Gainesville star.

MISSING IMAGE

Material Information

Title:
Gainesville star.
Alternate Title:
Gainesville twice-a-week star
Physical Description:
Newspaper
Language:
English
Publisher:
D.E. Godwin
Place of Publication:
Gainesville Fla
Creation Date:
July 21, 1903
Publication Date:
Frequency:
semiweekly
regular

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.)   ( lcsh )
Newspapers -- Alachua County (Fla.)   ( lcsh )
Genre:
newspaper   ( marcgt )
newspaper   ( sobekcm )
Spatial Coverage:
United States -- Florida -- Alachua -- Gainesville
Coordinates:
29.665245 x -82.336097 ( Place of Publication )

Notes

Dates or Sequential Designation:
Vol. 1, no. 1 (May 1, 1903)-
General Note:
Publisher: D.E. Godwin, May 1, 1903-<Sept. 27, 1904>; W.L. Hill, Oct. 4, 1904- .

Record Information

Source Institution:
University of Florida
Rights Management:
All applicable rights reserved by the source institution and holding location.
Resource Identifier:
aleph - 002046228
oclc - 01446361
notis - AKN4160
lccn - sn 95047242
System ID:
UF00048582:00150

Full Text












T. GAI AR






THEGAINESVILLE STAR*.
I': I TO TI3E VO L, JN11TIJ ) POLITICAL IlTTER EST8 OF' 0 &TY s rT1 ~8.E.

VOLUME I. 1RIIAV, 1913
LL4.ft .B4VA~lkl9MilW
FTHE TWO GLASSS. KNIGHT-LAFONTISEE. 1). G. rowland and Dr. E. B. Howell
and brother, Liute I lowell, were among
Wine nd Water ach Tells What Itop Youag Couple the pronineitt sines visitors to the
Ias Done. in "anevil' city- yesterday from Newherry. W e h ave
There are two glasses, filled to the bring, A beautiful houi e wedding occurred R
On a rich rnan's table, rim to rim. T u WO a iit th ome of the bride's parents in this iea rfect ordIn, and ver cheap Any
One was ruddy and red as neood, diiv W .Iay afternoon at 2 o'clock, one wishiig it againn should come to In Stock, and are consta
IGF Y R A ndl one as clear a s the crystal flood. -h coknt t ting X parties w ere M r. N\- ,. th e St o f v *'rhc aet. 0 6 ,h fo ut S to c kg U od a e "
hed Whiskey and Empty Bot- Said the glas of wine to the paler Judge Wills Denies Attorney R. E. Knight of Vldosta, C-., and Missl3/,csl ing "'up-to-date"' Shoes or Men,
1 rthr jWniieo ti .Rv). villetve loe t St-lsiemi yr lilt1 for St W o M~men anid Childrenaro ua
ties in Fryer's Store. ILet i rtell the tales of the past to each Davis' Prayer for Injunction. 1 1.it iontisee of this city. hov. .a Agustiie, Ie < ilt.N will attend St. prices and of the best popesa
antell- offidiated, And only the family anid a very Josepi's Aculidis Miait News.
JOB DID NOT WANT TO COME1. And the proudest and ;rantest souls on DAVIS. TALKED AND TALKEDr isesa. rem aiere present. thn are n s. teit of W e cll
Fell unaer ny thuch as though struck by who has been in the employ of J 'gons ever fiuvied tir sale in this city
.blight Butonas doring the past year, and he Fred ing tilt iin sttht i Particular attention to te L de
But Sheirf Brought Manl and Where I is king for I riledl in might. t roduced N rgumOe t-- h e a fteda h e Fred King, of frt im of JohnsonherC. rt" aO the ades
Whiskey Together-Joe's r the heads of kingls.1* torn the Thrasher Produced Law The bride is the beautiful and accom- King & Co., Macon, Ga., arrived in the "Broc ort" and Mens
crow; pishl dugher f M an Mr. L N.city Wednesdiay to greert old friends andi
Explanation. Front cr wn l of fame I've hurled and Judge Did Balance. LaFont ugt, this city, and is one of tre solicit rier fromeca" an -"W alk Over"enrad
Sheriff L. W. Fennell is said to he an n enwri The saloonists of Alachun county have most deservedly popular young ladies in old newspapers, suitable for wrap Ing,
I lablttetl iany anl honored name, purposes, I's eta it hundred or 2
eathsastic cat hunter, and if he finds la etae virtue an honorhame lain met their Waterloo. In the case of Gainesville. e s, a STA. oler 25 or 5J
any of the blind variety of tigers prowl- I have tempted youth with a sip, a taste, Sam Leonard vs. Btourtl of Couity Con- Inianediately after the marriage Mr.
legaround where he hunts cats, coons, That has made his future a barren waste. nIissioners, etc and I. W. Iennell as and Mrs. Knight left via the Atlantic C. col, tls popular agent of the
ad other "varmints," le captures then Far greater than king r I sheriff of Alachtua count., Flrida, bill Coast Line railroad for Atlanta, on a thoAl Air l.111C rilmat, at this point, f 08 11 8 e4 pu018. and 88jvid $ oft,
alive, brings them to town and places Or than an army beneath the sky. for injunction restraining the sheriff anti short bridal toner. Ims etur it on a few weeks vacation
them on exhibition in sonre of the court "I have maste tihe aris the driver fail, all other officers front attempting to en- They will make Ocaly their future spent inl Alabamat, etd tther points.
rems In the city. A sent the train fron* the ion rail; force the local option prohibition law i houe and Mr. Knight will engage inl Mayio \V. R. Tt'. tured WednesWell, thesheriffgothuntingin his head hathe shriekt of the Lot were sweet now in1 force in the county, Judge Wills, business there. lay front Kentuck is t irv he bought a
lad Tusday, so lie arned himself with to ume who was hohlitg court in Bronson this The Star, with other friends, extends car load of tinie holes itl muttles., whtt1h
his badge of office and went up in that week, denied Attore) Diavis' rotion for congratulations aid test wishes. are niow in sale at hi, i.tbles inl this city,
iseek o' the woods known as Ihigh Fate, satrenth, health, genius, before temporary injunction, as %%ill bie qcen by Rev. W. J ('apeitter left testcrday
springs, and before he had espied a cat, you fai1 the following: i for Fernanilinn, N hert, lie sht beei re. I
agL bagged a coon, he accidentally (?) For your might and power are over all. In Circuit Conrt, AlachuAR Countsy, eighth IlDr. W. II. Sibley made a professional,'luested to go setlelcr ali tesulil 'same talbled on to a dei which a little bird Ito, ho, pale brother," latighed the wine, Judicial CircuitIof Florida. In Chancer. visit to W 3lo yesterday. ete lost night atmiins tgiu ln was occupied by one of those great Sait Leonard ig llin yeur nothing cleanet at wen county, whi.re K %t mi dry election is
"vamints" of the blind variety, awl as 1 lil? vs Llyd Dye Wo .s July 14, tf *,>n to ble hehd. T T
the place emited a "bug juice" odor the Said the water glass, "I can not boast Board of county Coralissit. Mr. and Mrs. James Skinner were in All woien ati ist men are harmed
decided he would explore the den, t n a heart once had, era, etc., and L. W. Fennelh the city yesterday from Archer. witi a handsa e ring. Ve ca sdow
assbe found the following list of By ury crystal drops made ifht aid glad; as sherifff of Alachus County, A car load of wagons just received and you riMgs to suit all to teN, from simple
"things:" Of thist I've quenched, of brows I've Florida. on sale at Thomas' stables. ones for habien to those et with ens
folhlailsoo f tirs I'e qencedci bros Ive lorda.I oautiful enotigh ito leih es
One-half barrel of one-half pint bottles laved, Tie above cause coming on to be hearl 1 Col. C. C. Thomas has returned from a ut eligt c ess. HIS PAPER is pub she
of whiskey, two-thirds of a barrel of one hants I've cooled ard souls I've this day upon motion fir temporary iii. professional visit to Tallabassee. Aiitvh
saved;M ral Business andi Poliica th n-etee
plat bottles of whiskey, four barrels of I've leaped through the valley, dashed junction. 1) A. Robertson has been on the ajck atev tri t it as r e St of the Moral, Business and
empty whiskey and malt bottles, anti one town the mountain The same was argued by Robe t I list for several days, but is on the tmend right tdent IL 1 r Floria Sei. terests of Gainesville, Alachuauiountywash
J. Fryer. I"lIwed ii the river,.and played in the Davis, solicitor for comiplaiiiint and by I Four roots to rent, Next to Brown ry.ghtat uek ails'o ll e F toriun
Pryer disclaimed ownership of the 'dept in the sunshine, and dropped from B. A. Thrabber, solicitor for dl fenthusis. lutise, North. It. A Thrasher. 2 lown to buiness right, and the city will Florida, and in the financial interests of its
liquors and told the sheriff they were left the sky, Upon considering the amie it is ordered, Mrs. Naicy Shaker of Tanipa is the he alive with atudenits.
there by Dr. Ballard, who resided in High Antl everywhere gladdened the landscape adjudged and decree thitt tire simne be guesteditor and proprietor.
Spring several years ago, and who has anI eye. denied. g Wants a lorse- he Cle Plano
since died, but as the sheriff don't le- I hive eased the hot forehead of fever Done and ordered at lionson, Florldit, i ie Re .s o Alachum has Corny wants t e a good iaro or THOS'E W HO seemed to think when we
livtenion a vibit to Mrs. .1~, B.Mcbonald, organ for a god litigg) horse. For fur- ~V L~ ue e
lieve i putting off such doings its ruin- ant Imi, this 23d of Septenmber, 1V03., tis city. other partictilars tall i*n A. L. Reeder,
ning blind tigers on a dlead nian, and as I have tile the parched meadows grow J. T. W.s, Juge local manager, .;7 Court Street, started more than four months ago that THE
the ball pint bottles were nicely and, I can tell of tile powerful wheel of the The saloonists i Alachu, county, io *r f in y, county coitis. GiResville, iwa : STAR appeared in the journalistic, sk onl
fruelpy labeled "John Kazauzas, Valtlus- ill, through their attorney, Mr. Davis, have bnorter front Wacahosu ii tire it Mrs. Royal C fil, wli ws recenity
ts, Ga.," (where Fryer has been in busi- That ground out flower anti turned at been making a desperate effort to defeat erda). ajugei inane ant hi inte ben sta for the purpose of shining on a short temperness), asthe marks on the barrel head, nry will; the will of the people ever since tile I C. L. Me beod, wife 4d children, were iig at Mr. Most' E-lelstins imhoue, reshowed that they had been shipped to ihat t luanho del d y county was voted (ry. Their attorney its the city yesterday fanat their home at turned yetttrday to htuv hrnsband's hottle, campaign mistaken.
the 'Righ Springs pharmacy (Fryer's I cheer, I tel I strengthen and aid; sa shown himself to be n hard worker Rochelle, and it is hopel that tJhe will sorm be
business), the efficor decided that he hal I gladiln the heart of tan ad maid; and leech like Inangemon, and had there I. F, McCall. Jr., the Fairbanks naval clothed in her right mnind. T E STAR the PEOPLE's paper,
found the right tiger in the r.git deii, I set the wine chain captive free, been any law n his Aide of the question stores mart, swas a business visitor to this If your hair is becoming thin try GId. and will advocate such candidates for office
- ant that he would bring the whole pusi tni all are leter for snowing uie." we candidly believe he wonld have foIn- ity nesisy. dings U'nparalleled (11 Grower. Fot
t6 daiIesville together. 'liehe are tile tales they told each other- and produced it, but being without law Car lAd of frat-clas Kentucky horses a yd. ei r. t .11n d n9 StoSe th e
fa ltit- glfs ofstcls Kentuck horse itsh 'ile tbrtotther-mn soe s h dto eiee r
Mr. Psyer didn't want to coune wvith i glas a wine and s pa er- and in tIe absence of any argumnient on anti Dmiules ust privel, and on sale at Springs. t
the sherif-eald he'd come down the Astich r.4it ta> le to to rin his side of the question, e could only Thomas' states. Mr. I. II. Crlibbs uf Hawthorn, who is people's best friendswhen prince e
oeat day-but the sheriff wanted com. talk, talk, talk. His ability, can not be J. Mt. Fryerand Sam Leonard were in located at tLennon, was a itusiness visitor ence and ability are all considered and
pany and insisted that Mr. Fryer hodu- ViOLAT.as (JAME LAW questioned, for without ability, and won- I the city Wedmesday from their home at tothe city Wednesday, and ordered The
aceompay him, so Mr Fryer came derful tenacity, no lawyer toult Iwithout high Springs. Star sent tohis family at Ifawthor. Af. while friendly suggestions are
along with Fennell and the liquors, :11l Iw.# P'rominent Young Dentists Are a syllable of law or shadow of justice on Air,. J. J. Williams and children Cribbs says he likes for his family to co*ed, the policy of THE STA i
notwithathudlag their late arrived in tile Vined fur Killing Quail his stife) worry 6 few of the temperance have returned from an extended visit In have good papers to read.C
city that night, the prisoner got up t)uke aeihiestav Sheriff i eiill arrested people and keep up the spirits (we mean South Carolina. t. rc. Cail, IaACrnbe; I, K. Anderson, trolled only by its editor and proprietor.
and lagley-two saloon It-ten lucre--to firs. 0 J;. Tis)n anti it, IL. Jarvis, two of keep themur htopeful i of tile. sitloin people J. C. Newberry, a contractor anti buui- fligh Springs; 1. K. Mbianims, Jacksongo on his bond till morning, rather tla Gainesville's iost popular young den- as long as he has. ness man of High Springs, was in the ville; C. W. Ilauikiniglt, Archer; C. W.
put up at Hotel de Pennell. twists, for hunting antd killing quail, in Col 11 A. Thrasher, attorney for the tWells, Anhu.i; an. .. Af. l .avi-sonm,
Wednesday morning he waived exani- olation of the game law. defendants, went to Bironson armued wihity Wdire. .8 sy o ansili h ihSrns eee gtetasc u N e t
Instion and gave bond in the stum of $500 I1he youtng mien were caught in the the law anid justice, anri, tereftore, hl us o eativ .Dey or Sprinel.,Tims tors t ofg bshinegs werte tyou thisdta.a- Vu N e d Im
for his appearance at the circuit court act bty tine sherifff htimnself, andt, while but little talkhig to tdo, bint gained every thirparum t.as 2ie iot kl- Y f P ~ F
twen wentonv i aybrejoicing () btc prtes a1sion y icn o thsity ind thepleasure ant pty sawe the fri craft of Sheriep I.W. Pennell umsade a briel work elr thie h eial henti o stOsN ed TE TR
to High Sprlapg. shreriff lislikedl to cause themt trouble or his opponents go to pieces against the buitsiniess trip to thte southern part of the no more than inferior work. We also
.The editor of The Star accepted air in- iniconvenieince, thne law hail beemn violated, rock.bonad shores of justice. County last l uesday. Carry a nie line of paaraaolisit an uibrel.
viaiootogodontoth jilan seanti the sheriff conldl do ntothning but The saloon men are looking blue, antI I I. Guimnn, of the wide-awake town las at reasonable prices. I.' C. Smith. IF YOU'tT fao u da--oiia and

Alltht e ee cptuedished hee* ea fr ril.them-having become "tired of this fool- Guineuville', Wednesay. copies of today's Star to, see what's in 0O W ~ jy r m
all tht ben capetred ji he qthe he fofdr wetrrrigedbeor ishnes"-has packed up to go to Jack. Preshitng Elder Cole, of the Gaines, it are requested to call nit theicle, ornsee ST R d rig te o ig a p ig hc
a saloon-like appearance, but the few Justice Colman yesterday morning, and sonville. WVhere the others wil go is niot valle District preached at the Methodist the edkotr elsewhere, andh subscribe for to
prisoners in the jail antI thelfiqutors never eacih was fined $25, amnd costs, which they yet known to this scribe, but if they con church Wednesday night. it. A manm shonMt niot Ie hrrowiing a 18st be the greatest ever conducted in Florget tO~ther. pitl pronrpthy.tinue in the liquor business they will r.atMs. acs nh letthing that would coat hun les, thtan one .
pt together. p~~~Waierr y thatd sonme of our most hvtogo fromr Alachius county, for a WetIrnesha for Ne Mark, adewill eacnts4colsoTh arfrs.Bt Id ,ndiy udferw hteeioonp iTll8 CITY PATHERS. promuirnenrt citiens will persist in violat- majority of the voters, tnud His Honor absent a week or two. isGitddens' LUnparallelet lir Grower iCal Or Other matters, yOtt 8l5081d read the
Revnu Od~anc pssd-ras ig hegaruclas.Wehav feqenlyJudge J. TI. Wills, of the Highth Judicial is all that its nme isn lhics. It cures
Weven OruHa tc PassedTras 'cagleti antrin Th t.av t thatg Circuit of Florida, says Alachua is a tlry Mazxey liennettaturedy t his dadrf stelps falliungh< lrM ait rSOth tyoocnknwuh retohtsi
The City Councilmet Ioday evening ers that now surrounds our sportmen County._____relatives and friends in this city. s ainesv se~a dthe I'stel Iru~h and how to head him off.
and completed the pssageof the revenue friends, antiacautionel thieo ans tijo TIEAC TS~K ne lares an bust sot nitent of har- High Springs. SEKND US T O NET DOLLrARn d reciv
oriacwihi o a.I m nrotives hrave been pure; we base done it -- offercI for sale at W. RI. Thomas' stables. Mrs. E.Frenh, tht frthfuitem
poses alicense on almost every kind of foheifrmto oftepbic, believe Preacher Pailed to (et There, and Dr. isssNtl hke fTmsadperance worker whit hits livedi at Wind- 'O W VCm nh
occpaio, ndisconsidered b-i some a for iteto berthetduty of thespap. ev- toSiSpk. ges Zettu haer of lampa viitnd sor several months returned yesterday to
ver isween lag w. arer o w empupa-n keep the people posted on such matters. Rev. Mr. Wells of Jacksonv-ille was t Afries anZet e tlohety orfe w uskisitingehr oe ~in rs
t on aasbe aes muw bex pai ononce we published the game laws, anti have addressed the peopfh~ (f Starke last fctl adrltvsnthciyfra fewtrench was ant earnest worker in the V W
lceque tsanthtaemutbpadseveral times recently have we called at- Monday night, but ani tcient to a Vrsleasarceisad.tbe temperance fight that termiinatedl in a ~ ~a~~AI
'lemnPdikcle teto:t tenutioni to the importance of obeying freight train on tire roatd, mule it imnpos- Call, sent me your orders or 'poe for ofra u cut y na h temperanesi' people
Aldrsae edickcaledatentontothetti sible for him to reach thre appoinitmniit. what you want. J. G. Harrold, 'P'honeofAchaoutndn nevll
thgae f the nelet c omplintio ofr be- stlemieni Y'ou can nrot justly blame Int as good fortune would have It, Dir. No. 25. she will more than filth the place of army
tng alaewftheeglencted ontion fcmu theofficerstfor enforcing the law, for it Is W II.Sibley, of this city was present, Sherifflennell made au o~cdal visit one who may heave b~ecaunse thne townD .ODIN dtr
di rat o with reence watd the acocilu their sworn duty to dho so. It is your and was called on for ai temperance to ifigh Springs Tuesday and brought went dry.
tlatneo the pen w hdrve theci duty,'as good citizens, to obey the law. speech. lie answered the call andi spol' back Joe Fryer and some blind tiger ---- - -- Gainesville, FlorIkla.
troi (atreget tpron woroe Othe ait is trot the worthless loafers around for about three quarters of anr hour. is** quor.
erten agreed with Mr. Pericktherd a town who are most likl to violaefh aspec was lamiabl on eatIa was highly be dye wat amoasy tobuy a home, 011d 0111' L811111101 t0 4,,,44
r-lto ovra h gon a men wino would not stoop to commit D~r. Sibley is an old soldier in the tem-. or a asntract ore p &tabhlest-'['H
It I a otoiou fac tht terehaswhat they considered a crime, butt they perance army, having fought uniter Gen. .,et Moyers.
bis to nrious faiece aon thre pas bl~ ieso ad helioencl'soagtioinsar ie law a wrong. Gentlemen, it's twenty-five or thirty years ago, when camrieup Wednesday tosattend the mar- U
ticaerlnemand t Coni h wrin n ong; he careful, and don't let's have la.scrdaosiutoapohbtr rae of lus sister, Miss Iarln to Afr. II. J
anetmttorrellteotublhehebeart it law Knight. n v u u u
approval of many of our citizens. any _oretroulebou (.The editor of The Star heard the Doc- Giddtnga Hair Grower does the work. J. Runlkle, Proprietor, 'I U Y ~ TBE
toe speak here one even ing before our Vor Sale by Dr. 8. B. olddinrgs, caluesen.a...* is rs.It Was a Dandy. local option election, and his old temper- vine, adPthe P'ostodfice g sbtore.lHigh CAINF.SVILLE, PLA.
Of mnite o te oselwh i wlt Mr. F. SI. Ramnsey, a prominent citIzen an-ce blade had the true Damascus ring ________________O f a s l l t r o h o p l w o i e l o a a o t w s i h i y W d t tT h e fam ily of A ssesso r C o lso n h ave r- B' kowalapt. h idct: h aup rbn day anti, speaking of John Stockton's The Doctor saysbhe was truly gladf to mt-oved from Trenton to this city, and RI GS
Rev. P.W.Cpreached an able see- Shel hIrPotIspeedi,w hten'It heard shakethe handeof Laye (;ornt0uwhile thtman ~hedestrableadditionltOsine- Vou Chckn, gsITBPLC
man catio hi reeahrksh paid.I thao t as well taken by the vast nm1 chasable lawyer, and one whomr the so. Mrs. WV. II. Palmer of North Gaines- Vegetablles, and in fact all O G T
tmhe hcomi esarks he knows bar ofople who hear it. John Stock- ioon influences in his town andI county vylle, who has been in Chicago several kindst of Cotuntry Pro-I
whesmsfa hi h or ead hmel knos r eori lit," cannot buny. months frmdcltrustasent, is expect- duce. FN
wh eeeio f e sp eak ,fr h e n conelf is te -s a i .e om e di a to m orro w .E
wih h Bpts p A.hbed ithi city. For Shrif Cotton is coming In; business is pick- E F A.
ii5e started the qe sppers inerent ing~tps To the Voters of Alachis I ounty: log up; money is more pleotital with the 1itghest Prices f or Count -ATlaspctasstate inpresnfinr. herebyesasomace tnsetsand armers, sad dellaquest entacribers try Produce. anti f-ll as
evl adthtwhn hepaes iefwthr the office of Sh ,subjet to the shrontit reemerth aitr*Chn s heChapst
Mac othr ies the aer ovding with E acStioni of the next Democratic primary. Wermmegh dtrcepaQ~eCi itAt K R UI~ L
**h thr s he se owdongin 2If elected, I ise to discharete W have provided orstock with ( 3
Taitpa la publishing names as well as ,d thf e t a ot th~ gs espcill suiable...rb ithy C A L L. O N
places, Itallask the streagiholda of wick-. abiy ,ad th soliciwhen youor want Sh*
edaees a they waseshaken in Tampa to- '> soN al"Bv.J B Hleywaa Mpl adFacyOocris
day. as ...s. earvies wUi be w.uei .i C HAGUt yetns, esaia e ~gg iMA 80. alIiveOsA8Tral
constinesthi We is a pleasant a ___ed___AIEVI___ MCRYy

SMill agigg elect np* ~ ~ ~ i?~'









T-'8 TW40.A.WIK 81TAR, 4AINH$VILLE, I&
RACES WILL A ATUORRENT OF
"WEEVILIS RAMPANT "ADVICE" TO PRESIDENT. o DFELLOWS IN SESSION TRIALIS POSTPONED IcDirerea of News. D r o fAtlai r rSu M.
Chloago Federation of Labor Sends Annual Convention of Sovereign Grand t r:e n of ews, Novel Attractions.
Roosevelt a Long Letter Express. Lodge Assembles in Baltimore. The directors of the Southern Into 0 ed in Appalling Butch-Texas Pest Ruins Cotton West Ing Displeasure at Attitude. Accorded Royal Weloom*. Delay of$Sven Days Granted state fair to be held in Atlanta 're
-ea or iefSummar ofrMot ry i ery in Town of Kastoria
of the Mississippi. President Roosevelt was voted by The openln execises of the ann,. In Case of J. H, Tillman, Important Events busy in getting everytbing/IB 111
the Chicago Federation of Labor, at convention of the tovoreign grand shape for the event, which Wilf
a meeting dwiday, a 9,O000word letter 10490 of Odd Fellows began In BAIIofEchD y hold October 7 to t=4.

