5816.0 524.0 h1dl11J hsaQttd588.0 3252.0 5848.0 worcll4ur surpr3184.0 3880.0 5844.0 tae 3840.0 -236.0 4216.0 5884.0 3916.0 252.0 4220.0 5860.0 wlll -76.0 4296.0 4340.0 Ill -132.0 4472.0 5872.0 tW IIIb4td ttbllthett4664.0 5904.0 III In5360.0 5956.0 5968.0 Is 2624.0 2576.0 Itttls 2708.0 3052.0 5980.0 3140.0 fro -48.0 3372.0 6016.0 Q 3440.0 5960.0 it 456.0 3584.0 6008.0 lol1r -88.0 344.0 3736.0 ohart -304.0 4128.0 6056.0 4232.0 4360.0 5992.0 Aii 11114192.0 760.0 4640.0 6020.0 ovuronehim 4584.0 4672.0 6076.0 JlfrlJnCl -728.0 5400.0 5244.0 6028.0 ill 5204.0 1684.0 2468.0 6120.0 6140.0 2520.0 6128.0 eJ -100.0 2620.0 2712.0 nlll 2656.0 111 -144.0 Vo 6136.0 6 -64.0 3160.0 3208.0 6176.0 OII clwilrle -228.0 3664.0 3656.0 6164.0 l1Jt 3764.0 of -196.0 3960.0 4024.0 3844.0 3508.0 6188.0 W 1420.0 6196.0 6204.0 6224.0 6200.0 res 4264.0 4344.0 6228.0 4372.0 4376.0 4432.0 u 4416.0 1104.0 ulhtSallteiNtwnr 4520.0 lit -1016.0 5536.0 420.0 4652.0 6212.0 raHe 5144.0 6248.0 5072.0 5208.0 JII 5188.0 6236.0 5304.0 6279.0 1392.0 2456.0 6296.0 6300.0 -24.0 2480.0 to -108.0 2852.0 Snort SbortSlJort404.0 3268.0 6324.0 tiotlco Itotlcu3220.0 580.0 uutlcoaf -404.0 3712.0 6332.0 3848.0 6344.0 deaths ituathfl356.0 3996.0 6352.0 1I1thll -356.0 4352.0 6400.0 3068.0 6388.0 452.0 6448.0 lllullwl llalted1108.0 orntnnjcttAKtr 1508.0 2912.0 680.0 4604.0 ninrrlitifM -924.0 5528.0 540.0 t11UrIC 5284.0 6427.0 KIC 6432.0 IU 3788.0 6664.0 i900.0 6732.0 6752.0 i fI4004.0 928.0 1TO fo 1776.0 3028.0 6808.0 TO 3148.0 6824.0 -92.0 3240.0 3288.0 6828.0 coIu 1512.0 3292.0 CORKIWONDftNTS CORKIWONDftNTSOHT -1512.0 4804.0 392.0 6831.0 OHJU -1416.0 972.0 6840.0 5IIPOinUwrs Hspognltlx-44.0 6848.0 5IIPOinUwrsOMr -864.0 4708.0 752.0 7096.0 3752.0 7108.0 360.0 rOmrcnlunmsareopunto -352.0 4104.0 1660.0 7208.0 7211.0 OHT OMrOmrcnlunmsareopunto -252.0 556.0 7232.0 coltumis -1352.0 coll -556.0 3332.0 3100.0 7268.0 3008.0 2132.0 7280.0 am 7288.0 -124.0 3588.0 304.0 3632.0 7292.0 OJNM ClIIIIII3516.0 104256.0 7316.0 one Olle1192.0 7320.0 aueenrraIionden 4492.0 4556.0 c -892.0 5448.0 952.0 7324.0 cnrrolllloolll1811t 4628.0 7336.0 -880.0 5508.0 4668.0 7332.0 4716.0 rro 4700.0 7328.0 toitiUtii 4900.0 1992.0 2360.0 7388.0 7400.0 t2436.0 2400.0 364.0 7416.0 every cTH -360.0 2884.0 cTHliorrmpunilantii -212.0 2736.0 280.0 l1tr 2916.0 7412.0 toYI1 htrn3272.0 7424.0 and 3232.0 7448.0 3512.0 720.0 1I111110lon1 776.0 7443.0 puetofllcli -460.0 4036.0 7452.0 Q11I -232.0 864.0 7464.0 7516.0 tilfs11111a 3500.0 892.0 1052.0 1IJ4lillflOOIlIlIJ -580.0 4976.0 3144.0 7540.0 2504.0 7580.0 7588.0 2568.0 312.0 7576.0 1111 uaut2540.0 7568.0 7608.0 WuIs tluwe3132.0 3636.0 7592.0 lrollllch 7627.0 roar -588.0 4284.0 292.0 7620.0 1ach 3940.0 692.0 7644.0 lIottlUIIICllI eottlummil4280.0 4996.0 canuq -116.0 5268.0 7675.0 111111-180.0 3180.0 7736.0 652.0 r4orrrnlats 1016.0 2332.0 liorrmpunilantii IlorrllltpmlilulIllI-648.0 2980.0 7740.0 -320.0 3348.0 3080.0 7752.0 3152.0 nls 3424.0 will 3748.0 7760.0 bu bo552.0 7772.0 uellw -140.0 1lJwrcl plluwnl-368.0 4304.0 7792.0 -36.0 4452.0 4568.0 7811.0 to4572.0 tona 7840.0 aJ ay5008.0 7823.0 all 7835.0 Ille7852.0 988.0 7880.0 2lLhlriUl lIlllI d1HI-960.0 3320.0 2704.0 7892.0 Ihl 772.0 thlnceIJOy 2880.0 396.0 7912.0 IJlJlbJ -416.0 3476.0 7924.0 3456.0 7944.0 UP 3364.0 668.0 7920.0 IIVoab1 111u -668.0 4212.0 leu 3828.0 7936.0 about 1111111 4288.0 7956.0 Chulr thuir4196.0 4648.0 8000.0 11111 otvn4612.0 -224.0 4920.0 320.0 5000.0 town COW 5252.0 8024.0 5236.0 5372.0 8036.0 lr 5512.0 5460.0 rMM 1924.0 2324.0 8052.0 696.0 lIuttllltl1lll iletlbn11a1204.0 3124.0 8072.0 bill but3384.0 8100.0 nut Itul8120.0 8112.0 ono 8116.0 WIII wont3864.0 468.0 4320.0 8132.0 trill 11 4644.0 8140.0 bo 1404.0 4088.0 8148.0 8176.0 MM 4324.0 1TIII 4248.0 8172.0 4852.0 Jl 640.0 JItllih pHtiliehr4928.0 2368.0 8212.0 rumilntr rnulaurUIIIIIIIIIJWII 2904.0 8227.0 down duwn-344.0 3248.0 3296.0 8272.0 uiif IlIlriutr8263.0 otlior ulllllruthar4000.0 8244.0 iwishoiWf 472.0 HehulI iiatllo-696.0 220.0 3092.0 2336.0 8368.0 2392.0 Vu 2464.0 4404.0 8320.0 1856.0 2548.0 512.0 4448.0 rhrtlltj 708.0 4720.0 8280.0 iVtitmiuM -240.0 iVtitmiuMMor -708.0 5428.0 8284.0 titj 8316.0 4twut 8348.0 QUIII -292.0 5364.0 8388.0 ltlC 1464.0 2608.0 504.0 nleotl 3192.0 8435.0 rre 3112.0 208.0 8416.0 ClIO tttu3396.0 340.0 8423.0 rlltht rlftlt3668.0 484.0 8456.0 Inrrtk 808.0 taetrlkeont 2312.0 8488.0 572.0 8536.0 pIWIvtnt 848.0 8500.0 jiernrudltlee 4732.0 cant 948.0 3784.0 8512.0 nny 5164.0 8520.0 5240.0 8532.0 ue3972.0 8600.0 Wu ttu604.0 4312.0 8648.0 508.0 IImrtM proprPe4884.0 8655.0 t4820.0 2316.0 8676.0 8696.0 If15140.0 thaku npk112616.0 2256.0 8715.0 432.0 11MSpe 8772.0 3016.0 8764.0 424.0 8768.0 onltyl 3224.0 8792.0 fnper 3768.0 ilUlIJO 4168.0 umil -420.0 tjatt 4464.0 4776.0 8836.0 8844.0 yn 8856.0 lItloI 5200.0 8868.0 -220.0 5424.0 8863.0 5232.0 596.0 8880.0 8892.0 Mor 1401aorbs 2544.0 2612.0 lutil 2760.0 2828.0 8896.0 tl 372.0 8932.0 1I1lmnVOriCB -204.0 orair orairvorlcr -372.0 3280.0 8936.0 IIf 2340.0 9279.0 VOriCB vorlcr3032.0 9320.0 ro2084.0 9336.0 1092.0 AUVKRTliieRS aureRrlatfta9388.0 AND AWn4488.0 5180.0 9408.0 BUli auuBUliSCRIUERS -300.0 5480.0 796.0 9520.0 748.0 9552.0 SCRIUERS 856.0 SCRIUERSTmntlont -748.0 4260.0 9556.0 SCRI1fl 4084.0 9580.0 Ra 4064.0 RaI Ra1ntrtlaitl 816.0 9719.0 788.0 9756.0 9788.0 2276.0 9896.0 1412.0 9903.0 2372.0 Jrance JranceWooffer 2816.0 2440.0 Tmntlont 1ntrtlaitl2552.0 9936.0 ttiac -524.0 3076.0 ttiacttnoller -264.0 1020.0 9804.0 aJvbrtlstftucrftt advortlsemcftb308.0 9872.0 must 9864.0 be4524.0 9879.0 paid iilrf 5048.0 9888.0 for far9900.0 In 5308.0 9819.0 lu 5468.0 1916.0 10080.0 10108.0 Wooffer ttnoller 3036.0 10140.0 10 10172.0 per 3448.0 10168.0 emit emtillseouut dleentlnt10211.0 10259.0 Msiiu nnnteuuMttlntf 10280.0 1252.0 2868.0 10256.0 nlflnKnrur01111tnIm 10228.0 on All x1114536.0 10247.0 4764.0 10220.0 advurrl 4880.0 10264.0 -388.0 5280.0 lvurtl 4916.0 936.0 10304.0 10348.0 1084.0 oruroiittcoltjuiii 2344.0 oruroiittcoltjuiiirwiinr -1084.0 4188.0 10343.0 iii 4316.0 anlnfqtit 932.0 10416.0 2296.0 10448.0 nlnfqtit 1356.0 940.0 10476.0 10491.0 roeltlnne 3792.0 10515.0 4100.0 10520.0 284.0 756.0 10524.0 rl 10603.0 nil 1500.0 840.0 2516.0 10591.0 tml 2488.0 10596.0 2748.0 492.0 10624.0 rwiinr -492.0 1476.0 2928.0 10612.0 W4IIaradvortlelRretrt 2836.0 W4IIaradvortlelRretrtUublcrlhcri -1476.0 10644.0 -1076.0 3408.0 10656.0 3444.0 3432.0 600.0 3504.0 10632.0 vnrllHlnir 4148.0 10663.0 ratft 4328.0 10536.0 atlrnucud 10708.0 5040.0 10564.0 y1n 5124.0 1956.0 10788.0 Uublcrlhcri 10823.0 ttlll 828.0 3528.0 10840.0 ohlliauebii 10880.0 10916.0 Iflhin 656.0 4456.0 atptJfylnfr 2600.0 10888.0 tti 2648.0 10924.0 2232.0 10943.0 10964.0 any fallrre 3608.0 10976.0 3776.0 10984.0 roculu 3720.0 4276.0 10995.0 thrfr 11036.0 filer 728.0 11115.0 1552.0 2404.0 11120.0 Lucnlrtrheellrnenntk4 1140.0 4244.0 11227.0 820.0 centgperlln 5220.0 11239.0 1r4 5064.0 11332.0 2248.0 11420.0 2016.0 11411.0 2280.0 2376.0 11432.0 lln 2352.0 1416.0 11540.0 1608.0 11560.0 1460.0 2572.0 2632.0 11648.0 11688.0 Ir 2856.0 ruJlscttij 2740.0 11760.0 3536.0 1312.0 llverllRrinrltetiiunt 4728.0 11796.0 11827.0 328.0 11800.0 4132.0 744.0 tr 4rtrOost 5432.0 11856.0 11860.0 rc 2676.0 icI 2448.0 11892.0 WCekluadrauceorpartlee 2992.0 11956.0 4888.0 11987.0 1408.0 12023.0 12044.0 tIiIi 1780.0 1444.0 12040.0 tlop 12088.0 over 3992.0 12095.0 nntnld 4968.0 12112.0 Jatc Jatci 676.0 13068.0 13092.0 13116.0 704.0 1156.0 2788.0 13087.0 1568.0 1488.0 1704.0 13348.0 13355.0 MK 1732.0 1696.0 1752.0 13424.0 13443.0 1828.0 3412.0 13431.0 1620.0 1792.0 2216.0 13904.0 Tt1C 14007.0 13960.0 13988.0 3876.0 13976.0 3556.0 14036.0 4160.0 13995.0 th 4136.0 4560.0 14028.0 4936.0 arlra 5492.0 14151.0 tIr 14536.0 14540.0 4424.0 rInnttirttrlyRl0Otoprnditco 14636.0 1456.0 14983.0 15092.0 2412.0 Oost 2408.0 InnttirttrlyRl0Otoprnditco 2756.0 2812.0 14992.0 nearly -2052.0 4864.0 632.0 aiOOMO 876.0 4032.0 15011.0 tonrodnccs 3984.0 15032.0 4908.0 xmlns:ns3 ID12 14048 5332 184 15200 ns3:type 1316.0 15200.0 15324.0 ruh 2176.0 1368.0 Pu 15260.0 ng 15264.0 rn 4164.0 4592.0 15272.0 4476.0 itt 4856.0 15236.0 IP 4744.0 ittgK 4988.0 5104.0 15279.0 KO 5172.0 KOtllll 5316.0 aIt 3040.0 2244.0 15396.0 15439.0 tllll 15444.0 -152.0 520.0 15399.0 Slor Srior15420.0 OJ111 nail 3568.0 Ills I1ieMCJLhbr 416.0 tlotIl -596.0 4676.0 4600.0 15480.0 4800.0 15436.0 by 5120.0 5004.0 15448.0 tb 15516.0 15680.0 792.0 15535.0 tvfll1 836.0 15604.0 2580.0 548.0 15580.0 prente 2588.0 15575.0 fJlo -504.0 15568.0 ot 3136.0 15644.0 3592.0 pnintnis 3596.0 pnin -652.0 4016.0 15676.0 15683.0 4096.0 4468.0 15640.0 Trur Kli 15647.0 rlu -184.0 488.0 15656.0 conies conieshlogntyhy -488.0 15688.0 4984.0 nrI 5176.0 ir8 5264.0 5420.0 15759.0 1080.0 15767.0 15788.0 fr 2240.0 15815.0 ofth 1060.0 Uf 2452.0 tiltrrrltatQB 800.0 15800.0 rntQstflrl -468.0 15812.0 tit14tt1111tt 