GLOOMY PICTURE DRAWN nt. quo o*. Ga M rd..oar. oten o f LEXINGTON OVERCROWDED -A.en oor -- s.ai to. o eoxit there,l b REPORTS ARE CONFIRMED
the proeldent's attitude on the qutes- the grand lodge of Maryland, deliveryd In the western section of Worth coun- th:a-g.e will move as smoothly as tasy
-;;-t:on of open s hops. The letter was an address of welcome which was re-: ty, Georsta. In the last year five men have for the past several years. Lts ipth*Sae htTw
-h mlst In Em ploy of Governm ent I;rom pted by the decision of President eponded to by Governor Sm ith, n o Great T hrong G athered in Little South have been m ordered and only one ar- H K olley and John K err, ye id o w a ur gTen Thou sh d Po**
M makes T our of Infected s ections R oosevelt in the M miller ase in w h ich th e part of M ary land and M ayor M e. C aro l n T ow n W ith E x ectat ion se t h as been m ade in con seq uen ce. r at e n a o d r f u n o r
ad Predicts Dire Calamity the president nid that Miller or any ane, for Bam B. Goodwi, of of Witnessing Interesting -McDonough, Ga., had a 100.000 city with a carload of running bore prkl l
for the Future. o thaoler u ntpritin Georgia, then made an address, aftr Court Proo*dingr fire Sunday afternoon The blaze be I which wil tol b in the races i
Chale P.McantachmisoI'110lccuntofnndNi wrshs nnounon whchtecked tin ganelogepr-i&n.t 5o'lokiediasnotchcke ,trefar.Addtinalhose wiloa
"Deliaccount r-embershp In a unln which the overelgn grand lodge pro- -- ntil 10. Two wholq business block% from Springfled, Ill., and Hender so,
Charles P. McLan a chemist ura l o the "Deliciously unaware of the hypoc l eded te d lo temple and e. On recommendation of the gred Yere destroyed. Ky. Some of the finest bort k In h e o s from Kas or a S. t e cit eploy of the agr iult ral depart ent sy of the world of finance," "honnet Thejannualcre t oGra n d Jury of Lexington county, C., a d -Colum bus, a has a last bee country will be seen on the track, an is bsng and ta t the it
Of the United States r vernm nt, ur. find hum an*, but un hnform cl," were The annual report of Grand Sire aad Coum ue 0a. hae ats rlaet beren .n [ u n n a d t a he m z c e o
tt e U ite ste Commander In Chief John B. Goodwin, the bar of the town of Lexington, the wanted the through line of sleeper the out will be witnessed It opulaton (e tm ted to have nu
i Te d a at Knoxville, Tenn saturday some of the clause s used to dese rthe which was read, show the order to be case of the State vs. James H. Till. from WaNhin ton for which It has to The Fair A enocaton 1 paying sp ** t ed 10,000 p ron) wa s la ecr
rm Te as and Arkans s, wh re he the president in t;e l, n letter of th In a flourishing condition man was postponed M onday for seven on g besought the outh r a railway e181 attention to the racing g th ls year ably terrible The Turks sl a hero l
ope Thep totalcc meanrhl was po tp ne Morday fode e ln e ou h h eu r iw y
Iliad been sent by the governm ent !o open iho p armm raohs contained a The total meb ship of the or-e day a South Carolina state o ticers are and in addition to the horse races ldscr m lately Bul r as a nd
i n v e s ti tate t h e d a m a g e d o n e il th e d e fi n i te d el s a lm e r o a n y w is h t o a t w h ic h In c lu d e s t h e s u o o r d ln a te o I t is u n d e r s t o o d t h a t a t t h a t t im e u te d o v e r ad s c d o mi Ss m o ti t s s da OrInk tdi, m edn a n id r e n
cotton belt by weevil,.akM.V oeeL,(ebaefrt, membership and the sloters only cf Ite TIrs burnedtoo thatee attattmeterldre.soeofte ot a
c o bol t t e hl chief executive's attitude In the Millr the Rebekah lodge membership, ;s o motion for a further contiuance will murder, but refuses to surrender his tears have been received by ecret atl
He has pent two month tudyng affair being played on "a coterie of 1,329,950, 1h1 made by the defense- grounds not office to the coroner and the state law rank W elbon from Barney OldS ell, toear h A n sko o en Sptember 12
t he Insects, nd amts that the frtain well known Interosts which are The total revenues of the order i stated. It is supposed that this ti a forbid the governor's removing the the champion automobile racer cf tesr e 0omena nd chl suture of the cotton-rowing section stantly on guard around" the white 1908 were $11,558,905, of which $3,. point of favor of the defense, as they horifft for any cuse., America, In which he states that te drenatrJerian larevengefora defoot
11west of the M'seliippl Is exceeding, house. The president was told that 898,380 were expended in relief* were afraid of too jury. -At Frankfort, Ky., Sunday three is ready to do a few stunts in hands h r
ML say s te fell into error in his view of the The streets hotels and public resorts The grand jury made a special pr negroos made a daring escape from one ofte bg a cthe big gasoline machines. I t e sad he turn
", loomy. aythtt n question, "because of that impetuo* were allied with people wearlag the sentment reqesting that the six other Il. One of them plit the jailor's is said that when Oldfeld's machinej ostarved romn ae mtienns Oto
Mr. Mcneys Tatth cou t n wity for which we love you." & copy I. O. O. F. designs and Monday night murder trials be taken up before thott head with a bottle and the three then round a curve they sometimes slirdvastated om ere mu r4:rop la ninetysix Texas counties wl~l of the communication will be forward, the thorouchfaree la the central part of Tillman in order that Lexington reade a successful dash for liberty, forty feet. there de bydsoldiers.hoe BetweenrSeptembe almost a total failure, and that the ed to Orater Bay at once under date of the city, as well as public buildings county m ght not b burdened w th the ln an atte mpt to escape from th The Fisher Automoble Co sod tho er 1d et
-trtr n t pat rnsas apecaaiy of Lao d etebe foand many mercantile le houses, were expense of holding witnesses. South Carolina penitentiary a convict, Ford Motor Car Co. have alro not 11 B andetedbor he nesh
The reading of the letter before the brilliantly illuminated. During the They were not concerned about the Grant McNeil, was killed by Pre3t6a fled Becrotary Weldon that they wi Krushevodla the presence of thenkl- epte1ranceo lie predicts that cotton federation meeting occupied over an evening a reception was tondered so Tillman case, because Richland county Jefforscn, a trusty, who will doubtless be on hand to take part In the races. neaken (adminitrator) of Krushero,
appwn In the southwest will decline hour, and eqcited applause from thq Grand Sire Goodwin and General Pa. must bear that expense. be pardoned in consequence. The contests between the big tu m
crowd of delegates. my, commanding the Patriarchs Mfl, Solicitor Thurmond made an effort -At the negro Baptist conference In chines will no doubt be a great draw. Ians.
n the future, tant. Grand Master Edward Rossman, to have the case set ior Thursda-, Boston, Dr. Booker, president of the Ing card and will attract thousands .; r ish
All efforts to destroy the weevil NEGRO BAPTIST$ ON ASSAULTS. of Maryland, wes master of cermonic., but he could not prevail. Arkansas Baptist ocliege, told his race people to Exposition park chTsktsh bee see n o fortl
Foselu Invehiladelphpoloae"--The reception consisted of the intro Among the fourteen lawyers who ao- that the best thing they could do was t"Theh rePkd"s acsbeenloitctally
dvepouroed. Arkans u has not been teoolution In phladelphis Convetled ductlen of the leading members an peered In the cas Monday there was to Imitate the while man and Imbibe enl as the name of the midway at the frontier, la the vicinity of IIkovo.
ara b s ear as has n te Denounces By Members of Race hea of the a congressman, an ex-congressman, a some of h Amercan entrprt. amt
a dltbranches of the order At the sme former attorney general and a former -Chcago Feeraton of labor send s its, to the mountains of Krtovo.
b pr dlets that the devastating weevil Lynching and the crimes whih uq. time concerrt at the Patriarchs Mill. crut Judge. Pre side n Roosevelt a long letter tak. l between 3,000 Turks and 800 s
Will prad rapidly over the entire c t- untlly result In mob law wer r tant headquarters was j pro pose. Lex taton, a town of normal popuple seuereons to his atWitude on opeI
name wdo ten hedqarer wat Ihe comins Prsien Rooseve. a lootnue lette tak-ors
t land of the southw est w ithin two nounced in a resolution adopted by ,the A t the Initial m eeting"of the P tr f' t on of 900, held fully tw o thousand eo pe a p dem onstrated in the M iller name W lJ be e d a e comi g S The l aur nt u ed om b s w ith deadYr e r s P oe w It n y e v id e n c e s o f th e N a tio n a l N b g ro B a p t l t c o n v e n tio n I a rc h s M ilita n t a r e s o lu tio n w a d o p t p e o p le N e w p a p e r m e n w o r p r set can s p s o uiem oW o rld 's air a nd a t an l
ap p a rac e o f th e w evil h ave b e n sessio n a t P h ilad elph il T h e r so l .t ed to perm it th e m ilitan t b ran ch of t o m a s a r ae o can n o t affo rd to be second d th e d ree r e t o u ae b ned
"n: "04erac of the Mississipi tio prsnedbeen .1 Dro from a far off as Now York. cno fodt escntedr
Sthe MN ptlon Ipresented by Rev. J. I. Dart, of order to recruit Its forces from ana. -Posses in Montana are pursulnq tors of the fair have decided to Initiate repo
Both Carolina, was ts follow: ordinate lodges. The resolution will TItiman's Third Trial, "Kid" Curry, the train robber, who the uniqule title, asy were wounded. The losurgents
LOOKS BAD FOR CURTIS 4.... "Whereas, host of the bloodcurd* be presented to the sovereign ranrt The trial granted Tillman Is tne escaped from Knoxville, Tenn., jail, Chief W. R, Joyner, of the Atlants h twh al uned.
ling outrages committed against the lodge, the acceptance by the latter be. third hearing the former lieutenant -Bultan of Turkey expresses regret fire department, during his trip north e laet Rp aso ear Serna
W Witness Sware He law Defend. pure womanhood of our country mad Inlg required before it becomes, a law. governor has had since the killing of at the atrocities perpetrafed by Ie to attend the national convention of ensuget bas ntl sr,
-- 7Witd SweaGrs elawDn. which lead to mob uprisingl and lynce. Mr. Gonsales.
1 til o9fM C krilJt f h charged to mb rs an ou* troops and promises the Russian am- fire chiefs, secured many attractions aed nseate an woeenit: a th tr Uial of Curtis Jett for the al. Ing are charged to members of our TAX PAYERS RAISB HOWL. He was given a prollminary hearing bascador that they will not be repett- for, the fair, among the most impor- roude ofd Tuk antd hen oe.
aashinaton of James Cockrile, rac. February 19, when hp was denied ball ed. The murder of Bulgarians, how- tant being that of a monkey which us- pnh Tal
-. s Jekeon, Ky., the commonwealth "Resolved, we make no speelal plqs They Also Get Out Injunction Againalt and ordered to be confined In the eer, continues, conds in the balloon, cuttlog hime!f to to noun as.
Sa1"1tulurday Introduced William Cope an-i or excuse for such crlmi els of our Collector for Good R~aeons. county Jail at Columbia, where he To Lord Balfour, of Burleigh, s cre. loose and desednin a parachute, Bulgaria Mobilising T oop.
James Diaton, who corroborated oth. race; we frown upon any one who Is Tax Collector C. McCall, of W;i. malned until his trial, April 8, r ot r after reaching a height of 1,000 fe. Advces to the foreign oc Paris
f ere a to Jett being in front of the Elty of the crime of an assault o n cox county, G., notified Comptrolhr The defense claimed an bsence of try to Scotland, and Arthur yM l|0t, Oter rac i ing from Sf e,000 m b n
eelrt house immediately after the woman; we, the representatives of two General Wright Monday that 1,000 tx witnesses prevented their being read, ran'ial secretary to the treasury, the am o s loop toiall,
s. ootlg ad to the shots com ing from m million people of the blatk race, desire payers of the county had enjoined him and the trial w as pfotpo noo until the hae reign at o s w o pe in s e t r pr et effci orc tup toop 5 0,000the to place ourselves on record as say. from the collection of the taxes in the September term of court. the resignations who performed pi u At cinta some tior.
.' e tbatUtr was the testimony of 1la that any who Assaults helpless wo. county this year, and inquirlng If he Tillman's lawyers allegod that it wani d e cy of n ac co of yt he oreatig f ar s,
be Gre, the witnWo who s. manhood Is not worthy the benefits f must proceed with the collection of the imposlole to obtain a fair trial In dead commercrally on account of yAf- ie Interesting features.
41kP44 and said he was afraid of being life, but should be given a fair trial. state at of 15 per $1,000. Richland county, and Judge Townsond low fever there. There are over two A TO Y TT KE .med s Ma M1-150 .
'i 4* tetiled. re wis "Resolved. That Presldent Roosevelt The Injunction has been expoe'd ordered tat the trial be heard In e- hundred cases In Lnar, NO ACTION YET TAKEN.d, a 0.
6011111111 back under arrest from Lx. t to be commended by our people far since the announcement was made oy Ington county. -The longshoremen's strike at
Kr, He testlied tht he w s bl f61rlss stand In favor of evn the county commissioners that the Tillman's attorneys are arong the Brunswick a has been brought to a In Quiescent tt. alonc, Augut 4, ul rlan
ten fet from Lockrill whed handed Justice and air trial fot rate for the county this year wa most prominent lawyers of the state, close. The arbitrators' award of 14 T 00
shIotlag began. He and Cockrll both criminals and for his declaration at a $37.86 per $1,000. As soon an Lbe r.1,'e Georgo W. Croft, having been a law cents per hour pleases both sides and Tcel I no plten r i
M. He saw the shots coming in two time when paselons ran high and pub- was announced there was a storm of partner of TItman, and P, A. INelson all hands are at work again. celved a long cablegram from Minop ter Blonca, Auust 4. Ve-30.
106lle ftroM the court house window, lic sentiment was uncontrolled." protests from the tax payers. Advice being considered (no of the most -The City of Macon, for which fears nothing wa gen out regarding It x. 8o, Bulr, Ausat 23--50.
Bad sMIaw Curts Jett firins from the The eduational board headquarters of ,ttor4t1Ys won Pt onre sought and pruminent lawyers In the state of were entertained, reached Savannah cept the Informl statement that it ots, Bulra, August 30-650.
court oue at Cockrill. He tostifotl will be rmoved from Washingtoa to an Injunction served upn the tax cn South Carolina. lately. The passengers tell of har- contained no alarming news and was 80Is, ularl, September 1, men,
tht two other men were In the court Nashville during the coming year. lector prevontlng him from main g - -rowing exper dhees during the storm. in a o ring with routi e
1M10 whom he didn't recognize, and any collection. NO WEEVIL IN ARKANSAS. -n the Maama senate a motion n Wt80, Bulgari, Setptembr 1-rmuin
Uht but little smoke was visible, GEORGIA TOWN LOSES HEAVILY. It* Is -understood that the tax was was mde to rescind the resolution squadron from Beirut, It was tol, has and women-00.
let corroborates other witnesses it "- Imposed for the purpose of building a Peport of Government Chemist AI. giving Dr. J. L. M. Curry a place in not yet been determined on, and no 10. Sotla, Bulgarl, September 8. an o0110a111 that they believed smokelot Fire Cauns $100,000 Damage Int Mo. now court houre after the people of leged to be Somewhat MIlleading. statuary hall. The motion was ruled tendon has yet been recolved from garlnes-85,000.
Stew Ider wasl usied by Jett. Donough t With bmll Inourarn,. the county had defined to vote bon s Arkansas cotton men, and eiodl. out of order, but will be brought up Oyeter Bay as to the president's late. Sots, Bulgaria. September 1, gen
r Fire broke out in the building occ,, to do so. Things are seld to be at I ly those In Little Rock, which I the again. Its purpose la not known tons In the matter. era report-40.000.
-WOs iTION. led by the D, J. G reen Company at ver heat a the county over the enor- chief market for the state. discredit I -The New Orleans longshoremen Communications have reached the Kastora, September 1610,000.
Membe of. Edwards C Me Donough, Ga., Sunday afternoewi mou s rate of taxlton which woult the statements in the interview given have gone on another sti"e. They state department urging this govern. The sames of the towns' ldicate
One a Member of Edwad's Cabilnet. ad the entire structure, which ocu- have to be paid If the assessment of out at Knoxvillo, Tenn., by Charles P. now claim that their leaders betrayed meant to ay or do something that w'll from whence reprts reached Aarica.
S P( VLonos le te Pll. led blo kn Mon street, was tdo. cecounty commissioners wee allowed McLane, a chemist In the employ of them In signing tlfe contract with the put a Stop to the atrocities in Turkey Kiled by disease and deprivation,
rA London specil sarys:. Lord Bal* Also dese d Cmpto Wwd, the agricultural department of the lumbermen, It le said that pressure does not emo. women and hildren-50,000.
a, Bur secretary for Eot- Threar waCs also destroyed. he McCoalptroller Wright wrote Collector United states government, who ha -Booker Washington made an ad. nate from the missionary oetle. At Vilaes plundered and burat-1.
letad, sad Arthat Ralph Doulal County Weekly m ane he prnr apply t Tae the Injunction ould not spent two months studying the boll dress to the delegates of the colored the state department Ofelals are us. Recent separate Bulgarlan govern.
loseuy Thte ere otbe Jit of T enr y to inathonce to enforce th weevil I the cotton Producing coln- Baptist Conference, at Philadelphia, In communicatve as to the feell ea s o murder
o-', fllThel se oresinay at e dtasuyloes m h entr o tit of J. ,en obn a otha t fr e t h c elty mofbl wee anduth west ern ywhre Evn h0 e n d'thoa s ne t pre s hi te rlegn tro hees dn Shke trdopane-rd sch 200
-& be en r ears ied a t t ler b ealnt ou d County W weekly was destroyed. The l on o I t. l e stated flnt In seat eo l H o e bn e ad c r d re
With teeanaption of Lord Blour worthofaryo hae o boationt rehead would be to find employment are viewed by the People of the U uls

Aad Pl l tw acialt B eea blltt, b oth wi th l ne thae of ins r n. the b ihn t ut ws beoregtn the w avn tofa ou b t de t atehere ar e o r t H t then c m ited sAi esf o o a bta the s at threat, B rg rs report of oheAugultt3,00
_a s r e a ioi i n u l d e r t D I Na U C H A GeD. s ua le m r t e t c o p y m t t h e s o u h t y h i t h b o l l w e e v l di i h t sen A r k ansa . er D o ts v i nm a Il l, ti s s o u r M i t f rto ulr e s h o tr ia d I ~ 2 3 t w l t p s n g e d l amr d r
ph le t w c rc ll cert ain t t u tl en s man laeys tcens oth Co $8. 3e d inthec lsetao the tat e r)5 AReRp e l K e pR a GO D RCK.unsttan Wi co siMourda pnptrtt ate n neofthen o thr e on w la o and u diam ee-200,000.
8mbe to rialat bldthe eqlu en Ja m t rarCo la e n t ho r1phatic l v n mrod b r e i re$tvaw fe w P s~eyare ns In d faatal wttopr o n 8 fhlr 0U H R M K N IG M N Y
Bad, re l a ditp rt fo s repPi e y d p est a h r e e a y mhiner t osethourved ndth.M.l w n t d sole e confiernce Afen, wh o f tab lish ng e eu tralit Po iic a an Yldi of s k h rtend a to horktpa r H t A n a oshos d L a m rge ains5in
3 anbt e nllur ri elnt e ewe w in e t royed nt ount..oow I t o t e di t t W il o h ares aidbu t o ruhaivesedledo n K I trs e and m a in juc rte i po rn t fre b pefl fe ag teear There is beeproi v r L se r
atti tmnts islkeotubshesm*pato tobshpo Bokbnu.Y.terwudhaeteudrodafrmroIEanprn ld8halot Ms Jh rm, hredwt eenoprepil cag i huat NWYrkdsathsts h
$@ t desstrog mn tothe ar o. 0a worstated inrp ty aas frote The ilountx conyer arte ase rc.of $3,0 ere aptr ed onday the urdr.u ]to heund hmmi een ati.on.r ou rheporitsd tares la4circ aa eoto h oterira
ageadWion o thehgntow faLrd Brwtheeoa leas Th n pro.ram o w srance. te hinusttio llo er theysttw fameslftradvhtwihnhotuu.raridoacft Etotodoa.uwerelaiohrgadl ntoiaiosreteeajstisuensow tatittho.ca
M. luI~loall beetr lou t iaowrtly asitha benanouce.fsitlethmhghstrae ftaatonThtmntavetertamsast. latsh il b aragndsn.utanBup. ureyan BlgrarooinptoasotyaredefJne30ugosunig
-- 'e r n a fr e tr adr e oud t ever i known i the t tet oftGsucnastih ae v n d hAr e s ilas of ro ou t uin fth e Maedeso tia acuty ,wee $urn-,34,0 9 a l re e of $ *
= -WONGHEMEN STRIK ANC A N rtexton.-- Pih h ru ttybura.-Judgeroht n B.liEste,.MwhourMu Lassiwon B'ulg"ria' la1,t1,note1.81 pe cent
A T L A N T A N8t A Re Dl e I S A P R E .- - *R V A 0 0 88iP REt.o n* *P - - f a m e t okeo rha srsl d i r ,su re npa wdA A N D R B Iu rdOT A I O N
f ~ pleted, Trouble1atNewaOritansststResumedI---..... FORMR PH L P EM SHOLS legsator ded eyW n eel rday monlg fatta MILoEteohe rarp w 10N A IR A88ASSINATEDQ.
io o Ki ck ade oetan th turpris n fte r Supo et t e mt t t hes p o l i ig ith Ca ter ve Pstma n. I n t e is h oe lb Ginesilter ol ier s gest s re e co mbne with
Mege tain obeeece b h*vve.Nt ay abrp l en a e Ctrile ostaste r ker lit A Ma9w nla secil says:,bu The ne engd it t onspiray :o de memberng egtofs thatio bord of the w s ileaOtchro MAoNe I ., MOE.
feln01 t a oE naU'l l C o m panyd weileeleh q h o st r Ay oat t et w eeosl nth.. e o s h aet s p l ea d e di y t thoet nt h~ ch arg|" 6 e of,00 dw a o to iti~ r h a e Pust obe e l reg d atovernm ento h alst the at U n te M, nc uin e W oe r mica a u. alon on"o-h e rod-l-hs-r"
as itW gn deI>t ..adthogs r ea ben ane Irery ndut wthe whiche an~d iTw appr dopriate e m e$7,0 wto Tabihhe bmnetaltur e Dmne td ioaspee ate th cfree 7 ,00 snere estte t Lake Dester (lin th
of c 7 adaeouncdAn embrtfollxprles tl'them mne ty treec"lere odgh see~n r a s eramonttola $10an thdtc rts. w it tfrter 8prid fe d t th ohv ownde o forr, aes.r.htidngT e rnchaed its ti n tfr.,eve) coa mieretil ahne/ h tbveu end there owers, coo. te wH avssnated ie sayerw
alve ahtnotapplatli ed, nomb e T he, prandfl of the isoe lrro nse. ho e y woohanodn e b oufder onre of the0 est ualured stund s by the nregrof Giers ad bne to, Vinc sre rs re of coal so aneeal eprYodtleitet ohea itlali Th
$880,000 t | mp t wodcost ol tact wand saeuse term mmi the ho e l n traehslret. Al fteinse swo' e s ate a annuhl writ on, frmd thNo CarolnantontGar phrofi aind heg in erotlmightsretween Mr.et e eside s beol a a mit ll
f o dtrehwfr the iyor o ae voe at rought abou thesetrlmnt ofx thluiatteevneitio as on the sdae, Tlhe the prie naes of goin B o hve wld to thriel l ta upse rke hwages regardless tof a it- ale, was a we knwsNe Yor earn
t h e sd tr e et o t 8 ou t A r e s of t r 0 eH R Os O WH e n o n e ITE C th e d i s ut a d e w a o e eo t Mle n a t I a d st ut o o lee t t hl|In ef l sh pr aul d n n etilo n m i h o s th e c ale o n s u n g ubic. y w em a4, 5 4 0 I wl a I e pf 1

P e--ei-ntCtien o BrouiHRl DALolaRUTIN..Lols Tdeaof enaclr laeJDGdFRNKGAYtHOE
Ma at01aneNr orkklldowougnirIhedatneroe sOLtRAS YDOPeA

A'. dipac frnTl:n .yBfrobe UitNed States Commislod wa-Tre May NotPIN Recover.$-Si askaded erob he nk mofn ma n -othCro--.Esth MIl AeIpi Oratoral .
C.O 1tr ehnchkd A fTtwier atTroy, AtloGeen. AtI pallatith CaTenn..~ M on atrnm aor ra.Gu Wrk Mut noglasvle hin lhom s ofn o l JudgeFran B.uGart, CofmbiWll, Cadiat ----t"rIsttue
M fleound dead riday lon I Mp|all and Ricard Man wer he t on a sthr o seve r al vehirt. A dpatifon Messue Germaln,9 p residp rie nltaa, SrminetN,
*, tha t ead hun pot.e or The me e promint tensr~ent f atrally. I ayr' c te thousan0 forkinm dear pen. etblihed, a Thomadrle a. Washn Jm. Tlmany wil betiec o la o r and posbyteteta hatu
ams.T h i fann u cem was thitt k a n th Iar our hc o n and a al eed r0 e- an ma, wh n fl aly ca g t, Intpoehehwt afrorho.ma b end naeafrthopr osehas a si aio.o .Go s e a tiutaor a do bt-wk'h :
high al ola ha d cutmin t theman il hat intmiate netegrehshi wa s inchade tate tof ren that of d th.edui lt ukate i*s: "No me un -P. rodte gonn, Nebaska anitd Thecae o kr Tillman i euon aelved seoeroad s o a ekrs:1 ee. washn18,0,Inta t$ ,0 n h op oe enhdbe ln kllerl d uc whi which h her on s-l ta bo ers bheln t such- Iow,00haso one ratama g e to the. th Stator ale.T hr a re over th 00 MIAml Adrolacke tallesd fr oa.
------...... PURTH 8RIKE ON becamefrightned at toneblleonnies mueeeithe quitetemooreeped con7crop.wlineses.tI'e home.aheedo ethatrbi ble i
t tw eXeal nesdte .BN I IN M R T OU L toMna be hc I u blevd le.8a oe er hrel d c har ged"the lxenbso r e rs aore D.ad bil arancte attoey --.spoe oh v tees ma~a~ ud. s|te
~~ B i k a o R f s o W o k o d RA ND J URYs An ter BOOle n d ignat and aestrike a y nude l b ama sh e rvng e s tobl n et o TH Ee NC N he RE Orie o oalS o h tt i e a h ilo a r ,b
@@ilve You.oaerisaNowoChaed Wtd so er' He at Jnsnd Ciy, t enIn.hr- it ----- brouagpisnhorpeoaforawabenrdRO VNHroSmNi-ES
.h Em behae d le d t t h d teyment o ,00 h le o truo n onid b the ,. upee a e of Morafi t yesHes t s Cehl. PbectE R OtED KInu L L D y=la rdoned byo the r esCa oid aenAtta ck Deof t a mnt ofe weny*igh e ev r e tr hsd e~ la m ltn
A: cno anlg e eo embezz oa t o ,nly Amr a t kn o secur ah t om i tee Ato hia god ydment. l ftew tes s no nirmeduin Nt e wa as sassiec n ton of aTes lrequest W es a o inrA Mh a nt e pe ia l h s ay: A detablt sortr k TieM.ne
lan b16 n0 mae agaidnt hole Y o er dis isslh o the s l n ons t a wer e r e ael ia st thirtn th re .s Bh l av h cavle ofg ig t a ed toth me atie tat pico er C ity me s rtd of thw -l h at Iat r. woass ealte tw @ aegr Y rlia.
S former th aity traJ the agemen e t ralegeackfineathi wr fL me s(l o b el east n the J ws re orted onte t om ttheiDo rse in v bian tsumm rnresor s tl. e br d inb asadoa hrpn e 5 anod 0 e al a d ahed by the, i ld wtr eth saeppr t whch FrmlThshsthefo rtosri e ttehoe ta sa r un eth ve b e ss des'h m ,an ti a oao d th e h was me d ert ege ea lawt n a ssasat; la} dstet apen diiis a Chicae so.Ph s- t e1 h lat n It hetw r ce w eh tr a b e p o 1
elae slac sh rl afer Y ns. se eN m n mH a yG tak sH TECPs l G to oby ti s g m ~ sthe g ru or wa a e m d, b t ca s hope saho petion wil o, bes .8 a off a ter t skcal heplletisyo.
ere.. e wa ** S th ho e whc haee sleal *I tH Re DE AL Th* R UCTN S satm .Th foe ao co l si o T em a goerPen twll, he Ba riet w skle e g n h
Deah b kae Stle eckear Beol th* *Mite bts bomlslntr ay-T re a o e r Laiaorerdin g hero usWral S ot s --e8g m ake he rthe s On e of te ider oth e *atya @,swhl Mo shaber1

d~thbya lg cola et theh blag,,t esrdseelttlmitndestggg uag-porw. horsetatkehddatbea dll eyy the














___________~~~~~~~TH 714 WII.A-W1111K STANt, GAINKSVILL11, FLA.____________________*.EOJI~~h~b~ ITied by Tima SlOees" EGAR TAUGHT A LESSON. Amercan~ Orakes. fffhIfTft1 T U U A IO U ~

ticet eihr i te UIODSta11DT'I~fDJTATWhat Hapndto an Able-bodied I'Ml sPoclt':i of rerp.'nts In America
.1,.lioert toD ee wist, I wYuseI u ffJU.JUlk Tramp Who Asiked Alms. north of Mfitko, nnly about twenty
liery oreea tit A beggar approached an htuoky young or( vnoflhiii, Ithn otlIOrm Are about ni Rccommends5Pc-ru-na-Ott~ r m n n
Denver pi).irs i'it man at Broadway an di W~all street, tha l v .~ ti an Ito s r '~ iny M T e s tify .
firoustog.ate d 1,11, III il( so.ur h olri h yo h oao and, exhibiting tree cents In a grlmy I caught ovinli toy IbArv tiian ; +,% .rwjM e
Tie sho t ~ va s h ve trm dr a m e of 1X0.0 iiir tI have 1 hadt~ i ~ rt e I h hand, told a piteous tale of a job large b acks tini o,, A 1 111"111)" f v~~t Cm m od re nm ervile Ni lit l Of the
Tl hu 'Ys av (al drin. ti w i of tfor h:,e htd 'li I 'ili- rX10711ilit ttin near 116th street, and ceats &ackng snakes, three riilk osa(i t%, Vwttfd 81,,s Na~ty. ini a Ifl0 froiti IR17
4gwtr odntigfl lelkAigIivs g f i o ay the fae. nke n soi riN,, N. W., Washinitton, 1). C., says;
A' Ill"PPA b "ot there WVVIIll re nipdy. ,~ lw e is t oI tlterm i i th (,X 14111 ch nivl voiiI Sure," aid the y run st man. hangrdih s m fth i i i, l,
~f~bineriwe aniH arkd n several others. ii' it -a-r 1'. rinsl has been anti (4
91 s o rl bb si vo m i to latp mik Iren sa d lta i en a r P0i tll Of il Utt t o dii ol I'1 1 lu k, Is nt It? Haven't the ch n e t o gh s e of h m lit r w ise L b n eg y / We fr e d
Ie toerip o that ifain Ier Is5 doaqi~C itn efor Ine hqllte t)ilt~rl-atlv u d op a oad he cr nd Ill piy et$?rt o l s 0 113IUI'/O t,
(not boid) ait sighty swete ed ait sifferitig frnt ack ache led ud 1wt ta irt i co t t. te onl tr, i' g od or Hundred as many bramble sratrchs .1111 e ca'ihttrd it to a l esptail
le to hi~ iwa ourm.k orli l iieihiv ivstru lie Ti woould iay o. rdis the fiict and 'steenth street and more, and the wnirialasre t u erftcl snake. ~I onIrilo isI
to hiWen ed p u ith Is tfole We eks m old u ak Ujl pl~ iig yads K ialney thatt t e Poltaito i ra l 1 i s t e s a lo h,$ Your." harm less one, Is the !a e s a e $11D rilt l toa, It,(t 11,1 4 8 1 oi p ersns
begi to e grdualy sust~utedfo~ 'Ill, wa aulice tooo ofn oth r o hinuii bewltii than The tramp suppresed his ilmst which will uually be found in or near S.~ r.,o ill uiaijllt'
sou a.ck nebwihttatheenicoulyto te D ansdK dtyhely oathlol[etic chexaep peletIhanbowaterld pderheatletcpsat swimtemingpa wamin ongn
egn t be g a uly s btttd fi ,lsr aI s w~l s bet toIs Ilit' fifth r op of valni le in Illinois. husttled him in the car with a Tugh the string of the pickerel weeds In Uaited Stat so- M la,,i ~r t it luate ia la
it a Puppy be Nreatied when ix laohe, always sggrulvatel if I at long giil oa t i s ate it s tr y c ow er andI a slap on the shoulder, er puirslt of fro., or possoiblY coiled E EI.a P .a~ a
week s old there's sees trouble with at a desk, It striik fil that If Iois At~l pibtrto street tht isnh n et lip ho ev r tb ,b n T i n k4iltte ir .G d ryI utr 1w
.tomach worms. Ridiiy 1ills performed half what thecy at the hoat akn ras tonag(~A icysr th iih r upan te ank. hiIs snaoe illbl,~~ ~ ofe ~ir d
el lind e t poandte, ichi l of e pro ie t t ry n t t e as he p. ita s food, the husky young man, who play!fully 'mi the leat. It does not lay eggs, hut z entc yia a ltar ( a \
lid k ornd s et ato es wihu g r d e toe ty uhek r ieh,' It fi ba en h cueofm ch i pushed him back fil said "it 1iiiti brings forth its young alve. T.at D). witg o a rl fe o rd o g s t e d o g s bo d g r vdr aui s t p e p tu i ei l ui e i e I e f e c 'd i i g s t a r v a t i o n a d d i s e a s e I n s e c l i l a d r e l a n d Sse n l t e t e l i i e p t e m b e r I c a u g h t a fi n f s p e c i m e n 4 1 "il mu l s ~e t a ol ~ r al n f ully sous elep tar )t Prw
'It l Th oh the dog'sb nature a niv A l nd it oi. o r t lis gea ide y" li and co nt ries wh eiee tat oes are you be anxious, for I'm going All 13 fnd] carried her hom e lietween noon a tilt allmifistoi t e c oln ff c f m t e e m eiin v ii'i cullM r yiro w ll p0tiuind p o ei o mi c rc n w y m se f"an i f ur oc oceh h d n ne e n li'tle y iths.ave Hn e di 'table ditme s him nifctofpro d ebe- us e ile to whiel pirt of. the Unied costly. Inilvidunal potatoes have breet At C'anal street the beggar appealedI tit, ones, Thiy were% Irritable young. Aiutbr of Dongresst from Virgii a
.4 Pet. tates oil aplini oni~i. Address P~on- found it their present state of cltiva- to the cnductor. "Glet Off if yolU sters from the( start, andl almost a10 -ili s
Two meal. a day In enough for a ter-Nillivirn C'o., Iltffalo, N. Yt. For tiout without specil selection, to con- want," sal tho conductor, uolio had soon as they we'eo b~orn they would els
..rwndg:wieIhehtu ~~ stil'y till tlrugglitts, pIr 50 cents per taml fr-om one Atilt a half to four per been taken into the secret, "but in coll ani leap at rly haulI, with their lI"ll. G. It. P~rown, rtiville, Va. ell*hungry that lie bolts It a4 et dlys. box, vent, of protein, calculated to the fresh thinking you're better off on, anti little jaws wialo open. lit it i 'igsa it itrc,3:
jielea. Plenty of exercise gild plenty --- -- sbstancle, anid seven to twelve pet' that's no jo)!.e. L~ook at the fists on All our an-flies live vin anlnial fool1; I, 'I'e lll give sMY efidorseniecnt to
-if-good food make a fine, strong d~g.- ONLY WAY TO DO c .ent. calculated to tile dry substance, the man." the, larger ones8 feed an sinsli inai l. 1ii ,411- too it acqr for estorrh fill
-41ililadelphia Record. 'rhp fair your ili ng ig tell~n the remaninder being nll starch. At Hurt-n street the applicant for mals, birds, frogs andi roptles, anti itt,'tpik Il r;"oits iiave )eeis," fully din
Ab~lthwlipwh'tn5'h n sh It is thlgllt that at variety of ptal alma sneaked for the front doer, but the smaller ones onl isects. The 1wtnsc tat its-i from is alal it alt '
ANovel Dooke.... saw h~r brotb,'r's hit-'Iali tmini win lo givIng it fair yield of tubers with the importunate man, too, was "on," swallow their prey whole, the bone C.n ~ ~
It se ms a t ou h th re c ul t e in er ole la g m ill average proitelln content as high a o and tbratened him dem olition. So ef their heads being so loosely P ilute e of V m mfpo6 eo
I see s as t hoghn w i the ie o f t O he te r l "I 08 Fo d@ the est figure .% ali'c dy found, would ho planned a strategic niove awnt, In together that th y q n sr t h t e r hoie d 'i v e t llrin mc i ls i s to~.J o/ o
snn r n f h llni tton se IIny-e e In hs titile'lii ire toh(I y teisto prietto
li% fe'liitiibl var'iations of lighted that I jiukt huggred m)-self for Ito of Incalculable benefit to the ceoiil the execution of which he worked his mouths to an enormous extent. I have propirie'tity hili ies fiwr ptiabiestirs". Ibis
o l d d e s i g n s w h i c h h a v e a l l t h e a p p e a J o y 5 a s n y s a t h o r s e i k 1 f l4 l i 1 1 i a e o e a
.fl~ ..~. nvelt. Oe Qfthee isa Her,, the grate prof asor of psycliol- ito reason why this high protein ,oil- At Sixteenth street, where the car long swallow a fully flefged young justly famous, tis miits are known to so I o ontdrvepop n ai~ rather low, broad bookcase, at each end ogy Icakis uip with an it of Intervst stopped for transfers to and from thi' cathlrd-l'. If. L~aynos In Women's Imnany iot'thghailwstoafaormutsriuml'ata fPrur
of which tosin closet or cabinet, extend- "Huhggedl ycir!('lc-f?' he aghs. "in- grt'I.ec'heocoeftis crostw IieA the now one heitte t e i nmei write at oncet r lreagv~
gnrt i hIt s, tc. e ocmi e e i o rn th ns ex. t w in s e s w i h n e Hom e paipa in.Tmnt reciometdin i l'eruna. li n av ull atd c itoirieu ii le Ih
Ing the entire helghip of thle book deeid, yol nmust nays b~rn qite b-ItIdd peitltwl eloe r ihgotadtook It. The conditactor was busy f------- h i ilters s o I our atim a' lae ogv o iiiit~b~a1l
7hles b'lV are closed wt doors, yourself to do that. "--Jiid g(. itis-ArecaAgilurt, letting 'cmn off first, please, the young How She Knew.gin enaatrgedremt.)ngats
Oeeorated' ithj) eatrvbug Autf metal -ives,-Aela Agriculturist man was gazing at the sky, whistling Twvo little girls weare' lilaiig it front re'preentinug all e!sasn and stations are Address Dr lutnIelntoTh
higsadfs'ins h oblt-ANneseClna.eually represtink-d. Hlartmtan Sontrut~iiima
hinesandfateing, hecotiliiii*A onsns Ci~nar Handl1to~ss.ea a soft air. So the beggar slippedi to of a city dwelling when it itrango muan
tion of chair and table called the chair. The 03's'.er is a stupid thing; lmm subduiing tees oliIth smoke do I'ot the' platform and reached the stop. %vent by. tablilifjilot'Mle.itit ltwo in thle process lHe cannot tIine, hl cannot sIng, ove'lo the tiing. If you smoke tiut'ni There a ponderous woman, bound ito "That marn Is an undertaker," said of,44 evolution become a muis more He cannot even retit or write- for tmeliiii'uposet of removing bouecy fl' first to hoard the car, halted h0 ne fteltl il.Yu i e M ALSI& o
aflmaetitive article that it was forine'13. lntiet'l, ILe Isn't %-ery bright. f'oin thle super (to not drive the smoke fur a moment. o do y know?" asks.ed her Y ouwrl~ L ive 4 Suc osyhS1 iata
'.secinw of It ind lit ols Int at the enmtratnce. That till drive It was fatal. The young mn'iss compnion I JWI
itrs~o asel nsz When In Septembher .9(-hool begins the bees from the brood chamber to handl fell on his shoulder, and the "Ohlar because lied iIt'cmnwh i
Incnpiuu wn fo l p dh bask quil (A sf ie ol (if fish. Ii nt), tlm supem'. Tito fewecr bees you litivo young man'is voice shouted "Wow!" copon.ygadohr.-eti.n rer? igesto goodr I Pils
incnslcous wenfode bak.I~t' The fi,:ivi conic wtih Phining fIn t) cotnteind with lin the super the het- In his ear. The shout and surprise her Lippinrott's. ;The kind you have known all
it hall orfeor at.clau",hone, where And si 'it ?n revs wih haippy grins, ii. Tuirn uip one( corner of the qillt gavit him an Impetus that carried him Iorlf. a@heO.Lw~.s.'
economy of space is nuil object, thimsorlf. o--mo.
eh~~~Ir-tabie~1311 eseilycnied te ist er ibsn't seenl. visitt ie!e from the top; this will drive to tho aoidewtilk In a bound, regardless Sufficient Cause.
E~qually practical is a tea table of onltebciblw.~Ien31 eoeteo l n i a.A ulaedh Mary-Inut why (to you think tl"he' Want your moustache or beard
and the same size as, the squatre to",, Allitotigh 'tii '~ay tumoker too cloie to thet hera. Bjy so beida of Union Square. Without Ann-In the first place, their pa
Is closed lit at two opposite stales, l 1) Intcri u'earhced doing I hanve wocre than oncep slieit a b~reaing bis stride he hurdled ever rents, hate each other; and, In t(ho U K N IA
iile at thle oilier two firie little drop lHo fails a prec-. novice siinge thle wings of ill( bets. Do an of benches, and ats he landed second, neither oif them has a pennry BU KN R W ] lin
not- drive ~ fell% toiot lit Eng Ifes Bouin.ers,1
U*ut .Qosec -9t. Nicholas. tntdred timea s etinga ifurou in on the walk ain ever-readly policeman In the worild-October Smart Set.al
flits comptoomrta etu fura e l on him with his club.____ a il
tu ont could be Used for telt things, for Grcts Car.,toraoes. There is i'eaaoii iu nll things. "Ettouugh W~hon the car went on again, with TeWaWiN 111Oyt Hay P m 0 L
owning nagttk'Ials, or even as a reception' Miss Ellltrott-Wmy dill yo (i is as good ias a fetist" is nil old prov'erb, thm'j inignant. ponderous woman he- Colombia has in circulatioti $038.000'- I.-he
et o ioo' e i a' e. lag orIlriiesc 1ls. BY e,:peremce you will gain rating thme comucmtor, the husky young all value huas departed. Thme paper *s.. b Muail lvlia md e~am
c roaklynl Eagle, a fine Rppvairilme. confidemee. Eu'eii thent always have man Raw Ills sorely battered charge money per capita Is $11W, and It takes &dl

tho11.11 1"1your veil onl v'oir hat ready to protect disappear lit the grasp of the law, over $100 of the btuff to pay A hotel d rt
0. itmseiliii x D in y F b i s Itt. V\ I 'v. tltV iv out tll S de 1 7t s- ir face shl id the bee sidilemly be wh elreuapon th o seeker after Inno ent bill for o le damy. W P. etc., bo te s ujng
TA atnder'ing of em brioidered litteuts lg, le rani ri''r a ftnt wo rnl an ti it collie angered. diversion staled OR he reflected on the_ _ _ _ _
the manufacture of the titiuty ftiris. triler Stmarnt Stl. of broodl or lioney hold thm ith both In New York-Mali and Express. to distinguish the tire of emthusiastu. LI
Carelerswiall Ili this repeat nay lit it- ------ hands, so that they may hiang perpen-. rwuo t'on prat tIeonsIP I I
fewinttte rulm t'eks o sok. A-t'cit' ae ilry teIncs you tire liable to Redn nGop.Thmere ismonres Catarrbli this so.iott itl iol ; ua1lotem ha tlfi I sees. M#1 ?ogl;
in ~ ~ ~ ~ ~ ~ r ul wih te r g lr stVe.In f~ i'ln ~ -D m s a i cortc at ih s c u ccd n vt io d aluntil thanal it fw ye-is as spu oeltir Ia t ha'ee ul anr tns. il 'e el n- fo1 V~ i II' tiy O S~
oftlitereatiorea litoe shuts ofve bo e lot ofttiiel 411-io tht ao tal 4 it a. 'rohribtenalu.Fragra sy er leto
ti(it'he r g u a IilIlai l h t IP D f1- the1)( p art w ill ran to ctm u r yomn al rs to o li t me rder l p in w h y kit r u ant i tll foriseasoa sa r a n b a I O E C t t, G e7. ~a tv su f o 3 A i l~ e~ ~
60i-'dpIl'old levquivily st'v- She---Wlity ntt W(- rtmiill. return it at once to the hirie; thle bee's oaim roadl books? It Is nott difficult Ill loa remedies and by o aaty falling to) &Vb-(ML) AOlKNTi WANTP.
sIli"'ajll1i soileyotanlit itbolsa ariecee t a u@wt 06 catelt.pl"OllrdI n
it. ok ue'etirvoivithe ert "html LrIciS. ieudrtnigat ,u li~p ,,)y( I nitw VoittJe nev- ti-ill very ootn repair tile damage. if imianlsso ok oarne htcurae. ito tratmn prooseatar t itit apidtbet'e tIt m hr irc. be comp~letely severed, or a oIaitget Lach helps In th nesadn n onitutionaldisessowtand harefeorereopline., IK liiiTblsr
b&o eti # ruitffi, n4 'No- hut l've beepn ciligi~ed!"-Oc' thereof, bring the broken eidgels to.aIll upc'aii o h lwn one In r c ontutoaltreatme. J.Hball AO T Co..f
.9r3L frsig the s t t otter Si---- e. -- rgna n i ttee w t ouldn't it he wise to take them-oril To -eoO o i ::bony onstitutloai ours eiieee ~ e
surface~ f ian s v ly go lt h s r g n position, a d t e i th r w thontlem sirket. 11t 6,sta s i ternaliy a dmoss is
Il.tnso thoroughly Ill cold, ctsi'i iltit;'. narmmrow flits of tape. Return the conut those you prefer-in the order of their froml10drounetolatolitpoouifui. Itaeittlrseat- ieiln be
To dry, limly it bietwveen two toivolL or to the iie, amid after about twenty- time? First comes "Count Robert i' on the 1 to 4 mnutous sUrlanes of the -o
system, Thesy offer one huatired dollitrs for
thick Ihue cloths anid roil Jao.?lIy ill tti 11 four hours remove the tapes; it twill be I'nris," the'n "Tims Fletruthed."1- Next any easo it fali* to cure. lend for circumlarssodith
a waty tat no Paurt of tile ('uiibtoilu' al nirglit.-Amerlocan Cultivator. 'The Taliman," and "Ivanhoe," then and testintealals.l Address r. :. Ciasai A Stte i4 sn
%hall tofueh aity Wiier part of tile pim-w- Castle Dangerous." "The Fair MUltil Co., Toledo, 0. Ahst.ga.EeyillS
HumneFeei ug.ci Peth" ad sold by Druaggi848,160. [A14frmad~odrd liuahI
Kerr oldorIln;. u awettl,,-c r furmeFod lng (! Prt,""Quentin Dlurward," e al'ndsl li are the best. frwsfi

embroidert tar lav uIlitt ;t is'iii Any one who has ever seen a horse "Anne of ('lrestein'-ahll of which atro Th ineterInpesrealt omiev itta9lese rgSt
hep"utfrnmnt"villolnm-struggling to secure the contents of n if times before the discovery of Amer- TeIn ve eric I n bupleasureO0 yanht c s.,15 13ommtison a itIs qsfl 3
thing else is attended to. limt rti:le.1 feed bag fastened to his head will at Iv'a by Columbus, Reading them mnnA mrcIsaot60000an a wiii"VVtmMlsA
between dry'towelq, It ran het wiruailg, Dne recognize the necessity of some their order, one his a better Idea of the annual cost of their masinteaaac@ Vw *A B E s orted ther sn oudto tM
tivistod for 11lihlyl, euiumdu'aI t'o liatutei improvement in the de-sign of these Is about $6.000,000 itp~te' sesn hnhatwb
th ,. .,. higspuel ro ahuan saud'te ery imsan aprcite ec aseso- he ahelt ha wllho h bneits~')n unc's wtiuumtdligtI'tie uoo ecisre hoe efre I s mytimiecarerd.heprcend aanihe~) urd y heoealoaius eachU-










TES TWIWI-A.WUK STAR, SAINR8VILL3, FLA.
ARTIVILPS OF IN(V.R1 ORATION LJ
BARRS WAS SUCCESSFUL. due. They couldn't pay, and theta TWO SPLENDID CARTOONS. NAces ob moon on on 4446 6 6 *
-In ~iu lem Iar, ~ Hon. J. M. Barrs, city attorney were dispossessed; turned into the Too of the best cartoons that we day of octoLer, A. D., Ll3, the 1,et-'
D. 8. OODWIN, for Jacksonville, and the leading streets without food or shelter. have seen in a lorg time are the signd wil apply nHis xtellecv tW

gress in the Second Congressional and wan, and the sunken and lus- lis last Saturday and Monday. The Charter propowtd below. c
-"ute d April .. . 19M ated J. 1 T is 21st iaV of ,epterl w r. k. ) o )> .
Entered April 8, 1903 at Gainesvlle, District, has again placed the hon. terleas eyes of the children plainly cartoon Saturday represented o. 1" Menus "
Pl., as second-class matter, under Act of eat tax-payers of Jacksonville un- told of their sufferings from hunger N. C. Stockton peddling out his E' I). 4,. N U

P h -e ..... causing the city council to raise the fed by the police and thle children crackers in Levy county. He was ARt ICTFS OF INC O koRATION : 4 Till
at ed every a nesday and rdayadvance. assessment on property on which were taken to a foundling asylum dressed to represent a laboring v.s.,: pr.A.xN.s A"
a o Cents for Six Months, taxes were not being paid in pro. temporarily. That is what the countryman, and stood up in anl COFFIN Ci PANY.
25 Cents for Three Months. portion to its worth, or in such strike did for one family. Here is old-fashioned horse cart which was The name of this corporate cl I Kind Fresh
-ADV-~TISI'. RA proportion a was being required of what it did for another- loaded with great rolls of his i "The Gainesvill P'lanin, and cfi n +Afl
Adnva r s e. the poorer taxpayer Thos. Gowan, white, was ar- "Punta Gorda speech" and his Company," andl it pIrincipal place if 'us. 4
Local Readers in brevere type, 5 cents porr *t ,iesshall be Gujinesville, Floris 4
S a line for each insertion. The following from the Jackson- raigned before a police magistrate "peper box." The crackers were iess shall e ineville, Fl
Space for display advertisements pricedI ville Metropolis of Sept. 21st, will in the same city, on a charge of flockingjto the cart from all direc- Thie general nature of the bIsinvss to
on application. explain the nature of Barrs' fight stealing door knobs. There were tions. John was giving the boys be trau u sacteI I r at all b
the inanufacture til s e of cons and
gaiesvlleis ciy o s..h.ols,. tesdte hf ol h e hi s heya o millpandsu
-and tell of the victory he won for tears on his cheeks when lie con- the wink as he handed out copies luuber, and the operation of a pminining ... snesville is a city of schools, the people: fessed thetheft and told why he of his speech which they seemed to mill, andsuch other business as pertains
churches and pretty girls. The city council met again on had stolen. "I can't get work," he be reading with eagerness and great tet
The farmers have h d last Saturday afternoon to further said. "I am on a strike, and the pleasure. The cartoon was true to The amount of the capital stock autho.
The farmers have had ome de- consider the proposition of raising union has told me to stay out. life; it represented the real way in rized by this corporation shall be twenty
lightful weather for harvesting cot- Thousand (Jo,00.0) Dollars: the nun le e
Sthe assessment of the Jacksonville When I went home last night I which Stockton's Punta Gorda ber of shares being two hur: tre pr
ton this week. Electric Company from $288,000 to found my children crying for food speech is taken, read and appreci. value of each share (ne linIred )ol .
_._lars ($ioo.ou). Ten Thousanud Dollars
Lee county has also gone "dry." $1,000,000. and my wife so weak she could ated by a majority of the laboring (io,ooi no) of the stock shall he sub
The "cranks" are not all in old City Attorney Barraagain repre- hardly walk. In order to save people. scribeda f or anissueds at oncesto shall 1 PHONI 4
Alachus, no; not by many. seated the city, while Hon. J. E. them from starving, I stole the Monday's cartoon was another be full paid up when issued, and shall be
- -Hartridge represented the Electric knobs, hoping to sell them." In- good one. It represented J. M. non-a.4sesaible.
All indications at present point Company. The contest between vestigation proved the man's story Barrs charging the Jacksonville The term for which said corporation- f" 4'; -VTT
to a very successful coming term of these well known lawyers was true. The magistrate's sympathy City Assessment Machine with shall exist shall be ninety-nine years
S8tetaon University at DeLand. spirited, but ]Bars succeeded in was aroused and he told Gowan "hot air." He had run up the v.
convincing a majority of the mem- that he might go, but he must not Jacksonville Street Railway Comn- The business of said corporation shall. There is a probability that ,be conducted bly at Presidenit, Vice l'rteai- ETUIHOI*
Gainesville is to have a match fee bere that a million dollar assessment steal again. But what is the man pany's assessment from $288,000 to dent, General Manager and Secretary anT O
n"ae ma for this company was not exces- to do? The strike is his master; it $1,000,000, while the company's Treasurer, and a Board of lirectors t, H CO
tory. The good things are coming sive. has little sympathy for the hunger attorney, J. E. Hartrdge, stood by nsist of three members, and such other' H
S Oainesvilleward. R.J. Riles and Fleming Bowden of woman and children; if Gowan -looking quite sober-and was by the Board of DirectorS, or stockhohl-!
era. The business shall be conducted by Cott
Barring violations of the local again fought the increase. Mr. were to get a job at his trade of asking Barrs if he wanted to "bust L. edlin, President; Cotton Departm ent
option law, Alachua county has Riles contended that it was too teamster and endeavor to earn the machine." It seemed to strain ice.President; I M. Secret IniesT ecrtl T
Manager and Secretary and rvastrcr.
had but few crimnts committed much of a jump. bread for his family, he would be Barrs to get it there, but the assess- until there shall have been an election of *h
within her borders within the last This assessment, under the pres.- under the ban of the strike and ment hand on the dial had been officers held by the stockholders, andt Igi l ICS l01 till the sinme shall have been dutly qualified '
three months. eat taxation of sixteen mills, means might even suffer bodily harm. raised from $288,000, and was The first annual meeting for the election
A. that the Jacksonville Electric Com- O, the pity of it, that there is pointing to $1,000,000, which indi. of stockhohlers shall be on the 5th day ofI Seed or Lint, Large or mall tt .
c ni January, A. D. 1904 anIl o the l'irvt In Seed
Politics In loruda may get warm pany must pay annually to the city not some means at hand for the cated how Barrs had succeeded in ruesdny of January of each year thereor otherwise, but schools through- $ I6,ooo. permanent and speedy settlement getting the assessment raised to after, unless changed by the las of the Advances made. Warehouse charges free. Firm offers
out the State are opening for the BARR$ 18 INTRVIXWD. of labor troubles, and for the pro- something like what it should be. corporation. ade by letter or
___o____St__e____g orth nS vTaiW", made by letter or wire. Correspondence solicited.
Il ter, and prosperous terms City Attorney Barn, in speaking tection of women and little children bTATB PRBSS CLIPPINOS. The highest amount of indebtedness or
an expected In all quarters. e from the terrors of the strike.- liability to which the said corporation can . .. ......
of the matter, said today: If the Sultan really wants to help at any time subject itself, shall e Ten
By this time it must certainly "The raise in the assessment does Savannah News. out the head line artists in this Thousand ($io,ooo.o) Dollars.
VIC:
upon, [STAISlHED 101 "-0
have dawned upon the few who not require the street railroad to UBTTINU NEARER THE TRUTH. country, be will chop off a few The names and residences of the sub UN A e
would like to see Governor Jean. pay as much taxes on its property Along side of the great titter, heads at once.-Apalachicola scribers to this proposed charter are: THE ALACHUA COUNTY ABSTRACT COMPANY,
alg in the United States Senate in proportion to values as I pay ances of the great men we have Times. sN.res G. Wade, Monthrook, Fla., 25 Galnesville, Florida.
ane ftegea e ehv shares.
that his time has not yet come. and as every other citizen of mod. quoted how insignificant appears E. D. Wynn, Gaiine.svlle, Ila., 25 The question of title a first consideration for the investor.
_-____ Io .f eoM. f ,.. .,, bsrc Titleo adI ln Co nt7lt
I 1. M. Riles, Gainesville, Fla., 2,r, shaest. o T an y
Getemn D otvolt teerate means pays io proportions to the criticism of Mr. Stockton that If that grand jury in Washington share. RieGinil ,~ a.,23sates.' 8 J To any piece flnhd n AlacusICunt
Geatlemea: Do not violate the the value of his property. The the newspapers in Florida not sup. City continues its investigation into J L. Medlin, Albion, Fla, 25 shares furnIbsed on
game lass. If the laws are bad, raise in valuation from $2a88,ooo to porting him have parted with their "rrelarities" of the government REURED Ibine
influence for a consideration. of the government State of Floridantion.
lo jt grant and endure them Until $i,ooo,ooo, while leaving inflenc forp aesnal cosaertin before a: (.M ie ..LOMm
st grt an e re tem n $,oooooo, while leaving that prop We hope he did not make this officials it may yet find something Alachua County.
the Legislature convenes again, erty asemssed at much lems than its statement for it is an unfortunate wrong in higher circles than postal and El Wynn, each of whom Icing to I :emso4lci
and then ask that they be repealed. market value, will produce an in- statement for a person aspiring for clerks -Metropolis. me well known, severally acknowledged
And now Mayor Nolan of Jack- creased revenue to the city of over high office to make and will react _that they each signed the above and foreA' dnowMayoroan e.W of upon him with increasing weight. going proposLed Charter in the r:annersonville is mowing weeds. Who $11,500 more than it has been cala B inuer. The effort to enforce the "blue and for the uses anl purpws as therein
a law Sunday" in Tampa will be set forth andl contained.
S would have thought that weeds paying, and will to that extent re- Ve have seen it soniewhere stat- Sunday" in Tampa will Taken and acknowledged before me onl


careful she'll be accused of being a den of taxation. That the increas- every paper in Florida not support- It is regarded as a scheme of retali- Large. My conunission expires Noveni.
f,"dry town." es in valuation will also enable the ing himi was a subsidized organ of ation on the part of the saloon ber 1903 Schedule Effective June 28, go3
drtoncity council to get along with an his opponents of corse noone nien.-Tampa Tribune. State of Florida,
believes that Stockton vr made y 27 31 j 5 SOUTHERN DIVISION 4 I I6
"There is but little good in the assessment of 16 mills, exclusive ol such a sweeping statement, and Personally came before tie J. I,. Med- 9 35a 8 Oop 3 op Lv .... Jacksonville . Ar o as oop
man who mu only evil in others," the Carnegie Library assessment. yet we believe that no o le doubts Corn and not cotton or wheat is lin, to me well known, who acknowl- to 15 8 55p 34op ..... Baldwin ....... o a a 4 o
U.ys the esteemed T..U., and this You can quote me as saying that, that some of the anti-Stockton pa- king of the Uuited States. Corn is edged that he sined the above ad fore- I 46 o 45p 5 o3p Waldo........ 8 a 4 o4a a so
goinp anose puaroess thereinnr......p......5 3 Ar. {G NSVLL Lv 73 o
beWng the cads would it not be a "if the owners of all property in the pers are subsidized, and would .I)- grown in every State in the Union, and or thoe uses ad purposes as therein 12 2p 5 36p Lv GAINESVILLE I 30
S good idea for the editor of the city were assessed fairly, the tax- port himn if they could get more and this year is valued at $1,144,. set forthaken and acknowlntainedged before me 26p Lv .. .Silver ng . . ....
.. -U. to strive to e at least one able property of the city would be money to do so.-Gainesville Star. ad t t forthaken and cntainwedged A Cedar K . 5P
te tp oStockton did say at Bellmont that 950,000 or over one-fifth the entire on this 27th day of August, A. D1). 1903. 1 58p 12 53a .. ... s S as 41p
good thing in Mr. Stockton? greatly increased, and the rate of whenever you saw a paper oppos. output of the country's products. [soA Public ta f R. CoiatsoN, 2rge. 5 2 13a .... 8s a z s
Notary Public State of Florida at Large. 5 OP 7 2 ... ....... o
-... .... taxation could be materially re- ing him that you might know it -St. Augustine Record. My commission expires March 23, 1907. 4 14P 4 18a Dade City ....... . 1 s 75a
Barnra, the Congressman-to-be, duced. In fact, the profits of the belonged to the corporations, with State of Florida, 7 osp 5 39. . . PaP 742
not only "poses" as a friend of the waterworks and electric light plant, few exceptions, or words to that T. ...... 4 4p 4s
people, but is known by the people and these increases l valuation effect, and all of which e knew to been elTag loonSw d wt Per en L ca eN. G. Wade, 7 5 12 3.. ....... Sanata . o 2p
,bee sellng liuor o Sundy un trona wll 7no4n,12h303ck.ow...........p...45a...... o
to be their friend. He hs never would permit a ousoderable reduc- se nim undar our management, interruptedly for years will doubt- that he sinek le lave and foregoing R H.AND0oA
been found to be slow, or inefficient tion of taxation this year but for however, on accoutof his less sincerely sympathize with the proposd charter in the manner and for ORT T 34 W & N O M p
ri the discharge of his official du- the fact that it is apsolutely neces- hostility to corporations, and it has negro who was sent to the chain- and ontaie. Lv Jacksonville.....8.45 7 14p L Jackoavlle .* p p
ties," and he will make an ideal sry to spend during the next year never seen a dollar of corporation gang for six months yesterday for Taken and acknowledged before me on .r Pernamkna ...... 1a op r Lake City-.--.--. asp it sop
ongressan. a very large amount o money fr money to know it-not even the tthis 17th day of August A. 1). Ar Savannah .... zP sosie Ar ad.o . 35p a 58p
vweryage aun t o, m e orie bt a 'rJ that offense.-aTampa Tribune, ISa.] FRANK. E. CRAWEORD, Ar DFairfax ....... Iop ] 5sa Ar Monticello ....... .... a l p
The Sultan's many excuses for and drainage, which are reNews. Sept. 24 Notary Public State at Large. Corn- irk.....*....3 op 1 24a Ar Tallo...... 9 Iop 1 ISp
priceSoltanssbmanpteocusessfor Sept. 24. mission expires September lo, 1906. Ar Columa......... 3 57p a 5o Ar Tallansee ..... g .oP 3 1p
crimes committed against the sub- absolutely necessary to protect the Very good. The Jasper News is _----- ------- -- Ar Can -- 3 isct..........4 syp
jects of other Powers and the ealthofthecity." getting nearer the truth. From We in Florida have no cause to seerF's SALe. Ar Hamlet ....... 9 $5P 8 o4a Ar s ......... 505o
Ar Wilmington..........1 055)s A Mobile............5 5
Christiansunder his own fag,should TIB STRIKE STRIKBS. accusing Mr. Stockton of saying worry about the final result of elec- unde and yvirtu of an execution Ar Southerng tines Ir x8p 36a A New Orleans .
no longer be accepted by the Pow- The strike is a cruel master, and that ALL of the papers not support- tions. The Republicans during ued out of the Circuit Court of Florida, Ar Raleigh .......8.. 53p to 45* Lv Jacksouville .......... 8 zop
era. The old criminal should be the cruelty falls heaviest upon the ing him are subsidised-as some the dark days of reconstruction pre* i County, on the 4th day of March, A. D Ar Portsmouth ..... 8 5 35P Ar macon .............. 3 oa
hepeshv --cuny'nth 4h a fac, .IAr Richmond, Va. .... 6 35a 3 123p Atlanta............... c
brougt to a repentance that would innocent and hlples. Suffering have affirmed he said-the News cluded all possibility of this State's n, r Id fvtonr A. I e ington .Ar. o
toagoaintR favo M o A. I \V.gm an. Ar Wasinon .... zo zo. x! SP Nata~ -----------. 9 5
mean something. and sorrow almost invariably ac. leaves out the word ALL, and says ever going Republican, and about nell, as Sheriff of said county and State Ar Philadelphia 6- a- Ii 25P Nahville........... g sop
company every strike thatcontinues "wITH VRW EXCIrIo. s" atid all that worries us are the little saidIR.D. etn as theanortwill 1 ell at Ar New York...... 4 sp 6 3o Chicago 3a
Only a few candidates have yet for any length of time. There are then adds, 'or words to that ef. family tilts within our own party. ublic outcry, before the court house! Co nt forto .. .. ....... '
P+ < : oncostt almetto, Manatee, Sneeo and Srato i natstr
been mentioned as not being eligl- few workingmen's families that can fect." Now, what other anti- -Florida Crescent, Live Oak. oor, in the city of Gainesville.eAlachua days, from ainmesvteeO Saraoa on3. sept atur.
ble to the offices to which they as- stand the strain of several weeks' Stockton editor has repented (?) of October, A.D. 90, between the legal TatnpaoJ naos iad E ress, drawic room Pallan leepare between
pire-even though they should be or several months' absence of In- and feels like further revising thle During the storm on Saturday, hours of sale, all that certain lot, iee or day ce between Jacksnville nd W anoA vad amlq_ ending
elected-but there are many who come. The majority of those who charge? the 12th, a "wet or dry" election the Countyf off lahstu a,tate n of begor, car service from c sonville.
County of Alachna, State of Fl~~~or No 6, 8eboard kMail, day coaches, al agg n ~u ewe
was-elddnaf particularly known at,1 described as -Jcnille_,. nd W...ington, an dr ag 1, iulm ale e bp11Iltw uck
will not get there just the same, for labor with their hnds are depend It d that Frk hwas held in Lee county and the ol oprti an-rty-it n(4),l e 1. Jasonville and w ,o in ma a k
the voters must yet pass on them eat upon their daily income for is s tai tan t eat county was voted dry by twelve hundred and forty-eight (4), n ib s nvie and inew York. w
all-it is not convention now, yotu subsstence, so that when the in- exoutlawisuingtheatermana-majority. The FoAdition to the town of nigh Sprin m I ,c Srkfor. Aachna. Williford. Wa and later
know. come stops It is not a great while gers for producing a play called says: "It is understood that the sa- the ereditamgents and appertenances to SNo.. 6 and Pllman sleeper between New Orleas and .