3660.0 3740.0 15831.0 lt -500.0 15848.0 lp1t 3856.0 4408.0 15852.0 1tjt 4440.0 15884.0 tt 15864.0 tnt 15896.0 -296.0 5292.0 15900.0 jt 5092.0 jtf1l1Cue 15948.0 15956.0 784.0 2348.0 16020.0 o11 1276.0 1072.0 16011.0 rltJflM 16023.0 f1l1Cue 16036.0 ilo -392.0 16075.0 16051.0 Toly 4060.0 16080.0 16027.0 Nctl11ottt Nctl11otttII -808.0 576.0 16060.0 pfdtlflo -792.0 16116.0 tta 5352.0 16187.0 16219.0 768.0 2260.0 16264.0 1248.0 1012.0 hs 16271.0 lfntl 16240.0 bijnJ1r 16244.0 3952.0 4692.0 16259.0 Jil 16252.0 lil41 16276.0 tJ -112.0 tJtol 4768.0 16331.0 16427.0 660.0 2264.0 16443.0 tol 1536.0 tapg 16532.0 16440.0 OllI1 968.0 16436.0 OutttniliyftG 3072.0 3164.0 Brnid 16452.0 wurL9 16484.0 4268.0 16479.0 tlio 4780.0 16515.0 4904.0 inittt initttlniot -428.0 16520.0 JI -424.0 16488.0 h1f h1ftlltll 16623.0 16648.0 lniot 16684.0 tlltll -256.0 16639.0 hlogntyhy hlogrnhyblogi -800.0 nlflty ol16711.0 3932.0 16672.0 tilt tliotho644.0 16660.0 iJltiftlril 4184.0 -644.0 4972.0 16696.0 lttst 4380.0 16723.0 16680.0 iti tton tttrp4608.0 ttonwhore th1Il1nnllA 5296.0 thJ 724.0 16807.0 16912.0 Pinrl 1284.0 2164.0 16864.0 1Il1nnllA -380.0 16900.0 2764.0 2820.0 16852.0 told 111111JOCltfo Inemttio3104.0 3704.0 16919.0 16880.0 of16895.0 UIl 980.0 16835.0 thqantlrrios -192.0 912.0 4484.0 16831.0 HIillrlldr1 -676.0 5160.0 HIillrlldr1111Or -912.0 5396.0 16904.0 Itr ItrJ 17036.0 17060.0 17091.0 urnio 111Or -436.0 3000.0 17076.0 whore whlran1urewhorewent 3468.0 17067.0 17100.0 yllgyikil 3756.0 17127.0 qJf -604.0 17079.0 hj rW y7 4752.0 lnt tntiy 17144.0 17048.0 bf be 5388.0 be1P 17251.0 17332.0 17304.0 Flwn 1292.0 17308.0 1P 2384.0 r1 17268.0 A1HO ttiQ17272.0 toltnrllot 17320.0 tiIi -720.0 17323.0 ll8 17340.0 3912.0 O11i 17299.0 lf 17275.0 il 4336.0 4756.0 ppnt 17356.0 -332.0 5324.0 nra 17423.0 17500.0 832.0 17624.0 17627.0 872.0 412.0 17492.0 went 1400.0 inset 1iumt-412.0 2808.0 17524.0 17464.0 ijIOI1tlllOR 2920.0 loludinu 3624.0 17536.0 Ohn 500.0 Olllds 4236.0 17548.0 17468.0 t1J 17519.0 tohyoftam 4636.0 thOh1lRt 17672.0 Oh1lRt Ohrst17724.0 qn 17679.0 qntlt1 3056.0 17688.0 -340.0 17696.0 -16.0 17691.0 Ulji 1112-260.0 1692.0 17703.0 1fathlIilnMtnll Diothryltnhtlrully1fathlIilnMtnll1Ib Diothryltnhtlrullytr1-1692.0 5380.0 JrotJuVjTbVnf -1688.0 JrotJuVjTbVnfto -1140.0 4832.0 17892.0 17911.0 tr1 trrltt 1544.0 1Ib -248.0 17920.0 mf 2684.0 QIfto 3200.0 17899.0 fiteach anch3368.0 ptol plalurn -280.0 4108.0 17956.0 -528.0 4400.0 lotnrQ 528.0 17928.0 roVvTl roVvTlbook 4772.0 hW hf -396.0 tyor 17975.0 lrtul1Jook 4912.0 18056.0 18080.0 616.0 18083.0 S 480.0 tlorftitbook 1572.0 764.0 18095.0 rtul1Jook -764.0 book 18112.0 innlchlo hmtrh1bintehleea4172.0 18159.0 s 818128.0 hi 1t1fi4576.0 18068.0 ii itiiwlmro 4680.0 18116.0 nt 408.0 18147.0 Ih1Vlt 18076.0 ifurltt -408.0 ifurlttit -472.0 18200.0 18248.0 1744.0 18255.0 1880.0 18276.0 1868.0 2012.0 rtU 18279.0 tltt 18300.0 beulty 18324.0 llPl111 nppnnld18339.0 18367.0 4072.0 18360.0 ocry avory4076.0 itoil 5056.0 18384.0 18312.0 hr -12.0 hrI -200.0 5276.0 1rrla 18492.0 iuatt 18523.0 2388.0 18532.0 OIltt 18556.0 un 18520.0 untl 18528.0 in 3088.0 1864.0 18496.0 lvQrrOJwlsUnrfQtf1I1W 18568.0 vtgr -1772.0 1264.0 dhtleUrid13tafnt dhtleUrid13tafnttviwro -1264.0 18676.0 476.0 wlmro tviwro18680.0 luro 18719.0 tljoro 11010lioro18747.0 18771.0 iuontochildren 3540.0 ohlJita 4252.0 18779.0 ticpbnoksellsItsnlt 1068.0 4332.0 18743.0 thpbnoksoils ticpbnoksells-1068.0 thpbnoksoilsItsolf thobnolt 5052.0 18764.0 1C11s 1C11sItsoJ -348.0 2288.0 18915.0 Itsolf ItsoJItsnlt2900.0 18927.0 OhriHtinn OhristInnOhI -732.0 18951.0 Mlnn 18939.0 ttannnthitolnun 18975.0 IQII 1lan-1324.0 4112.0 18955.0 nnJMvomuti 4052.0 nlutJ 18979.0 W01l101 4460.0 19011.0 nro lIromtramtrai 5148.0 19015.0 nroniiikliiKJnunoyrnpfdly lIroJUllkJI 4924.0 19132.0 19140.0 19147.0 2292.0 niiikliiKJnunoyrnpfdly 1812.0 JUllkJI -1776.0 4068.0 nlitkltlk 19180.0 stun JIIOI1I19183.0 -4.0 3324.0 y 19144.0 rnljrctly rnpfclly19168.0 flilfilm nlfltlgJfit 4824.0 19175.0 ordorM O1IIi4Ortlort4Ortlort4Oh 19211.0 O1IIi4f O1IIi4v-516.0 4840.0 ordorMA -508.0 19307.0 19336.0 2484.0 19328.0 GHirintfun 19403.0 3212.0 19331.0 Oh 19379.0 19343.0 tfytian 19367.0 19383.0 2960.0 19388.0 nnn II1Bnman-328.0 19364.0 yv qt19400.0 3796.0 3888.0 woninn tcotulitl -552.0 700.0 I11UlI1cnn 19415.0 cnn ht19407.0 19391.0 thl thlt19376.0 thlc -268.0 thltCrilrnll thin thinc 5408.0 19563.0 19623.0 19591.0 Crilrnll 1160.0 nviniinltyHoon itilattlttltynoon19596.0 ltynoolllUnkt -592.0 924.0 19603.0 nmkol000 1492.0 19572.0 nlnkit1UOOtiiikiny 888.0 19608.0 loOOtnkllJl -944.0 5128.0 loOOtnkllJlI -888.0 388.0 4684.0 19635.0 nclni o5 or19627.0 o5lor -164.0 19787.0 dons lor 19831.0 19799.0 fmfur19807.0 chrJatmns ohritltulnttohrl -768.0 19828.0 tmntt 3520.0 19852.0 juGJionMj 19823.0 jireNOnts 4500.0 19843.0 cnt -316.0 4816.0 19916.0 19840.0 Mrs MraMrsniteul11 MraVnitn 19964.0 19991.0 Wnito Vnitn20007.0 niteul11 20043.0 our 20039.0 nfiotit Ilncnt20051.0 ag 3360.0 3680.0 20024.0 1152.0 19983.0 MnrtsiiohiiKOtta 3824.0 1tiu -1152.0 5028.0 20031.0 Ititll 812.0 20003.0 iohtillottil IiohusottatinsBald tins 1msbns1msHold bnsIIuM 3176.0 20184.0 Hold IIuMBald20239.0 Oorovir20199.0 W000 UOOf3ooo20203.0 ilollnrs dollnratlollnrlt20223.0 worth fortholth 20259.0 4t20251.0 rUU 5020.0 rUUnn tho-208.0 20395.0 bnfll llooks 20440.0 nn 20443.0 1256.0 20404.0 sliVtavcryaIiort lnnvecsahort2784.0 -1136.0 3920.0 20416.0 qrrldl01t 2876.0 time 20488.0 nio 20428.0 Mis Mlsuls20459.0 Sackoittt 4868.0 20455.0 Sack SaekSluk5336.0 Saekouv Slukii 1516.0 20627.0 20631.0 2160.0 oittt 1588.0 2268.0 1t 2532.0 20715.0 2444.0 2628.0 ouv itw2560.0 20655.0 -272.0 2952.0 20648.0 rtjfpnt ngent2956.0 20672.0 3400.0 3024.0 3452.0 20639.0 iii20636.0 Nov NowNew4124.0 York YOlkhas hils20675.0 sold 50111soldjj sold1IIOOwnrtlt 1952.0 20772.0 20899.0 20880.0 1964.0 20904.0 jj 2144.0 2096.0 20791.0 diiv 2272.0 hY 2644.0 20835.0 IQOOvarth 1000wOlth1IIOOwnrtlt20856.0 ortlm tthA20859.0 3860.0 20863.0 books 11OUI8book20875.0 iq20923.0 ft nrt20916.0 very VCJY20920.0 VCJYlt 5036.0 21040.0 21155.0 2236.0 1824.0 21043.0 liori 2284.0 21052.0 Ortimo 21076.0 3108.0 timoJht xht21047.0 Thnbook -284.0 21104.0 21064.0 hook book4272.0 Js JI21116.0 21083.0 printed prlntUtlprtnttod21140.0 5084.0 onI onhQ 2024.0 21191.0 21275.0 21195.0 iiS1rQtfhtietacdlfllpotbnltntlfullybotntd 2056.0 VMvqt -3144.0 21248.0 hQ 2768.0 2036.0 21251.0 Hntahtdpnpurbountifully 1056.0 fhI18ht11IIPOt -2036.0 21320.0 OILII 21287.0 tlfuJl 21300.0 bound bouml4784.0 boundiv 21375.0 21459.0 wtr 1640.0 21487.0 iv 21456.0 Ouvdftml GudinnlOutdihnl21471.0 Hod HflitpdnJVu nttd21499.0 nU 21516.0 g 21483.0 go1d 628.0 ldrtnd u1t1Ind21508.0 ttnd 21463.0 ndorncit ndolnctndorneilndolnctyl ndorneilr21495.0 ndorncitvltiGordnn 21595.0 21703.0 vltiGordnn 1vitliIttldnp2080.0 21664.0 yl 21652.0 t1 21671.0 2908.0 21655.0 rdon 21679.0 HOio Uosos21676.0 Kcwoanml 21695.0 Ulltl-312.0 IHIes r4I11eiillee21712.0 21724.0 Iswltlion iswHl1out 21855.0 21863.0 wltlion wHl1out1940.0 21908.0 -632.0 2432.0 Itlnutdoubttilontostbeautiful 2972.0 21879.0 doubt1thphlostboiuitJful -2016.0 doubtthnitost 21903.0 hmntJru 4228.0 21920.0 bobkbookof -384.0 booktthis bobks 22083.0 22116.0 tf22120.0 tthis 22107.0 this tlie22151.0 century centiitycclltlUj22147.0 Write1 3708.0 4428.0 22156.0 22163.0 ito 22171.0 tor22199.0 terms tornistorma4792.0 tornissqnlcklyjirfd 5436.0 tormailnfuldy termsultrklyrufd 22303.0 22328.0 sqnlcklyjirfd ultrklyrufdilnfuldy -952.0 22340.0 3084.0 22335.0 fl nOt ti 22343.0 jot 22376.0 22352.0 tie tiie22407.0 IC 1000.0 22400.0 vuannggmen luano 22412.0 lu1nR 22395.0 qmenL 22383.0 5228.0 uCttfoftlUffrkitfiiw 22403.0 uCtnrltlHY 1556.0 2304.0 22527.0 22531.0 tlUffrkitfiiw 22551.0 Fattttfitiry 3284.0 22579.0 22555.0 Vit You 2728.0 612.0 tnrltlHY 22615.0 enn 22572.0 work 4704.0 ctn 22639.0 22603.0 rn1my rn11ur5152.0 22727.0 22879.0 1216.0 22835.0 880.0 22819.0 rj1 22747.0 ij1 2192.0 22792.0 22787.0 1mmlilslon 22799.0 22775.0 nndIlul22780.0 when whanvt9lmlyou 22840.0 22847.0 jin priv -216.0 22855.0 Vf 22739.0 5412.0 1472.0 22940.0 1520.0 22903.0 1576.0 22991.0 -8.0 1584.0 2028.0 22907.0 fIf 2064.0 22931.0 Vyour 22947.0 tvyoursuceesa -532.0 23000.0 ol1r 3304.0 snccosa 23003.0 ItlCCQ 23007.0 iro Wltto22983.0 11113616.0 iI1 23036.0 iromoJo llrontoolromo -672.0 23051.0 4872.0 23043.0 yott 23048.0 yo 01 23055.0 23024.0 totlio toilia 23148.0 2308.0 23163.0 tHoilia1044.0 position positlonor -620.0 23179.0 loci -824.0 23196.0 3044.0 23220.0 23208.0 -20.0 23191.0 3652.0 23155.0 rtlnnngor binnnior1Inl1n -700.0 23239.0 23199.0 anilnnal23211.0 Oorros OurrctlarreOorrosfjcindnt 23215.0 OurrctJonlHmtl tlarrelfantloftt -448.0 5156.0 23371.0 23527.0 2300.0 fjcindnt tJonlHmtllfantloftt1948.0 23399.0 at23428.0 3216.0 3356.0 23416.0 pprmnncntfinlnry perllnnlentsalnry23423.0 ptrcI1lHmt -1412.0 fnlnlj 4300.0 23443.0 