Thefreeebefore the wolf begins to peep in at "The James Boes in Missoturi." -loon men are consulting lawyers in tuimeng or an any wise apper Thursdays an .y tan aL ee Pr Tamps b aed g, All-.t MAnoDOonvetLLnnowsousuGenn., Pass. weAgent, ....ac.....s ....... .....

e or the li oFrank James, it will be remember- Tampa with a view of contesting Sad property to be sold as the proper- EC. C. OBB T NRL, e Ant Gainesvlle.
Agricultural Department at Wash- th door. ardneIseera yarbagoit doects"-d xiution sad ct.D.Mdltnopa, eAgn Gievl.
ington is a humbug and should be often see the semy side of the lie d was pardoned several years ago, the election. "-,Tampa Times. ty of the said R. D. Middleton to pay
., Ariuta eprmn tWs-oftethose who aem ide befte oife and has since lived a peaceable life, l tF~xL, _________________________________abolished. Not one in twenty of thoe who are idle because of and if he is really sincere about his Negro crap ooters should not Sheriff of Alachua Co. Fla.
thehpackagestof free seeds that are strikes. What is seen is the pa- reformation it must be humiliating be compelled o associate with C. MATiInSN,
thac o f re seeds f the trade, and what Is heard isthevoice to him to know that "The James white blind titer operators when Plaintiffs Attorey. G ainesville & G uIf '- 'C

cost the government anything, the Boys in Missouri" is being present- the two classes are sent to the same EXECUTOR'S SALE.
amount of their cost cotid be betteeach trying to justify his own po- ed on the stage, but he should re- chaingang camp. There is o Under and by virtue of the authority Time Table in Effect July 5, 190).
pm'iaced*a r ind nt a d member that but for his real bad good reason why a poor crap shoot- vested in ihe as Executor of the last will
n p n n s d cwrom View, there are accidents and anud testament of Arthur Miles, deceased.T s
Haacts the immaginary ones would ing negro should be compelled to I will sell at public outcry, before the No. 0. No 4. IaI 9J
y i e e not be presented, and he should associate with an inferior being, out house dour. in the esy of Gaines- Da.et Dail
-: Congress is very essential, and the heart. make the best he can of undesirable unless it be that there is a chance day, the th lay of October, A. ues. ,na. D De BTATION
much to be desired, if anything is In New York the day of the big conditions which but for his past to improve the morals of a white for cash, to the highest and best biuhler, . __
in iewof hisfac lt u reeni woanledinttheeeittehcil-latgaoul noonoresstoin igeaopetr soingtweatte lga hors f .le,.lltht P.. PK. A
to be accomplished or Florida, and storm of last week a tired and weak bad acts would not now exist blind tiger operator by al owinge lot, piece or parcel of land, situ 4M
... u vew f ths fct et u reemwoma, ladig thee itte chld-- ........+ hm tokee cophimwitoa keeplyigcompanyg with ou a afte0d, l... ........t..d..being .......the.. county.lt of..7. ."iiai.r:i.." Arr I,.M .lAr...... N.a Au PUd
ber that Florida can do no better ren, applied at the police station "A Bartow man." says the gambling negro. Alachua, State of Ftorida particular
k~~~~~ln an a te ofes ri d a ol, a toiuary : 0... ....
than to send Sparkman, Lamar and for the shelter of a vagrant's cell. Tampa Tribune. "invited his aohn alles rie d as follows, o i s ,ama.
'.rrastoWasihington as ourCoo. The woman said she and the child- friends to attend a reception. Joe Fryer says the whiskey Sher south-west M of Section 27, Township 9 ........ aew...........en. ren had lived on the streets for When they arrived, a barrel of iffFennellcapturedinhis(Fryer's) 't aTnogeher witael and ing i ........... .......
'O three days and nights, subsisting beer from Tampa was found to be place at High Springs Tuesday partenanes to the same, belonging or a ... ....... e .........

tOys l cala Banner con- upon the scraps they could pick up. the principal feature of the enter- was some that Dr. Ballard left ay wise appertaing O.ltn..'o.......
ptis "r. editorial under the Her husband was a good man, aid tainment. After the beer had been there several years ago. Dr. Bal- Executor. 1000L 4 .- pa .... ** ***
captem "Mr. tockton as a Mo- provided for her when he had consumed, the hat was passed and lard is dead, and can not deny it,
it.noo oteculreader work, but he had been out of ema. 50 cents contributed to th e.btteeae teswoaent I i sjbpitn ouwn tsn saa As i ....o.
mMIt wouldsapMeo pqledideditorial ployment for meet than a month penme" by each guest. The court dead, and Joe will have to S up a your orto the star it a IM l eaer Hor a a s gis p ls, but d. on account of a strike. Oradually held that the unique "reception". better defense than trying to peck it et you. d r ..
suityou------------------------iiaiis
Ito, r ri h's not a'delelis to, all their money had give ot, then constituted an illegal sale of lquer, his crime of on a dead man. s ** *
o h s .st a g. that their furniture went for feed and and the ho t was sent to the gtrtthisarGaowe I.r I *
~ lg*b ts im hiriaiy*~ for P0 days. "Biled Tigr Sgigig A
M. A he a
a!
.., ,




Full Text

PAGE 1

BRONOSBTZERiLkPorto-bloIfoursforajJAGRICULTURALM-MifwIICearfeatfDropsyUem-ovUPoorlyDORBYNfBUCKINGHAMSusi-afiiRThStIThCo5o-ulbrorJjIiSAllfluln3aRccommcndsPcrunaYourLiverI-sbyyourm9rchantoDOUCLASusehold9fMALSBYtiIttsnaot-lIsurtttcepCtjinjcvnyE1STESTCOLDSortoiajMuUtrybombwllcroEnginesootdiZouI-13oyszTgnilyiIpringi1a4YIbFREEWORl5SVinIuiuiIilfitflNO-htpuisTumbulcnnroKerroltatorerliltrlalboUloiuxltrenlliefro-QIiltIIJnd-gaSTUARTSters1-f71advertllrJAt393-tRECIPESBl-ackLThechair-tnblpJOldWeiVaMtlmsSONMILLSProminentthosolledprecoqiilcftTycOnDYj11tuI-yanoJapojjubJItBoilersIotreatmentpronouncedSflyrsaparlllaFabric-ThuTaVinaoringfhTreorpvariationsTHIN-QrftUWMrBadfebtBdy4-PJepslnBiliousnessLDouslu3OOHSAWtliolr-snporlorltyovorallSarsapaf-lHiMllibviADi-iirriNOiAiiiorgrinATiovfotnat9p3JBarnlshMACHINERYROWELS1-Iiztix1t32ieslsiuIU-viLJLCentury-FITSneraanenllyrc-ccivcdMRLItriM-toYmllgthatJudgo-NofleneTttrJtle9eteg4tfmzTpstifytlIICSpOdIiU8fntaiiiIssiheatltal-iuiIjUcahuininaitaroughsmuchmoren-WdctlVoagainstb1-warJsWUMillsDigestiontW-MCarpcnlersP1Q-SOFTnUWjaLBQMttLvdets17gJtatkIrU231G-IprominentAyerswltlicarvingnWWaVwilockorI-UMBDIATXjO-UARAuTUaDNotwithstandingIndcntlI1romilroi-constitutionalSmvIIll1nolIabollHhlaraPhiladelphia8JAIONcnfnlocucJlAlO-WAiErarqtma1ustcsxiceagaWatkinsremembertablespoonfulsInuresmoustacheInoneydlgcstisltouldCAIUIUNIURlijmunhesitatinglySILKYgentAbotcenOAINEQVILLEBUCHUT-oCTI1ANTOOthernQttryhopeful3dootbeUrPtsoaFOworms-WcllbollctlVlrfjlnin-VillesCblckcnSlngog-4l1UadCI1bIflmanipulatingjfo14cbJ1uxauiplo-wouldntchronologicallytablespoonfulorhhoCnJohnlightly-brownedco-Louisvilleregularaccompanyingthrolye6i1-dAyersOlgngedlOcIntercollegiateembroideredencouragedtablespoonfulapproachingothordlAoasotputtcftspoontulpuro-soapdipEeEEGeEGEepcrpon-llcularlybwollolCINandTupmanBowelsPhiladelphiaunderstandingRichmondHAIRgrandmotherMcifoUwhendiolson-UnitedAgriculturistInconspicuousembroideredrolKlnispecimenpfAltlioughtlstwentysevenraproveincntCompoundIlluam-Tabulcsuutt1dlorphonographLlpplncottsacquaintancerecommendingdepressionappreciationteaspoonfulpanhandlor1IlotblDIrofenMARVELtryingti-meitihichthoroughbredfros-terMllhurnembroideryMARROWvegetablesUlcrleXovhuftntutollCIImportunateImprove-mentendqraementWhenqllitoTonstSIIcowagglingVgurDpg-HoVfMJVKiiKlpaj1tlICsconvlnttulCOUNTRYarrangementwrItngtroublesFEVIRIsh1unemplenCarclcssjiisVciotab1oContplUodyCompaayCbMf8awMlJUXlnlrhntfsIllnnlnlfrt-CalaltiaddressedMpplncottsLbyalclfiUBsuffererappreciatesmaintenancefct-irevcntlngSanitariumdruggistsIlotrothcdBESTJaraTnkoSubsequentImportancoappreciatedapproachedPJie21knownstrongcompanionsubstitutedboi1ul8ia1fedI4dMtsthlrtabfoactingInterviewedtbatifdlscaqadistinguishSsrsa-parlllaIhhIrV-fuIisfOconscquoncoComiwundInvestmentintroducedyourselfrrpretentlnKregulatingImprovingUuaUniula-lKINDSreproducesembroideredInterestingSeptemberSeptemberrcjiitnf-etaAIUIUIIj1TIOIproprietarycompletelyInvcsllBntloiHappenedexhibitingcured-ForombiblderyPOMADEfasteningsUitlinonlakconductingcompanionCommodorepolicemanUn-thinkingIaLeIhrinuuispracticalrinWmmwhereuponWashIngtonBoycompletelycombina-tionAlllnlllI-AkACROSSuwcqtoucdapplicationespeciallySeptemberAorrtncHtmanufactureRaspberrycxpcrlcncagenerallyaggravatedexperimentestablishedtakln-CA8CARET8InhabitantsIncalculableerullAIthoroughlyembroideryproprietarymedicinedyspepsiacommencedCompanionmnnutnotnrodpossessionsmoothingbook-shelvesSeptemberUimttomalntCaralessncsspreservingmoneyrqllloosclyaMocthorpontlorousoverreadyswimmingWogtLtfleYorkltuI1hopelesslydisorderedrepreientrtlAblebodleWth-ConRroMtrimmingsthoughtfultestedVegetablevltt-stomnchlottomoistenedSeptembercommendsgenerallysttaf-actoryBroadwaycirculationMenscarcelybCILrlngdcommencedcuresuc-cessfulMcDonaldeatiiplocoregardlessnothingSeptem-bertlngla-yenrTAUGHTstand-pointreceptacleoccasionalTHEconstantlysimmeringJupprostcdthreatenedwomansmaintainedconstitutionalLlpplocottVassoooStatIonaryWindowsIrI1-111iJpronouncedandViliinitonjlioufotioltlpigeonsmovemententhusiasmrafthorsoundertakerponderousTwentlctl0000000goodrghtgbwnsupposedtjmarrloJ-NoIcucorrhccaappearancepeaketbapplicant500J000Pressgraduallybeginningatetiqast-Imttdiscoveryendonementcultlviv-tloitdruggistsdecoratedriwp-benleafollowingspecimenabso-lutelyRichmondDontu-futtHaydisappeargrad-uallyCoiiKtvsfrccdoni-Ihopsychol-ogyperformedgystormcnsufferedNEEDEDmakeHtrhlUIflDangerousbreathingClalsupplyremovingFORcontractedIndustrialnyearoldanythingIDANBYdemolitionbolnourablorrcoiiimotdwithoutniolstenedrccognlzoDontmusinglybuyinghViifritlftlOtherwise7-IannouncedconsideredparamnesufferingcompletesuggestedAmericantestimonialsSuddenly11elplatformbreedingInternallydress-makerschoppedstrugglIngClolrostolntexhaustedoriginatelieautlftilIndustryappearancePerhapsopinionsprlopoundedwhyfasteningAmericancirculars-nndthickenedprescribeddepartedcertaintyHackneysprinkletrOOODamtuomontothergreatSomfrvlllocalculatedbreakingcheerfullywhistlingIndignantBringingUIUelJconductorsubduingpacUrtBOsurprisebitternessexniembpossiblyappealedcalculatedstarvationconductorprobablynecessityOeorcjlaprovisionnfllk-MilkremainderconfidenceremainderstrategicNicholasImpunityscratchesUroolJynchoppedjpatncareanUrUMidflirIndividualcrostownColumbusrestaurantEnjoyedAIHMtlilsuddenlywithoutclotoruilnoProbablydwellingpositioncrlnicuttogetherconductorite-rlglnalAmericanbeardevolutionItn-uencliclilrelievedsubstanceconductorInasmuchCultivatorColombiaReadingordinaryrebellioussubstanceSixteenthhandlingordinarySCKSS7parsleySufficientcharteredpromisedarrangedirvanformerlyEnglishpickerelprofessoraddressconditionAmericanReadingpleasurepaprikamcillcliioal-thoughrpdmoyvege-tablelnoscsuilqutcflstomachperfectlightlyotherwiseAmericanyachts-inbencIltciTlYgallopedplentifulsecuringsmeltingslzq-vlhBTalismanQuentinhandlingsoaUOcTfftISconstantlyrequiresoffcastun-dertookconductorexecutionwhlqh-hoBlireripottEquallyhystericsmateattentionharmlessDruggistwasteWomenstogetherMlnlstirijenlersjImproveperhapstriedbasketsslightlyWantharmlessImprovepotatoespotatoesoearhcadcollapseTUItNrll0transfersOEQQAFIattendedbo-ratinggiving-hofotftltl-fejIU14flyparsleyrotimTrecentlythemorwbcrcofgg93DthroughC41rJt4TMJdicingwhateverI-sbsorbcdDurwnrdCulimibingoldenCalendarsixtyLibertyGodfreymileelementsLEOSONIJbcsQproverbshallowersaucepanhovebutterflyrevealedIlooltcni-enKingdomoppoBltooneballplatteryournecessarynothingnunlcatcstodayIt-DoiifflairoUloljowalkWEugenepota-toesDrultoreLHeadingshoulderNlfholwndiversionsbv-HlusoSoothinguprightbqgketsPillsthoughtIncreasedtrademarkli-nlwnysdesignsbrothersltachtnstyWhrfrfthui-uitnUepriceIrritable6tose-daysi5IConereuMonmchhungrycupfulsmeiliclnetthroughcllknflouImpetusswallowthroughchambergtmlntntuSlLPiai-CUREDentirelynuffningalreadycornpart-damagethroughiMpmtntpositionnothingbackacheslightlyplayfulEnglishInnocentenoughonhandMemberThoughhundredANDoccasionthroughoorpentsIrenlilentmomentyourselfchauffeurFADELESSplayingcountriespositionplannedtntementpoundsyourselfmedicinecohtnlnJlshln5wouldkindUseSurelyto-getherhesitatedmillionreflectedbookcaseISxprosspoundsFamilybetweenbrnmblopeelingKidneynm3mtusuallyusuallyiuewniyshoulderpEfpisiiehtAmericapeopl-estertiCENTS-AtmillionschonilcnlmedicineanimalsHartmanfeelingstoppedangeredremediesbnlnncctheavilytryingLydiaproductserpentTribune-SHundredrubbInghoweverdiseasesstrainedpoundslookingNicholasfastenedDotwoontrottingincreaseWithoutIvanhoowithoutonehalfsmokersreptilesfastenedhoweverAmericaInsteadInquiryspillingvenomousenormoustoma-toesonstrAtcdKidneyfeedingItnmlllnicontentstwistedgen-erallyIhducediindayerisingAlnayflreadinganimalsfivecentgeneralKidneyslippedcortplnsufferedhundredkindAimflattenedthrolleywellocs-ihUlremedyshiningpresentchangeZlothlncahoustonbeggarkidneycannotcupfulstoppedvwhltoelt-IgII-IhenllhsneakodpiteousbecoinoHuggedaccidentbatteredremovedsubjectAtlantain-tendedTramptxiItAvmosacri-McmhcrtogethersimilarglassesvarietywithouthandledL5mam-malsbencheslLflilUcoolingselectionnineteenKuoiiRUPOTKAWIrrltabloalwaysproteinwhichpursuitregularquicklygreatercllroloinnnjsAnnInuuran-Hre-maindifficultholdingenoughproteinfledgedjlevlcegurglesremedythoughhuggedgroundlooselyMeasureentranceAmericaSpeedsTheplentyOctoberpresentturningcontainssprigsWrltoFrontby-ThatdrouschangeswallowInterestIroningopiniongreaterlargoTurkishsecuredmintingbetweencontentssowingTheupplyalwaystwentyhdrlnkHaventwithoutknowlnatleficibocausoadditionprotectGroupsJostledphraseiVriittfthustledrespectmomentladybeggarSquareAyersreadersthatrefundedtreatmentreachedsurfacesHumlrcioutcomebasketfallingprocessseveredllnctlyhurdledwy-iInucALLnwnaaproteinproteinproteinbeggarmouthsCompWlettersbecauseInsistedbrownllnrtoianIJaynoathereforeIlleairdwithoutbecauserumsmallerathleticqbnrgotimeWUTBprcadpushedcaughtAddressvenomouswillIroningproteinpurposetrampmyselftwentythicklypepperhighlylibertyrcrJbetweenbweballpurposecircularsupplycountrysmoothlightlyseededtakinglottingfast-enedcoveredchickenshoutedjursosucupfulpurelysupplystrangesoapeldrunnedsupplyoitrallvctakingtwingetwentybeforeanxiouseconomywhosotellscatarrhminutesPlentygroundsupplycarriedblanketpoorlyhighestufJheightUOIUMHcauGhtaboardloslredworkedMinisterTurinchickennmrrlodscattersmoiledrrlollu4wluctjInflammhingesstretchspeciescarriedTomatogentlysurfaceshoulillightedmyselfhymnstollingBtioufabecomeInterestAtitlresabenefitspicksOltcwouldrtodCi-ntMkidneyElllcottpnpptfWhenRecorJ1111111sVAClicinlcrtlchargospecialhymnsbeautydesignIc-t1ialwaysyouretcioekrnremedycabinetDenverInterim1111111011CheesewithcontentsnakodaintyhumaneanswerpratedsupplyequallysevernSaxonyrepairnearlyneitherUooeycrumbsbcovcllAnothersteenthnumberbenaroundIerunn-itappeardeSiascnlilcPatAnrrangfsupposetigUlarlygrainswondercontentcontendexceptexcepttoastedDenverdocthorcontentparrothuskystrongbeingspopperplaasohuskyfigureshundredthatp6ppcrtomatotmnkoswildlyaverageTostationscatbirdplentypromptreyersosmokerhereofbeginswrliMiHTpa-tentsdangeranimalHappypreferrewardpurposeOysterprocess001IIMandgivingvaluableberriessnakesSrafceoyourtatutiiweighlookedtakingbringsthUARrlliHtRtmpurposepotatolwayshuskyyoucannotWIIIWUnitedbeforetroubloRobertWuntercom-bollltnolahappyfrlcpiwfurnacecapitahlugsthingssnakesthingsHoDonnlmnlObenoyannualLMQr2cay-ennewithinbrightHcllsfsorelysaffronsomepotatowasbedilrofitcn29SVIlyamllyandthemmothlIllinoisflowersInsoclnInsectssnakosoclockfln1l1JwomeneatinglawyerMexicoOyetcreposesIllinoisthingssallyattacksdiseaseOlveiobjectlulnutoQllmorsnakessec-tionslOdropssurfaceBuffalostconthmotherbenefitnovoralcommonbrokenchildrenstationdingusFrenchthingspotatolargerstupidchance050000PerunaiburiedkaowStatesdrvU11InsectstowclaAOKNT8baskettenderalmostttrrlttLynnpeopleapcnkandpeopleanimalchurchSilencehouoyInchesrumcUbottlesliumnnpotatoJuiceDistrictpinchyachttogethertmllshouldaroundut1V150extendstationsecondgrimBrownfabricscbecrieQuickhiudacheyachtcostlyDonsRecordhowpinchfivcryBiAntherestwelveTemLOWCEagledoz-ingPorunMANanl1nuboutweakschoolquartrepeatItcturnbottombottomDoansmightnuiriiciTVAddresspotn1nearlyanimalcheerknowsmiledtnaCollcurabletbtAIPholInhIframesshouldWhen1l111swith-nnDottlohoneytodayShouldbottomkittensoceotnowingschumpgoingVsrtllareadyabiolutilcuredVouvobasketlandedPerunnffrslfmonthtubersbrownSmartmakescannotoverdocannotgoodtodaynationcreambeau-tystatedwheatTHHhymnsystemnervoustunedatlclowhichHCJIAHBfrocksUnitedcannothaltedPRICEalmostDoanhastenIlublcoldDampheavylittletowelsMaryqnlfoStnan-OlnquickbrotubasketbarberCaesarwhitewishBlrlnasurfnoenclothsfellowAskedbeforewhichwhorepainsbolngcircularcnrnlrIndewlschoolsmokesmokuHunterbasketreadyTherecon-tentwhichCastlespeednt-tblsseekerwomb-Ilocklnyoungyoungbeganticketaboutroublebutterobtaincon-taintrueMrsschoolextentthingnatureDaintyshouldpiecesnakoiwhichcelerybeIngbatterVirtueyoungresultswhichstrongbroadagain11011Bliddtr-orlaugtWhyboiledfriendQQfathermightUfdltlpeLottloothersmanyshouldONLYreturniVrunnedgejustlytheACCIIHAOVresultDrownUIIDI-orstarchOatarrliOwnrrlttalliedcountrycombsbettorIllnossthrowInowVtlninpbeingcannotHumansmokeuparateentirnTypetalTrrlneweeksbsalddcatarrhsnnUopapergrainstarchweedsnozzlesuccessbeingblackpuppymouthdiuInitowclathingfairlymndeCcicarttiplaceUnionHorsewatergivesfamouslontUlrculMassonnleheadspennyhelppointTheyTlieywhichTherohotterDottleHorsoclnwciStatIcmoneyweeksBiusUoInventothersbringrtfoadeijdeepreliefshallyouroaftherwhichWhonhandscolledsixty>largowhiteotheraboutaskedclosedNeversortedmoneymanyboundfoldedVANTipuppypuppyTood-MwheresmokelovlcoloinsbringTHEstrliekbeginthinggrainhelpswholeWhycostsHomobottomTheroavenueEyahorseWowlcalledwhichyoungknowntouchDooltsgrainsquurobybrothboundyoungkettleTherewouldthingsingegrainreddermunchtailingadvicer4uc11gatesTHEmotionPduiliishownUnionstrideunderCountwholoWhonSmartbreadedgestimesJustwouldDrownpapersblackbottlethatsbooksplccomealsbreadbelowntloustreetstreetstreetwhichstreetwouldactionmrercl030000everyMoiaboutdlseiuothicktapeslovoGreatWhetyoungpointrightearlylocalollahrnreservelawnsfoundclosedclovesfnrfol-drtakenwomanbelowbooksbeingwaterWhoaWhenboardwhichstreetTherohelplargofrogsThoyfounddollarsaboutcookotherwatcrgre1tportstemsyieldsecretwomanyoungpiecegivesseasoneffectmanyvalnobe-comeboardtakenwateraboutwhiteboneswrungpiecehiltBfzcdhangbreadbroodhorselfnUonwhencrushprovingtimesthlnltentireStatesTherel1llndogsycunsSmartyoungWhenbeenaboiitfiiiliisliceseffortwhenwaterrolledaboutwaterToledorelieffewershoutderiveyieldstreetremoveinrrowremoveabsolutewaterTIHALyoungdiseaseshesieveJohnhangShortestcontswhonByropblackhot-terotrooHowoooutmuchwhllobroodgivenstomachpricestreetAddrsLarloItsbll80SlatesCovertossesrtiultlaberthororeallylinesthomskillquitofoodyoungclosetaboutblackbardwhilemakoGretabroodworldovarycuredknowsplitfullygirlstliHrfoundmlUKlineJhlekhavoWhymetalrollllotltiisthanabouthangbreadmetalgreenformsCnnnlpesteryearskindsliablehoursmuchrondocents1crthbawlaboutgrinsHtrapfrogsgarterCauseheapSilencethornbirdsXldae7womanjawsHerothreoTheyKnewshelfthemaboutwhenmakemuchtherorantswhenorderosnctFromgreatranchScottseasondownoniontholrcanvastherewhenfromdogsheatItHpricefedsNavytheregraspgivemadeAmornnkl3quiltquiltTIiOUClcouldItselfcouldsellerwhenreachTheresmallthorowomanaiem4lrlntgreattlicroordertakenuulllileavestalkwihtreasonlinenbirdsyearsgainthosePromtheyotherAtlantaIJouluipartotherpressvolcoParisthroowhatpaperftuiffLOIUdancowritesreasonthnt-oe109Kdrivewhatpricehavemako10U1AimHMblXwhenalterhomodropnervoustbl1thinkcleailitselfchiefdriveusualthereIfccilobsreliefScottboonlowiultheirwaterseemscombcontstakestAuIuInlonomantisrcnkhabitmorseOFfriendskndgirlssugarsuperyourachairwashlooksliarItselfvaluehorseAnneCJMMthorntholrgoodagedtheypromWhycuredorderprintthreemadehorsevalveOoldensIncedriveaboutcouldcaseswasmealdoorssuperfromseasonspaceFmrcentstoberthemcentstablecleanwriteStudyreasonYorkFilthdropwhensickforthllttloBIlJIstheygoodWhynotFLAwithmadencntmade9rtheseWAYmucousdrawgravosuperotherdasltwithfreshboltsthemfrontwhatlettersevereuntilMaidtholrseveretheystopmehtitholrtheytheyonlymontdrnTthesellCththemlittlethemtherewithgoodBolothosenorthnailslIegesbtathifiHVObeetsherobusytablethembankalivefrontwontthemdrivecomescrocuslittlewanttheirstarthavohotelhandDIeuesingwhyleapWestcombaboutWallchenhighkeptsuch-areasonjoloEvenfromtalksQUItheyamonmanySo-holottoStateea-AddrqcholeastFirstlittlesidessidesNoxtthemlettereachwithCoronawhenfoodscornerhandantimootalmsworkDonlLookstersrdtritlISCWcbackwhentheysecurosourcebooklethigh9UJIIji1alclrfromwantThereandlongbollshavetheirllttlotholrianioTwoheadsaidSamebottlecrassStreetmorefltimcrreasonllltloKnitcleanstateliverscostbeenlevelstnlountilleastpaidfirstmeatpartwithwhyNoveladvicefullyolhc-eilfromwldotholreach>havetriedwarmlwereachfromstuffttiuttt-tigamepourWhoTurnortsmainThntfeastafterthornchiefallwithMikebeenflourwithhandworkdonttrainYCWwithclubfromLastcvelCUREmenushelpAnypartonlyIres1a-newwithfowlPatbeenbeenmatowithwithlevelfata1fo-UobavodothwantheadmanssoupwithproucttapelistslittlecookbuckachebacktriedPhatthathavefromhavebeenUIpartonlypnrtslapjustacrossoffttfallswithtypocuredlongchatuntilnntllacheclosefromQPOwithwlsoeachretailintoEomoservesscarcethancookwellsaucemilkwithThishave1hal1littlecookwithmeatwalkwonthaltsdirestdustsuchdayshardJustsu-garhaveripemanytypemelttiarafromJ1l1chumansInglluctihaveuntilthentheir3JustJamnameforumtiredthuswiththouyqurroadThischronicJdoorcausetakenwithlevelyearwithslicewithwithneckLaUglwmiLIlyafterrnunllaaTwithfromuntilthoubackgroatjustpaindeedIsntwithflourtubesangthanThisdoesmoodusgTimethenbothPillsSirswithwithsuchwithdoorbredpreybeentimefamilydoststfIcIsbacktoameachsangwithbeeneachrichneverJillsbitethathiverichwomanmansHtcdtadtubebeenfrom1cwsfldeskTriedtnCIltalknovelmakethemStirwomencudswithSurelimoHowGiveironcaimJustcasethenGreatroadtakecostThisshoeswillfoodracktleverthatcoldnnflvilLDRUGcentmoatmilklisletrainhaveyourseven1ILVJ1IIeachwornbathsborndaytbljol-qllplccsllciravoIsntyounBayJustsaidpartthntIdearicoonlytwosptiirJlQUOroodvsolrrndercitycover12IorAddSpieldaythatfourbeesbeesthatwhothenFairgiveliebenThiswiththanbareVabecnHipyonMisstorytacoholdsamotextsaidJunethathasthorutssfzojoylIsntfoodhlvowifethatTimthatbeesnuaecenttryAddwithasksthatwhogaveboybothfoodOXluckwithvastbaglazytintlk1ipassnavoNowyourdoorTworolleiUoikiwhoshnthatthatIsntfifthholdtareBolilbagfourtakobeesbeesthenbeescutsNowSendthusgntniputroadwithtourboatLulusednnUbeenverytootDicetinsfoodcoinThehaltonlyandHasdoesmayandbagtoldthatthatwhothatraidandandandThoPillsbeesfrontiiicilflrmsaysholdwithdogpetlinobagtinymouthpoorhoesIsnioverttlC-lanmaymannailTimeAnrtII-ItltnrnTmanynddfactthishimTho30ththathaveopenoverdrymaybooswhoteedfeedsendsentlotjnnywinduntilhalffourdogrJbovnlbestbustbitethisIntoOFTltnivkothirerthatThoricebagveryKyIngmiiiedThofirstlikehershesrloscatlossregumoothimllkoruinfirstbelntruehalffacetornrichAndherlutefistsfeedthanahIZlocalbutsomeYellowjilarightsaidbowaldcrophaveproyin-boUIIUwillyOUItmttcandwillwillandyeaswarTholienmidthntraInmoredryputhimwillandhimthatUsedietokythoandandIlllsfromdryeggsUIOIIMThoofTorfromjoufsaltAndfirsthltosomenlolomorenameandhimhallmidhrotaowascoldrhoThowayThosaidandhalfJobhimbaggivemorethisoverIngtallThoThofirstfirsthatfromdrYmeandryhutworeweroArchNOSEWilYOhIonndsoftandthefowMenthissaltandthisthislallI-JTimewillilloMrathisafter1SOThoeachsamecomorowsandhadOutTimebeenputdayiuBtenndhowroroOnosOcutWtcollatirePa-rdrynndricooverovergotannieandwillDutThehimminbollandantiandandfairendhimTheansiricolinoYouwillantilinenoonworetodaytwoandwilltwosoldThoTimefnflstillingimmureot-ootwayfsomelaidtintsuitsUnlYandgetuteCCCnoaitwosaleThofair1001feelandwillmotthislIonheartleftIronHoldcatIhadnndhimpudlivehasmoroandandsideciroandHutilllllqansurDlapOurooverLiterWritewhitouosandlowclsofastandandtwoandoddsalthadlayaddthisbitsandandwhowayboxwinantiandShehadandandShewet11HimPutlafe4randIcsdantiricethiswhofoldsoftlionmustoldfigtimewithtopetcI-tlOIhirtcomovenlinedsometomeImdandandfiveandwetandaUtlwillanyand1hofineandnosotileForyouUyerfeltyou1505andandandandlhitonceoncofedlayI1JI4theliiothaniunndyonandluciat6ogetfineantiandwillyounndandendandandantiandTheendButandsoonnndaddandlingandthishasstirandhashasandandhadfishbut000PernudhadantianydUllU1OseentwoJjshotirishthetheboPtibookrouaithoflvotwoShotwoTubgnufinofeltArehunandcollTholiesIvewindyetThefluidOAtOLyourandyouendandAndyoupayLasbuthasoakandlIPtheandlOttholionandsellrowbatfulloverthountilFtcitsoonnittiletotthfitopmanmannunMowthehadyourayWritdcuveilandandGetnearoverbedhasFortactlatandpyand1hoantifleahost1837tho701lawhastiethetholintlintmanliterfrytophyrcornoveroverKIIItwotrutthefullthothethoSotnntnothethomanyouyoubutnUllandsooniestljourthethelaynfllowandheriioiyouandlustwayandThefinsoddnowmanyourandwayonesnotlimohotthohersoilthothoherthoandandaridthethothothothotilethethoUiothothothotimethothoHueHteiroutonesmorothoDcclthotheanyandandAhothaulhasthothoIe-ItanyoverthevlllandandtwoninathethoCullabOotmanWonotthobotyoutboshothecutthethothothothothothoStiLttwoncotho1ehethothothogistwithcomeOs-Gthothothothothotimthothonotthothoouticenxmetfinesoilthe1aisyousilkandantiSinbutthotwoyouseenoncetonmnjthetimetimethoyouWUrnthothotodltimeButthobutnotBythothotimthothothothothotollthothebillVythethothothothothothothothothetimethothothothothothothonotthothomanoiltoothoemanYorkthethotimewiththethoSisalqitulienlIDSantithothothosliohothothothethefoilthothohatnotfwbut5thothothothothothotritethothothothothovpoleaflrfttthethothotheredallthethothothothothothothothebutthothothothothetilltime00seesoncesumshobnotlinnotperrimIfnotantinotthisthethetholotthethothotryonothotbocurthotinthethothethetimethothothotholireyoumanforr4lithothosuuJMlrTIIbutnottbothecomsownewnnistirSoverthoSotoldthoItsthohisthotholiednAGcropthela-DfdidhisoatAllmanthemailhotthethoperyouhisBythothothothethohothotimethethethetbethothothosawstomatinforthesatthoSettho100slimbythethethethohisLtdIrotillforforthotentileyouiHflorwasperforlnEtimeColthowasoldDOforforTwocothishiswasthanlilahisforbutnndandloittiythoImkillsyouoftimTinutontooforforlilaforforforthohistheGGAnnasonethobyhisComenhisforforyourcgantipotthothemywnsouthisforbybyforTOMrhisJpeforAnAllItbysawwaswanwasonostnhiswillteaaIrfformyee423IDUandtOlwasanaeurocureeurocomfortooforforhissliftswhosetetcbisairherwassoldforbybyitolinothistimeIJaITmJbitonoCurbyForbybynvrpcvforwas11111utrooatforforforutbArofornotOhillsawformoshNoofftomtheonearobiffmywasJlIIO0-oHoHodietentooAll111114IlloneOutSJhfforoneToforbynoronoshoeMrCMOmenmllnonecasetowfntallearyoulcfltliesKtlunitoustonoonewinHoforthetIbusoouronoourcueHJOAnforlIdbydoHoliltlimocute-onoourononilDoDomymonliebqhohoonooneTikareacdcaryenitchandDotmanmylimoownallconHositSo7Jufluhisstuse4til1owntitofformythethoarecarorttieteronomiHcutths28eforthoAtoilnorcarcararen-otcanItsAtitDrVAAIyouUmhitIs-obooffnewhoniloutraeKillbdforbohohoAtartcarforAtfitsbonittlorot58badOhnthcumUleaareusefrrUioarearearcboInhowillhobedoaiooreInbybohoAthoboho29wonnilhetodoanboallallersyotzItsareCor031InlisaMttOIboupPrtboftbobootbojhoWbobonilbodoboofniltobodofreecartoHoOUhoantwillCoforupwasoneoJCoupboiushootInonebyofacTlIlnanyupNottlSdohomycartmboIThohodrnareofbodobogoitsformomomoofIbofluIncofSthowDofofoftQeliotWofbo00ntbonilorbeIfbofbooftoIkeuseyouofOarettboamourourupofnotatof-tofbeatofbyofofofVIIInofarccmtrofofofwomeo2ofinctCRfnertoeiaimaretotqwoIfofoflitofofbyofofgnInInbebebyofofofusebeallforatofofofdoyoInofIndoynallItsitsiyoInwotvotheCototoitIninarcItofInInInInonIfatofluofoflu01ofofotofofofofoftooftoitatatofInatofatofofofotofofofofofofItInofofforNoforofofofoftrofatofofnfofofhoDrDMonalleM1manranillCoonoUInIntoofHIMInlIEotItofofofintoof44IstoluofofrfatoftoofInatofofDfofofofofotofofofofofonAUtoitofoftoofInofofatofofofoftoatotofofcr4ofofonIsofyeantelitnorareInInofInofInInInofofIntotoIttoIntotontinInInoftoInto10toInInofInInAnnoanThoftoofottoofatcdoftotoInIntoInInItoftoofStofoftoatIIOfnnCOofthlannonmalllIf1111onanonannoortotoInluInInIntoInInofInInofIsInInInIsIrattoEInInInInIIIininIttooftoofintoIntointotoofofoftointotoIntoat1mtonnonfalyannoonI-weAtasonononI-IIstoIttotoInInlntotoInInlu03InIntototototoofoforIBJBAInofInofIstooftoatiiasorannotoIsananIstoasnoasenononorIsnoonorupireoronofIsorasexItisofIItotimofontoinotofIntoIsItIfIsIstoIfto1JleelN1TnTonasIsInIsitIsIssoItAononsolilrutasI01111OtoAItIsIsIsIttlItIsIsAaaAAItittotoourIsofasasItItIsIsIsIfIsIslieItIitoAIfororKItasororasu4lieHeratWisisasotIsIsIsolasonInAtnMCoto0OtoIsIsIstnIsItIstoto6tlatorliInIsIsInisIorsooritaIsitItIsareasis11SorasassoSriasorornuasasOOoIntoisDNsoevcntoOofsoOIsislaIBIsIsItIsitItOtosoOfIfasOPIsIs08tonoItororbllnoIt0orIIforLoItoerIsE0O0rlitOOtobtItIsnIitItItofonlitAIsItUfetimtnrItJorsoVOO10OOIorItIfbeonaItofBOTOon9voII-JCInIIlaUOfAOoItVsCfrnoYViono=AI177IIItoIt0IsIt0lit93AMfUtoIrlitla+IsofonSUEDoratCVlDmftuit+0Ii+++IAS+crIuItUeini10+a+ItIaII+toorEcrIa++++I11+8++n++II+1Cto101Itttbn+a++roisAIorIdJnahr+A1SIuII3nanaCIaRa8a3f0IIIbIaananaannnaiaaataCl1aIIt-uaaaaaaaaah0inaaaaannnannaynamuanIIIIknaanaaannalIaoaaaaaaanaarnntIIIaaaaU>IInRanaf1aanaaIIaanVJnIIaaAnantiaooIaaIaaaa11IInnI1>IIK5JdftItaIIIoIusIIIaIn11aItitt1IafInIsi>IartIIrtaajoIrltA=t>c>tu>ynIIISJtI4JJr

xml version 1.0 encoding UTF-8 mets xmlns http:www.loc.govMETS xmlns:mix http:www.loc.govmix xmlns:mods http:www.loc.govmodsv3 xmlns:ndnp http:www.loc.govndnp xmlns:premis http:www.oclc.orgpremis xmlns:xlink http:www.w3.org1999xlink xmlns:xsi http:www.w3.org2001XMLSchema-instance LABEL Gainesville Star, 1903-09-25 PROFILE urn:library-of-congress:mets:profiles:ndnp:issue:v1.5 TYPE urn:library-of-congress:ndnp:mets:newspaper:issue
!--METS HEADER--
metsHdr ADMID digSig CREATEDATE 2006-07-28T01:07:31 RECORDSTATUS Validated
agent ROLE CREATOR ORGANIZATION
name University of Florida
!--DESCRIPTIVE METADATA--
dmdSec ID issueModsBib
mdWrap Issue metadata MDTYPE MODS
xmlData
mods:mods
mods:relatedItem type host
mods:identifier lccn sn95047242
mods:part
mods:detail volume
mods:number I
issue
44
edition
1
mods:originInfo
mods:dateIssued iso8601 1903-09-25
mods:note noteAboutReproduction Present
pageModsBib1
Page
mods:extent unit pages
mods:start 1
original
mods:physicalDescription
mods:form microfilm
reel number 00175042428
sequence 178
mods:location
mods:physicalLocation authority marcorg displayLabel University of Florida FUG
agencyResponsibleForReproduction FUG
Present
pageModsBib2
2
00175042428
179
FUG
FUG
Present
pageModsBib3
3
00175042428
180
FUG
FUG
Present
pageModsBib4
4
00175042428
181
FUG
FUG
Present
amdSec techMD mixmasterFile1 NISO still image NISOIMG mix:mix mix:BasicImageParameters mix:Format mix:Compression
mix:CompressionScheme 1
mix:PhotometricInterpretation
mix:ColorSpace 1
mix:ImageCreation mix:SourceType microfilmmix:ImageProducer University of Florida; iArchivesmix:ScanningSystemCapture mix:ScanningSystemHardware
mix:ScannerManufacturer IImage Retrieval, Inc.
mix:ScannerModel
mix:ScannerModelName Next-Scan Phoenix Upgrade,SN# 0249-001
mix:ImagingPerformanceAssessment mix:SpatialMetrics mix:SamplingFrequencyUnit 2mix:XSamplingFrequency 300mix:YSamplingFrequency 300mix:ImageWidth 5259mix:ImageLength 7669mix:Energetics mix:BitsPerSample 8premismasterFile1 PREMIS object OTHER OTHERMDTYPE premis:object http:www.loc.govstandardspremis premis:objectCharacteristics premis:fixity premis:messageDigestAlgorithm SHA-1premis:messageDigest 2c2d817a0765e6a176b9b9aa7d999b97b8011fd3premis:messageDigestOriginator Library of Congresspremis:size 40332299premis:format premis:formatDesignation premis:formatName image/tiffpremis:creatingApplication premis:creatingApplicationName iArchives, Inc., 3.129premis:dateCreatedByApplication 2006-07-17T16:13:36mixserviceFile1
34712
525976698premisserviceFile1 SHA-1267c70670faa1488e66710bb26a39620f68716a5Library of Congress5042587image/jp2premisotherDerivativeFile1 SHA-117cf338dc96efe5c15997f69a9bbe5d10a1103b8Library of Congress1735403application/pdf2006-01-27T14:34:57premisocrFile1 SHA-1bb7b13cccc3e61c999a2c452c2f244424467634cLibrary of Congress1244599text/xmliArchives Newpah v2.36mixmasterFile2
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300526675918premismasterFile2 SHA-1442fb9d7982c9c3733bb2fbeb2da383096a8e809Library of Congress39975234image/tiffiArchives, Inc., 3.1292006-07-17T16:15:43mixserviceFile2
34712
526675918premisserviceFile2 SHA-1640fc10b8ad43d3bd878e18b8f8c787c5d81bf56Library of Congress4997918image/jp2premisotherDerivativeFile2 SHA-16d9ab64fd8defb4881c4d204db13c05807f3c7a1Library of Congress2025383application/pdf2006-01-27T14:35:34premisocrFile2 SHA-1fcf361a4fef2c16b012147c8a24da79c8d99a103Library of Congress1787622text/xmliArchives Newpah v2.36mixmasterFile3
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300530277348premismasterFile3 SHA-182ee3c5c3caf69ce56d245c3265d140f388aa05aLibrary of Congress41006696image/tiffiArchives, Inc., 3.1292006-07-17T16:13:52mixserviceFile3
34712
530277348premisserviceFile3 SHA-1f16d00751bde56442ec4dd76b923deacaa71a731Library of Congress5126880image/jp2premisotherDerivativeFile3 SHA-11c242055c8729aad6a74b8b11e3054a7bece013fLibrary of Congress2048045application/pdf2006-01-27T14:34:48premisocrFile3 SHA-1e53a1d1f016bb617cefc379c98f592bb2b8ebc2dLibrary of Congress1864359text/xmliArchives Newpah v2.36mixmasterFile4
1
1
microfilmUniversity of Florida; iArchives
IImage Retrieval, Inc.
Next-Scan Phoenix Upgrade,SN# 0249-001
2300300552975718premismasterFile4 SHA-10c3546b47f3e0b7f4dcb50bd8dbd1f99d3c5ee05Library of Congress41861087image/tiffiArchives, Inc., 3.1292006-07-17T16:13:39mixserviceFile4
34712
552975718premisserviceFile4 SHA-18cc95e909208c81d605fd29b53b0b315ce54198cLibrary of Congress5233688image/jp2premisotherDerivativeFile4 SHA-19943c4f2fc2b9160e251275bcae049dfe435489fLibrary of Congress1937869application/pdf2006-01-27T14:36:05premisocrFile4 SHA-1a6b3f22449ca8795eeb54d86c2301bffdfadc234Library of Congress1348851text/xmliArchives Newpah v2.36digiprovMD Mets record validation signature XML-Signature Signature http:www.w3.org200009xmldsig# SignedInfo CanonicalizationMethod Algorithm http:www.w3.orgTR2001REC-xml-c14n-20010315#WithComments SignatureMethod http:www.w3.org200009xmldsig#dsa-sha1 Reference URI Transforms Transform http:www.w3.org200009xmldsig#enveloped-signature DigestMethod http:www.w3.org200009xmldsig#sha1 DigestValue mWG6jTOIQuMKpodb6XIrW75B4X0=SignatureValue CNUPVtpC5nEtat+CogUAQyf1vG9rYVojhdE7aVLB//nqxy3tXAh60A==KeyInfo KeyValue DSAKeyValue P /X9TgR11EilS30qcLuzk5/YRt1I870QAwx4/gLZRJmlFXUAiUftZPY1Y+r/F9bow9subVWzXgTuA
HTRv8mZgt2uZUKWkn5/oBHsQIsJPu6nX/rfGG/g7V+fGqKYVDwT7g/bTxR7DAjVUE1oWkTL2dfOu
K2HXKu/yIgMZndFIAcc=Q l2BQjxUjC8yykrmCouuEC/BYHPU=G 9+GghdabPd7LvKtcNrhXuXmUr7v6OuqC+VdMCz0HgmdRWVeOutRZT+ZxBxCBgLRJFnEj6EwoFhO3
zwkyjMim4TwWeotUfI0o4KOuHiuzpnWRbqN/C/ohNWLx+2J6ASQ7zKTxvqhRkImog9/hWuWfBpKL
Zl6Ae1UlZAFMO/7PSSo=Y mXOVPGlCNaLDDWsM5jfj5TvDmTxvJIvexBgDXCPi1M/4zBF2NEYJxfSw0wCSiKF+1UZ3rED0LI+C
ASWBos3yGoRXHjIwmeo9TJbIbxvRA7yA+errdOypRTefDs0JjDcdV9Our0FbPNmWV5TfDd2M/Kby
bvq8naha5mdcWiCaZ1Y=KeyName NDNP.2.2
!--FILE SECTION--
fileSec
fileGrp pageFileGrp1
file masterFile1 USE master
FLocat LOCTYPE OTHERLOCTYPE xlink:href 0182.tif
serviceFile1 service
0182.jp2
otherDerivativeFile1 derivative
0182.pdf
ocrFile1 ocr
0182.xml
pageFileGrp2
masterFile2
0183.tif
serviceFile2
0183.jp2
otherDerivativeFile2
0183.pdf
ocrFile2
0183.xml
pageFileGrp3
masterFile3
0184.tif
serviceFile3
0184.jp2
otherDerivativeFile3
0184.pdf
ocrFile3
0184.xml
pageFileGrp4
masterFile4
0185.tif
serviceFile4
0185.jp2
otherDerivativeFile4
0185.pdf
ocrFile4
0185.xml
!--STRUCTURAL MAP--
structMap xmlns:np urn:library-of-congress:ndnp:mets:newspaper
div DMDID np:issue
np:page
fptr FILEID



PAGE 1

NewsjTORRENTPOSTPONEDRAMPANTpercon-tMiliONAIEplaglng200000S-OUTHERNTRIALISOVERCROWED-GreatWEEVILODDFELLOWSBUNDofSovonDaystho-federationmeetingCONFIRMEDMississippiPRESIDENTLEXINGTONAppallingSESSIONA-nnualTWICgAAVECKovorytiin3jlnKastoriaGAINESVILLECreamfrHHHllREPORTSImportantKrushevo-raassacrelngmatter-CommunicationsFlowednonmembershipSummaryDESTRUCTION-FiveGLOOMYLONGSHOREMENGranteeRESIGNATIONSButch-eryUNCONQUEREDPICTUREN-tVorkerDRAWNWHITECAPPINQADVICErepresentativesthraL-ookroakcrscoalconsumingTwentyEighthIndiscriminatelyDISAPPOINTEDHYDROPHOBIAburntlQUOTATION-CoalSurprisinglycomposeEmbezzlementTlllmanTwentyeighthjudge-LexingtonGubernatorial000-0AcIspatchresignationsASSASSINATEDrecommendationdemonstratedcommunicationlongshoremensnotchoc1led-ntllcottongrowingConstantinopleDelicIouslyARKANSASEvents-ofuncontrolled-ThoembezzlementunderstoodthoroughfaresExpectationGOLDBRICKEDwemen200-Sofiaemployment-forconsiderablybucksnoL-HellomcommissionersPreatrfn-Jtfforscnsecretaryshipcommonwealthrecom-mendationsfexamjnatloiconference-withATLANTAN8slaughteredVANDERBILTUNCHANGEDWest-ofBulgarianscommerciallypresidentscommandingKastoriasayTROUBLE-Colowai-ImpotalolowhltccapplngArraignedpopulationamusementDispleasureInterestinglongshoremenSeptembercommissionersresignationWashingtonCommissionerLex-ingtonProceedingsInsurgentscommunicativeDelaylongshoremenWitnessingheadquarterscorroboratedPhiladelphialongshoremenmembershipexceeding-lydestroyed-with5000AsinglehandedthoroughbreddisappointedheadquarterInsurgentsAdirondacksTexasDrlckmasonipenitentiarymembershipnegro-DetectiveresignationsPhiladelphialongshore-menconferenceIndescrib-ablyespeciallypenitentiaryresignationsCommanderconsequence-Atappointmentsbuildings-andDispatchesencouragingMisleadingComptrollerperpetratedmembershipDouglasvllleMississippitreachery-ONexcongressmanPhiladelphiaPHILIPPINEmeotlneofInvestigationWednesdayappropriatesChamberlaina-fisslaatloncontainedSeptemberImmediatelyresignationsthreatenedevidencesannouncementmootingpreliminarySeptemberSurprisingadmlnltratorat-CartorovllloassociationsAssassinationCOOO-OKastoriaWashingtonUnconfirmedSeptemberparagraphsnegotlatfonsdepartmentASSAULTSassassinationFEATUREIntro-ductioncommissionappendicitisassassinationgovernmentComptrollerMcDonoughdepartmentEXBANDITThornasvlllcHempatcadMississippiBulgariansexpediencesLYNCHEDunderstoodgovernmentCottonWithdrawalsintimidatorconsiderableWashingtonpcnlte-nn7agriculturalDrlckmosonsInstitutionsdiscouragedcompleted-ItMobilizingCompanyprominentdepartmentWednesdayIndignantDispatcherannouncementdosinattdvrorklnpmcnAttractionsdeliberationsMnssacrcaDetachmentcontinuanceBulgorlonuTownagriculturalAsnoclatlonmissionarySeptemberMcDonoughdeprivationconstantlySeptemberbrilliantlycovernmontdevastatingIndictmentsInterferencedepartmentnecessarilyexaminationmanagementdepartmentuninformedunfavorablecorroboratesWashing-tonresolutionInterestingMississippidescendingeducationaldli-posltlqnInsurgentsNewspaperpracticallyConventionwhatsoevergovernmentSeptemberprumfnontBAPTISTSflourishingpresidentsInjunctionassassinatedSeptemberUQe3deraInvcsUgatoconstructionMacedonianYoungerAssemblesSCHOOLSExpositionREPORTEDunconfirmedAppalllntfExpensesrequestinggovernmentdischargeddischargedSpringfieldestablishedministerialpresidentSoyerelrjnKlllottwasmutilatingconventionNEGROESSeptemberassassinatedExpress-ingconsequenceInjunctionInjunctionontcrprlvAmericanLynchingapproaches-AacceptancerespectivedepartmentallegationsconspiracycongressmanpassionsHempsteadAutomobileo-tabllshlngninetysixSeptembersomethingperpetratedperceptiblemillionaireomphallcnlgovernmentnowrcfusopeaceablyiVhljhRuinsJ-SmerdeschFederationImperativeIlluminatedproducingSprlngflodprn-rsontmcntImpetuousForopaughattorneysQovernmentsuoordlnatoconcerningexecutivesbloodcurdleglslatnrewomanhoodWEDDINGcommitteeInjunctionexceptionsbelongingdoubtless-boInhab-itantsAtlantaparachutere-spondedpreventingdischargedpostponedGnlnesvlltoplunderedGovernmentCartersvlfTeen-gagementprominentThursdayexchequerdispatchResolutionPhysi-ciansSecretaryInjunctionLexingtoncommendedCouncilmanespeciallyfrightenedArmonskoannihilatedBu-lgariansHEAVILYPatriarchsPlttsburgautomobileFederationSomewhatThursdayprominentConventionBaltimoreevangelistunderstoodconventionpopula-tionLoxlngtnnAdditionalCarolina-NOportfoliosopeningmountainsgovernmentHHHHLexingtonpresidentdeclarationdeterminedtolejramanomi-nationPostmasterBulgariaspresentedpreventedHendersondevastateddestroyedBronncckoautomobileperformedgovernmentpursuingunderstooddiscredit-theregardingLexingtonpostponeMoralityhar-rowinglumbermenSraerdoschCompanyunderstoodSettlementcontractInfantryhypocrl-sydepend-ingmassacredbmordeschtestimonyregardingrtlurnefldisclaimerpresidentreceptionregardingSupposedmurder-ingmanontlyciv-ilizationTlllmansSecretarychampionconventionestablishedentertainedcablegrampresidentmercantilecommittedintroducedsettlementcommitted0000wordgloomy-MrNashvilleMarylandnothingMarylanddestroyedarraignedkUlodUappointedcppoarancoSouthernshootingVigorousdetach-mentwellknownMlss-ldppldestroyedCompanyRlchlahdsometimesGEORGIAsuccessfulcollection-ItdifficultytovorclsnBulgarianapplauseBulgariaInterviewassessmentexpendedTllmauagenerallyinquiringgovern-mentDenouncesDominicanMAKINGDay-AcovcrolgnpresentedsuspendeddifficultyrecognizeneutralitysovereignattractionsPatriarchspromisesPreserversresolutionBrunswickcompleteEvansvilleMarylandoperationLex-ingtondestroyedProminent100000-flrocommitteecermonlosreturn-ingCalamityBaltimoreIntentionbullyingconferenceFebruarydetermineRooseveltcontinueddevastatedFederationattorneysmillion-aireDlavalo-tbooutragesIntimation60-Salonlcannnounce1InsurancedestroyedpassengerpardonodHighwayInvestlgathousandsThousandalarmingInspectorreceptionprlnclpilappearanceCincinnaticollectionBontlmontSaturdaysecretaryprom-inentspoclallsthomilltestimatedregardlessNeckwearcriminalsremovinglegislatorconfidenceImpor-tantpromptedstatementswitnessedRooseveltInsurgentAsallar4VacanciesSwindlerspresidentRooseveltmountainsthoroughBriefexpenseTownsendCandidatePrisonersDonoughsustainedAmericanErstwhileembarkedjsmHr-nearBOOKIESPostmas-terprisonersseriouslyshotgunschildrenBulgariaOklahomaKrUEhovoPatri-archsmountainssecretaryAREsecretaryCompanyattractionsdelegatesconditioncharacterRooseveltwitnessedgamblingsmoothlyIncludingSaturdaycaught-wassouthwestsmokolorsappearancedispatchdiligenceSoutherndelegatestreatmentBroadcastourselvesCHOSEN8ecrctavFARMERconsideredarbitratorsKnoxvlllowitnessescriminalsFOURTHattorneyAffaIrsCockrlll-ofctntoraentAfterwardYounaeroccupiedSuggestsTurkey-InsouthwestbesoughtwitnessessupposedburdenedmachinesChicagobuildingCockrlllWisconsinprovidesportedAbbevillepresentsstudyingThurmondRooseveltwitnessesCasoPresidentCHARGEsurrenderpassengersbuildingsResumedgeologistFRRANKpardonedRooseveltresolutionlieutenant1610000AccordedsquadronhoveringntudylngreachingBulgariaorerclscaoperatorsBurgarlaSaturdaylloDolvodstructureGermanyprisonersgasolineLolschmanpossiblyadventureoperatorsprivilegeacceptedBulgariathroughSuUtiosotasouthwestneighborwitnessesQuIescentdeliveredconcernedChicagoCarolinaKnoxvllloNebraskaDomingoISpredictsbetrayedofficiallyBulgariaSavannahshootinggovernorschildrenThrongBrodrlckdaughterEachMOriUayquestionattorneyreportedBulgariaArKansasEducationColumbusresolutionPcnsacobcollectionAmericanmachines42354069pallntlnattemptproblemsde-stroyedindustrialTerminalNationaloxpocidannouncedInsuranceArkansasAmericanAttitudeopeningmilitaryBurningeighteenPostsufferingsug-gestednecessaryPresidentweddingwitnessedconsistedmobilisedvillagesprom-inentdeliveryvicinitychargedPresidentPresidentdismissalexcitedde-fensiveChargedMondayFrankfortconcealedagainstArkansascontinuesresidingInjuringGonzalesoccurreddirectorshandlingSouthern1RossmariColumbiabuildingmembersqimllQcdBulgariaMostBaptiseMemberspleasuregrowingYoungerstrikingWorkersInfantryWelcomeCOLLARatrocitiesatrocitiesafternoonfrequentDalfouramechanicstatementexpressesGatheredprintingMondayhundredBulgariaBulgariacollectionKnoxvillebusinessenjoinedconfinedAgainstchargedgrowingGoodwinbusinessWitnessresignedpredictsrequiredmorningInstituteafternoonTlllmansopeningAckcrmwOliarloslynchedOldfloldsInten-tionsadoptedDouglassDirectorsVillagesdecisionordinatorequiredMissouripro-ceededmembersbyjhopaymentArkansaseducationeducationassaultedmotion-wasDurlolghdispatchbroughtMondayvolleysbranchespresenceCon-trarysecuringimposerreporterInstituteCollectormurderedfranchiseBulgariaerratrocitieshelplesscollec-tionwitnessestreasuryrecentlymanhoodCollectorMonastlrWEEVILMondayprotestsBrooklyn11053005FranciscolawyersHIgginscloctrloSTRIKETutwilerbasmdorliberty-InBloopersTlllmanArkansastenderedBurlclghMondayeupportburningSTRIKEovldcncoCarolinaSolicitorhoningHutchensattentionArkansasundergoacceptedAtlanticnothingChicagoRdwardoearningsCockrlllCarolinawoundedtuo-futuroGoodwinHutchensItkhlandcentimesWeeklymembersswindledMondayMondayeffectiverefUsed18FurLOSESArltnnaaaMayorsthroughspecialbusinessIonsallcapturedAltcrmiuInterestsWhereasmembersCollectorrailroadsurprlsocontaineddesolatefinancialpropertyseparatethathlsresignedforwardwearingCarolinaScotlandIncreaseengagedthousandBetweenHaakovoholdingtreasuryholleredundergonum-beredWeeklydamageMooneyquicklyResolvedattentionProvidesthousandTldemanattackedreadjustattitudeGeorgiafightingdamageChicagostatuaryre-ceivedIncreasorunningagainstSundaytroublesgroundsSocietiesKILLEDbetweeneveningCombine110118attract-edjailorsgettingTroopsCURTISreceivedmakinglookingpresentInfectedDouglasMondaychargedMONEYSocietyadditionTurkishLaborerscontractBcauiurtliumnnoheaviestremovedmonkeycountryWrightcommerceSalonlcabetweendistrictsPAYERSGoodwinwhalerPredictsdeclarednationallawyersmidwayEmployRoacmnnRebokahUNIONSBarancasfrloIn-tentionACTIONRossmanat-torneycountrylawyerschargedagainstrailwayreportedworthyescapedMOROSAlabamacockrlllChicagoAlabamaAugustloadingpresentfearlesspemanddraw-ingEoldlersreturnedwoundeddamagoOldflellFollowsMondayGeorgiaCaptainfnandnlBazoukscountiesbetweensubjectImitatesigningcountrygrantedmur-deredproceeddescribelriformilBeetlonipuzzledservingemployservhisfoliageDamagelawyersbroughtAtlantaUli-vltzapleadedRuna-waychildrenfamiliesDuringWrightAlabamare-mainedmivdughighestes-capedcoupledPremierforeignAugustAfricanalreadyTurkeycxpcit-tobroughtsoldiersIncludeslaborersAmericareceiveddesignssmashedcomingCountyJohnsondeclinedchildrenCharlesattachedheightallowedBaptistTurkeyTurkeydrivingAmericaHarbourGeorgiaEatontonpowdernoughtRACESdecidedSeptemFridaybakingcominglaborers1320050SalonlcaMontanaMeasureMinisterCarolinaSalonlcamilitantCountysit-uationbelievedCitizenslaxaltonadditionWilliamOrleansCountyBaptistJ3GOOOOThomassocie-tiesMemberGRANDAmericafeatureportionGovernorduringReportMcLanonationalPEARSsoldiersCharlesbecomepersonscomingpleasesTurkeyattltudooipocKIchemistaltitudeVariousTlllmanques-tionAlgeriabecomeOrlandoarrestedMinistergrantedGeneralprevailhighestThlngnBloodyboyondwesternTAKENfeelingOctoberInjuredTroubleJohnsonCarolinaKratovodorlycomingChemistbetweenMilitantpre-sentsprogrocastudentsDuringpublicNEGROTurkishNEGROfailurespecialtempleJacksongeneralCharlesWorldssayingpayingrumoredprotestpeoplehusbandsectionsdis-trictsBaptistBarneyAugustweltaxationdoatroysectiondiseaseMattersbeingwhichQlantonhopefulforeignAugustfeaturesOrlandoTurkeyAugustfourteenEdwardaddressexpensesllossmanBarbourFridayforwardchildrenChokedcuortlyocllcgeTlllmanAmongAugustLOOKStestifiedRussiandonatedTlllmancitizensagainstgovernorduringAustenCabinethearingterribleofwesternvehiclespresldotestifiedtoatflcFollowsassaultsSandersmemberdesolateInjuresRegardfeelingprojectchil-drenOrleansHORSEAFTERfrontiernouncodgeneralWilliamroundedSundayAugustarrivedIndicteduppoBcdpermitmemberchargeSundaycountycitizensenor-mousal-legedTOWNallegedJUDGERichardhundredThomasPasteurSenatorBalfoiirWeldon24575JusticecontestsagainstwelcomeCockrlllrapidlypeoplefiptJPInsteadpartnerhavingcountryfatallyallowed2350iodc9specialMil-itantagainstprogramagalnitfollowsallegedcarloadreportsabsenceFridayLiptonagainstbetweenchargeallegedspecialcountyAl-legedallegedprogrambenefitsAdvicesreachedtaxationOysterPrivate2115072000PasteurgovernormassacreAnnualServlaAtlantadefiniteconcertcabinetchemistmaskedDefendspecialAuguctreportMcLanoclaimedMcLanobocauoaccusedaccountanotherwhenceLondonSundayTalnotballoonenforceburnedpublicBritishcuttingchangoreportsbecausestarvedOwnersGeorgefrenzyformercountycountypeopleaccountRecoverTlllmanunusualdefensereachedcountyvillagechargerobfatallyJoynerutmostminersFATALweevilschokedarrivedprogressGeneralreachedLinaresAustriaarrestpeoplebishopduringduringnotifiedDEALSgradespeopleseveralreportsEdwardpurposecountycountyNbgrode-fraudpeonageKansaswltnttfsHellomfarmerswithinexpressPETERServian3OG0countyprovedhlmsolfmorn-Inghun-dredpeoplecountyrepliedJerseyAtlantacoterieTIHmanKRUPPexpenseduringrepliesopin-ioncountyuniquecarriedpressureplacedArthurfederalintenseeonduct23G50-forbidswindowServianAtlantaofficialsofficialsLinaresReasonshitchedInitiate893220countydefensestrongNevadaMcNeilkillingKolloymassacrebulletspayingBookercountyOrleansnumberAGAINmarketAtlanttmonthsenteredbecameAdvicescarriedpeopleconvictMcLanoWednoaIndicatefurtherchangeinstantspreadpastedVanitybandedpoaredpeoplelodgesPutnanroutinecountyBalfourwoundsMaloneGreeksaddressAtlantaKansasorderedstorm-Inpurposecom-panymayorsrobbertradersNOELdayo-ItDownSouthrecordreportreceivemurdergivingnoti-fiedhomescountycountyspeechPresideurgingcountycountyGreensubmitofficialsdefenseorderedclauseslocatedriddledsectionballoonemployleaderscountythIngsHOWLptoploliveryseveralreportaroundcom-binefinallytherenegroescentralar-resteddaringunawarewesternrevenuesAtlantacrimesViachsMayorsessionlongerrapineMasterWilcoxofferedcarriedreportsundonosecuredagentsUnitedprisonbailerseekersracingdaringBtiongKrupprullllonGreeksrefusesheavystationcountyrun-awayassaultMexicoguiltydeclineRAISEmotionManilamurdercttwl1sCobybombs750000repeat10000ar-rivedmonthscountyLouIseresortsMastercoloredhow-evercertainrescindbranchperronsrecruitminersUnitedWorthSTARowingbesidesstrungsittersUnitedmotionHEIRScertainballoonTheym-ldiossfederalfurtherHousesHousesbeing4almost350000SaludnIllinoisSheriffnegroessecrettroopsMllnorweovllMcCallcircuitmurderLodgepurposehoaryprisonOyotorI1111adviceamountnormaladmitscountyRoyalthirtysettledcountynakanGwarareportvisibledolngdofcotwhichguiltypublicamountagtnsterectedformerBritishJcrvanburnedsoughtknowntentedstandsLuxoraPossesviewedTroy641811BourseAttackescapesrulingGougeTurksArthurfhorlffElliottcelvetlis-condsTgoingcertaincounc4100000UnitedMcCallburnedburnedDexterBookerwhorowhorestreetsfamousknowncannotmurdergrandweovllRhInObeforestrongalongThoeomightMlllorstatedJURYformersoldiermasterAdviceattractDexterbulletsGARYguiltyLargepardonblocksStatedgrandwhichseveralstatewhichsharpMcCallUnitedmurderknownofficersracingmadeoclocksummerInsectsannualanimalWorkaBostonImbibeknownrogrotWilcoxloadedJamessherifflikelykilledUnitedservedTOslayersafelysweptBeforePowellJamestrustydrivenmightlimingIsuedFutureshouldLatestentireJudgeburnedsay-ingbeing1menannualhorsiwhqlograndIndianpub-licbeingbeforebeforebhckkansasManilasraokoSwordNelsonRalphshapeMOREdonlosKERRpooplbhonestRecentGrantadoptresultmightRupeldoubleannualweovllreportLet-tersMillerreportwoovllthoTOroprlcctAboutMOREStatesIndiesSecuresecondbolngCausesShowsLaborknownFightfinanceelatedMakeshousesformerfarmerDexterProfithenryOurtlidcolroFrankestatecouldvacantYearshorsesDepotapplyoth-ersSlaterRussiaJudgemightwhichJamesUnderfourthLanaoBlakebolngWhichafraiddidntresortswhichJudgemisonsanniilUnitedUni-tedcoronerwherebanditorderwesvllJamestracksweovllSultanex-ceptbe-holdwhichenemycausedknownhoganlipiiBograndYlldlzminerescapoCurtleGrandTurksTheyhousoSmithwhichThreeLabortownsguardloverpayerspayershI9lsbohgreignCurryPLANspentroioltistuntsgoingJ10VletterJameslodgOhastypowersstatedtroopsStatesafraidspeakRefuseJGOOOstrikeTheywhichWILLcottonchinescottonMillarJnmoscausedElliottbeingcity-IsgivenThereTurksmadeeffortssenateHoukestrikewhichFishercausedoingwhichiheadwhichSafdaKilledGrandPublicTurkswaterseitherThereJesseMaconlodgeManyconcerngrandstateshandshorwsentireTownstrlkobeginlodgebegankilledWhensts7eboardhoardwhichGrandGrandMoroscrowd60000cottonplaceAfterlodgecollarundercircusMinerKilledcoun-tyentireCroonCurrygrandplacoplacestopsgranrtchiefsLittlereadyboardTowncsotatak-ingcottonfuturOwhichforcesPolicePostalFrankBeirutTurksshowsaboutInitialwhichwhichGrandhandsfavortrOmunItySmallearlynightgivenFordscourtsobtainFrostsnpontletter10000womengivenwhomhouoowhichwoullbandspow-ersdoubtTexasafoLetterhotelsterrorwhichPoliceWhileescapecOurtclllcpreadyjuriststatedErwin72000depoteightStatesheroTWOgivenpayersfiringgivenGriffindeathLongNovelGivesDeathFranklosersstrikeSendamongTurksohopsselvesLaborQroouworthstrikewouldWhllounderMillerMotor13000whichyoungwhichbrokeheadsstormSouthtwicewouldHIGHprofitbeingpointAprilFiftyownersMaconStato3createFullylodgethinggroatagainThirdSouthStatesJETThousofoundaboutfutileentirewhichbottle65000hungwouldwhichGreenlectorkilledwhichWorkkilleddeathwomenattendhouseboatstightYprkTheypostsxnahohomohomowouldOleanblamewhichSmithwouldwhichukatoSouthwhichwhichendedJohnwherenialtocollarcrlnioshockvotedplacocottonWestnightLlttlokilledOtherletterGainshomebe-ingGreenwhichworldGreenCourtstormaffordcalledtownsexcuseamongordereventGOEShayoGrinFREETherestepspartyStatesaalnkneesHomelationwomencottonNorthunderfoundlution50000homostreetLaborWavebondsBet-tervivodSomoKingYearHsscnfromgroitwhenbe-ganhomowagesGreenFakesrelieftrialswhiteunionBashIwomenwomenhorsostrikefrownSWQOstatesthemblackblockgreatawardGaryar-restChiefAiredhorsomakegrossSouthtakenordccPetertlotherofficeehopwhichJonesmadoKioskotherthereMadeNoelTheydlrcchootGrantkingwhichfenceblockabidelyingfaultMannkilledTheirbusywealdoubttheyblllqhotlyfightmadeNewsshotsfortyroundofficeorderRulerwhiledeedsothergreatunionhorsehomogirlsWithpricelatterlatestTexaswomanfullytheroChiefethercourttherewhilesmalllandswhenwhentrackStatoChefbelieftollJonesSouthncHyhopeportssplitthat1000sinceorderCourtsendsEstesroadsOayoOloanletterstandmadeStatocouldthosoFrostothertheremadoWcromadeclaimsoutHCopofrqmLordstateordoreffortsendsfinesthousatermsjewsaccusethoyhighWithbrickTrialfromhavoletterhorsoNewlaborthoroChiefmilesnornodlertmadostreetnegronegrowouldhomotherethreelorcohour2CuEliotsevenJohnonlyFvoOutfitothertheirthemGirlslightparkwishIvoiyfan4gaywrotecourtthosethreecouldflanknorthwateryearsaffairmadoyearsotherLakesinceWithTrialhavehavecornershallStylethemdallvrondoorderloopsmosthavobandonlyfavorshowslncothreewhenParisdowndeepcourtstandofficehomothreeforcediesPlkpnameshaveonlyhlchdaystheirwhenTHEfiscalGrcsAkingcourtmadomineshotsParisfeverstatoAfterjuryMaychiefmoottheirstateploaTcnnfilledWithTomeKickatnt-iaCterhavethirdsovcroSomeeffectli-kentaxesmadoTonnwhatfromfrontWiththemtheyliavoupcnfamecircakinglongThatmustwithheadWasYorkINtheymanyhavedaystotalMadeworkafterJohnGoodstatestatestatoRockafterMuttlooseSofiaInsuaatooperaprovejurytheirWithchiefThatYorkrumortrainfromNewjurythatshiptheytheytheyMayCitybondcarryhandshipmanyhavocoastdownStateFirewithfighthighdeadgoodcostsTcnnCroftheirscentsLakemanygirlcloseThatwhatclosecourtbeen1000beenYorkGilesouchlittlefromhaveliavofromhighthemparttheyjustdonofromfinedexisthaopaidCitythereSofiahightheytheyTonnruledSOresnegrostatefrlmWithrankTAXaftertowntheirFirstIowamostMine2800SofiaJune1231hovelevyquittracthavobeenNowbonworkHa-mtthemstateSofiahorsecourtwillfromtheirhourlongloadhavolongFairshowDondmustcastCitypastfrom3730have3000theirJohnJohnhavodono2000afterKerrhavocayswiththtmtauthavetankfromtotalSofiaSofiaSofiacourtcourtstateir-onyneckLordHoldopenstatemostfearstheirafter1000havobandSealjurygiveyeartheypartstophavehavecopynnll1000lived3736Johnfromhavohave70001lodCityoftrialmentwfll3000TcnndashuponhanllingMissnamesTonnJohnstate3000thatbackbeendictafromDARboonLordsuitshaveelideYETfromtriedfromloopthenfourhighfromAREWildfrompartofficetrialtrialwithstatetheirJunoSofiatakoLordbeentotalfromtlmosidesmuststateRaceSofiahaveOvermostfromopenthemcityfromfromDartfromhaveuntilfromhaVeuntilOhiohavethatTboportloopstatewerestatomostpiedOneparttownhavethanpartjustdeadwithAlsowithusedthostatefromcomecourtfromFORdocssuchwithhardbooneachREVsuchfrombeenbackbeenNowcityIazomustbeenfrombeenfrompleabothdateusedFairwiththanhavetimeTourviowleastboonheadfromfrombeenwithworkbeenboonNowdeadbeenhonThisbeenboonYorkyearsuchwithbeenwithwithmostKcrrPasoNewthatmanspartwell1000SAMbeenthatmobwiththatThinbeenfrombeenbeenthatheldthorboiltimecardOOlttermbeenbeenfromnovwiththen1002errorLanothattakotlmoNowPlkousedCastcurve42JCracesFORyearfromwealratotoryMillEasteachFordlandtnckFivetrialFairwithtrialnotcityFallroidfourthatholdwithshotopenfromboonQuitwiththenracesmoveyourboarBaldbeenNewlendholdtrialthatlonglovotrialthatfiledthatonljDirefromboonManFlrobeenTommororacesusedheatNewthenusedNowcagoI1InworeJottsoldthatouthLutzcropwithtealThothatthatthatthatgavoJottThglosscropTwoShotnamethatreadthattakethatthatensuemobhourSamOuthogwillracesofTwowithtimewithbothcitygoneuponbesttitlethatworesomeLowcostlackSireratewhoJoltsaidThehimSentLastThedogThoSireThothatwhowhothatSIrothatCoatwhothattrialthenthpBADLawwithdayInthocovernamenateTheyearsaysthathowThoIbeThothatThonotThoThotiedcitylinesoultacoColewildsaidwhothatHitsthatTherateThoaltodogthatbeenthatmayracerandWereNowFairGUpeLatervAcmaysflcroOddThoTheOatniceatlffflayThoIntothatJI-calwhoThothatthatthatThowhoThofourthatCltvththitthatwhodiedwellhoyThoMebTTheOddThoNewmodovenfairsameyoirvoteyeartripmobbest10thcomepurenotecasesracojThothatThothisWolbothwcrosomeagesthatalsoThothatcldosaidoldthatThoverotootlnotWillfivethatLItthatbudtboyearPewrcrirhellfranovermoroTaxArkjailtentJottIntoliasforeThoTbowhothatThoratofirstworeworeweretoldwerethatwhoThosoldthatTenThosaysboltThothatwhobestfromsaysworeThodaythatwiltfirstlastthatratetuatironthatOnothatwhoMenGutvoteftcrositeandwerewillBayThocolorateThethatthatThocostThoRevThenndthatthatThofactTWSsayscentwillwillendandballriudintoratowhoThethatcoalthatmanpentendthetboplowereratewerebo-IsandTileThosaidLionfairwilltoldwillwasThoThoThoTheIntocasesaidrateThetreeIOnNotRevfri3willaridwillTillThehimoastthatThethatIntoeverratehadliaswerenewssayswillwilllastTheThowillbollwilllossJimhimantiMlnfeetBIGcost-SandwillBeentheThoThoTheThoTheThoalsohadwereovennOTcoalcoalcosttwohadandlawworogirlworowerejuilsomeThejailThotwotwoandnndbadandthisandWASlastthishimthiswillTbohatandwerowerelesswillwilltoUfoworeThepeoThesomethowillwillOnewilllawTheSawrateratoHlahasmanoccioncohimandAlaandhadbutnotthisandfeVandhadbollnorfairdvLouwllwillandlawhadhimnonewnQtwo0allovthowillhadwlUandclalbiteInghasbigyetoccumaybutpotthothosaysracetorsandendandandandandanyleftwillandwillandfairendandandlastnn1antifairHisandantithisfindSanwillandandhadfairwillMrshadtheseenhasandandbillonceFillthebarcaocornovertheracebfandmenandandbollandhallfewlastMrsoralandandandandhindandlawWibanandKidandwillandandandhadandandtwoandantiandUI4UftUlieshaytheownWasthothethofoilHismenmenbignearthethotheputthoantinndandtrillthothothothethotoythoandantItjandNotandthoandandandMidandlawwillandandandnndandfiveandandfairandandandthooverboandTillandandfairwillhashasnearseenoveroverhasthooverthothotheraceoncethotho000thocaseandandpayhaaandmenmaotwoanytwoandnndtwoandandpayandandlowcasethothotheendandantifleenndbutbutshethetaUcutlensthoJottho1MthomenthothotileONthothotbothooveracrethomenthethothotbothetbocasetho000thothothethothethoyetSerandhasandKyoveryoutwoandtwoandandandandnndandanyandtwoandandhaslawandwillandSanillsthobutthohasChibuthasbuthasbersayauJantiandthethotwothotheracecasothocutONthethothothothethothothothothoeversowwasH-IsthothethothothethethothetheKysoonmenmenthothemanthotholilatheyetwoeforthothewoowashashasandandthethothoTietbothoanyanyandandandandandCarandwnsandynlandcaytonHalthobuthasherhas500delbutthofellbuthascasethethothothothethethothethetlutbothonotthethothethothothethothoIJpovermenthothethethothothethethothemanthothathothethothothotimthethothethewaawasmenthothothotbothethoLasandagoBarbutanlthothothethothoandftohastheoutnothashashasGenGetthethooverSuncounKythothethetImthothothotheperthethethethoGekthothoflrothethe200thothe800themenwasthothothethowashistrythothothethothethehethethothethotollthethotbothethothethothothomanwasnndsumthohashasoneanyforanyGetnotthorobbutwastheoutFlathethocutthothothothothothothothethethethothothethethethethothothothothothothethothethetheitothewantwothothothothothoItothethothethethothotbothothewartiletheNOemathoforasiocasewasKythethothenothasthothothetnothothetnoweewaswonanynotiij1stythothobutthotbothothoSixoutMcthothothothothethotlOtaxthothothethothothothethethoAllthonotthotbothoOFthothethothotaxthothothothethothetimthothethothethothothethethethethethethethethothenownowmennessthewasfarHistheforforforthefortuokitwaswaswaaperHowaswaiwaslIonnotthothothethothethethothe3001EOtenagowasthothethethothothothothothothetbothoforthotheMrthothothohoforthethethohisbothothothothethetho200BYwasthethewnowaswasAllhisitysaynotoutthefironotbbsthothothothothothethothoUfothothowasnowarpthothethethothotonnotputtaxtaxhothethoIndthethotheriowanbybywaswasthothoforforforforSirbutMswaswarperwasnotparthewasforcspwastnnforByBygrofiletheforoutWASthoforwaswaswas500laoBEthewaswuronefcrMrforforforforforhishishishisItawassaywaswasthothoperbyBIIJpcrCclthebillcawwaswaswaswasWDRwasLiforfor250HothohisAllforforforHotheMcfor131onewaswasnothisofwaswasforforsixhisaidforourperarosettenbyrantheCIatnxbywaswasWAawasbybyforHohisAnforhiswasoneonoIboaretaroHtohithiscaldistheHaviawasitsononowwasMrhoMobybyHoi8cnobybybybybybybybyarearobytarourofbitcanMrledoneNoupHoAllMrourjncwasbobybyourrantarhpbybybybybybyhitOnforbq12offAtIto110IrearesulHsolTosurarecoxccnboCobybyAnonebybybyoneare-arobehohoonearehoallnotarowuonoArwoareareorebynrabyGoAtallothoItsItsHeGaThAtarearelieAtwobyarearedaItsCobqINbyofAsGaTnbyhobeDrlorhoOacoare+Coup+veThobowouparcboAtInhooffhohohohodobe+111ninareotupupboarebohoWbeDrGabobohobodoweerabodonilboHIAtofofbo10bobobobobehoAtbodoboWbelyupotofatboup12IndoboboofpfarebebermbobodobeboowboanunofnttpofofatotofottoheofofofoflaInofcdboKINoybo30amofofgoofofofofofofluotntInofofntotofofStofof30ofononweInInofofofofofof1024odof70ofatatofatofofedofof23itbolybe10notoroatInofinInInofinInofofInofofofofofofofofofofattolaofofotatofInhicfofofofoftoofatofofoftoof01ofIntotoInofInInloIntoofofofofofInInIsofotofofotofofofofofofofofof75atofofofofofotof24lyInoronofofofofofofofofofofctIninInInntInInIninInInIntoInofotofofofinofofofofof4ofofofatatofofofofInofofofofofofIsInInofofofofofofInotofatofofInofofofatcfofntofofofofofofofofofoftoofofofofofatofofatotatof24Inofofofatofof10ofatofatofofatofofofntIpananwatototoof10toofofoftoInIntoInintoInInInInuiInInInInInInInannnnonooftoInofInInIninInIntoInofofatofoftoofofofoftoofcftoofInIn14ofoftototoofIn12InofIninonofatatofofofofofoftoofInofofofatLatatatofofofInoftoatnoanoftoatonatofofoftotoatatof22asisonnoanoronononoftotoInIntoonononoftototoIntoInInoftotoIntoInofInInInInInInInInInantooftooftotototototootoftotototototototototoleHattototoatInatIntoofIntoInattotooftotoatofInofoftoIsatofofofatatattotoononononononnoonatlaononIsonanaslJantoofInInIsInInInIntototoInIntototoInIntoattototoInInoftotcastotoInInIninInInIntoInInInIsNtorttotototoattototoatattototototoIntotoononannoanunnoantonoonatatIsononloAonorvsnnMIsanasasasonononontofttototototonlIsInIsisIsHitInIttotototoisootoatItIstoatsoInItIsasasnnasnoueasIIanasInnsasottol1IsIsIsIIAInIsItItIsIt+asasasIsIsIsAnotorasexorItIsoasAFtosonttoIsIsAhIAasIsUifIsFAsomitAItorAonANIsIsAY0F+AifItItIfCasosAEJIsItBDIs0DItItItitYIttItItIfItD7R0ETDAitPnG0CA01ItN0AAA0IItCPYPIIIititP+pSB8IJ8JJ1I4JI9JJwyhOt>Jqtw7bb7Jj555itaaaaaaaaaaa7aaaaaa38banaftaaanaaafaaaaaaaaaacnlIiaaOLaaaajLanaaaaaanaaaaaaaaaaa5noaa1aanaaaaaaaaali8aaavaaoaaaa44aaaaaaaaaAi4Iaj231ai18AIC1g1ILW1IIIrr11k9L1BlITIIt1t