tl123419.0 detievote 5452.0 1I 23471.0 2152.0 23552.0 23660.0 23600.0 vote tnto2172.0 nto 23624.0 your jOULtlm6 3qur -796.0 tlmo tint13564.0 780.0 23591.0 nttcnillng nttcullingntteniling23643.0 lO4548.0 23648.0 aRCrtta fJCZHSngentsaRCrttatond -520.0 5456.0 23651.0 fJCZHSblld ngents4attd 23779.0 tond blld4attd23796.0 tljo tllQtltc23963.0 1244.0 23815.0 oorrospondenqe 0011091011IIUOoorreepundenGc23832.0 Aran 23787.0 Wanted Wanfed23839.0 cd 23844.0 nlsu nl n123983.0 su wSt 24007.0 i1 tj 24004.0 tt4llflIogor ttt -904.0 24159.0 hlminngur 24043.0 Co 4176.0 24031.0 hno hnveeli c1i4540.0 24067.0 tg 24035.0 tge 5096.0 24055.0 ofofolflCti 5472.0 24367.0 bOTdb olflCti24215.0 884.0 hfrtndtust 24219.0 Lhntlrfiz 24212.0 OIC1u 24231.0 ginsU11a -476.0 24251.0 llit ihtSuite StnteStnh24260.0 nnd tnd5044.0 nndof nndmontage 24408.0 24511.0 montage 2000.0 24456.0 -548.0 24427.0 lRJUIII 2964.0 511 24432.0 tho thobtj Jli 24423.0 lejs lnnessor24463.0 thoState StatovStatc4860.0 Statovrooo -540.0 5516.0 24459.0 Statc8U StateSonLfar 24623.0 24812.0 K 8U SonLfar 24723.0 rQr 2724.0 3048.0 24647.0 tarll 24643.0 tortttPdtlress tortttPdtlressy -1312.0 Adllr 4224.0 24695.0 sR sRij 4364.0 2492.0 24855.0 24879.0 ij 24875.0 24872.0 JntTrSTIt 1528.0 iltfirsrlItrtrltTdd 24891.0 mnl0 24911.0 CoN 24919.0 Oj 25044.0 25087.0 N 1764.0 25092.0 r25075.0 Jorcurun prduran25095.0 Building 25107.0 ulltll11g -564.0 25080.0 Oppont Onpos1tttOppontU -704.0 592.0 25255.0 25339.0 25288.0 2688.0 25283.0 25303.0 T311 25347.0 Hq 25351.0 688.0 25319.0 rWlt1i Vllt S25331.0 D 25311.0 OJ OfOJfnoo 25487.0 rt rj 25711.0 25871.0 26048.0 26012.0 25931.0 rooo fnoot0O1680.0 824.0 2948.0 25923.0 YfiAltTA 25939.0 Yl 996.0 25907.0 llAltT4to 3228.0 AItr -716.0 3944.0 25967.0 25951.0 OhTlrfton Ohrhlton-684.0 nJitan 4140.0 25955.0 min innri26000.0 tnri 25983.0 oP5212.0 orwonmii 5496.0 -172.0 5500.0 oonnl1l oPt 26096.0 26135.0 1336.0 26268.0 26172.0 wonmii Wnttttlll1396.0 26184.0 onnl1l 26147.0 toloolc toinoktn1JMk 26159.0 after uftcl26111.0 tulr 3964.0 26199.0 OUT UUlfirowtng rolnggrawving26163.0 b h26167.0 isi nlIU -40.0 fz 26307.0 26319.0 26371.0 1816.0 tlaw 2500.0 26392.0 2672.0 26399.0 2528.0 26419.0 z 26359.0 ht2668.0 2780.0 26387.0 26335.0 tillsAod 2832.0 tll18-712.0 26383.0 26363.0 ndjolninjj ndfoining1428.0 tljolninJOOjlf1ti 26367.0 Colt Oojintie 5376.0 26395.0 tt5504.0 ttto lto 26551.0 26571.0 26567.0 net twtact26579.0 as usltS26563.0 MnndRCr Mnnnserrlnti -608.0 26607.0 nndnmlOw Zk1JtY 26600.0 26555.0 jpartdont pohtltiltFlllltlduiltpohtltiltr FlllltlduilttjpartdontNvork -744.0 26723.0 26799.0 1668.0 1988.0 26859.0 1768.0 26767.0 Nvork26803.0 ciao2732.0 26808.0 lIn bt done donaIono26811.0 ut Ulatyotiv ytty26820.0 yU 26784.0 home homc26751.0 Eii EtiEiiolo EtiK 5344.0 26796.0 li 26963.0 27055.0 olo ulu27004.0 2564.0 27016.0 iI 27023.0 26967.0 tstIf BtflfndrtrMsi lrntlllrlsltl27011.0 H -1000.0 26971.0 ndtlrresetl d fitnmpcd IitltnpCllstiunpcd26983.0 onvelqpo anvelopo26987.0 onvelqpofoi anvelopoM127028.0 t11 -664.0 JQfJO JQfJOrOl 4844.0 27171.0 27219.0 M1 foi rOl1720.0 27175.0 860.0 27179.0 piirtlcnlnM 1utcnlnrJpurtieulnrs27188.0 toll 3492.0 27200.0 27212.0 I11S1it AShernian AShetn1-616.0 ntnn 27231.0 27191.0 Gen Genr 27239.0 enCrnl 27343.0 27387.0 27363.0 oral Crnl1624.0 Mnnl 1ianm27432.0 OnCM prclrnn Builtili 27391.0 27396.0 iltHngQP iltHngQPnO -760.0 5260.0 27444.0 op oppo 27571.0 27723.0 27623.0 nO po 27611.0 804.0 27579.0 itoUuitei 27595.0 1C 27587.0 Unit 3404.0 3264.0 27604.0 3Litey 27643.0 lICl8J17 27628.0 rensllty1 Wsht 5024.0 27592.0 Wsh Wadi-432.0 Yt 27807.0 r1aton 27867.0 27884.0 1504.0 27895.0 2200.0 27939.0 27971.0 1r 2136.0 27975.0 2252.0 Iy 608.0 28059.0 28183.0 28115.0 fs 1944.0 28143.0 2100.0 28159.0 1960.0 28195.0 28087.0 28131.0 28095.0 28315.0 28343.0 28543.0 28387.0 1976.0 28371.0 k 28460.0 1120.0 28635.0 28675.0 tI 28783.0 28803.0 2204.0 28787.0 2196.0 28915.0 28943.0 28951.0 28935.0 1688.0 2364.0 28995.0 29099.0 29027.0 Iff 3804.0 29095.0 29075.0 29055.0 ff 4796.0 29091.0 29048.0 29143.0 29159.0 29155.0 29179.0 xmlns:ns4 ID16 13600 3212 5608 1584 ns4:type 6756.0 1580.0 6968.0 JhjAL 6832.0 7356.0 1592.0 lIA -1192.0 8548.0 lIAH -848.0 8204.0 6040.0 2380.0 ic 6080.0 1t6376.0 6520.0 6684.0 ilrur avtr6580.0 nV 7148.0 7060.0 6932.0 7248.0 bullion bu11i0I1owned owncdowtledownedbjf 8788.0 owncdb 5744.0 5748.0 bjf 5972.0 bjftlj 6456.0 6132.0 hGnverniuent 5868.0 tlj -1680.0 7816.0 1304.0 6512.0 Government Goel -1304.0 7176.0 7120.0 11el1t 7220.0 7980.0 is 7844.0 8248.0 often rofteti8136.0 roftetiharcl 8268.0 oftenhardpressed oft 8796.0 8692.0 8560.0 tl1 8736.0 5736.0 harcl hardpressed 6232.0 l1 -1368.0 2896.0 tc1pts 5852.0 6312.0 pressed 6760.0 6988.0 7204.0 fOl1Uol1e -308.0 fOl1Uol1eVh foriuatey foriuateyw -1044.0 foriuatey4Viteu money1 money1i 8384.0 6656.0 6868.0 6784.0 6900.0 6928.0 6640.0 7072.0 5936.0 When 4Viteu6032.0 Vh 6508.0 6416.0 6292.0 6604.0 3572.0 6712.0 3488.0 patronizing pitrot1ling6628.0 6716.0 3524.0 patron -1048.0 7764.0 using1 7284.0 7952.0 8200.0 Boston 13ottton8048.0 13otttonhotut -600.0 8800.0 Bostonhotul 8420.0 lton 8324.0 ltonhotu hotul hotuhotut6260.0 dont donlt6180.0 6792.0 forget forret6708.0 7420.0 3760.0 Ihftf thltthhtuculillnr 7828.0 uculillnrvlt1 -752.0 8688.0 8056.0 culiunry culiMtryrculiunrysympowum culiMtryrylban 992.0 4039.0 sympowum ylban -916.0 5836.0 vlt1 6208.0 oium 6404.0 iutn 6908.0 4051.0 oti6728.0 7272.0 lhe7112.0 7696.0 uQlor7976.0 fiuv fivm8308.0 fiuvincuiH ail ailmliU1M fivmuleuls 5768.0 incuiH mliU1Muleulshash 6320.0 hashLondon hashr 7508.0 R RTOflott 7560.0 7804.0 2796.0 5928.0 London TOflott-688.0 6616.0 6068.0 ondol1I110 6000.0 6680.0 shows 1iovvs6980.0 Irow lrow7228.0 lrowlittle 7640.0 7724.0 little 8152.0 tipto upto8156.0 tiptodtttc -480.0 8724.0 uptoclute up 8568.0 8448.0 toclate 5732.0 dtttc cluteclate6192.0 6104.0 6380.0 6624.0 5055.0 having hniuilaving6720.0 7756.0 5116.0 7604.0 profouusensation profound profoullcprofouu8660.0 profoundsensation 8780.0 profoullcs 5720.0 sensation -828.0 6548.0 5908.0 5796.0 atioJ1 6632.0 oer7016.0 7344.0 former furmer7192.0 actress nctrcoactresslost 8740.0 nctrcoI nctrco108t 8620.0 actre 8708.0 tlpsti 1272.0 5728.0 lost 108tlpsti 6048.0 6072.0 Uiampttds tliml1oud5diantpttdsUiampttdsOf tliml1oud5Itliml1oud5OfdiantpttdsOf-860.0 7000.0 5916.0 6088.0 Of 6092.0 thq6592.0 6100.0 155 l5S6500.0 6944.0 saloon Balooh6a100n6864.0 licenacs liceimes7520.0 licl -692.0 8336.0 7964.0 6156.0 njcs 8408.0 6116.0 heldill 8412.0 held 8776.0 heldin 6328.0 ill5984.0 Manila Munilu5876.0 6348.0 6620.0 6096.0 6336.0 Innllil 6024.0 6836.0 6356.0 only oul onl7372.0 6364.0 23 3 7732.0 6408.0 are arume8168.0 iu8008.0 6372.0 Unhattla 8516.0 OHUn8744.0 thehands OHhmd 5712.0 6588.0 hands hmdhattla984.0 6644.0 Americans AmcricansAluerlcans7904.0 Where Vbere7628.0 6608.0 Tberc tcur 8652.0 hiisour 8784.0 hiIJUlboaslcd 2108.0 6879.0 cur1032.0 6852.0 IJUlboaslcd 5988.0 664.0 boasted bpttstcd1008.0 6800.0 enterprise cnlctprieuterpriye7908.0 enterpriseExpiingqjthe -1008.0 7808.0 euterpriye7w euterpriye7l-908.0 7708.0 7632.0 6904.0 cExpL1l1g 7172.0 5892.0 1172.0 7376.0 Expiingqjthe ExpL1l1g -1172.0 7064.0 7384.0 1896.0 7404.0 xpttngqtllruccaunts 5940.0 6796.0 t1l 7419.0 accounts 6964.0 uccqunts 7996.0 7407.0 8192.0 8264.0 mans Ulansmansinhumanity Ulansinhum mansinhuntauity 7624.0 inhumanity inhuntauityinhum 6740.0 nitjL 6952.0 7663.0 7116.0 man 7136.0 7864.0 7656.0 from 8484.0 thctheworldts thcorld theworlds 7888.0 worlds worldts5840.0 orld 6252.0 7932.0 6184.0 6412.0 hisiory llintoryhifii 6876.0 6744.0 7856.0 avid atida11d7528.0 7460.0 7800.0 small 8440.0 vol yolyolIlmc 8444.0 volimc 8544.0 01lIme 5688.0 lIme imcIlmc8184.0 vvotl 6124.0 wotHd 6172.0 volfl 6536.0 6496.0 hl 6488.0 6540.0 6600.0 8144.0 contain COfltnill7472.0 8160.0 tUeTcst 7380.0 tUeTcstA 8180.0 tlWzt4 7832.0 8208.0 7940.0 totA 7896.0 8004.0 st totstJ stTstA 8664.0 8684.0 6112.0 clnwu5l elniI18691.0 cltttrti73 6764.0 6860.0 8700.0 73 7048.0 adyts cadtts7052.0 1fl ls 7492.0 Itshats8360.0 8728.0 bout UllIboutgraduated UllIgriHluutcd 8552.0 8760.0 et 8504.0 etgrhduatcd 5684.0 8920.0 graduated griHluutcdgrhduatcd6816.0 8944.0 frclltt8952.0 West 7236.0 7564.0 7636.0 rcst 7676.0 7788.0 8972.0 sl 8956.0 Point PointThey 8680.0 Pointihc PointIhcy 5676.0 9140.0 9184.0 They Ihcy9192.0 ihc 6144.0 shtJUld shduldshdtald6036.0 9204.0 9207.0 1J b7084.0 7168.0 9212.0 sent sclll7648.0 9188.0 totfic 7532.0 9216.0 8216.0 9176.0 7704.0 tHe 7824.0 Philippittcs Phil Philippines 9291.0 9392.0 9424.0 ippines ippittcsanJbc DUdbeanibc1612.0 9439.0 yivenpennission venpermissionivenqcrmissionyivenpennissionto venpermissiontoivenqcrmissionto-1612.0 8732.0 gi 9496.0 7296.0 5672.0 9632.0 9704.0 5888.0 9680.0 haze hasjchazl5828.0 9688.0 6284.0 964.0 Againn1do 9656.0 ninaufo tlinnrt 7224.0 9748.0 7152.0 9692.0 7744.0 ll17596.0 