xml version 1.0 encoding UTF-8
mets TYPE urn:library-of-congress:ndnp:mets:newspaper:issue PROFILE urn:library-of-congress:mets:profiles:ndnp:issue:v1.5 LABEL Gainesville Star, 1903-09-25
xmlns:mix http:www.loc.govmix xmlns:ndnp http:www.loc.govndnp xmlns:premis http:www.oclc.orgpremis xmlns:mods http:www.loc.govmodsv3 xmlns:xsi http:www.w3.org2001XMLSchema-instance xmlns:xlink http:www.w3.org1999xlink xmlns http:www.loc.govMETS
!--METS HEADER--
metsHdr CREATEDATE 2006-07-28T01:07:31
agent ROLE CREATOR ORGANIZATION
name University of Florida
!--DESCRIPTIVE METADATA--
dmdSec ID issueModsBib
mdWrap MDTYPE MODS Issue metadata
xmlData
mods:mods
mods:relatedItem type host
mods:identifier lccn sn95047242
mods:part
mods:detail volume
mods:number I
issue
44
edition
1
mods:originInfo
mods:dateIssued iso8601 1903-09-25
mods:note noteAboutReproduction Present
pageModsBib1
Page
mods:extent unit pages
mods:start 1
original
mods:physicalDescription
mods:form microfilm
reel number 00175042428
sequence 178
mods:location
mods:physicalLocation authority marcorg displayLabel University of Florida FUG
agencyResponsibleForReproduction FUG
Present
pageModsBib2
2
00175042428
179
FUG
FUG
Present
pageModsBib3
3
00175042428
180
FUG
FUG
Present
pageModsBib4
4
00175042428
181
FUG
FUG
Present
!--FILE SECTION--
fileSec
fileGrp pageFileGrp1
file masterFile1 USE master
FLocat LOCTYPE OTHER OTHERLOCTYPE xlink:href 0182.tif
serviceFile1 service
0182.jp2
otherDerivativeFile1 derivative
0182.pdf
ocrFile1 ocr
0182.xml
pageFileGrp2
masterFile2
0183.tif
serviceFile2
0183.jp2
otherDerivativeFile2
0183.pdf
ocrFile2
0183.xml
pageFileGrp3
masterFile3
0184.tif
serviceFile3
0184.jp2
otherDerivativeFile3
0184.pdf
ocrFile3
0184.xml
pageFileGrp4
masterFile4
0185.tif
serviceFile4
0185.jp2
otherDerivativeFile4
0185.pdf
ocrFile4
0185.xml
!--STRUCTURAL MAP--
structMap xmlns:np urn:library-of-congress:ndnp:mets:newspaper
div np:issue DMDID
np:page
fptr FILEID


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01987\ocr\0098a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:22392
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1198
splitwords:0
ScansoftOCREngine Character Count:23843
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:24460
Abbyy6OCREngine Character Count:25590
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;25590;3065;44.3681;95.6272
language:en
ScansoftOCREngine Predicted Accuracy:72.54%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:7859
ScansoftOCREngine Character Error Ratio:0.3288
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;24460;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:95.63%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:95.63%
ImgPrep Component Range:19114,22392
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;23843;7840;0.785681;72.5412
noPunctuation:1
ImgPrep Component Count Low Estimate:19114
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 10.0 ID5 11.0 ID6 12.0 ID7 13.0 ID12 9.0 ID27 8.0 ID29 7.0 ID32 15.0 ID33 19.0 ID34 58.0 ID35 33.0 ID36 18.0 ID37 47.0 ID38 32.0 ID39 16.0 ID40 17.0 ID41 34.0 ID42 14.0 ID43 23.0 ID44 25.0 ID45 28.0 ID46 6.0 ID47 20.0 ID49 29.0 ID50 22.0 Layout Page ID1 HEIGHT 30284 WIDTH 22116 PHYSICAL_IMG_NR 4 PRINTED_IMG_NR [4] PROCESSING PrintSpace 30144.0 22063.0 HPOS 0.0 VPOS 132.0 PC 0.95629996 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1480 22063 0 132 ns1:type simple language en TextLine 180.0 60.0 13736.0 String CONTENT I WC 0.8095238 Ifir SP -60.0 13796.0 192.0 15500.0 6564.0 316.0 204.0 Irn STYLEREFS 80.0 22035.0 348.0 1 15268.0 6768.0 1I -28.0 72.0 120.0 4884.0 432.0 Tr 128.0 9564.0 5504.0 448.0 104.0 7 15040.0 488.0 9432.0 5608.0 140.0 11408.0 496.0 548.0 616.0 108.0 676.0 580.0 li 152.0 524.0 64.0 728.0 -56.0 784.0 56.0 3532.0 2776.0 756.0 IifJI -20.0 3552.0 52.0 11872.0 596.0 J 8320.0 164.0 556.0 664.0 ifJI ifJIfk -164.0 720.0 144.0 1008.0 396.0 912.0 112.0 176.0 fk 888.0 984.0 572.0 36.0 1368.0 944.0 f 452.0 916.0 552.0 13760.0 1060.0 528.0 B 760.0 1100.0 r 232.0 240.0 1272.0 440.0 832.0 68.0 13708.0 1212.0 e 12196.0 1512.0 352.0 17804.0 1568.0 1260.0 248.0 hI ALTERNATIVE fir76.0 6020.0 1476.0 L 4204.0 1816.0 336.0 10256.0 1396.0 TfiJI TP1I4124.0 6132.0 680.0 10648.0 TWICIIA 10592.0 1216.0 10652.0 1392.0 TW1CRAWULK -676.0 11328.0 472.0 11376.0 1388.0 WHItIl -492.0 11868.0 88.0 11928.0 5 11848.0 116.0 304.0 12016.0 TAR 0.95238096 96.0 12224.0 R -96.0 12320.0 168.0 12544.0 1380.0 AI 224.0 124.0 956.0 12548.0 ItSVlttJl AtNEsVzLLz12712.0 48.0 13344.0 1560.0 -160.0 13504.0 288.0 13628.0 1376.0 1LA 252.0 13376.0 13824.0 1372.0 A -92.0 13916.0 280.0 18240.0 1504.0 ki 4320.0 13920.0 18328.0 It -192.0 18520.0 18408.0 1524.0 > 18419.0 t -4.0 18423.0 1552.0 18471.0 18639.0 19336.0 608.0 18728.0 xmlns:ns2 ID4 8728 4648 556 1860 ns2:type 312.0 4536.0 576.0 1860.0 200.0 1948.0 276.0 2548.0 1892.0 The Tho1912.0 636.0 292.0 2896.0 1880.0 Gainesville OaiResille2828.0 928.0 3740.0 1868.0 TwlcBAWBB 3680.0 416.0 Tice -928.0 4668.0 284.0 536.0 4216.0 AYcek 4156.0 300.0 4812.0 Star 4752.0 StarD 0.96825397 -300.0 5112.0 1068.0 3304.0 2280.0 100.0 2316.0 D 2300.0 E 0.82539684 B03404.0 620.0 3752.0 GODWIN OODWINcIODWIN3636.0 GODWINbdltor -620.0 4372.0 OODWINbdltor cIODWINl cIODWINidItorand 148.0 3508.0 2528.0 420.0 2552.0 bdltor 136.0 692.0 2536.0 idItorand -420.0 3928.0 236.0 3964.0 and -236.0 4200.0 732.0 4252.0 Proprietor ProprietorEntered -732.0 4984.0 ProprIetornntered Proprietorltntered 708.0 2768.0 l 2400.0 2700.0 2872.0 2908.0 Entered nnteredltntered160.0 320.0 3264.0 2912.0 April 3196.0 480.0 3656.0 281003 3584.0 2S a8-480.0 4136.0 256.0 3880.0 1003 1tO392.0 3788.0 at 700.0 4400.0 Galneiville4332.0 GainesvillePU GainesvilleFlaGalneivillena-700.0 5100.0 184.0 2580.0 2568.0 3044.0 3084.0 PU Flana84.0 2916.0 3136.0 as 2772.0 II -120.0 3036.0 3072.0 3088.0 secondclass econdctassKCOfldCIUS2976.0 404.0 3872.0 3080.0 matter nlaUer44.0 3828.0 360.0 4356.0 3052.0 under 4276.0 220.0 4756.0 Act 40.0 4716.0 5020.0 of 4976.0 ofCongress -128.0 5148.0 ofCOligms ofCotigress 188.0 1652.0 3244.0 3288.0 Congress COligmsCotigress3164.0 3267.0 3116.0 3360.0 3256.0 March STarch3292.0 156.0 3804.0 31879 3756.0 31879Published -416.0 4220.0 3284.0 3 t879 18793864.0 t879Publlhed -256.0 1879I 4540.0 3604.0 604.0 2696.0 3651.0 Published Publlhed2112.0 584.0 332.0 3376.0 every 3300.0 520.0 3772.0 3628.0 Tuesday 3708.0 4360.0 3612.0 nnll4292.0 428.0 Friday I1rldayrrWay4596.0 Fridayat I1rldayatrrWayI-428.0 5096.0 3336.0 824.0 3812.0 3920.0 3860.0 1708.0 844.0 2628.0 -48.0 2676.0 2800.0 3840.0 100 3848.0 -232.0 3032.0 a 2848.0 268.0 3180.0 year 3260.0 ear -188.0 3448.0 3492.0 3820.0 In 504.0 advance 3608.0 advanceSo -504.0 4160.0 advanceit 4004.0 3976.0 4040.0 it 820.0 4100.0 712.0 1620.0 4048.0 768.0 852.0 3056.0 4044.0 50 So301284.0 1772.0 344.0 3236.0 4008.0 Cents Cent3192.0 3624.0 3996.0 for 3580.0 212.0 3844.0 3984.0 Six 4096.0 Months 4056.0 476.0 Monthst -476.0 4576.0 4132.0 4151.0 4196.0 24.0 1048.0 4228.0 i 424.0 624.0 2996.0 25 231924.0 1072.0 4224.0 2 3168.0 4184.0 Centa3560.0 4172.0 3516.0 368.0 3780.0 Three 3744.0 512.0 4192.0 MonthMonthL4148.0 MonthsAnVHRTiswo -512.0 4704.0 MonthADvnRtISINO MonthLI 4608.0 3940.0 560.0 4496.0 4532.0 872.0 3148.0 4508.0 AnVHRTiswo ADvnRtISINOADVUaTISIHO408.0 4092.0 RATES RAIJtS4020.0 RATESI -408.0 4500.0 RAIJtSIocat 4568.0 564.0 4648.0 4760.0 2692.0 4700.0 2096.0 4688.0 ocal Iocat2752.0 I4ocal -344.0 4680.0 Readers 3632.0 4672.0 la3588.0 460.0 3824.0 brcvere brcvercbrevere4352.0 type tPC4284.0 4708.0 4675.0 4620.0 scent 4768.0 scenta -368.0 5076.0 4820.0 cents centsHue -312.0 5132.0 centsI 3480.0 4840.0 4880.0 2540.0 4904.0 ft1940.0 600.0 2664.0 4864.0 line Hue2612.0 172.0 2948.0 2900.0 2992.0 4900.0 or 3120.0 3156.0 4860.0 each cach3504.0 insertion InertlonjusertloninsertionSpace -548.0 4052.0 InertlonSpace jusertlonI 4560.0 4988.0 5044.0 1092.0 5116.0 492.0 5047.0 Space 1116.0 5040.0 456.0 3308.0 5032.0 display 3268.0 5008.0 dlptayatvertlsement dIsp1aya1vertiSeflet1t3-456.0 3764.0 advertisements -916.0 384.0 priced pricedon pricedL-384.0 5136.0 2868.0 568.0 5208.0 5260.0 228.0 924.0 5248.0 644.0 2544.0 on 976.0 688.0 2748.0 application apptlcaUonapplicationjQafnesvJIIe -688.0 3436.0 apptlcaUonGaincsvJlle 5428.0 j 4520.0 -12.0 272.0 840.0 5460.0 992.0 5496.0 ti 880.0 3208.0 5612.0 5680.0 804.0 2680.0 5632.0 jQafnesvJIIe GaincsvJlleGaiicsv1I1c1920.0 5624.0 Is 3484.0 3792.0 5668.0 3696.0 3924.0 5616.0 city 3868.0 4548.0 schools c1iools4432.0 schoolschurches -552.0 schoolschurcbes 3428.0 936.0 5796.0 5924.0 1024.0 4J 5852.0 churches churcbes1400.0 1148.0 264.0 3216.0 5832.0 436.0 3548.0 5848.0 pretty 5828.0 girls girlsThe -320.0 4364.0 2464.0 6180.0 6204.0 3104.0 6196.0 farmers 3712.0 have 4144.0 6187.0 had bad4472.0 6220.0 some 4420.0 4944.0 de delightful -168.0 deI 5120.0 6252.0 3464.0 1704.0 6392.0 6547.0 6408.0 lightful flgbtftil800.0 1728.0 3112.0 weather 208.0 3784.0 6404.0 3716.0 harvesting 3992.0 216.0 cot 4848.0 cotton -216.0 cotr 5124.0 6460.0 1792.0 6616.0 6687.0 2532.0 6644.0 ton 1748.0 2816.0 this 2756.0 388.0 3132.0 week wcckweekLee -388.0 3520.0 380.0 wcckLee -380.0 2292.0 6960.0 6988.0 Lee 3016.0 6984.0 county 2972.0 244.0 6972.0 has lies3876.0 6968.0 also 7000.0 gone 4736.0 dry dryThe 4992.0 2616.0 7156.0 296.0 7192.0 3028.0 7184.0 cranks crauks2824.0 7220.0 are 196.0 3500.0 7187.0 not 7172.0 all 4272.0 4660.0 4912.0 7160.0 old 4792.0 oldAlnclum 5144.0 oldAlachla 1684.0 7388.0 7412.0 1740.0 7476.0 1712.0 7404.0 Alnclum AlachlaAlachun748.0 1788.0 3252.0 7440.0 no 3572.0 by 3808.0 b -180.0 4104.0 7424.0 many tuany3948.0 tuanyAll -404.0 manyAU manyi 952.0 812.0 7592.0 7620.0 1632.0 828.0 5t -132.0 1764.0 2432.0 2716.0 7728.0 7756.0 All AU3060.0 7744.0 Indications 1ndIct1ons7760.0 7752.0 present 4080.0 372.0 4776.0 point pointto -372.0 7904.0 7988.0 to 1636.0 2744.0 8016.0 n2688.0 2880.0 8008.0 very 716.0 7955.0 successful 532.0 4032.0 7948.0 coming 4616.0 7964.0 term terni4564.0 5004.0 7936.0 4948.0 ofStetson -148.0 5152.0 2176.0 8160.0 8184.0 Stetson 8172.0 University Un1verity3076.0 3960.0 8180.0 3904.0 4152.0 Demand DeLandDemandThere -572.0 4724.0 De DeLandi -196.0 4348.0 nt1d -252.0 nt1dThere 4504.0 660.0 8512.0 8571.0 2712.0 8532.0 There 2024.0 3312.0 is 3144.0 3424.0 probability 3684.0 308.0 4856.0 that thatGainesville -308.0 5164.0 2608.0 8723.0 796.0 8740.0 3408.0 3364.0 3596.0 8756.0 3524.0 340.0 3736.0 8776.0 4168.0 4368.0 8728.0 match watch4308.0 fac factory -212.0 facI 5128.0 8792.0 4.0 4572.0 8931.0 8967.0 8976.0 tory 1932.0 8955.0 2860.0 3432.0 8952.0 good 464.0 3836.0 8948.0 things 3776.0 8984.0 4300.0 540.0 comlug4580.0 comingGalncsvllleward -540.0 5188.0 comlugGaluesvl11eward comingGaitiesvilleward 2572.0 9164.0 Galncsvllleward Galuesvl11ewardGaitiesvillewardGalncsvlllewardBarring -1148.0 3720.0 Galuesvl11ewardBarring GaitiesvillewardBarring 2452.0 2740.0 9503.0 9524.0 Barring 9512.0 violations vlolatlo11sviolatlona3296.0 4240.0 4528.0 9516.0 the 4384.0 local localoption -336.0 5192.0 2584.0 9720.0 9732.0 option 9740.0 law 3040.0 9728.0 AUchua AlacbulAlachna4328.0 4188.0 4956.0 4832.0 hashad -240.0 5196.0 2604.0 2592.0 9928.0 9948.0 3000.0 9943.0 but few 9940.0 crimes crimlS4428.0 committed committedwithin -768.0 2600.0 10143.0 10152.0 within 3124.0 10160.0 her ller3444.0 10156.0 borders 10148.0 wltb1n4624.0 4556.0 he last lastthree 5204.0 lasti 940.0 10368.0 364.0 three months mouths10536.0 xmlns:ns3 ID8 8424 4956 360 10684 ns3:type 2448.0 2784.0 10684.0 10699.0 Politics PoUtiesvout1in 3320.0 Florida Plorida1lorLda4176.0 10735.0 may 4120.0 10708.0 get 4480.0 4828.0 10728.0 warm warmor 5232.0 10892.0 10952.0 2836.0 10904.0 otherwise 3640.0 3528.0 4016.0 10899.0 3896.0 592.0 4604.0 through 4544.0 throughout throughI-592.0 896.0 11100.0 11155.0 1672.0 11192.0 2632.0 11131.0 out 1736.0 2940.0 11104.0 2884.0 11119.0 State arc3600.0 588.0 4024.0 11107.0 opening 3944.0 4732.0 4612.0 5036.0 4928.0 thefall -224.0 thefaU thei 3652.0 1608.0 11288.0 2644.0 11332.0 fall faU1692.0 2984.0 11344.0 terms tcnnstenus3556.0 11320.0 3388.0 11351.0 prosperous 392.0 4868.0 termsare -392.0 2028.0 11532.0 11583.0 2932.0 11536.0 expected expeded2888.0 3568.0 4072.0 11544.0 quarters 4012.0 quartersBy quartersDyquartersf-600.0 1104.0 11839.0 2820.0 11899.0 By Dy1168.0 3140.0 11884.0 324.0 3536.0 11892.0 time 3420.0 3972.0 4164.0 must certainly 4524.0 certainlyhave -644.0 5264.0 -640.0 -636.0 2656.0 12083.0 12104.0 3108.0 12100.0 dawned 12136.0 upon 4256.0 12092.0 4140.0 12088.0 4484.0 4964.0 who vhowhowould -304.0 5268.0 5012.0 vhor 1016.0 12295.0 12315.0 444.0 12307.0 would 1564.0 like nICe12327.0 3852.0 12344.0 see sec696.0 Governor 12300.0 Jen Jennlngs -248.0 5212.0 Jennings 904.0 12508.0 12563.0 2660.0 12520.0 nlngs ningsniugs1700.0 960.0 iu hlIii3704.0 12515.0 United 3592.0 4248.0 States Senate 4696.0 Senatethat 5272.0 Senatei 2208.0 2672.0 12728.0 12732.0 his 2968.0 -208.0 3224.0 3280.0 3064.0 3644.0 12740.0 3892.0 4236.0 yet 12768.0 y -220.0 4456.0 4404.0 12735.0 4312.0 4512.0 12759.0 come comeGentlemen com comGentlemen -288.0 4800.0 comeI 1096.0 13068.0 13160.0 792.0 13083.0 Gentlemen Gcutlemeu1732.0 Do 4180.0 13092.0 violate 4408.0 5056.0 13071.0 5000.0 thegame 5280.0 2684.0 13276.0 13336.0 game 3128.0 13295.0 laws laVis1avs3676.0 13292.0 If 3452.0 328.0 4268.0 13288.0 13324.0 bad 4924.0 badjust badJust 13484.0 13500.0 just 412.0 13520.0 grunt 2964.0 3488.0 ond3440.0 500.0 endure 3760.0 4492.0 13491.0 them 4380.0 4960.0 until untilthe 5296.0 2556.0 13696.0 13716.0 Legislature 2920.0 656.0 13740.0 convenes again againand 5244.0 againud againf3476.0 1776.0 13904.0 13947.0 860.0 1824.0 13959.0 -264.0 ud 2904.0 3012.0 then ask n1kasic3328.0 3700.0 they 4436.0 13911.0 be 4656.0 repealed repeatedrepealedAnd repeatedAndrepealedi-596.0 5252.0 14244.0 14343.0 2864.0 14252.0 And 1780.0 1084.0 14300.0 now 3176.0 14259.0 Mayor 3544.0 Nolan 4676.0 4916.0 14247.0 Jack Jacksonville -332.0 JackiI ack -244.0 acksonville 5256.0 14312.0 1064.0 14447.0 14464.0 iI 14455.0 sonville 1416.0 1276.0 14452.0 mowing 3472.0 4288.0 weeds 356.0 Who Vlio4720.0 Whowould -356.0 5304.0 1200.0 14660.0 14676.0 1424.0 3220.0 llave14672.0 thought tlmouglmt14667.0 4872.0 wceis4728.0 weedscould 5300.0 wceislA 14843.0 14868.0 lA 14887.0 could 1596.0 14884.0 bave14916.0 grown 14928.0 gf -460.0 14923.0 wn up 14872.0 14875.0 busy 4908.0 4852.0 5240.0 Jacksonvllle Jacksouvilie 14940.0 1056.0 15072.0 n 544.0 15087.0 sonvlllesouvilie1556.0 1140.0 15092.0 3240.0 900.0 3688.0 15083.0 Jackouv1itedont 4588.0 15080.0 5028.0 becareful 15288.0 15304.0 careful shell 3200.0 15300.0 3936.0 15295.0 accused 15292.0 4488.0 400.0 4772.0 being 4692.0 5224.0 15331.0 5172.0 adry -76.0 668.0 2804.0 15515.0 15527.0 town townThere -348.0 15776.0 988.0 15851.0 15988.0 15863.0 1988.0 1004.0 15860.0 15855.0 little 4424.0 4340.0 4836.0 5092.0 4968.0 theman 5316.0 theI 2440.0 2708.0 16063.0 16111.0 man 16072.0 wbosees 3380.0 only 260.0 evil evit16068.0 4416.0 others 4640.0 otherssays -444.0 othersJ 1032.0 16215.0 2620.0 16271.0 16319.0 says 16283.0 tlie3008.0 3400.0 esteemed 16276.0 TU 4060.0 4664.0 thisbeing -268.0 5312.0 thisbeiuSt thislj 16328.0 16515.0 lj 648.0 16476.0 beiuSt1668.0 1028.0 16491.0 time3096.0 16503.0 case Ctlsecne3384.0 16488.0 svould4476.0 16479.0 16500.0 5016.0 begood 5176.0 5236.0 16527.0 agood ati 16688.0 16700.0 16703.0 1688.0 1012.0 3160.0 16696.0 idea 3908.0 time4244.0 editor 16691.0 5080.0 time4940.0 theTU -228.0 5308.0 timeI 16908.0 17012.0 1640.0 16932.0 tostrive 3344.0 strive 16923.0 16947.0 sec16920.0 least lenIt5048.0 16940.0 one onegood onei3 17111.0 17116.0 i3 17123.0 1664.0 thing tIming17119.0 Mr 3660.0 Stockton StocktouStocktonBarrs 4684.0 StocktouBarrs StocktonI 17464.0 17503.0 2852.0 17479.0 Barrs 2420.0 17471.0 Barrstlic 3664.0 Congressmantobe CoimgrcssmnntobeCongressmantobenot Coimgrcssmnntobenot-1388.0 17676.0 17696.0 2980.0 17679.0 ouly3460.0 17723.0 poses nfriend 4780.0 5064.0 4980.0 thepeople 17884.0 17891.0 people 17887.0 3496.0 known 3668.0 4784.0 peopleto 18092.0 18111.0 18099.0 their 3048.0 4260.0 He lIe18095.0 bas18135.0 never neverbeen -396.0 neverI 704.0 18292.0 18304.0 been 1956.0 736.0 found 3024.0 18324.0 3692.0 slow 3912.0 4392.0 18343.0 4600.0 18295.0 inefficient inefficientin 18507.0 18515.0 18512.0 2832.0 3184.0 discharge lila4084.0 468.0 official 5060.0 du 4996.0 duties duI 18584.0 1108.0 18715.0 18735.0 ties t1es1572.0 1124.0 18723.0 aud2944.0 18727.0 3368.0 18720.0 will wiltsvillmake niake18763.0 an 4552.0 ideal 4844.0 idealCongressman IdealCongressman 18940.0 Congressman xmlns:ns4 ID9 1796 4580 716 19304 ns4:type 2444.0 19304.0 19324.0 Sultans 3152.0 19363.0 3800.0 excuses 4336.0 19328.0 fo focrimes forn forj-200.0 19524.0 19599.0 1876.0 19587.0 1132.0 744.0 2004.0 19560.0 cilnies640.0 2048.0 516.0 19531.0 against 19536.0 sub 4876.0 subjects subjectR 2596.0 19732.0 jects jectR19744.0 other 3932.0 19751.0 Powers 19747.0 nud4448.0 th thChristians -140.0 tbetbeChrIstlou5 5284.0 theChrlstintisunder 19947.0 Christians ChrIstlou5Chrlstintisunder -724.0 3416.0 19956.0 19952.0 3900.0 hiisown 4112.0 19995.0 own 4440.0 788.0 flagshould flagshmouldflagshouldno flagshmouldno-788.0 2524.0 20159.0 20200.0 2928.0 longer louger20164.0 accepted time4920.0 20171.0 Pow 4804.0 Powcrs 5220.0 Powera 20367.0 20408.0 ers crsera20372.0 3396.0 criminal 20375.0 should hould20379.0 bebrougt -156.0 20572.0 brougt 3248.0 20587.0 20623.0 20604.0 repentance arepelltance-72.0 4452.0 Hint thntflintwouh376.0 wouhmean wouldmean -376.0 1192.0 20787.0 20823.0 mean something sorlIethlngsorlIethlngI -748.0 3884.0 20828.0 so icthlng 3276.0 3616.0 21019.0 xmlns:ns5 ID10 8816 5268 21135 ns5:type 21135.0 21155.0 Only 2144.0 21179.0 3188.0 21140.0 fcv764.0 21143.0 candidates caudldates4636.0 21152.0 21191.0 ye yebeen 21167.0 YftYftbeen yetbeen 21343.0 21352.0 mentioned meutioned3856.0 21396.0 a93796.0 21379.0 IIOtmiot21355.0 beiiig behtgbeing4888.0 21360.0 eligi eligible eligip 21432.0 21548.0 p 21643.0 816.0 21676.0 2668.0 21551.0 ble 21575.0 21560.0 tIle the3068.0 offices 3352.0 21584.0 21567.0 which 21572.0 21611.0 aspire -144.0 aspireeven 21759.0 pire pireeven -276.0 21807.0 even -324.0 21771.0 though 4116.0 21780.0 4000.0 4516.0 sbould21783.0 beelected beelectedbut bei 21923.0 21956.0 9 21971.0 elected 1604.0 electedbut -488.0 21975.0 21983.0 there 22031.0 ninny21995.0 4808.0 whowill whowillllot whop 848.0 22143.0 22179.0 vi1willllot -260.0 2924.0 22200.0 3272.0 22207.0 22191.0 3968.0 3916.0 22203.0 22247.0 same 5024.0 forthe fortbe 22283.0 22387.0 tbe2936.0 22411.0 voters 22420.0 22423.0 22451.0 pass 22456.0 Oiltbem4744.0 themall themallit 22524.0 iaUIt 2564.0 2652.0 22599.0 aUIt allit-176.0 22603.0 3092.0 3316.0 22623.0 22615.0 convention 22664.0 22667.0 you youknow 5216.0 22807.0 know knowThe 2392.0 23183.0 23188.0 free 23195.0 seed 836.0 23200.0 department 3768.0 4764.0 23207.0 23212.0 theAgricultural thel 1900.0 23379.0 23399.0 Agricultural 1928.0 23408.0 Department 23432.0 23423.0 Wash Washingtou 5156.0 Washington Washinglon 23584.0 ingtou ingtoninglon23591.0 23647.0 23611.0 humbug 23623.0 484.0 4460.0 23627.0 23631.0 beabolished bef 23787.0 23795.0 abolished 1968.0 23823.0 Not 3324.0 23867.0 23831.0 ill4108.0 23859.0 twenty 23847.0 ofthe ofI 24007.0 2956.0 24015.0 packages 24027.0 24036.0 24051.0 seeds 24060.0 24103.0 arcarcscut aresent 24188.0 24203.0 24231.0 sent scut1716.0 24236.0 2952.0 24263.0 arc3564.0 24271.0 ever 24248.0 planted plantl24307.0 < -80.0 4412.0 4644.0 24267.0 tbeytheycost tbeycost 24432.0 24439.0 cost 3004.0 time24471.0 government goverulUent3232.0 24475.0 anything authing4972.0 24483.0 tbe4788.0 theamount 24643.0 24655.0 amount 24676.0 24679.0 24683.0 24691.0 better betterplaced betterptaced 24843.0 placed ptacedplacedHarmony -452.0 ptacedlIarmony placedm 25179.0 m 25200.0 Harmony lIarmony2100.0 25248.0 among 25259.0 our 4068.0 25243.0 members erubers25271.0 -612.0 25255.0 inCongress -136.0 25183.0 25403.0 25411.0 25463.0 25444.0 essential 25483.0 andmuch 25620.0 much 25639.0 25623.0 25627.0 desired 25635.0 if 632.0 25659.0 4304.0 25676.0 isto -108.0 25760.0 25843.0 2328.0 25823.0 2788.0 25835.0 accomplished 25840.0 Cor25855.0 25887.0 andin andp 26027.0 inview 2844.0 26035.0 view vicw-328.0 3172.0 3228.0 26043.0 26047.0 26055.0 fact fnct26060.0 let 4128.0 26108.0 us U 4632.0 26115.0 reniem rewemrenmemreniember -464.0 rewember renmemi 26231.0 26267.0 ber her26239.0 26255.0 26311.0 can 26275.0 do 26319.0 26287.0 betterthan 5228.0 26376.0 26439.0 than 2288.0 26471.0 26468.0 send seud26475.0 Sparkman Sparkwnn26495.0 4324.0 Lamar -68.0 26531.0 amar 26504.0 andBarrs andI andarrs 26643.0 pans Barrs2792.0 26683.0 arrs 26671.0 26667.0 WnshingtouVnshingtou26736.0 4208.0 26743.0 4464.0 26712.0 Con 4824.0 Congressmen 5160.0 ConFrressmen Congressnmen 26783.0 2516.0 26879.0 gressmen FrressmengressmenWednesdays -816.0 3332.0 FrressmenJim gressnmenS672.0 26891.0 gressnmen -672.0 27004.0 Jim -588.0 1268.0 27167.0 S JimW 1444.0 1300.0 2080.0 2780.0 27195.0 1000.0 Wednesdays 27212.0 W -956.0 884.0 dnesdays Veduesdas27239.0 Ocala OcaIn27263.0 Banner Bauuer27319.0 con conecontaineduajpng contain conetamed 27367.0 27419.0 taineduajpng tain -1072.0 3724.0 tamed rfa 3100.0 3212.0 27471.0 27427.0 Jong Joug3832.0 27443.0 editorial 27483.0 27495.0 thecaptionVMr thecapUop thecaptioimMr 2504.0 2640.0 27591.0 996.0 27632.0 captionVMr captioimMrcapUop -996.0 27644.0 27599.0 27679.0 27647.0 27712.0 4376.0 27731.0 27699.0 Mo Monopollst Monopolist 27703.0 io ionopolist 2576.0 27827.0 27835.0 nopolist nopollstami iliaItRi27871.0 27855.0 time27883.0 casual casunl27907.0 reader readerit -436.0 28011.0 28051.0 2812.0 28059.0 2760.0 28103.0 appear 28108.0 asplendid splendid-84.0 28087.0 4592.0 editorialleader 28251.0 28407.0 leader 28272.0 28315.0 113340.0 28279.0 socialist asociahist28319.0 paper 28283.0 4584.0 28299.0 Ed 1d4932.0 28439.0 itor 28471.0 Harris 28492.0 28504.0 28535.0 28531.0 -88.0 claUstj28507.0 oh obohno obno 1864.0 28671.0 28803.0 28695.0 1896.0 lies hes-292.0 3372.0 28679.0 jest 28736.0 3816.0 28699.0 gettin 28707.0 skeard 4232.0 4952.0 28719.0 tbl1tthat3ob 28859.0 Job Iou3ob28879.0 Stocktomi28903.0 11-116.0 4036.0 28911.0 going 28935.0 4444.0 28923.0 28971.0 2720.0 29047.0 684.0 uexfUt 1180.0 29059.0 1t13it4Stftt -684.0 29087.0 ttntes 29115.0 Senator SenntorSenator1c -544.0 29223.0 29727.0 1c xmlns:ns6 ID11 5344 2708 5232 1724 ns6:type 7912.0 1724.0 JIlIon 7940.0 JHon 2016.0 5544.0 1832.0 1856.0 DARRS BARRS6136.0 1852.0 WAS 6064.0 6568.0 SUCCESSFUL SUCCESSPULS1JCCI3SSFUL6500.0 SUCCESSFULHon -992.0 7560.0 2412.0 5440.0 2060.0 2084.0 Hon lIon5860.0 35756.0 6068.0 2076.0 M 1I5948.0 6336.0 Darrs6212.0 6848.0 6736.0 612.0 7240.0 2064.0 attorney nttarne7116.0 attorneyfor 7852.0 nttarnefor 2588.0 2244.0 892.0 5572.0 acksonvllte5484.0 6636.0 2276.0 6464.0 6992.0 2268.0 6888.0 7328.0 leading lending7216.0 leadingCongressional -528.0 7856.0 lendingCongressional 2460.0 2488.0 Congressional 6396.0 2480.0 candidate 6280.0 7200.0 2468.0 7080.0 7520.0 Comm7396.0 -272.0 7792.0 Commgress 7812.0 2520.0 2732.0 gress 5676.0 5628.0 5884.0 5820.0 6228.0 Second 6112.0 6852.0 Congrcssionnt6732.0 CongressionalDistrict -1008.0 7860.0 CongrcssionntDistrict District 5928.0 5804.0 ogain6172.0 6680.0 6612.0 7120.0 7536.0 lion bonImoim7444.0 lionest 7804.0 bonest Imoimest est 780.0 5512.0 taxpayers 5444.0 6348.0 6292.0 ackso1vUJe6492.0 7612.0 un 7460.0 7800.0 7808.0 der 5540.0 lasting 5488.0 6088.0 obligations obtlsntions6036.0 7024.0 6880.0 7288.0 him 7688.0 7576.0 bycausing -184.0 7872.0 causing 5864.0 5808.0 3523.0 council 7036.0 6980.0 7244.0 raise 7656.0 time7604.0 theassessment 7884.0 theasscssment timeassessment 776.0 assessment asscssment6076.0 6016.0 6368.0 property ropertyvroperty6248.0 -632.0 6412.0 6416.0 7124.0 6452.0 7436.0 7308.0 whichtaxes -448.0 taxes 5688.0 3988.0 were 6080.0 3956.0 6024.0 6376.0 6324.0 paid 6804.0 7296.0 tim7300.0 7400.0 3980.0 7340.0 7588.0 pro proportion 7836.0 proportiou propotfomi 7832.0 7844.0 portion portioupotfomi5760.0 its 5960.0 worth 6952.0 6772.0 7268.0 lit7112.0 7552.0 such suchproportion 7876.0 752.0 6060.0 4407.0 6004.0 6268.0 was 6608.0 belug6552.0 7064.0 required 7016.0 7740.0 oC7668.0 7880.0 oCthe 5528.0 poorer 5468.0 6048.0 laxpayerstaxpayersThe taxpayersTime-796.0 6844.0 laxpayersThe 2404.0 5400.0 4796.0 Time5772.0 following fottowlng5708.0 6524.0 from 6580.0 roam 6856.0 6916.0 tbe7224.0 4779.0 Jackson Jacksomm7136.0 -580.0 Jacksonvl11e Jacksommvilla vllle vl11evillaMetropolis 5564.0 Melrop 6424.0 6308.0 6160.0 6664.0 Sept 7132.0 21st tvlhl7420.0 willexplain tvlhlexplain explain 5872.0 6156.0 nature 6104.0 6724.0 6632.0 5200.0 Barrs1 DarrsBarrs6868.0 7516.0 fight fighmt7372.0 fightand -340.0 fighmtand 5588.0 tell telt5824.0 6092.0 time6032.0 6360.0 5431.0 victory 6316.0 6948.0 5419.0 Ime6860.0 7284.0 5416.0 won Von7652.0 forthepople 5656.0 thepople 5500.0 thepopleThe 6008.0 5536.0 -472.0 peopleThe 5712.0 ople -296.0 opleThe 5868.0 5800.0 5744.0 6176.0 5844.0 5856.0 met 7176.0 agahl7680.0 7580.0 onlast 6044.0 6084.0 652.0 5596.0 Saturday 6304.0 afternoon 7092.0 6059.0 7352.0 further furtber7228.0 furtherconsider furtbercouslder 6288.0 consider couslder5932.0 6284.0 tbe6264.0 proposition 6152.0 6256.0 or6996.0 508.0 raising 7276.0 raisingthe -508.0 5276.0 6468.0 6512.0 6504.0 assessument6480.0 6356.0 6652.0 6472.0 tbe6536.0 920.0 acksonviUe6876.0 JacksonvilleElectric -920.0 7888.0 7040.0 7052.0 acksonviUeElectrJcCompany -836.0 2624.0 6716.0 Electric 6711.0 ElectrJcCompany Company -668.0 6620.0 6692.0 288000 6704.0 7692.0 5364.0 6919.0 1000000 0000006928.0 xmlns:ns7 ID13 3348 5252 7116 ns7:type 5436.0 City 5816.0 7140.0 Attorney 5748.0 6532.0 DarrsBarra6936.0 7468.0 repre represented 2636.0 7320.0 sented 5784.0 7348.0 tbe5720.0 6052.0 7336.0 6456.0 7332.0 while 7327.0 Hou liou7152.0 ou 7072.0 7508.0 It7584.0 EHarlrldge EHartrldge 7848.0 ItHarlrldge 7532.0 Harlrldge Hartrldge856.0 7547.0 5992.0 repres -856.0 6904.0 6584.0 nted ntcd6964.0 ElectricCompany 7776.0 6216.0 7764.0 7768.0 contest ontesd -532.0 7196.0 6780.0 7803.0 6836.0 ntest 6824.0 7304.0 between betwecnbetweenthese betwecnthese 7972.0 7992.0 these 5776.0 7984.0 well welt5636.0 7979.0 6072.0 lawyers 7644.0 8004.0 Wnl7528.0 wasspirited 7920.0 Wnlspirltcdbut 7916.0 8199.0 spirited 8196.0 spirltcdbut 5984.0 6236.0 6380.0 Barra 8232.0 nrr -284.0 6788.0 succeeded 7784.0 7660.0 inconvincing Inconvincing 8396.0 8408.0 convincing 6140.0 8455.0 8404.0 majority 7168.0 8400.0 time7128.0 7504.0 8440.0 memo memnmemn-400.0 memobers nmemnbers 7864.0 8467.0 8616.0 8628.0 bers 5640.0 5584.0 8668.0 5936.0 6108.0 million williondollar doHar6628.0 8624.0 7088.0 assessmentfor -784.0 5292.0 8827.0 8839.0 5548.0 thl9111195888.0 8868.0 company 5840.0 6668.0 6548.0 8832.0 uot6944.0 7464.0 8860.0 exces cxces7316.0 excessive excessiver cxcessive 8876.0 9047.0 sive siversiveR siverR2456.0 9244.0 9272.0 5696.0 9268.0 5896.0 9260.0 Riles flues6332.0 9252.0 9247.0 Fleming Plemning6604.0 Bowden DowdenI3owden7292.0 Bowdenagain -584.0 7924.0 7344.0 Dowdenagain 7360.0 I3owdenagain -560.0 9460.0 9476.0 9472.0 fought 9464.0 6828.0 increase Incrcase6684.0 7416.0 MrRiles MrRUes 9668.0 9687.0 RUes9680.0 contended conteuded6696.0 9675.0 7376.0 9704.0 7712.0 too toomuch 9892.0 9900.0 5768.0 9896.0 5904.0 jump jumpThis 6484.0 2472.0 5472.0 10092.0 10107.0 This 5880.0 10119.0 10100.0 6660.0 7208.0 7596.0 10128.0 pres 7892.0 prescut 7908.0 10304.0 10339.0 ent cut10315.0 taxation 10312.0 sixteen 6428.0 7048.0 mills 10336.0 means xmlns:ns8 ID14 8684 2716 5328 10512 ns8:type 5328.0 10512.0 5692.0 10527.0 5980.0 10520.0 7568.0 Com 6872.0 5340.0 10716.0 10780.0 pany 10752.0 5700.0 10776.0 pay plY6528.0 annually annual1y6436.0 10747.0 7408.0 tIletime7640.0 city16ooo citym6ooo 10955.0 16000 16ooom6ooo16000DARKS 5920.0 16oooDARRS m6oooIJARRS 5916.0 5764.0 11216.0 11223.0 DARKS DARRSIJARRSIS 181052.0 6476.0 INTBRVIKWBD INIHRVlUwnDINT1tVIIW8DINTBRVIKWBDCity -1052.0 INIHRVlUwnDCity INT1tVIIW8DCity 5532.0 11416.0 11428.0 5908.0 11436.0 11440.0 Darrs6576.0 7020.0 speaking Jpeaklugpeak1ugspeakingof Jpeaklugofpeak1ugot-664.0 1820.0 11643.0 11648.0 ot5560.0 11652.0 5520.0 11664.0 5788.0 6440.0 said 6784.0 today todayThe todayrhe todayTime 2344.0 5652.0 11844.0 rheTime11851.0 5952.0 11856.0 in6340.0 