8020.0 9744.0 catch catchhim 9752.0 ca 8460.0 tch tchhim 9924.0 him 1111119984.0 SC6060.0 6148.0 semi 6308.0 6564.0 11t 6428.0 6504.0 9996.0 6672.0 9972.0 6676.0 tnie 6804.0 6960.0 6976.0 10003.0 9948.0 vlKii wilen1111C117672.0 9952.0 ho heIIC8032.0 III8088.0 10008.0 b4 8292.0 alivt divlLI1ValivtSciclrtWvs 8712.0 8296.0 LI1Vet 8344.0 divlS 8624.0 5976.0 10428.0 5832.0 10431.0 SciclrtWvs Scttbtlats10472.0 -872.0 5952.0 10496.0 chttJ 5932.0 6636.0 10488.0 lipw I1PW tint 10539.0 say sa 7432.0 10544.0 10500.0 theeart11i theeart11iI 8616.0 ucitrL 7960.0 fCirthi 8396.0 fCirthiJhbrief -656.0 10552.0 JJ 8496.0 8584.0 8644.0 10572.0 10668.0 Jhbrief htulei10720.0 btlrJltIIthircl 10876.0 -776.0 7188.0 rtilcl5 10692.0 ljithireen Ytlirtcen10704.0 7300.0 10784.0 1184.0 7496.0 10744.0 a1loucnhnli a1loucnhnlitftiles -1184.0 7500.0 md-1180.0 740.0 10756.0 oiuMiali 7820.0 oiuMialiolilea -740.0 10792.0 ol1 halj 5624.0 10907.0 tftiles 5628.0 olilea tilcl5 arbuifd r6ulftitirOUttil6084.0 6920.0 10992.0 tin tlru1tlm7312.0 poled polctpulet10936.0 than 7768.0 7900.0 11000.0 8312.0 8220.0 11043.0 8080.0 10980.0 bw byrbwhe bhe 8592.0 byrhe 11184.0 he 11256.0 cqualor cCluatrcquatr11268.0 11232.0 Notwithstanding LNotwith8bquUngNotvvithstaltdingNotwithstandingiiisfact LNotwith8bquUngIis-1576.0 2892.0 5696.0 11459.0 iiisfact Iis 11516.0 115 11468.0 fflltr 6012.0 fact 6424.0 852.0 6736.0 11464.0 following follOw1n -852.0 6812.0 11483.0 oll 7164.0 11492.0 wil1g 7020.0 11500.0 titstitsr 7988.0 q 11543.0 eyun 7876.0 eyunor 8588.0 11548.0 lm 8260.0 lmJrll 11712.0 11763.0 5716.0 Jrll 5864.0 5800.0 11768.0 5964.0 11727.0 voulil viultltl11772.0 wt 6368.0 llll 6240.0 11744.0 1rubtll1y 6668.0 11780.0 jm -780.0 IJ 6856.0 bably 7128.0 Ltl 11788.0 11748.0 prcfcrfcU plcfcrrlljprcferrct3plcfcrrlljmo prcferrct3y-836.0 5608.0 11932.0 12016.0 03 iuost 5808.0 11980.0 most 6304.0 12020.0 mo 6384.0 11984.0 pcopleUo popkto11959.0 peoplc -820.0 7040.0 12004.0 11992.0 7680.0 11996.0 polar 8232.0 route routcroutelUOund -452.0 routcUOLlndf routeirOUndIh4 12207.0 irOUndIh4 5636.0 12219.0 lUOund UOLlndf-932.0 6568.0 12228.0 6572.0 6648.0 12231.0 world work6472.0 workon 6652.0 worldiorm -456.0 6940.0 12396.0 7160.0 12420.0 1840.0 6748.0 12656.0 12695.0 vr41 12719.0 istor 12743.0 rVI rVIotJsv 13008.0 13012.0 otJsv 6956.0 9Y 6244.0 5640.0 13171.0 13244.0 on6004.0 13211.0 Just 13180.0 previotis 6436.0 13235.0 pi 13192.0 6596.0 13268.0 6984.0 13228.0 hll he7480.0 13232.0 8656.0 8672.0 jlOrn1 8820.0 5660.0 13395.0 13496.0 iorm lOrn113412.0 tvhiclii 6064.0 6216.0 13464.0 which wlJic16948.0 13460.0 wrecked rtctcd7688.0 ckcd cfty dtyvitycftyipparently 8576.0 13452.0 dtyppareuO vitypparentlyacityprelaitpr4y 13663.0 956.0 13728.0 ipparently ppareuO13696.0 pparentlyacityprelaitpr4y -876.0 pparentlyacityprelaitpr4ytmcs -2868.0 8596.0 6820.0 13711.0 city dt 13699.0 in1 in7068.0 13692.0 preljujfyjrk preljujfyjrkimeswAs -996.0 8628.0 13716.0 prclJ1g ri 8196.0 8524.0 iLmjS 13936.0 14012.0 imeswAs tmcs 6464.0 14024.0 WI vvascpgulfcdon 6316.0 6524.0 cngulfcd cuglfcd-1160.0 7684.0 7456.0 ori 7668.0 7812.0 13952.0 13943.0 lie5Wt g11ut8092.0 5Wta 8352.0 lillt 14263.0 LmjS 5664.0 14268.0 14227.0 whpk 5704.0 wl wit 14232.0 alt 1116392.0 14156.0 Galveston 916.0 6396.0 14224.0 Galvcaton -936.0 14244.0 stO 14272.0 14239.0 jtmts tlt1l 7972.0 14139.0 tatti 7848.0 8128.0 14200.0 factonlans fil 8476.0 factttr 8580.0 14220.0 ltr1 14416.0 14459.0 14571.0 14543.0 ttr 5752.0 14495.0 6272.0 14447.0 thfrllt 6264.0 14476.0 6560.0 slll 6884.0 14500.0 6788.0 14492.0 twV5 7256.0 14512.0 vs 7444.0 7488.0 thCGL 7796.0 GLOilinns 14468.0 nbV 8564.0 5616.0 14664.0 14696.0 onlans Oilinns5620.0 14791.0 5784.0 14767.0 1mS 14727.0 14712.0 today toctay6492.0 toda -496.0 14676.0 fay rur14667.0 faW 7616.0 Ito 14720.0 7720.0 somewhat soniewluitsOl1cwhalsoniewluitbetter 8636.0 14703.0 sOl1cwhalbetter somewhatl 14964.0 15004.0 better etlcr15007.0 tbau6692.0 their 14987.0 lh 7124.0 15023.0 7200.0 14980.0 predecessors prdeccssorspr -1120.0 7484.0 dJ ccssors xmlns:ns5 ID19 13996 3288 5532 15367 ns5:type 15367.0 1024.0 Sensation SCt1sation15492.0 rumors rumQrsmotorshaveItlghcd have 8632.0 havetfj haveql 15724.0 Itlghcd 15755.0 ql 15752.0 c1 15728.0 Arcadia Atcadia15743.0 to15736.0 ef ofeff 15700.0 iltt 8808.0 5576.0 15944.0 16048.0 fBUt ltt5580.0 tfj 5652.0 16068.0 16044.0 tliat tllat6444.0 16032.0 rtiiotllcr ituotllcr16099.0 7428.0 15991.0 erl 7600.0 16015.0 wife vifc8064.0 andson 16084.0 ason 8376.0 5552.0 16300.0 16400.0 son 5896.0 16336.0 havecomc -484.0 6696.0 16379.0 cpmc 1176.0 cpttiefroni 7392.0 froni7872.0 16316.0 Geor Gcor16319.0 Georgia GcorI GcorgttJ 5596.0 16572.0 5564.0 16615.0 gia gttJ 16704.0 16699.0 16847.0 1360.0 acconipariicd 6052.0 16692.0 -1360.0 16668.0 aeconiilttt 6168.0 onlpati1 7028.0 16620.0 Cedby -512.0 16627.0 al 8028.0 laws JawfJawfyerto lawseNtO vt 16663.0 1CLt 16888.0 16943.0 yerto eNtO CLt 16988.0 16931.0 contest cohtestcoi1test7308.0 thc16971.0 7984.0 viil 7992.0 8068.0 i118436.0 16907.0 oft11e oftlie fthe 17227.0 tliet11e17184.0 late latd17208.0 6440.0 6160.0 17232.0 tte 17196.0 Jitdge rtidge17203.0 17199.0 17263.0 gel 7348.0 17191.0 2 7352.0 ZihaII11g ZihaII11giy -1220.0 8572.0 17211.0 7584.0 ha1Ktii ha1Ktiic -832.0 ha1Ktii1ys 17175.0 inl 17407.0 iy 17571.0 1ys 5920.0 17488.0 17476.0 tliciainparrtbitue 6484.0 17516.0 -1632.0 17567.0 6772.0 17559.0 11lIJa 17528.0 7212.0 17443.0 Hj 7544.0 17552.0 7748.0 ulhc 8472.0 17483.0 rr rrThe 17732.0 17775.0 17799.0 The lhc17808.0 17811.0 report 17787.0 Current 17847.0 -784.0 7340.0 ltrr 7396.0 17791.0 trrent 7664.0 17844.0 7928.0 17763.0 3s 3st 8340.0 8464.0 17760.0 ttlttlthe 8468.0 totte 18043.0 tte18119.0 5912.0 18088.0 1eeffect 5656.0 effect -572.0 VhCl118140.0 7216.0 1164.0 yonugman yonugmanKiiilj -1164.0 yonugmanh 18131.0 -1028.0 8012.0 g111U 18136.0 18315.0 18375.0 Kiiilj 18379.0 18456.0 5764.0 5856.0 18408.0 18363.0 wasco111pcllcd waxcompelled18432.0 was -1596.0 compelled bJt8328.0 18344.0 tli 8224.0 tlif1th 8332.0 tlip thitlipfrfili thifif 5584.0 18647.0 fif 5600.0 frfili f1th5900.0 18652.0 tQftQis 18731.0 x -1080.0 18655.0 18695.0 woman 18712.0 1Hlt1 7692.0 toIGart 8252.0 tomartylierrand totuan 5592.0 18908.0 18936.0 martylierrand 18999.0 tuan IGart-1784.0 18963.0 t11er 6528.0 19003.0 cr 6996.0 ind 18948.0 18932.0 said sitidsaidnat sitidthat dtlatvhilc 19192.0 1116.0 19228.0 tlatvhilc that -1116.0 6700.0 19283.0 nat while vliilc19235.0 lieagreed agrecdagreedd7036.0 8016.0 19243.0 8356.0 19231.0 8228.0 thecdrehlouyiir thec thet19508.0 1380.0 19524.0 cdrehlouyiir 5632.0 19611.0 -1380.0 19555.0 tenion iri 1836.0 6460.0 19512.0 1itrfacFhavjng 19520.0 -1300.0 19575.0 tio tio6pt5onvhe 19584.0 tH tHptionJ 8608.0 1option 19783.0 19952.0 6pt5onvhe 5560.0 option ptionJ-1020.0 lie19819.0 toJst ojjl piS17360.0 19816.0 tlie 7780.0 7504.0 19847.0 womanand lvoifinn lvoifinnand 19871.0 19876.0 nnuc1 20063.0 20132.0 nuc120124.0 her 20108.0 fath father fatherr6892.0 20167.0 20100.0 1480.0 thatltcwolt1 thatltcwolt1uever -1480.0 iveVojjJd -948.0 iveVojjJduevcr 8492.0 20067.0 ll1 ll1uevcr 20368.0 uevcr uever6256.0 20399.0 live 1384.0 20380.0 livcwitJfher 20392.0 with lvit117868.0 shortt1 short ShOTtshorttuiip ShOTtt 20679.0 tuiip 20651.0 ile 20767.0 976.0 6152.0 20687.0 afterther 5944.0 20691.0 -972.0 844.0 ftertl1e 1004.0 cerdmonv 20743.0 -1004.0 reaiitiirr r4th -788.0 j3 J1 J1l 20660.0 lie l1elieT l1elGcorgi 21011.0 1168.0 20987.0 lGcorgi 5644.0 ftG 6768.0 20971.0 orgiaco 7264.0 20983.0 cIiuiinl 6896.0 1228.0 20963.0 itlgtoSO1th 7728.0 itlgtoSO1thl -1228.0 8704.0 20975.0 tasontll tasontll1arkda 21224.0 21296.0 21227.0 1arkda 5668.0 5780.0 21231.0 jb fJ 21243.0 cia iat 21279.0 but hut7056.0 21263.0 cim lieliii21272.0 trot ioV21284.0 get 7908.0 getdlforcc 8432.0 gc gcdt 21327.0 iY1i 21571.0 dlforcc 21583.0 21611.0 orcc arcc5824.0 21691.0 21635.0 7700.0 21667.0 Y1i 7660.0 8720.0 21643.0 xTho 8756.0 5788.0 21795.0 21860.0 ThoG2Or 1756.0 GfiOrjiato6rce 6872.0 21891.0 Ot -1452.0 8104.0 7012.0 21824.0 jadivor 7088.0 21827.0 ore4a1 ore4a1arc cdaWs cdaWsrt 21899.0 iavjj iavjjare 5612.0 22039.0 22219.0 arc22207.0 5948.0 22187.0 ve 22135.0 pecnliar 1iecullar22204.0 cl 7092.0 lj 22056.0 rttf 7440.0 7524.0 iare 22111.0 hrt 22092.0 22132.0 tlitrremutt 8076.0 there tlitrretherebo 8508.0 le 8364.0 letUUft 22448.0 mutt tUUft6220.0 be22427.0 beatr1al 6452.0 6544.0 atrial 7244.0 22496.0 -660.0 6724.0 22419.0 trial 22431.0 22487.0 22484.0 jury 22436.0 JurYItc JurYItc1cci1 8668.0 todFCi1Vlletherr Iclpcide 22687.0 22732.0 clpcide 22707.0 dFCi1Vlletherr 6280.0 1cci1 -1768.0 whether betbe 22771.0 22768.0 livorse l1Vdrscivdrsc8096.0 ivdrscIiit 8716.0 ro 22923.0 6360.0 vliit ljli liit Iiit23227.0 23027.0 tf 23075.0 can 23012.0 caa 22967.0 Ueius 6888.0 22979.0 inslittttedand 1028.0 22976.0 tutedanct -1024.0 23063.0 -928.0 tcd 8040.0 22959.0 tfw tftt11etwerdit tfiftfe 8640.0 f1 f1t 23232.0 23332.0 tfe 23271.0 tt11etwerdit 23351.0 ov 23295.0 Verdict 6340.0 23311.0 rdlt 23316.0 23292.0 23356.0 lS 7132.0 23287.0 sib7140.0 23319.0 23283.0 affirma afillmaaflirnlaaflirnlatitC 7916.0 affirmative afillmatLva 23392.0 23567.0 23595.0 tive tLvatitC23576.0 23579.0 real 6468.0 7408.0 trml23583.0 thecauses 8240.0 thecause 23775.0 23827.0 1caus 23847.0 23947.0 cause causcauses6288.0 23939.0 chines cQmes23868.0 coiner -640.0 23875.0 before cforc7860.0 23880.0 another anotheryv anotherif anotherjury 24088.0 ifJ 24179.0 24239.0 24227.0 24224.0 24287.0 24379.0 TheGeorgia TlieGcotgia24411.0 Th -1356.0 oTh 24420.0 Geo 7276.0 24444.0 han 7572.0 24391.0 claims c1ahl1sclaimsthat c1ahl1stbat 24664.0 24727.0 tbat24776.0 110uocfi dicii24703.0 brce orceorc 24679.0 vias 7156.0 24743.0 tas 7776.0 7556.0 aS 24735.0 efer ctcr24764.0 24767.0 er 8392.0 24715.0 pb pbpitied 8404.0 ob ohobtt oht 24939.0 24984.0 pitied 25032.0 iuett lCctt 24996.0 6924.0 25011.0 apjaears 1372.0 7180.0 24999.0 appearsJthat -840.0 lp -1268.0 24963.0 Jlrs 8108.0 25015.0 25059.0 25223.0 25355.0 vas25295.0 born 6476.0 25291.0 7536.0 25279.0 hef7436.0 25300.0 rs shprtly shprtlyaf shprtlyaff ortly ortlyr ortlyatt 25507.0 25587.0 af 25575.0 att affIgr 25511.0 rfi 25563.0 Kingjef 25567.0 iq 25627.0 tng 1100.0 25560.0 tleftGcol cf 25596.0 GeorgiaJtldgc Georgias giaJ 25787.0 25835.0 Jtldgc JtdgcKing 25852.0 dgeIing King 7240.0 25867.0 Inarriecl 25919.0 m l11lrj rrie Miss MissFlorida 8752.0 25855.0 1iss 1iss11orida iss Florida Floritla11orida26191.0 Brewer ErcwerBr 26223.0 wer 26208.0 atF tarl 7716.0 otl Ogden OgtlcnOgdenFla OgtlcnFla 26464.0 26488.0 Fla 26531.0 011oil26476.0 July Julj2i Tuly2j18601andshe 2J -1540.0 18SO 188026479.0 amUe ands1Jc26483.0 uml atldumleight ateight atldeight 26759.0 eight survive SU1ichiu1lihnhimIf hiu1If lihnXt 27040.0 If Xt1036.0 6108.0 27067.0 lUcrcporta 27071.0 -1036.0 tltaz 27103.0 lrel lorts 27083.0 iir 7080.0 tits 27095.0 27064.0 tfii tfttttli3 27091.0 27107.0 nbi 8372.0 bi4sV big bigJIftt biglalvsutt 4sV 27260.0 JIftt JIfttJlLw 27227.0 tC tCJawsuit 27323.0 Jawsuit lalvsutt27367.0 JlLw 27347.0 uit 27339.0 inf 27351.0 tnspziQSlleCt 7076.0 tosp 27383.0 osp 27331.0 ctv cti7948.0 tiud lndnd 8300.0 27359.0 theFlorida 27335.0 thelrlorlc1a 27559.0 lrlorlc1aiflod 27695.0 27631.0 wifc Vl 6576.0 11iflod 27635.0 27619.0 1ll 7260.0 27563.0 licii 27583.0 ticita 27616.0 27659.0 arc are8044.0 27679.0 iji ip8124.0 27691.0 27727.0 27699.0 la laJcltaatrasShlg 5544.0 JcltaatrasShlg -816.0 27911.0 0rt1 27983.0 rt1 6584.0 27919.0 il1 27915.0 voSitiot iQi iQiJl 28299.0 28311.0 28339.0 28419.0 28511.0 28424.0 28451.0 6780.0 28495.0 28431.0 8236.0 1Jo 28547.0 28579.0 Jo 28819.0 1tf 8304.0 29107.0 29171.0 29187.0 29199.0 29327.0 xmlns:ns6 ID22 14204 3192 8820 1448 ns6:type 10092.0 1448.0 10928.0 iil 11056.0 10064.0 1644.0 10728.0 IIt 1632.0 10380.0 11876.0 10084.0 1920.0 1i 10780.0 10184.0 11924.0 2072.0 10360.0 2112.0 Indl 10484.0 Ink 10368.0 dl dli dlh1 11328.0 10336.0 11012.0 11808.0 11060.0 1dSfJlIsflc1l 11848.0 10344.0 3243.0 h1 h1tt 10452.0 10340.0 11044.0 10420.0 rrG 11112.0 10376.0 rG 10440.0 rGI 10672.0 r3 ty 10580.0 10308.0 10296.0 ttAND 10392.0 9376.0 9848.0 5756.0 EN 9892.0 147 10204.0 11136.0 5776.0 IA 10836.0 IAclSfallslcaI 9032.0 6071.0 dSfJlIsflc1l clSfallslcaI10144.0 CZ 10096.0 CZFigures 10260.0 10192.0 Z 10480.0 me 11188.0 cls 10884.0 11396.0 andFigures 9028.0 Figures Gonfzl Gonfal9640.0 Gonfzlo 10208.0 10504.0 Over 11224.0 Pages PagesOV1R 6647.0 OV1R 9180.0 9364.0 Vlll 9324.0 9960.0 9852.0 10OVERj 10232.0 TOP 11096.0 6671.0 CS 11008.0 9380.0 6891.0 OVERj VrR oc 10052.0 10776.0 10688.0 10872.0 6972.0 6916.0 CCS 10912.0 11928.0 11576.0 1M 11960.0 1SPECIAL 9784.0 7104.0 0SPECIAL 9824.0 11608.0 2004.0 9292.0 7223.0 SPECIAL tATUR 10156.0 tATURmcnts 10996.0 10436.0 7271.0 ATURSr ATURSrThe 11296.0 10584.0 TU TUThe 10828.0 9956.0 7503.0 10456.0 nsi 10300.0 10460.0 nstfs 10680.0 nstfsI 10800.0 ynt 11640.0 2212.0 9060.0 t9CO 19C09248.0 10384.0 rational 11140.0 ji 11144.0 7784.0 7859.0 s5and 11644.0 sand 8852.0 9056.0 ttrp15 9764.0 10200.0 10072.0 Itc tte10292.0 dec cleedecT 10960.0 8840.0 9048.0 8203.0 Fs 8872.0 9052.0 9156.0 9112.0 9128.0 9160.0 8507.0 9168.0 ttbr 9240.0 9760.0 Lion tion9652.0 8299.0 Foul Foutc10372.0 turiesof 10288.0 turies 11040.0 10404.0 8164.0 turns 10824.0 10868.0 10988.0 11132.0 11244.0 fT 11668.0 1928.0 9040.0 8643.0 rts 9100.0 Amts 9584.0 Am 10248.0 cn 8607.0 prag pragress 10968.0 10864.0 10748.0 PolitIcal PoiiticalPolitIcalretori 11160.0 11544.0 t1y 11592.0 9592.0 8875.0 ttcsst ress 9064.0 1y 9200.0 retori 9256.0 9011.0 rewr 10164.0 10316.0 10660.0 8960.0 900 190010716.0 11152.0 SClfJJCh SClfJJChr 11676.0 9071.0 1724.0 9844.0 9164.0 co con entiolU enttons10224.0 entiolUs 11348.0 vtn vtntom 11568.0 9036.0 9220.0 tom aad 9544.0 10196.0 9356.0 Fttforin tforn1 10832.0 tforn1ll 9288.0 2700.0 9024.0 9499.0 9523.0 9588.0 9104.0 9196.0 9572.0 ll 9548.0 9516.0 9312.0 9736.0 9560.0 Ameti 9596.0 1308.0 ArtuFiltnruletn 9620.0 10516.0 9564.0 rurcin 10468.0 G Gthe 11424.0 9576.0 eI 11724.0 2184.0 9776.0 8848.0 Irilippi 10016.0 9768.0 Prlippincs 10712.0 PrlippincsN -856.0 9800.0 eS eSN 11004.0 9728.0 9968.0 cW 9920.0 10027.0 tQvern 10236.0 tQvernments 10972.0 ovcrn ovcrnments 8964.0 10128.0 ments mcnts9472.0 9912.0 P 9672.0 9916.0 Pp 10148.0 10152.0 10235.0 10216.0 iRico Rico 10844.0 nod11452.0 10160.0 Ha 11316.0 Haivail HawaiL Hawail waiL ivail1432.0 PoIatEploratlon Porn Pola-1432.0 11020.0 10244.0 ptor plocation tioD 11016.0 11092.0 11352.0 1900 90011264.0 1900v 11732.0 1900Coilcfusion 11436.0 900Con 2844.0 Con Coilcfusion 9448.0 10639.0 9684.0 9540.0 10044.0 10568.0 10588.0 hc he10068.0 South African Afric1DAfric1DIW Africanwar 8904.0 10752.0 10796.0 IW 10835.0 9092.0 10816.0 war ar 1204.0 9536.0 PanArctican 9268.0 -1204.0 10740.0 Pan rcrican ccrican10860.0 Exposition Expositionof f9019108.0 9828.0 Cmu CIDl1Ib ChinsIts10268.0 Its 11007.0 present prescnt11444.0 11372.0 condition 11740.0 11736.0 11076.0 11180.0 dition 11191.0 9444.0 9944.0 sJaus s1austaus9904.0 10444.0 among 11200.0 natfons oalionsnalionsnatfonsRoster 11756.0 oalionsRoster nalionsRoster 11380.0 Roster 9608.0 11387.0 gEnrat gnral11392.0 nrat 10540.0 officers 11260.0 11168.0 11536.0 11384.0 11440.0 theRjr theR theRcgu1r 11583.0 Rjr 9296.0 Rcgu1r 9080.0 Iruf 9664.0 Ur 9476.0 rU 9712.0 9876.0 SAjra7 S11rmy17891900 S11rmy17891900r -1780.0 11764.0 S11rmy17891900AJTPolitifa1 11652.0 my -1384.0 11595.0 J789J900 J7899OOJ7899OOj -980.0 11803.0 9044.0 AJTPolitifa1 12035.0 Political 10548.0 Register RegistersRegisterB Registeroitp-1092.0 RegistersFacts 11584.0 11908.0 12104.0 9096.0 12544.0 Facts 9812.0 12559.0 tlia 9668.0 12587.0 everypari1ot 10088.0 everypari1otd 9384.0 12884.0 12960.0 9492.0 10104.0 12927.0 ougt 9796.0 10732.0 12924.0 12888.0 Inoi 10920.0 Inoito 11528.0 11220.0 13328.0 B 1564.0 13792.0 oitp 13808.0 ld 13816.0 10648.0 10900.0 13859.0 10852.0 13864.0 an 11156.0 11204.0 13847.0 address addrcjjaddresscts 9332.0 cts ctsI 9120.0 14916.0 14920.0 9464.0 9152.0 9500.0 15243.0 15252.0 ArttCA1rrbr 9368.0 -992.0 10272.0 9400.0 10320.0 10640.0 15300.0 t1TIton1TY 10024.0 1808.0 8824.0 15523.0 10592.0 15532.0 xmlns:ns7 ID25 13608 3304 8828 15759 ns7:type 10111113ht1i 8992.0 15776.0 Orilh 9568.0 3hl 9508.0 15828.0 15779.0 slit ritt 15819.0 ch 11524.0 A1 A1t 11704.0 15924.0 16008.0 8860.0 lPh 9148.0 15963.0 S1 9272.0 9144.0 9308.0 15972.0 9488.0 tit9404.0 15960.0 ili 15932.0 15984.0 drta 10276.0 10432.0 10904.0 16087.0 16003.0 rpiLY 11412.0 ioJ 11280.0 15951.0 Tin1It 1j 11936.0 11636.0 titc 11684.0 10820.0 16111.0 16135.0 11888.0 16147.0 16195.0 9244.0 tL 9344.0 16216.0 wI 9328.0 9532.0 16192.0 9512.0 9624.0 rtlarlti 9772.0 10136.0 10132.0 16171.0 lloi 9964.0 1af 10528.0 16168.0 ltnLSi114t -884.0 11472.0 16223.0 f1f 10628.0 fVPl 11572.0 11952.0 11624.0 11616.0 16152.0 11716.0 1rn 8916.0 16464.0 9072.0 16415.0 UI 9000.0 16364.0 hLIr 1I3h 10352.0 16371.0 1a Atlt 10556.0 16419.0 16383.0 10856.0 16391.0 16388.0 ffd 11024.0 rtJnldtlr 1nptS1lclgr1nptS1lclgrt 16359.0 rtJnldtlrf 16544.0 16632.0 t16575.0 11uhisu 16591.0 aldl 9644.0 9880.0 ilmtftElclntiti 9708.0 9928.0 16636.0 -976.0 16656.0 llOlid 10252.0 16608.0 10908.0 yP 16584.0 QJtHtJtUl QJtHtJtUlti 11368.0 16548.0 ntttltur ntttlturili -576.0 11944.0 8912.0 16752.0 16876.0 16787.0 8980.0 9116.0 9504.0 16799.0 S1X tJF 1096.0 16763.0 1jrtc4cattlp -1040.0 16792.0 oJjI 10040.0 JjI 10212.0 trdlfjatJ 10848.0 16928.0 Jr 16775.0 11388.0 11ritirortt 11300.0 16844.0 16916.0 11632.0 itit itiJr11820.0 16948.0 3004.0 17012.0 ritirortt 8908.0 9460.0 17055.0 Xt 8940.0 17088.0 9808.0 17007.0 Thlji1tttiIt1 9908.0 10760.0 nM 10560.0 17015.0 10284.0 16995.0 atom Og 11320.0 17000.0 ntltl nttdFnll 11816.0 17003.0 Lr 9016.0 rin 10032.0 1irtur 10464.0 17223.0 10412.0 hot 17215.0 ohiPorj Ut11 11312.0 lliq 1tlel1 8928.0 17292.0 9020.0 nll 17244.0 9440.0 17239.0 Yrh 9612.0 Ititttr 11364.0 17284.0 Yaie 11988.0 17316.0 aie 9208.0 17456.0 tlel1 17399.0 tir 9628.0 9780.0 17480.0 lU 9360.0 17428.0 uu 17431.0 chgatyr 9tnt 17531.0 17380.0 11108.0 IlnTuwilt 11064.0 IlnTuwiltyatrl -772.0 11880.0 tnJ 11832.0 IJlL 11864.0 17591.0 17615.0 yatrl JlL 9352.0 9480.0 17648.0 fit in9412.0 Ull 9636.0 17607.0 nidt 9976.0 868.0 titoft4Iopt 11284.0 1IomIJ 10676.0 11344.0 tIgaTtd tIgaTtdrlj1111tiii1 17664.0 CCIS CCISI 17860.0 rlj1111tiii1 8948.0 8976.0 9396.0 JQ1d 9340.0 9820.0 17944.0 9724.0 17835.0 tvm 1440.0 10100.0 umitblyipti9nfbfhei 1YJ -1052.0 17820.0 nfht 17863.0 11356.0 17827.0 trl 11656.0 17851.0 11828.0 17832.0 rII rIInufulinuntyI 11976.0 17872.0 nr 17995.0 18071.0 1424.0 18052.0 nufulinuntyI 8968.0 -1260.0 Hat Utlt1 10240.0 17999.0 iflordl laridil10112.0 18028.0 luwl 11128.0 18064.0 lvf 11048.0 trJ ttt1trJfolrt 11904.0 ttt1III 18219.0 9088.0 folrt 1136.0 9416.0 18267.0 llIt1hldltnt 18251.0 IIlivfdNL 18260.0 lntert 18308.0 ftr 18236.0 itr 11124.0 nthlt nthltJJ1 11612.0 thstitvt 18284.0 1fJ 18427.0 18487.0 JJ1 9124.0 18499.0 tNUrt ayil ol roel 10664.0 18468.0 uflniul u1nn lnttl 18463.0 11176.0 11400.0 18451.0 knoxvn kilrlvn11240.0 knoxvnll kilrlvnt11916.0 11556.0 11480.0 1I1 11588.0 1I1JKI 11968.0 8900.0 18664.0 18700.0 JKI 9600.0 18736.0 18688.0 ltl 9932.0 18683.0 tHt dtrueiltt cl11IPt 10948.0 18671.0 1IiJ 18668.0 1111lltltr 11116.0 11476.0 ntl1r 11564.0 18692.0 mll1 ntl19068.0 18867.0 9232.0 18924.0 tl11i 9264.0 18960.0 viii 9836.0 18884.0 uuyyetl vnyed 10652.0 18879.0 18920.0 11248.0 18872.0 1t11604.0 heir 11664.0 heirt 11840.0 18903.0 I1111I1 8888.0 19047.0 19104.0 1111I1 ul 19151.0 Jt 19111.0 9484.0 9456.0 ttI 19108.0 ihvwof I4of10124.0 19092.0 orl 19087.0 filiHl fildntllu intcdie 11216.0 19056.0 oliice 19075.0 lfII 11720.0 19120.0 19080.0 fu 1196.0 19223.0 19240.0 10076.0 19247.0 10576.0 19255.0 iJ 2932.0 8996.0 19355.0 9280.0 19319.0 19352.0 pt 19359.0 19312.0 ahuhionh 9884.0 19316.0 htQl 19300.0 19276.0 iitliI 10700.0 n3f 11028.0 11192.0 19280.0 091 736.0 19271.0 Ooutpnny Ooutpnnytac -736.0 tilny tilnyt 19455.0 19500.0 tac ittitl 9348.0 lI 9604.0 19536.0 9432.0 tu4itutt 9716.0 9816.0 19551.0 1088.0 19460.0 utJ1Jijrtul1lJ 19472.0 tuii 10952.0 19488.0 tk iiit 11148.0 19491.0 19532.0 11488.0 19479.0 dthol cithorcithori dtholi 9012.0 19639.0 19735.0 19780.0 19775.0 19728.0 1l1c lul19771.0 9528.0 19756.0 19711.0 ny 19716.0 19675.0 tii 19684.0 shell ShcU19699.0 Vdintl jtiilitt10892.0 19668.0 PistI 11496.0 Pist lrshlrshelhlo 11912.0 8828.0 19895.0 19912.0 1596.0 19919.0 19935.0 19947.0 19967.0 11512.0 Mi 19979.0 lY 20084.0 20103.0 20148.0 elhlo 20187.0 9732.0 20096.0 9940.0 20155.0 tilliili it1TlIL1H utictjthUrtl lVJt1h1 11252.0 20115.0 int 11376.0 ititnte6t ititnte6tnthiitt -628.0 11852.0 titnJjIW 20328.0 20335.0 nJjIW nthiitt20435.0 20359.0 rtlnUf 20332.0 Hit1VOklpn1c1 Jtr lUl 20356.0 tX ul20344.0 JiQll JiQllit 20387.0 rUt0 rUt0sitTfnrt 11940.0 8832.0 20547.0 20603.0 sitTfnrt 20555.0 20576.0 Jtnrt 20607.0 fi 20564.0 ti1 9720.0 20600.0 atirEty 10356.0 20624.0 teiiitnjls it3 nJ 20567.0 nt1 11552.0 20552.0 Itfl 11680.0 ItflttoJtftl tiltt 20763.0 20811.0 til4tttr 8864.0 20815.0 ttoJtftl niflllllph7tl1I 9700.0 gtnnl 20820.0 Itr20779.0 11324.0 Pt 20959.0 21055.0 9008.0 21019.0 9076.0 21016.0 tath ftt 21071.0 l9740.0 21059.0 wn 1110060.0 TT TTftt 21031.0 10120.0 21035.0 llt 20999.0 thotimeKorr hC111CPt1wirv Itllt11100.0 Itl oj ulojiUKiml1 or1Ql ultut 1Ql tut21200.0 elm 21159.0 IkUlxlrlIl lfiidr iUKiml1 10608.0 21171.0 aiHl tiillltiittlUvtnrvou UvtnrvouX iStnrl 21215.0 I11 I11jhlt une unet1 21391.0 jhlt 21475.0 21432.0 21427.0 9792.0 21399.0 9660.0 21447.0 lYtf 10772.0 l1l1ulu 21415.0 11304.0 21396.0 wIraltJlh 11824.0 11792.0 tut tutr11111AVj 21563.0 21640.0 X raltJlh r11111AVj 21647.0 21580.0 wAi Irlt1 10188.0 10056.0 21604.0 lndliiiinHUf 21616.0 Imlit 21623.0 iul 21659.0 10616.0 nH nil21607.0 hJ mt 21599.0 UJP UIItiit11032.0 21568.0 lota 111a21592.0 11784.0 11692.0 off 21767.0 21872.0 1t21848.0 III9420.0 I9452.0 21843.0 Jippy 21800.0 crvnya 21836.0 trtun10808.0 21803.0 tm thl1tturitid 11172.0 nnl t1dlil 11484.0 21839.0 4C 4Ct giihM tiH 21960.0 22027.0 22020.0 iH 1t9228.0 22003.0 4r22047.0 ai 22063.0 tISlIr 10724.0 ntl 22023.0 flintr 11508.0 11596.0 flint nl1ifnl1ifr 22259.0 iihM 22252.0 tiltlct 10036.0 t1lutlitl5 fry 22228.0 o18atthttt 22264.0 22223.0 11308.0 22216.0 1llOtln 12080.0 22195.0 lImo 12116.0 10804.0 ttl hlt oJlrl Iitiet tII 22415.0 fJh fJh11I hIntl 22455.0 22511.0 Imo 22520.0 i22499.0 9616.0 11WlihFl rlt 9832.0 22460.0 ertr har 10176.0 22472.0 22632.0 22659.0 Intl 22716.0 11I 22675.0 22671.0 11JItllt 22683.0 22668.0 111tnr9t 9696.0 itt4ihl 10396.0 22635.0 u1l 10620.0 t1t 11288.0 22647.0 11460.0 22644.0 ccrtlfln ccrtlflnI ec 22663.0 ttflt 22928.0 22876.0 9136.0 22888.0 IRp 22912.0 ttl4 22895.0 22843.0 hfjitll 10180.0 rtllittrWiiLYit tWtil 11448.0 22816.0 11272.0 22831.0 hI 11122859.0 tIJ 23087.0 11Y11 23139.0 9132.0 23091.0 lJy by23060.0 Nrt NntfllVmtikar lk 23084.0 nti 23031.0 nllt nn1111620.0 11660.0 lloiidn hlIi 11920.0 12124.0 23108.0 23235.0 23335.0 23299.0 23307.0 23263.0 Ii 23247.0 llrtliier 9988.0 23280.0 WIt11te 23304.0 10940.0 rfII 11628.0 23268.0 11752.0 23447.0 23507.0 fII 23500.0 23491.0 23531.0 23519.0 1IJW 10944.0 23459.0 1l 23476.0 23495.0 11708.0 Ihr IhrUl 12024.0 23711.0 Ip11A Ul 23719.0 23663.0 Il138dytah1l 23699.0 10012.0 23684.0 dyCd 9840.0 23703.0 bfP 23655.0 rrei 10696.0 rcl 11520.0 12036.0 nttt 23736.0 23935.0 tll ttt23927.0 23892.0 23907.0 23863.0 tbtUler 1110 41 r523851.0 1t4 23856.0 thJlit 11336.0 thJlitIIIT 11600.0 11728.0 ijilt ijiltt 24052.0 24143.0 24171.0 IIIT 9252.0 24147.0 24131.0 oC ut24091.0 tikOl1 Akttlln24111.0 cot 10636.0 Jflo11du 24064.0 loiidn lotidtt11900.0 24059.0 intitles Init 24335.0 24331.0 yt 9304.0 H02 24267.0 24343.0 VIg 24323.0 ptgt 24387.0 24279.0 r7 24284.0 11408.0 24263.0 HI HIIM 12048.0 24556.0 24587.0 8984.0 24575.0 IM trrlatl 24583.0 Jm 24483.0 If1 10004.0 24492.0 fill 24504.0 10324.0 24507.0 24471.0 tyucs 24580.0 11292.0 24475.0 titles 24487.0 24652.0 24771.0 tIit 24788.0 ItMatlll ItMatlllinnin naiH 24671.0 24839.0 24739.0 24667.0 10532.0 wtWi1i 24691.0 thrit lw 11208.0 24707.0 1tuat lultt ooni obIr lft 24967.0 oni tWi1i innin24884.0 24947.0 10020.0 24972.0 s24975.0 24923.0 rd 10512.0 xail 10604.0 24899.0 tO 24867.0 11otl 24903.0 11456.0 til1 11844.0 fOr fOrthe Atilt 12000.0 jtht 12032.0 25047.0 25163.0 thttilt25199.0 8o lSonfJt 25171.0 25143.0 9860.0 25159.0 10424.0 25123.0 25119.0 1idntitits 25104.0 Crst1r 11052.0 Wif 25083.0 ib14 ty1d11672.0 25063.0 WjV WjVOV 12128.0 ftlura 11884.0 hnCr 25252.0 l2 l2J 25403.0 nCr tlura25376.0 25424.0 25364.0 25379.0 qrfpbl1rLcyJI4 1548.0 9856.0 25463.0 25479.0 25547.0 25572.0 19N 25584.0 2032.0 WMlr 2800.0 25783.0 Mlr iiurgtlr 25799.0 25771.0 25743.0 Mf 25739.0 25615.0 Cswi7ritlftt Cswi7ritlfttFot nc 11164.0 25723.0 25695.0 t1r 25768.0 JF 25991.0 Fot 25935.0 25988.0 hOl1f hattilfalf 25963.0 9 Tothb 11196.0 Lp 11580.0 25911.0 Ai Aiy 26075.0 26131.0 ttill1 26196.0 26203.0 neI3 1320.0 26311.0 26323.0 IOf 26440.0 26687.0 26679.0 1rcl lkititJ 12132.0 titt 26868.0 26832.0 26856.0 1344.0 26915.0 aJtathRtn aJtathRtnk -1272.0 26999.0 10508.0 26959.0 26975.0 t1ts t1tsny 12028.0 8988.0 9284.0 isaF 27059.0 ai1 10048.0 OV WW IVVI IVVIi 27135.0 27183.0 yri 27207.0 1lsM 11964.0 27224.0 ht 12052.0 2048.0 27375.0 27439.0 27451.0 27420.0 27408.0 1V 11072.0 27483.0 Yi 27767.0 27527.0 sM 11088.0 cont1 rit 10328.0 27815.0 fI 10364.0 27879.0 27987.0 11236.0 U41 U41l 11948.0 uvxls uvxlsa 12056.0 28127.0 28255.0 28379.0 rtI 28463.0 28475.0 28303.0 28472.0 28484.0 28507.0 28575.0 fS 28571.0 28551.0 flID 28659.0 28687.0 28739.0 rJ rJko 10028.0 28855.0 ko 28891.0 1296.0 28876.0 28867.0 28871.0 rM 12076.0 28959.0 29079.0 rytt 29127.0 29183.0 xmlns:ns8 ID28 14256 7380 12020 1472 ns8:type 14688.0 14764.0 Lo 14728.0 LoiIIL 14828.0 15552.0 1484.0 wwr 15872.0 rrwarww 15928.0 16840.0 17355.0 17031.0 4M 17404.0 4i 4r Ry 12064.0 iIIL 14188.0 1604.0 1848.0 12340.0 14288.0 1736.0 18299.0 1804.0 4I 4A 12472.0 14876.0 1884.0 14044.0 16647.0 17016.0 2140.0 17039.0 OL 17119.0 17312.0 15952.0 2156.0 16104.0 16856.0 16136.0 16932.0 13488.0 12160.0 13896.0 13664.0 13928.0 14196.0 14068.0 14584.0 joI 14448.0 14888.0 2168.0 14760.0 15143.0 14976.0 16740.0 16772.0 12180.0 12224.0 12680.0 12280.0 12852.0 12700.0 13568.0 iw 12920.0 14004.0 13764.0 14372.0 14123.0 14599.0 14439.0 14924.0 14804.0 15108.0 14960.0 17576.0 t12356.0 15220.0 17735.0 1i11H 1i11Hir1Jlt 18059.0 18152.0 18104.0 18184.0 ir1Jlt 12308.0 12792.0 3v 12992.0 13024.0 13204.0 13512.0 1SC 13516.0 Rat 13608.0 15 14127.0 14283.0 14424.0 14628.0 14316.0 14632.0 cv 14692.0 14936.0 15151.0 15071.0 12artJ1I1 15364.0 15632.0 16095.0 15784.0 15699.0 16175.0 16180.0 16232.0 16243.0 16376.0 16432.0 fdJ 16372.0 17027.0 17823.0 id 17852.0 18016.0 17891.0 t1I 18280.0 Jagon 18283.0 12492.0 agon 15060.0 13276.0 Harne3s 15088.0 Harne3sjlll 17024.0 arneL 15939.0 17864.0 16764.0 AI 17924.0 AB 18940.0 13368.0 f7 13120.0 13472.0 13524.0 3340.0 13575.0 14076.0 13872.0 a1 14216.0 14296.0 15368.0 3600.0 15408.0 1716.0 16448.0 SaddILy4 1040.0 SaddILy4a -1716.0 18164.0 16712.0 r1e 16968.0 dd 16984.0 17043.0 orHi 17652.0 17412.0 ia1 17700.0 17772.0 17796.0 18352.0 3260.0 jf7 18371.0 17583.0 1W 17640.0 13208.0 13288.0 jlll 13264.0 13416.0 Hi 3831.0 13648.0 13856.0 Sri13644.0 14148.0 14084.0 14152.0 14207.0 14744.0 Supplies SuppliesIJA -2056.0 14748.0 14768.0 14952.0 uppk 15112.0 16272.0 3808.0 rJp 15376.0 teso 15996.0 tesou 16200.0 16580.0 16260.0 stllyhta 16791.0 12240.0 4348.0 hlfH tllyhta12332.0 12788.0 13144.0 31tii 13352.0 ltii 13720.0 14340.0 1ipilig 13724.0 iph1g 15076.0 15476.0 16567.0 Gun 16100.0 16996.0 17616.0 vk1I 17336.0 vk1 trll17996.0 trllrI 17992.0 18024.0 1144.0 4508.0 Stow StowRanges -1144.0 18287.0 12404.0 12528.0 12648.0 rA 12772.0 13672.0 13164.0 13676.0 13796.0 14096.0 vv 13992.0 14240.0 7I 14519.0 114524.0 15496.0 Sc 15160.0 15792.0 CinVar 1iawari15596.0 16992.0 StOVq 4t 4tHanges 12868.0 Ranges Hanges12272.0 13860.0 SQwfn Sewing 14508.0 14948.0 14660.0 14968.0 Liclint 15352.0 1ine9 15668.0 15748.0 15840.0 15976.0 tt116308.0 16204.0 liitur 16360.0 liiturU1i1l 17279.0 1tt 16951.0 turt 16808.0 13544.0 U1i1l BLIL1lGlJl IJA 15172.0 14984.0 Ar ICRIA 15248.0 15463.0 15608.0 RAt RAtlarttk 16132.0 -1060.0 16220.0 JJrick larttkinwi inwii 17364.0 inlt 17252.0 13111 13111Lit3 14300.0 5568.0 cL 14816.0 16163.0 ulrtth 16468.0 17104.0 16540.0 llIa 16624.0 16719.0 irUyt 16963.0 irUytCroijcefy 17212.0 17056.0 5604.0 13428.0 5643.0 c1ten Lit313967.0 13971.0 14047.0 14292.0 WN MN 14568.0 5619.0 1HQJ 14796.0 15116.0 5631.0 15576.0 15288.0 15156.0 15412.0 QYx 15392.0 15648.0 Gi15732.0 15796.0 16120.0 17172.0 5667.0 17600.0 17792.0 17636.0 17940.0 ICr 17968.0 13560.0 Croijcefy LrotkeryCr 14544.0 13776.0 13832.0 14164.0 13888.0 14328.0 14736.0 GlrI 14616.0 Crlr 15120.0 15383.0 Fare 15855.0 fHa1 16024.0 15920.0 16028.0 IJltUJ IJltUJutltty tTiips tTiipsittlerj 16768.0 13944.0 CiUrery 14120.0 utltty ittlerj14776.0 14740.0 15067.0 15440.0 Cut Trutt15332.0 Crls lls15832.0 Crlstvl lls11t16491.0 16392.0 16487.0 16871.0 17300.0 I12244.0 tvl 11t12352.0 6635.0 12620.0 12560.0 12504.0 12740.0 t13016.0 uict lact13103.0 act 13372.0 13480.0 6623.0 rny mylrnytluuj51 tiuug13811.0 14396.0 14212.0 Jg 14016.0 14484.0 14376.0 14928.0 6612.0 cit cii14844.0 15028.0 15328.0 itl 15512.0 four 15459.0 15980.0 15672.0 QtI nlljl tt16399.0 16628.0 16664.0 16832.0 lirsvcl lirsvclsrarioro 17448.0 6532.0 firK 17111.0 16959.0 rst cU1t1 clirii17743.0 18215.0 ru rtrttruVJUi 18396.0 rtrartor rttTttrtorC 18404.0 18392.0 6855.0 srarioro rartorTttrtorC12936.0 itt12784.0 13056.0 13108.0 llriC 13300.0 ricstrat 13528.0 titlt 13780.0 hat villvlllsatlf satif14604.0 sat 15176.0 Llttai15968.0 tt15588.0 16396.0 t16563.0 bini limhltlt16444.0 17140.0 call cntl17072.0 cntljj 17460.0 callA4l 15416.0 7247.0 15572.0 7252.0 15775.0 16424.0 7235.0 Ie 16247.0 ythrrrw 16516.0 vw 17400.0 17663.0 17620.0 18228.0 wH 17728.0 wHr A4l 12392.0 trMR 12312.0 12856.0 7MPN 13224.0 13176.0 13400.0 7283.0 if11r 13712.0 RrrM 14312.0 17936.0 14384.0 aOur 18008.0 14496.0 14552.0 6044.0 12264.0 VJUi 8428.0 Our 12644.0 iUU 12584.0 fee 12892.0 12952.0 rebuned 13668.0 13044.0 VbUI 13004.0 13376.0 llbi 13332.0 13616.0 tso fail 14160.0 failpny 14472.0 Any vny 15052.0 15508.0 scadidg 16208.0 ckeoh 16744.0 description 18036.0 18135.0 18232.0 12072.0 pny 12364.0 invention iliVeiltioll13196.0 promptly 13584.0 14480.0 receive reeeivn14420.0 15136.0 15064.0 opimoi opimoibility opitiktTrsto concerning 16472.0 17507.0 17815.0 1nltontr 17667.0 1nltontrtblity 14532.0 obtain obtn15044.0 alten ent 4ent15712.0 upourequcat uponrcqucet17776.0 ifaentJ 17903.0 ifaentJeourerl 18012.0 tenU tenUiecured bility tblity12692.0 12592.0 Brmo natno12848.0 13680.0 8887.0 How tliow14260.0 8899.0 ta to8911.0 14436.0 paten 15208.0 iecured eourerl12764.0 through 13484.0 ns tie13408.0 13731.0 13660.0 13768.0 1628.0 13876.0 9107.0 lvorUiXidfoibalortt lvortlslLful -1628.0 15504.0 bnlcl 14868.0 9119.0 2pense ipensc 16536.0 ipenscPatonU 9300.0 PatonU Patinta12084.0 12964.0 tfsk 12900.0 tatklI 13212.0 13360.0 9403.0 ifc 13548.0 1f 13760.0 tllro 14548.0 9372.0 igJi 14228.0 14656.0 u514932.0 jiwk llts 9327.0 urtrVo tolicswlt 16320.0 17008.0 ithwit 17128.0 17124.0 9315.0 17511.0 17168.0 17236.0 ont 17612.0 charge cltnrou1iiiftiEPATENrTv u1altPAZ 6276.0 12136.0 9635.0 ftiEPATENrTv 12232.0 9659.0 altPAZ -1288.0 13520.0 viuiiHublvated 12808.0 ilubtstc1t 15056.0 15192.0 15652.0 vy 15196.0 16064.0 oirouhttdjouraa 16004.0 aireulsed jo 16879.0 tnalconeultot 17080.0 tnalconeultotly -1208.0 17632.0 consulted consultedMiinufncturcltiuiid 18412.0 12356.0 9867.0 Miinufncturcltiuiid Innufnoturetstld14020.0 Investors Invostora13932.0 12096.0 ly 9980.0 12292.0 MSend 15880.0 tPassenger 12288.0 Send 12760.0 12696.0 13064.0 10123.0 ample 13000.0 13700.0 Cot 13632.0 14180.0 IrlrIE 14056.0 15128.0 YY 117 16824.0 17064.0 mr mrj 17156.0 17256.0 13272.0 j1124.0 12148.0 ItHaIJB 13304.0 14112.0 CsAclli AU0I AU0IIrt -612.0 1280.0 17680.0 J3 J3M J3oot13380.0 10956.0 15428.0 rlr 15615.0 11019.0 tHaIJB 12164.0 11103.0 Irt -804.0 12968.0 12440.0 lWYYiJ 12344.0 11335.0 11360.0 aMwt oot 15892.0 11347.0 wnRrwrynw 16052.0 -1200.0 17440.0 uvwwri 16356.0 uvwwritl 17572.0 16292.0 11399.0 Jarra 13048.0 12988.0 13072.0 11739.0 13183.0 13088.0 13440.0 11643.0 13620.0 13804.0 14116.0 14556.0 14940.0 E1r 15140.0 11607.0 15684.0 11495.0 16780.0 16500.0 17704.0 TJarra 17840.0 17983.0 4Passenger 18176.0 3308.0 14672.0 11875.0 IPassengcf 14708.0 12468.0 Passenger Passengcf11935.0 Schcclulc 13404.0 1844.0 11947.0 ScheduleEffective -812.0 SdHH1ulelur -1844.0 14516.0 Ltffectli 14900.0 cb 15240.0 12008.0 Sep 3lPSc115280.0 1ir 16416.0 16140.0 14UO 12252.0 atta 16612.0 12279.0 tfU 16920.0 12120.0 12327.0 12384.0 r12360.0 ntI 13500.0 13820.0 12351.0 13688.0 12336.0 lty 13900.0 17160.0 Li 14136.0 12487.0 12731.0 16228.0 17 14264.0 12860.0 12979.0 ttd 14252.0 13123.0 1200.0 16756.0 15284.0 13223.0 16784.0 17579.0 16924.0 17644.0 TP 17676.0 14172.0 13292.0 17964.0 13316.0 17987.0 13476.0 01I 17520.0 13240.0 13556.0 13596.0 ttjk 13948.0 1820.0 13675.0 17912.0 17868.0 17948.0 13735.0 13783.0 12152.0 12628.0 13840.0 j1 13032.0 16428.0 13852.0 16848.0 13892.0 16868.0 13924.0 13931.0 13964.0 116112.0 14108.0 14144.0 15760.0 14115.0 15824.0 16188.0 16588.0 IX 14168.0 14860.0 14908.0 16352.0 13132.0 14215.0 13800.0 14248.0 13160.0 14236.0 14856.0 cimrrally 14088.0 14872.0 14944.0 14280.0 16124.0 17180.0 17152.0 17187.0 tT 14335.0 15716.0 14324.0 15912.0 14320.0 15756.0 14344.0 14423.0 Ut 13880.0 14440.0 13920.0 14408.0 5tI 5t14399.0 Iti 11114452.0 16160.0 14371.0 16148.0 14464.0 16212.0 14375.0 14380.0 Vr 17220.0 18020.0 14435.0 17716.0 18303.0 ih 18063.0 18516.0 18580.0 12480.0 tto 12532.0 13756.0 13604.0 14564.0 14104.0 17560.0 14608.0 12616.0 14576.0 14591.0 14788.0 12640.0 12476.0 14555.0 14619.0 1076.0 12540.0 13704.0 16 14583.0 3tJ 3300.0 14460.0 18316.0 18040.0 14700.0 14724.0 16251.0 14779.0 15484.0 1936.0 lq 12980.0 14815.0 13824.0 14884.0 15744.0 ir 1872.0 15888.0 14839.0 19332.0 12612.0 14947.0 14975.0 5524.0 18196.0 5132.0 14032.0 14995.0 14080.0 16732.0 19060.0 16816.0 15059.0 15155.0 17532.0 t9 16072.0 t9c 15171.0 12108.0 14784.0 15212.0 12424.0 15255.0 12676.0 tJi1 15000.0 I1Ir4JIe 15179.0 15303.0 rdtl1Uhrh 16019.0 tJI 16184.0 16643.0 15296.0 15228.0 18203.0 15183.0 17035.0 18784.0 12100.0 15348.0 12576.0 15363.0 15356.0 15379.0 14644.0 15432.0 1n 14363.0 15391.0 14755.0 15351.0 rlllrtJH 15048.0 15375.0 15184.0 15124.0 15231.0 15256.0 15424.0 15703.0 15427.0 YI 17271.0 YIt 17848.0 17768.0 17880.0 18295.0 18168.0 PI 15520.0 112328.0 110 13868.0 14684.0 I15499.0 515511.0 1452.0 rtP 17876.0 18120.0 15547.0 15623.0 15620.0 17751.0 15599.0 Iio 15583.0 18223.0 18388.0 15592.0 18328.0 xmlns:ns9 ID33 3156 7160 12144 15736 ns9:type 14308.0 12436.0 Oo 18000.0 15867.0 rli 16340.0 16040.0 17444.0 18340.0 15936.0 12564.0 15975.0 12608.0 12708.0 i1al 13040.0 15999.0 s1tl 12996.0 i11 13624.0 fur rtfUCII lnnClltQlM1 14704.0 tlr 14504.0 14820.0 ttv 15008.0 15360.0 1128.0 15404.0 16940.0 1300.0 17092.0 1ndnfatPD 18416.0 Itt 18472.0 12464.0 16123.0 ndnfatPD 13112.0 pP 12844.0 13308.0 At II1154 Nt1 tmu 16183.0 15040.0 15660.0 LA 16144.0 tai 16403.0 16524.0 16736.0 16108.0 16936.0 17224.0 17267.0 tY 17360.0 17800.0 17907.0 18143.0 rij 18160.0 rijt1UI 18436.0 12144.0 16235.0 16328.0 t1UI 16343.0 12516.0 16355.0 12256.0 12668.0 16367.0 12664.0 12896.0 16280.0 jtt111 13152.0 i1t 13708.0 13552.0 13540.0 16268.0 1tIr 14620.0 14896.0 IIttf 14648.0 Ijo 15168.0 1itrv ivt 15720.0 16348.0 15771.0 1A utrl 1tr 18148.0 18552.0 16288.0 18504.0 18596.0 12752.0 vri 12916.0 13124.0 12984.0 vrll 13784.0 14432.0 lGtJ 14348.0 16496.0 14612.0 15340.0 16512.0 16508.0 15584.0 15768.0 16455.0 11ft 16296.0 3Jd 16676.0 titir 17328.0 16467.0 16431.0 17427.0 17608.0 Itnraiiuli 16555.0 12260.0 nraiiuli 12316.0 12512.0 rnl 12736.0 12820.0 J9 12688.0 lrarc 12940.0 13128.0 Cnrrillwltedaily nrri14JlfeIIIInoounl 14352.0 ttW 14824.0 16323.0 16616.0 17351.0 16716.0 wc 17568.0 16783.0 12456.0 16819.0 116528.0 Incr1 16896.0 16795.0 16828.0 17484.0 rlrtJJh rlrtJJhfl py 17952.0 17888.0 SM 18455.0 12596.0 12652.0 12728.0 13172.0 13220.0 13636.0 13752.0 13655.0 16859.0 16955.0 14392.0 15024.0 14864.0 15316.0 16811.0 16823.0 15387.0 15695.0 15708.0 15904.0 ilfti 1aWq 17419.0 17019.0 oy 12748.0 17108.0 IT 15472.0 17103.0 ftkH 15964.0 ftkHnMl nMl 16576.0 tIIl 1560.0 tltrLtt tltrLttrtrmfhrttt 17248.0 2Ir Hfit 1496.0 Hfitr 12496.0 13652.0 17260.0 13736.0 rtrmfhrttt vutrton 71tiitP 17296.0 17280.0 rti 18535.0 13036.0 13356.0 it1 17347.0 17344.0 904.0 16972.0 Tr 17435.0 pI 3832.0 17452.0 17543.0 13916.0 13600.0 te 17004.0 17619.0 14835.0 15180.0 ig 12320.0 titi tititrdlllp 12552.0 14140.0 Iun 15740.0 17748.0 16091.0 1tctK 16727.0 17803.0 ucllu 17788.0 f117544.0 nrt 18539.0 tft 12168.0 urd 17887.0 5548.0 17904.0 12484.0 17923.0 12956.0 17947.0 12804.0 13020.0 17980.0 17671.0 12192.0 trdlllp 12604.0 12812.0 12732.0 dfJJ1 18011.0 1Ii 15851.0 18212.0 15931.0 Qf Sf dtl 17416.0 17148.0 18019.0 1to 18512.0 18256.0 19256.0 18544.0 Arnduw 19303.0 16007.0 18207.0 18264.0 16476.0 Ifn1iI 12176.0 18288.0 18355.0 rnduw 18348.0 n1iI -400.0 12672.0 12904.0 18327.0 Ul1dll Undnrea 15543.0 18415.0 1p ffi 16368.0 18372.0 t1stf1 18332.0 tIRt 14640.0 18447.0 18460.0 toT 18475.0 16776.0 18484.0 18435.0 18240.0 18444.0 12296.0 IRt 18540.0 1stf1 12460.0 150 12824.0 18551.0 12776.0 12976.0 np13156.0 1996.0 18592.0 E1 12376.0 18728.0 14595.0 ll14800.0 15276.0 18791.0 18716.0 18800.0 18704.0 17368.0 8rfoM 17499.0 xmlns:ns10 ID34 8356 3292 12136 18936 ns10:type 18996.0 rtwrr 19059.0 14100.0 19099.0 19216.0 12632.0 13284.0 19443.0 19515.0 19708.0 14904.0 19632.0 15244.0 15336.0 19768.0 12200.0 19811.0 19892.0 20151.0 12600.0 12408.0 12768.0 BdefQ 14675.0 13188.0 20235.0 20215.0 r14176.0 14668.0 20268.0 14808.0 14812.0 iIt 14848.0 14911.0 lII 2636.0 12716.0 12684.0 20663.0 20471.0 An 12712.0 20507.0 13096.0 12744.0 20504.0 13312.0 20476.0 13844.0 20464.0 20431.0 14580.0 20512.0 15223.0 20720.0 15204.0 0f 0r 12508.0 20784.0 20787.0 20911.0 12188.0 20995.0 13384.0 1132.0 oI 13436.0 1Jt 12268.0 Xr tIIf 14792.0 13252.0 21308.0 13364.0 13908.0 21312.0 21336.0 13980.0 21255.0 21387.0 13891.0 21408.0 21439.0 1800.0 21468.0 21575.0 21547.0 15084.0 21504.0 14456.0 21683.0 14716.0 13996.0 21884.0 21931.0 21967.0 IIC 21975.0 22008.0 12236.0 22032.0 22168.0 12416.0 22243.0 22059.0 13052.0 13532.0 22144.0 13344.0 13984.0 22139.0 ffisa 22316.0 13236.0 22424.0 14592.0 ifN 22560.0 22704.0 22699.0 12624.0 22823.0 22596.0 13260.0 13468.0 iijt 13912.0 22711.0 l111 22852.0 22587.0 rfs 22952.0 50 14528.0 jU 22964.0 22988.0 rahorl1 23099.0 23151.0 23184.0 12572.0 tl6e 23535.0 nfP nfPj 23543.0 23803.0 12348.0 23639.0 23760.0 io r1r1 23723.0 23743.0 J1i 23679.0 14j 12196.0 23923.0 4j 6e 12724.0 23992.0 23995.0 23968.0 23951.0 a13200.0 arrt TtII1 13588.0 12872.0 24127.0 TtII1E E 14304.0 24079.0 jCir jCirq1 24155.0 rrt 24519.0 24539.0 14276.0 ts ttb 24599.0 24655.0 q1 1740.0 12368.0 24631.0 12928.0 L1 24896.0 oJ oJCS 25008.0 14359.0 25068.0 15400.0 25027.0 25127.0 tbt 13140.0 Jj 12520.0 25187.0 12636.0 tv 13280.0 25335.0 25156.0 25527.0 rntcost 25151.0 11tv 25472.0 13296.0 25599.0 25680.0 25719.0 15020.0 12204.0 25707.0 15100.0 1ro ntcost 25819.0 COSC td 14092.0 26103.0 26115.0 26127.0 13740.0 1348.0 26151.0 lhD 26259.0 26275.0 26503.0 Vot 26407.0 26331.0 14256.0 26495.0 26631.0 26648.0 26655.0 13884.0 26636.0 26660.0 26787.0 0t 12212.0 26880.0 27031.0 26947.0 13592.0 13564.0 26903.0 AUlffI 15268.0 27007.0 xmlns:ns11 ID36 8396 3776 15448 18896 ns11:type 18896.0 ci 19267.0 15836.0 19264.0 Etc 19304.0 16327.0 XQ XQCh 16600.0 Ch 16760.0 11211tc 2I16980.0 2Iy 1rJ 18564.0 1roJ 19424.0 15488.0 19467.0 19496.0 15556.0 19527.0 16504.0 tff tffI 19659.0 19720.0 19663.0 15868.0 17684.0 1188.0 16284.0 19795.0 17288.0 iu 18911.0 1376.0 18952.0 19924.0 15560.0 19904.0 19859.0 1UUt 19855.0 tlart 19188.0 19888.0 19988.0 15764.0 20292.0 20323.0 iitt 15908.0 20371.0 tn 20495.0 20423.0 20363.0 lVlVsian 20383.0 18272.0 20411.0 20535.0 sian 15536.0 20583.0 20619.0 11kiiPntdtut 16312.0 t1fr Nnt 20595.0 17020.0 17392.0 ntII 18519.0 20615.0 20760.0 20827.0 20808.0 17756.0 17472.0 20775.0 111f 1728.0 16156.0 20892.0 20992.0 20944.0 16196.0 16460.0 16635.0 16456.0 20935.0 20951.0 17084.0 r17884.0 15916.0 16344.0 l1f 21028.0 jI 16604.0 17096.0 sn 18755.0 21107.0 17240.0 INt 18780.0 19071.0 21135.0 21236.0 tS1Y 15628.0 21239.0 15876.0 21212.0 Nt ilt simt Pic 17604.0 ItKnat 18428.0 18464.0 21324.0 15600.0 trCt Wrm No 21348.0 21367.0 31IC 15692.0 21492.0 1IC tKnat 15816.0 16167.0 16056.0 r15trn ttr1m 17712.0 mu 21423.0 21444.0 18500.0 jij 18531.0 17408.0 Iit 22104.0 f22123.0 16976.0 22175.0 0I 1324.0 22319.0 22359.0 22323.0 rT 18067.0 22524.0 22536.0 15992.0 auft 22620.0 17496.0 I1fi 18480.0 18944.0 41nitift1th 19079.0 22744.0 1fi nitift1th 14 r1IIClm r1IIClmi 16860.0 kthl 22720.0 4r1 18424.0 22759.0 22867.0 22891.0 22900.0 18400.0 1288.0 1lI 22955.0 tIN 16559.0 ctW1Ji 23072.0 23096.0 tltiMil 16380.0 23187.0 1o 17655.0 ittt 23115.0 Itb tttt18044.0 23119.0 OJt Hf 23347.0 23344.0 17587.0 23455.0 23464.0 23523.0 16592.0 23503.0 1If 17708.0 18888.0 11iAUtttin 15564.0 23559.0 hvrld 4g9 23547.0 iAUtttin 23715.0 11L 23727.0 17372.0 23675.0 18192.0 23755.0 23CO 23COT 18576.0 23751.0 00f 23799.0 23811.0 16420.0 16803.0 23823.0 23835.0 +17540.0 18188.0 PJ 17856.0 18991.0 23883.0 23931.0 23975.0 Ja ltn 23959.0 1h 1s rjto rjtoUikMi1lan 18656.0 23944.0 lirA lirAl 24100.0 24195.0 UikMi1lan UikMi1lanIflZSRe 24167.0 MjfJ 24176.0 1532.0 18420.0 jf 18588.0 t4j1Il 24308.0 24384.0 4j1Il 24396.0 IflZSRe ct1 e11260.0 24360.0 rkt1t rkt1tT VtKJ VtKJy1 24468.0 y1 16384.0 24439.0 ItI 114 16820.0 18824.0 rJVlll 18956.0 24611.0 T24559.0 willinm9 24592.0 16255.0 18084.0 4Lt 24595.0 1JtN 24568.0 owh 24571.0 24783.0 24795.0 tN IDh 24887.0 18244.0 18831.0 18839.0 18972.0 24960.0 25023.0 m16128.0 18180.0 ItW 19007.0 25147.0 25111.0 1or 25099.0 xtrl 25115.0 t3a 16748.0 25168.0 25228.0 i25271.0 Aiv 18931.0 25436.0 25431.0 25407.0 iril 25439.0 rbantl irbantl25359.0 JWyn 25412.0 iit2lr tp 25675.0 t2lr 25692.0 Prti 25699.0 16407.0 25683.0 25611.0 11trl 25731.0 25727.0 25687.0 Inn 18124.0 25639.0 iIla iIlai 18624.0 t1i t1iiyC 25915.0 Wyn 15528.0 iyC 4t1 25888.0 lJiwpf J1Jjr itfir r11t 25847.0 17136.0 jg urtittlr urtittlrAh 25903.0 Jrrtrr 17895.0 18032.0 Hrr Hrrt 15664.0 26051.0 26091.0 Ah 26084.0 hri1io 26119.0 nb 26123.0 1lt 18607.0 18732.0 26211.0 26299.0 26256.0 ti15988.0 26287.0 lyiri4 26239.0 lnn 26247.0 Wi3 26343.0 yi 17068.0 26347.0 Wfft fitstilrwfitstilrwt JIt JIto 17819.0 26251.0 tlnn 26511.0 26523.0 rtff 26519.0 IalJ 26612.0 alJ 26711.0 18660.0 26619.0 l1QhfytJ 18892.0 15539.0 26939.0 QhfytJ 26951.0 tlJf 15636.0 27143.0 nitd 27203.0 p18759.0 27147.0 xmlns:ns12 ID39 2340 6568 12168 27303 ns12:type 27303.0 Beauti 13256.0 till Ribbons 15344.0 27315.0 14991.0 27447.0 8ft 27471.0 el0 27435.0 16944.0 daf 18100.0 ittlau 14388.0 27511.0 12276.0 27743.0 tlau 12432.0 12780.0 27703.0 27711.0 12880.0 27735.0 lv 13076.0 13628.0 27667.0 cc44t 27848.0 14336.0 27640.0 rtpva 14732.0 PJlJ 27791.0 qr 15859.0 27655.0 t1G 18644.0 27831.0 rio 16892.0 27891.0 27851.0 27855.0 tok jAAt 17747.0 jAAtJ 27836.0 27999.0 27991.0 28151.0 28167.0 13492.0 28187.0 13508.0 28080.0 1832.0 28119.0 16812.0 28211.0 28247.0 12568.0 15016.0 28235.0 28243.0 12704.0 28271.0 28503.0 13504.0 28479.0 rf 15524.0 14624.0 15619.0 28439.0 28295.0 16552.0 28412.0 28323.0 Vt 16875.0 28359.0 28367.0 2r 28591.0 28603.0 14040.0 28615.0 28599.0 28623.0 28611.0 Yr iN 28656.0 28671.0 28683.0 28747.0 13339.0 28647.0 28695.0 fJi 14852.0 28663.0 28723.0 28699.0 28735.0 err errrfh 28627.0 tJl 12972.0 28751.0 28791.0 28807.0 1540.0 28828.0 28852.0 28835.0 28864.0 oi 13788.0 28843.0 28903.0 28923.0 29019.0 29123.0 12660.0 29147.0 29012.0 28983.0 13772.0 14060.0 29083.0 srw 29195.0 29051.0 rfh rft Yjf 29039.0 29007.0 1LH 15307.0 28979.0 df 15320.0 rot 29163.0 29015.0 16700.0 16715.0 29067.0 17960.0 28963.0 29135.0 fiJ 18096.0 28991.0 lT 5476.0 29271.0 12828.0 29295.0 29263.0 29259.0 29268.0 ia 29227.0 29244.0 29379.0 15036.0 29339.0 29235.0 29440.0 29239.0 Nl NlrI1t 29452.0 rI1t 29455.0 15372.0 29495.0 29507.0 29527.0 29563.0 29539.0