6556.0 time6520.0 11863.0 essmentasessnieimt6792.0 6832.0 -808.0 7684.0 does docsdocsnot 7996.0 doesnot 5372.0 12039.0 5672.0 12064.0 require 12068.0 6192.0 tb 6516.0 6600.0 12080.0 street 7148.0 railroad 12076.0 topay 8000.0 5376.0 12271.0 12324.0 5900.0 12283.0 uuch6800.0 6748.0 628.0 7260.0 propertyin -628.0 7976.0 12484.0 12496.0 5580.0 12488.0 5508.0 6400.0 12503.0 6344.0 values 6544.0 7252.0 12524.0 7108.0 7724.0 payand 7980.0 payInd paymid 12679.0 12708.0 Indmid5684.0 12744.0 us12691.0 6808.0 citizen 12688.0 7636.0 12684.0 mod 111odmoderate 111oderate modcrate 7952.0 12896.0 12935.0 erate crate12952.0 5736.0 12948.0 pays 6244.0 12904.0 paysiu 6640.0 6920.0 12916.0 7696.0 tothe 5384.0 13104.0 13131.0 13128.0 value vatue13124.0 13116.0 Itis6352.0 6840.0 6700.0 TimeTheraise Timeraise 5392.0 13332.0 5792.0 5988.0 13327.0 valuation 6744.0 froni7256.0 7076.0 2496.0 13532.0 13580.0 OOOOOO13583.0 13536.0 5552.0 leaving heaving6672.0 13568.0 prop proparty 13600.0 5408.0 13735.0 13768.0 erty arty13747.0 assessed Messedacssed13764.0 nt atntmucb 7056.0 13744.0 less leMUIllnitlitsmarket itlmarket Itsmarket 13944.0 13964.0 market 5968.0 valt1evahime6496.0 13952.0 vIiL6820.0 produce 6756.0 7484.0 13991.0 Immincreased Inreased Immcreased 7968.0 14008.0 5404.0 14164.0 14167.0 creased reased5996.0 14208.0 revenue rcvenu14172.0 time6760.0 7100.0 7708.0 14196.0 over overtl6OO 5516.0 14324.0 14375.0 11600 tl6OO6116.0 14420.0 more 5972.0 14380.0 14408.0 7032.0 14372.0 hilsIms7676.0 14368.0 beenpaying 5396.0 14583.0 paying 14587.0 vihI14604.0 6708.0 totbat 14599.0 extent 7180.0 7820.0 14619.0 relieve 7704.0 7824.0 re reoreolIeve 14648.0 7960.0 14783.0 14804.0 lieve 5740.0 14800.0 wl 14839.0 o Jlavcimave14792.0 beemi7004.0 payimi7456.0 payingmore payinghlore payimituore 15000.0 15036.0 hloretuore5836.0 15012.0 thau tlmu6224.0 15003.0 6624.0 15008.0 share 6572.0 7068.0 7012.0 7700.0 bur butburden butden 15068.0 15208.0 15227.0 den 5724.0 15223.0 15220.0 15211.0 That 6508.0 15215.0 time7448.0 increas incrcnsincreases incrcnsem7956.0 15276.0 15420.0 15467.0 es em15432.0 15428.0 7204.0 enable citablethecity 8012.0 5412.0 15624.0 15636.0 15640.0 couucil15655.0 6488.0 15648.0 Igetalong 6740.0 7380.0 with 15664.0 anassessment 5424.0 15831.0 15848.0 6200.0 15843.0 10 15839.0 exclusive 7896.0 15836.0 ol 01of7840.0 olthe 01the oftime 16048.0 16060.0 time5728.0 16051.0 Carnegie OarnegleLibrary 6364.0 asessltlentasscssmimcntassessmentYou asessltlentYouasscssmimcntYou5420.0 16251.0 You 16307.0 16280.0 quote 6028.0 me wetue6900.0 16300.0 saying 16256.0 thatif thatff thatIftime 16456.0 ffIftime 16512.0 owners 16471.0 ownersofail -364.0 6908.0 atl6956.0 7624.0 16464.0 1mmtbetbecity 16679.0 16723.0 wcreassessed 6144.0 fairly tbe7720.0 tax taxable 16739.0 16879.0 16892.0 able 16911.0 propcrtof -624.0 6384.0 6596.0 time16887.0 6896.0 16884.0 bc7748.0 begreatly bcirreatJy 17087.0 17107.0 greatly irreatJy17104.0 iucrens5912.0 -104.0 Budamidtho tbClthmo7512.0 rate 7356.0 7780.0 oftaxation 8020.0 oftaxntiou 17312.0 taxntiou17316.0 conld17319.0 6924.0 materially materiatly17351.0 reduced 7944.0 17379.0 17519.0 17527.0 duced 17532.0 1mm5812.0 6272.0 17524.0 nettact6208.0 time6940.0 profits 6884.0 7548.0 7788.0 tbethewaterworks tbewaterworks 17732.0 17735.0 waterworks 6588.0 electric 6540.0 light Hehtplant plautplantand -360.0 plautoud 17923.0 17947.0 oud17944.0 Iii6864.0 o1ua1l0n7144.0 valuationwould o1ua1l0nwould 18152.0 18155.0 permit 6432.0 18200.0 considerable 7540.0 reduc reduction reductlou reductiomm 18223.0 18360.0 18363.0 tion tloutiomm18367.0 5944.0 tbls18403.0 Cor7648.0 Corthe 18575.0 18580.0 6012.0 6296.0 740.0 6752.0 apsolutely 7556.0 18611.0 neces 7492.0 necessary 18643.0 18783.0 18828.0 sary 18804.0 18787.0 spend during 6912.0 18795.0 next 18824.0 yeara 5336.0 18792.0 19039.0 la 18995.0 large 6300.0 19015.0 amnount6240.0 money muoncy7796.0 18991.0 8032.0 xmlns:ns9 ID15 1932 2668 5372 19200 ns9:type 19200.0 19251.0 sewerage 6096.0 19208.0 6040.0 drainage wblch7044.0 19247.0 arc arcabsolutely 5388.0 19415.0 absolutely 6188.0 19456.0 6128.0 necessar 6932.0 19432.0 protect timethehealth timeImcalth 1244.0 19623.0 19631.0 health Imcalth19628.0 oCtbe oftiiecity -432.0 6320.0 oftiiecityTHU -744.0 cityTUG cityTUB 1680.0 19920.0 19923.0 TUG TUBTHUSTRIKE STRIKI3STRIKES STRIKBSSTRIKUS6776.0 STRIKESThe 7488.0 STRIKBSThe STRIKUSTime -660.0 20140.0 20143.0 Timestrike 20183.0 cruel 20155.0 master nnd7608.0 andthe nndthe andtime 20343.0 20363.0 time5644.0 20360.0 cruelty 5592.0 20352.0 falls fallllfails20355.0 heaviest 7264.0 20387.0 theinnocent theilluocent theimmmmocent 20555.0 innocent illuocentimmmmocent20567.0 6444.0 20563.0 helpless JlelplessSuffering SutTeringSufferingand SutTeringandSufferingammd20771.0 ammd20819.0 sorrow 6276.0 20775.0 almost invariably 7772.0 20811.0 ac accompauy accompany 20840.0 8036.0 20976.0 20983.0 1020.0 thatcontlnucs 7236.0 continues 21048.0 xmlns:ns10 ID16 8576 2684 5288 21188 ns10:type 21188.0 21200.0 5620.0 21244.0 any 21203.0 length 21195.0 orthne oftimne-152.0 6592.0 lucre21232.0 orearefew orefew 21408.0 21411.0 workingmens workingamensfamilies 7716.0 21439.0 canstand canstolid 21616.0 21628.0 stand stolidtime21619.0 strain 21623.0 several 6712.0 weeks weeksor 5332.0 21831.0 21879.0 21835.0 montimsabsence ablcnceincome 21899.0 22039.0 22091.0 22048.0 Time7188.0 22043.0 those timosewltowlmowhoabor wltolabor wlmolabor 22251.0 22259.0 labor abor5704.0 6148.0 22256.0 hnnds hands7028.0 22295.0 are6976.0 7364.0 depend 7248.0 dependent dependeutdependcut-516.0 22459.0 22487.0 cut eutent22507.0 22468.0 thcirdaily dully22463.0 7732.0 forsubsistence forsubslstencc 5320.0 22671.0 22676.0 subsistence subslstencc22719.0 22679.0 when whcnwhcmm1mm7632.0 1mmcome 22743.0 22884.0 22935.0 22908.0 stops 6168.0 22887.0 Itis 6448.0 22927.0 a22899.0 great grellt7544.0 wJlilewhilebefore wJlilebefore 23091.0 23108.0 before 23099.0 6100.0 wolf 6056.0 23096.0 begins 6420.0 23115.0 23140.0 peep 23123.0 athe attbe atthe 23307.0 23316.0 tbethe23319.0 door 6232.0 rhe6676.0 public 23311.0 docs23331.0 110tnotoften 7932.0 110toften 23519.0 23527.0 often 5732.0 23567.0 23524.0 tbe23563.0 seamy side 7084.0 life lifeof 23731.0 23739.0 23743.0 5452.0 23775.0 are6312.0 idle because becnuse23736.0 7672.0 oftrikes ofstrikes 23944.0 23951.0 strikes trikesWhat 5780.0 23987.0 seen seeu23947.0 pa paade pazade parade 24155.0 24167.0 ade zaderade24164.0 24159.0 what whatJs -124.0 heard voice voiceof voicef24371.0 24379.0 -52.0 parties partied6388.0 24387.0 controversy controversyeach controversyach-852.0 24575.0 24587.0 ach24579.0 trying 24596.0 6372.0 justify Imis24623.0 7664.0 24627.0 po papoitlou position pasitlomi 5288.0 24792.0 24799.0 itlou sitionsitlomi24807.0 But Dut6260.0 behind 24795.0 hidden hiddenrom hiddenfrom hiddenfront 25004.0 25015.0 front5348.0 25051.0 rom 5664.0 View 25007.0 iew 25048.0 incidents andoccurences 25219.0 occurences 6120.0 wetltvchi25224.0 calculated calcnlated25236.0 wring Wrillgwringthe Wrillgtbe25432.0 tbe25435.0 heart heartIn 5956.0 25643.0 25647.0 25651.0 New York day 7312.0 tbebig bigstorm 7900.0 bigStorm 25867.0 storm 5752.0 25859.0 5892.0 25903.0 11tired 25864.0 nndweak wakweakwoman 25899.0 w wakwoman 7628.0 ak akwomau 5324.0 26067.0 26091.0 woman womauleadinfthrec26072.0 child chitdchildren chitdrenchildremm7828.0 26143.0 2560.0 26271.0 26299.0 ren remm5648.0 applied npplled26283.0 timepolice 26295.0 station stationfor 26463.0 5576.0 time26487.0 shelter shelferslmeiter26535.0 26519.0 vagrants 7572.0 26499.0 cell 7432.0 cellThe cellTime 7816.0 Time26724.0 womuat5604.0 26700.0 she 26703.0 26707.0 Uletimechildrell childrca 26888.0 26919.0 rca renrellbad26899.0 lived 26944.0 26907.0 thctime26927.0 streets 26923.0 forthree fortbree 27091.0 tbree27099.0 days 6124.0 27120.0 27111.0 nights 724.0 subsisting subsistingupon 2508.0 27307.0 27340.0 27355.0 scraps 27328.0 pick 27371.0 27507.0 Her 27516.0 husband 27575.0 27571.0 1127527.0 7212.0 mau27551.0 mid andamidmidprovided andprovided amidprovided 27724.0 provided 5940.0 27739.0 27748.0 badhadwork badwork 27935.0 work 27947.0 lie27951.0 27959.0 7280.0 27995.0 em el1cmiiemployment -204.0 el1ployment cmiiploymnent 28031.0 28144.0 ployment ploymnent28151.0 28195.0 28199.0 Q28163.0 month uionthutouthmonthon uionthonutouthon28359.0 28376.0 28388.0 account 28403.0 7164.0 28364.0 Gradually GraduaUyGraduallyall GraduaUyaUaU28547.0 5524.0 28603.0 772.0 28567.0 mOlleybad 28571.0 given glven28587.0 28575.0 tbenthemithentheir tbentheir themitheir 5352.0 28751.0 furniture 28795.0 went 28779.0 28783.0 food 7096.0 28791.0 andafter 28939.0 after 28987.0 28992.0 5876.0 28947.0 28967.0 Ihelrbeir29004.0 scanty 29011.0 store 28983.0 otofextra otextra 29155.0 29163.0 extra clothes clotltesThen fbenTlienthe 29187.0 29203.0 rent rCl1t29207.0 fell feltfeltT 7736.0 29607.0 29675.0 29623.0 6184.0 29711.0 T 29632.0 s 29627.0 xmlns:ns11 ID17 5388 2724 7960 1680 ns11:type 8980.0 10656.0 Idue 1696.0 1808.0 due 8240.0 8444.0 1804.0 They Timey8056.0 8888.0 1800.0 couldnt 8824.0 coul 9508.0 couldmitay 9188.0 9296.0 9804.0 9544.0 1796.0 riay9952.0 nmmtl1844.0 10220.0 10296.0 10120.0 thewere 10524.0 thiep thiepwere 10616.0 2012.0 8376.0 dispossessed 8312.0 9376.0 turned turne4 -484.0 9860.0 turmm 9864.0 9980.0 into 10392.0 thttime10268.0 thestreets 10624.0 thtstreets timestreets 10584.0 2160.0 8592.0 2220.0 without 9316.0 2232.0 9176.0 9784.0 2264.0 ort 9636.0 01 10044.0 ojmelter 9960.0 ojmelterTime -780.0 10564.0 10084.0 liclter i1le1teri1le1terThe 10140.0 liclterThe -424.0 2408.0 2436.0 Time8412.0 8268.0 9068.0 2484.0 8940.0 1144.0 9480.0 liollowcljeekcd bohlowciteked9336.0 liollowcljeekcdand bohlowcitekedarid-1144.0 1101l0wc 10108.0 10372.0 kcJ 10204.0 kcJand aridwan vaii8244.0 8708.0 8608.0 9040.0 9348.0 sunken aumikemi10008.0 9876.0 nndl nnditis10272.0 nnditisterless -564.0 10572.0 10332.0 liis liistcrlcs 10504.0 stertc81 tcrlcs tertc81terless8536.0 eyes 8460.0 8900.0 8852.0 9112.0 9048.0 9404.0 cllildrcnchmildrcmi9344.0 plainly pininly10000.0 plainlyfold 10620.0 pininlyfold fold 8344.0 or8284.0 oftheir 8496.0 8544.0 -352.0 8896.0 sufferings mfferingS9028.0 ufferingfronm -648.0 9676.0 9712.0 frour10036.0 hunger hmtmgcrhungerand hmtmgcramid amid8332.0 exposure 9004.0 9232.0 1he9664.0 womtlnwomaim9528.0 10176.0 wasfed wasrcd 3468.0 fed rcd3512.0 8564.0 time8504.0 8844.0 8788.0 -412.0 9256.0 pohicetuid 8892.0 9576.0 8936.0 otceluJd 8928.0 9320.0 9672.0 timechuidremichildrenwere chuidremiwere10588.0 8416.0 taken 8356.0 8804.0 9008.0 foundling foundliugfoummchling9144.0 10064.0 asylum 9944.0 asylumtemporarily -524.0 asylumtcnmpornrily temporarily tcnmpornrily9148.0 TlintTJmt3895.0 9748.0 10360.0 10264.0 thestrike 10600.0 10364.0 10596.0 did 8744.0 8680.0 8796.0 8944.0 8996.0 oueommefamily fanmlly9248.0 10020.0 Here iere9768.0 10492.0 10384.0 iswhat -112.0 10604.0 Iswhl1t 4279.0 whl1t8340.0 8556.0 another 9052.0 anotherThos 9696.0 anotherlimos 8144.0 Thos limosGowan Gowau9388.0 white wllite9992.0 9792.0 10416.0 ar arraigned 10560.0 arraigiied raigned raigiied8520.0 9104.0 4791.0 9304.0 4748.0 9848.0 magistrate waglstrate9724.0 magistratein waglstratein-772.0 8176.0 8104.0 8468.0 oity9276.0 omi9604.0 9456.0 9824.0 charge 9684.0 10480.0 ofstealing 5175.0 5180.0 stealing 8552.0 8992.0 knobs kmmobsrhereweretears 2648.0 tears 8384.0 8560.0 checks clleekswlicmiwlen 9904.0 10024.0 10196.0 confessed confesscd fessed fesscd8476.0 theft thcft8704.0 9116.0 9592.0 told 9440.0 10016.0 why 10452.0 10328.0 hehad -172.0 heImad 5815.0 Imad8316.0 stolen staten8252.0 8988.0 9124.0 cant 9060.0 9560.0 9492.0 10464.0 beliehesaid 10636.0 besaid liesaid 6035.0 8572.0 8272.0 am aUlant8640.0 6071.0 8920.0 9220.0 9152.0 9292.0 amid10412.0 time10276.0 theunion 10644.0 timeunion union 8836.0 8720.0 9620.0 stay 9760.0 10344.0 10208.0 outWhen 10576.0 outVlieu When Vlieu8516.0 8448.0 8584.0 9128.0 home hOll1e8972.0 9520.0 10060.0 night nlg11t10456.0 Ifound 6675.0 8492.0 6720.0 my 8428.0 chll 9160.0 9436.0 crying 10012.0 9908.0 10224.0 foodand 10640.0 6892.0 lilYnmy8276.0 8632.0 wife 8568.0 9044.0 6931.0 9196.0 10252.0 xmlns:ns12 ID18 3356 2676 8012 7104 ns12:type 7104.0 hardly walk 9208.0 8968.0 order 9368.0 10056.0 save 10192.0 savethem savetheUl savethenm 7324.0 theUlthenm8456.0 8908.0 7315.0 starving 8780.0 9936.0 stole 10428.0 time10280.0 theknobs timeknobs 8576.0 hoping 9080.0 9332.0 sell 9280.0 9716.0 10432.0 Iii10072.0 Investigation Investlgatlon Iiivestigatlomi 10608.0 8024.0 vestigation vestlgatlonvestigatlomiproved 9392.0 9744.0 mans mausstory 10184.0 storytrue storytiLie 8028.0 7943.0 true tiLielhemagistrates 9924.0 sympathy sympathywas -728.0 8164.0 8216.0 8168.0 aroused arouse18296.0 nr -556.0 8912.0 8596.0 usel amidlie9572.0 Gowah GowanCowanGowahthat Cowanthat 8388.0 liemight 8419.0 go go19400.0 9328.0 lie9652.0 8392.0 9912.0 10436.0 10376.0 notsteal 10664.0 8600.0 steal 8420.0 8352.0 9056.0 8595.0 Dut8808.0 8588.0 10028.0 time9932.0 maim10260.0 manto maimto 8812.0 8803.0 Time8800.0 8932.0 9412.0 9656.0 9596.0 8815.0 10420.0 ithas 10660.0 9012.0 9024.0 8336.0 9016.0 8280.0 lIympathymympathy9832.0 time9764.0 hungerof 9235.0 womauwomnamm9228.0 amid8760.0 9223.0 cllildren9092.0 9776.0 Gowau GowanCowan10076.0 Gowauwere -520.0 10680.0 10164.0 Gowanwere Cowanwere 10676.0 8044.0 9431.0 9488.0 8452.0 8648.0 9484.0 8872.0 job 9455.0 9308.0 trade 9868.0 10540.0 10396.0 ofteamster 8048.0 teamster 8820.0 amid8676.0 endeavor 9084.0 earn earmi10180.0 earnbread 10688.0 earmibread 8052.0 9856.0 bread 8528.0 9863.0 8784.0 bis8736.0 famltyfamnily9640.0 lie9800.0 beunder betinder 8064.0 10068.0 10080.0 tinder8840.0 ban bau9224.0 9108.0 10071.0 9852.0 imtrike10424.0 andmight andmuighit 2256.0 8072.0 10288.0 muighit10327.0 8960.0 suffer 9428.0 bodily 10284.0 harm lmarimi9884.0 xmlns:ns13 ID19 8928 2664 8080 10491 ns13:type 2236.0 10491.0 10508.0 thc10500.0 pity 8692.0 9132.0 10496.0 9032.0 9424.0 9692.0 9984.0 isnot 10704.0 Isnot 8080.0 10732.0 10756.0 soiiic8880.0 9444.0 baud handlmmmd10172.0 10484.0 timethepermanent timepermanemit 10916.0 10943.0 permanent permanemit10920.0 speedy 9956.0 settlement settlementof -760.0 8084.0 11124.0 11136.0 8300.0 8228.0 8732.0 troubles 11128.0 audamidf9r19r9964.0 11168.0 protection protectioti 10668.0 11196.0 8092.0 11348.0 tection tectioti11339.0 11384.0 women 9408.0 11336.0 9360.0 10124.0 childrenfrom 10712.0 2396.0 11548.0 11556.0 8508.0 11560.0 time8816.0 11571.0 terrors 9300.0 strikeSavannah strikeSnvannah 8108.0 11768.0 Savannah Snvannah8916.0 News 8828.0 NewsdBTTINU NewsOBTTINU NewsUI3TTINU 2304.0 8236.0 12143.0 12148.0 dBTTINU OBTTINUUI3TTINUNEARER NtMU3RTHE TilETHU9600.0 TRUTH 9972.0 TRUTHAlong 12368.0 12387.0 Along 12380.0 8724.0 12372.0 time9828.0 12384.0 10320.0 utter imtterutterances imtterances 10672.0 12440.0 8100.0 12604.0 ances 12560.0 time9180.0 12568.0 9064.0 12576.0 men ifleii9552.0 12580.0 we havequoted 10720.0 8096.0 12711.0 quoted 8712.0 how insignificant 12720.0 Inslgni -896.0 9752.0 12756.0 appears appearsthe appearstime12875.0 12923.0 time12908.0 criticism 9072.0 12911.0 9212.0 9700.0 10440.0 12899.0 tbatthatthe tbatthe thattime timenewspapers uewspapersmmewspapers13076.0 iniim9236.0 I1orIda13107.0 sup 10356.0 supporting 13140.0 8116.0 13244.0 13259.0 porting hiltim13264.0 13252.0 parted 9384.0 9996.0 theirinfluence 10736.0 theirInfluencc 13396.0 influence Influencc13435.0 8768.0 13479.0 n13420.0 consideration consillerntloncomisideratlonconsiderationWe consillerntlonWecomisideratlonVe-960.0 13592.0 13616.0 We Ve8656.0 13612.0 hope 8540.0 liediet1111I0t9556.0 9968.0 13595.0 nmake10476.0 thisstatement 10740.0 8120.0 13804.0 statement 13788.0 13780.0 9140.0 9416.0 13776.0 13816.0 a11aim9880.0 unfortuniite unfortunhteirnfortunhteunfortuniitestatement -860.0 unfortunhtestntement irnfortunhtestatement 13940.0 13976.0 stntement9000.0 14000.0 9204.0 n13988.0 person 9284.0 9872.0 aspiring 9812.0 forhigh 10744.0 forlmigh 8132.0 14116.0 14131.0 high lmigh14136.0 office 14140.0 of1 14179.0 ce 8688.0 14152.0 14124.0 amid10004.0 10388.0 react reactupon reacttipoim 8128.0 14292.0 14351.0 tipoimiiinm8480.0 14307.0 9324.0 14295.0 increasing limcreasing10188.0 weight weightOcala 8292.0 14488.0 8772.0 DannerBannerWe DannerWc BannerVe 14679.0 14700.0 WcVe8612.0 14696.0 14727.0 seeli9372.0 14684.0 808.0 somewhere soimiewhierestat stated stateddont statreumeniber 14752.0 14860.0 ed eddont remember remcmberreumeniberill9616.0 9796.0 10324.0 14896.0 paperthat 8288.0 15027.0 15048.0 15044.0 John JohllJohim15039.0 Stocktoim9756.0 15032.0 10444.0 thatevery thateery 15259.0 eery15256.0 Uiorlda9840.0 miotsupport supportIng supportlug 15375.0 15396.0 ing lug8424.0 hlll1imimim8764.0 9088.0 subsidized 9156.0 15384.0 -736.0 idlzcd 9504.0 10116.0 organ 15380.0 ofliU ofhis 15556.0 15563.0 liU15592.0 opponent oppomicmmts15611.0 9184.0 poneUli Of 9708.0 15595.0 course mio10168.0 onebelieves onehe1ievcs 8136.0 15727.0 15739.0 believes he1ievcsStcktotm15771.0 VIr9788.0 10348.0 made mimademadesuch mimadesuch 15899.0 15920.0 8580.0 15956.0 sweeping Rwccplng15923.0 statemcnt9452.0 nndmmdandyet nndytt mmdyet 16075.0 16107.0 ytt16131.0 16084.0 believe 16087.0 tliqt thqtthmt9168.0 9648.0 16119.0 1111tinoleoic10244.0 doubts douhtshoilhtsdoubtsthat douhtsthat hoilhtstimat 8140.0 16264.0 timatSolliesoimmetimeantiStockton nntiStocktonantiStocktomi9356.0 10516.0 16295.0 papers papcrs 16324.0 16428.0 pers pcrs8484.0 arc8748.0 9588.0 16432.0 aUlIamiL16467.0 10352.0 10696.0 16495.0 16599.0 16635.0 port 16607.0 iminiIt9020.0 9532.0 16652.0 c uld 16628.0 gtt16640.0 lUoreimrnremoremoney lUoremoney imrnreumoney 16780.0 16831.0 umoney8672.0 16807.0 16788.0 doso soGainesville dosoGaimmesville9036.0 10292.0 StarStockton 16988.0 17000.0 16991.0 17032.0 say 9548.0 17007.0 9496.0 Bclltuont DelhnontBehhmimout10448.0 thatwhenever thatwhencver thatwimenever 8124.0 17172.0 whenever whencverwimenever17208.0 saw 17212.0 17203.0 oppos opposing opposlug 17235.0 17336.0 17343.0 lug17348.0 luau8348.0 17384.0 9096.0 9608.0 17340.0 10628.0 itbelonged 10724.0 itbelomiged 17512.0 belonged belomiged17536.0 8964.0 17515.0 corporations 9288.0 10404.0 withfew 17691.0 exceptions 9632.0 words 17708.0 thato thatoffect thatoflect 17863.0 17916.0 17875.0 fleet offectoflectond8500.0 17872.0 nil8884.0 17867.0 lie10132.0 knew 17879.0 tobe 18036.0 18048.0 false 18039.0 18084.0 vhiIalways 10104.0 alwaysoppose 8112.0 18215.0 18263.0 oppose Him 111mimimiiundar imudar18256.0 9420.0 18259.0 18235.0 management muanagememmtmanagementnot muanagememmtmmot-904.0 18387.0 18420.0 mmot18399.0 however 18435.0 imishishostility hisbostility imishostility 18560.0 18563.0 hostility bostility18592.0 8716.0 18568.0 hnshumshasnever hnsnever humsnever 18739.0 18744.0 dollnrcorporation 9808.0 corporationmoney -820.0 18920.0 18968.0 8652.0 8904.0 itnot -100.0 18935.0 10048.0 18956.0 thctheprice thcprice 19087.0 19096.0 price 19104.0 oiof19143.0 subsciptlon flubsciptloll1576.0 stmbsciptioiiJasper -880.0 stmbsciptioiiJasperNews -1576.0 Jasper JasperNews 19280.0 xmlns:ns14 ID20 1632 2632 8084 19476 ns14:type 8264.0 19476.0 19488.0 Very 19483.0 19479.0 19491.0 9568.0 10088.0 10548.0 Isgetting isetting 19691.0 19696.0 getting etting19735.0 nearer 8620.0 time19700.0 truth 10316.0 From Fromaccusing 19903.0 accusing 8856.0 19911.0 19908.0 9076.0 10228.0 saylmigsayingthat 10232.0 saylmigthat 20116.0 20119.0 20152.0 AU 8380.0 8700.0 time20128.0 1I0t9736.0 20135.0 10632.0 supportiug 20188.0 8088.0 20323.0 20328.0 lug ingiughminiarcsubsldilcdns subsldiedas-740.0 ns somehave 10700.0 somehnve 20539.0 hnveaffirmed beImesaidthe saidtime20543.0 Newsleaves 20747.0 20751.0 leaves 20768.0 timeword 20783.0 ALT AIIAILamid10380.0 20792.0 saysWITH saysvirir 8208.0 20964.0 20991.0 WITH WITUvirirjKw IHWvEv9192.0 HXCIJPTIONS nXCltPTIONSiC11TIomS10408.0 amidxmlns:ns15 ID21 9104 2700 7992 21171 ns15:type 21171.0 thmeim8464.0 21176.0 adds acIds21215.0 ef effect effeet fect feet21387.0 Now 9820.0 10340.0 21384.0 anti niuti10200.0 niutiStockton 10612.0 2260.0 21591.0 21596.0 hns21599.0 repented repentedand repentednndrepentedamid-608.0 21804.0 nndamidfeels 9772.0 revising 21816.0 Ute tljetl1etljecharge Utechar tl1echarge 22019.0 chargeIt char 22067.0 8372.0 eIt -64.0 8220.0 22340.0 22347.0 22343.0 Frank lra11k22352.0 James timetheexoutlaw timeexoutiav 22551.0 exoutlaw exoutiavsuing 22555.0 theater 9540.0 mana mamma10112.0 managers mammagets 22631.0 22763.0 22811.0 gers gets8472.0 22768.0 producing produclnf8684.0 9644.0 9536.0 play 1111 22771.0 called calledThe calledliThe 2416.0 8068.0 22971.0 22975.0 liThe22983.0 Janies22980.0 Boys DosiuMissouri MissouriFrank MissouriFmnk Fmnk8548.0 23191.0 Jame6Janiesvili9216.0 remenmbcrremembered remenmbcred-720.0 23268.0 23444.0 23403.0 pardoned years 23447.0 ears 23451.0 ago agoand 23615.0 since sincc8604.0 livedn23655.0 apeaceable 23620.0 lifeand lifean lifeaui4 23819.0 23828.0 aui48188.0 8524.0 lie8752.0 really renlly9396.0 sincere about btshisreformation btsreformation reformation 24039.0 9100.0 mutist24043.0 9448.0 humiliating Immimniliatinghumiliatingto Immimniliatingto24275.0 8212.0 24251.0 lmini8152.0 24255.0 kmiowClTheJamesBoys JamesBos 24463.0 Bos8364.0 24468.0 10040.0 24492.0 presented -536.0 24539.0 24724.0 outbetime24695.0 stage lie9816.0 24731.0 reoreomember remimember 24763.0 24891.0 member mimember24895.0 9988.0 24903.0 real renl24899.0 bndbadacts bnda 25099.0 25120.0 acts 25147.0 ts 25103.0 time868.0 immagiuary immaginaryimmagimiaryones 9628.0 25115.0 wouldnot -440.0 wouldmiot 25311.0 25331.0 miot25316.0 25319.0 nd 9888.0 lie10136.0 25323.0 shouldmake 25519.0 25527.0 25523.0 timebest 8696.0 lie25563.0 25531.0 undesirable umidesirableundesirableconditions -832.0 umidesirablecomiditions 25731.0 25736.0 conditions comiditionswimich25743.0 25767.0 past pastbad 25947.0 25963.0 8256.0 8660.0 woutd9468.0 25995.0 mmow25951.0 exist existA existCIA 26307.0 CIA Bartow Dartowlartow26347.0 26359.0 SRS10400.0 26323.0 timetheTampa timeTampa 26507.0 26515.0 Tampa Tribune 9688.0 invited h1itedimwitedhisfriends hisfriel 26727.0 friends 26731.0 friel -500.0 ds attend attelid26771.0 reception receptionWhen 10556.0 receptionVheu 26931.0 26947.0 Vheu26939.0 8432.0 arrived 26983.0 barrel 10488.0 26959.0 ofbeer 27143.0 27151.0 beer 27155.0 27191.0 27179.0 10144.0 bethe betime 27359.0 27364.0 timeprincipal feature 27391.0 enter entertainment 10568.0 entertainmuent 27451.0 27567.0 tainment tainmuentAfter 8636.0 9264.0 9612.0 badbcenbeenconsumed bcenconsumed 27579.0 beencomisumed 27787.0 consumed comisumedtbehat hat Imat9340.0 27823.0 27791.0 passed 27799.0 27980.0 contributed coutributcd28016.0 9920.0 28004.0 28055.0 ex cxexpenses cxpemises 28083.0 28224.0 penses pemises28211.0 guest 28215.0 Time28239.0 court courtheld 2492.0 held 8304.0 28395.0 28415.0 unique 28443.0 receptionconstituted 28419.0 -692.0 constituted 28651.0 28611.0 illegal Ulegal28635.0 sale 28639.0 liquor Uquorliquorand Uquorand28807.0 8324.0 28811.0 28815.0 host 28855.0 wns28843.0 Ient28847.0 28891.0 gang Cor29007.0 CO GO608224.0 29019.0 dns29027.0 Blind 29031.0 Tiger 29055.0 Socials SociaJsSoclalsSocialswill SociaJswiU Soclalswill wiU29255.0 cease 29260.0 ea 29243.0 popular papuJar9836.0 9780.0 Polk 9976.0 10472.0 30227.0 xmlns:ns16 ID22 8452 2748 10704 1752 ns16:type 10956.0 1752.0 TWO 11392.0 SPLENDID SpLnNDlDSPLIiNDID12248.0 1768.0 CARTOONS 12180.0 CARTOONSToo 10908.0 Too 11260.0 11200.0 11448.0 lime11404.0 2008.0 11712.0 12120.0 2020.0 cartoons 12060.0 12808.0 12731.0 13164.0 13096.0 wehave 13356.0 11084.0 11568.0 11444.0 11820.0 011696.0 11996.0 2224.0 long 12424.0 2200.0 12800.0 nrc12736.0 time13028.0 theones 13352.0 timeones 11120.0 11056.0 11464.0 appeared 12176.0 Iii12404.0 Mctropo 12623.0 MctropoUs MctropolisUs lis10960.0 10900.0 11264.0 SaturuaySnturdny11204.0 11988.0 Bud12316.0 Monday 12244.0 13052.0 Time12900.0 Thecartoon TimeCa cartoon Ca 10896.0 rtoolm 10872.0 represenled11980.0 13024.0 Jno Jima12920.0 JnoN JimaN13296.0 3020.0 N 11000.0 C 10856.0 11248.0 Stocktomm11108.0 peddling 11896.0 12780.0 12660.0 13144.0 hisPunta 13360.0 10828.0 Punta Gorda Garda11272.0 11880.0 speech 11788.0 aimmomig12360.0 Uletime13040.0 thecrackers Ulecrackers timecrackers 3456.0 crackers 11380.0 inlii11580.0 Levy Lcvy11512.0 11948.0 12796.0 12567.0 13016.0 wasdressed dressed 11244.0 11676.0 represent 12528.0 12351.0 laboring lahorlug12600.0 laboringcountryman 13368.0 lahorlugcountryman 3907.0 countryman 11748.0 3888.0 11600.0 12132.0 stood 12020.0 12636.0 Ipimp12516.0 12932.0 12824.0 13192.0 aimanoldfashioned 13372.0 13195.0 anold aimoldfashioned oldfashioned 11708.0 11008.0 fashioned 10936.0 11772.0 horse cart art12159.0 12588.0 13100.0 13031.0 wasloaded was101lde1 4316.0 loaded 101lde111824.0 11680.0 12408.0 rolls rotls12204.0 12872.0 12724.0 13020.0 hisPnntaGorda hisIIPunta IIPunta10844.0 PnntaGorda 11284.0 11420.0 11876.0 spechmspe 12412.0 h 12252.0 4523.0 13152.0 13000.0 hispepper 13364.0 4740.0 pepper 11396.0 box 11343.0 11992.0 Time11672.0 12364.0 12304.0 12972.0 werefiockinglto 13383.0 wereflocklnglto wereflockingto 4907.0 fiockinglto flocklngltoflockingto11540.0 11915.0 enrt11836.0 12200.0 nil all12652.0 12968.0 direc directions 13328.0 5163.0 5168.0 tions 11304.0 Jobn11732.0 11660.0 giving givln12004.0 12692.0 12592.0 boys boysthe boystime time11028.0 wink 10968.0 11400.0 11604.0 5380.0 handed 12628.0 12512.0 12936.0 copies copiesof 13388.0 10940.0 10884.0 5600.0 -36.0 10976.0 11040.0 11152.0 11207.0 11764.0 whicim11700.0 12272.0 12648.0 seemed 13247.0 13180.0 5803.0 reading 11504.0 11944.0 eagerness eagensesseagerimess12696.0 12644.0 13012.0 12956.0 greatpleasure 13392.0 pleasure 11584.0 Time11364.0 11887.0 12552.0 12492.0 12895.0 12828.0 tolife 10748.0 10972.0 11224.0 time12124.0 12556.0 12480.0 12892.0 way 12832.0 13260.0 inwhich Inwhich 6443.0 6455.0 11312.0 Stocktons Funta12940.0 Gordaspeech 13400.0 Gordaspeuh Gordaspechi speuhspechi11300.0 11236.0 11528.0 6663.0 read 11936.0 12428.0 ondamid12812.0 appreci appreclappreciated appreclated 6728.0 10760.0 ated 11132.0 11068.0 11308.0 11476.0 12220.0 oE of12376.0 12772.0 laboringpeople 13404.0 1aborin 1aborinpeoptc 12764.0 peoptcpeopleMondays -468.0 11228.0 peoptcMondays Mondays 11760.0 cnrtoon12448.0 12839.0 anothergood -568.0 13408.0 13448.0 IBarra 13452.0 7559.0 11756.0 11488.0 12008.0 12960.0 12852.0 13208.0 13044.0 MBarrs 7711.0 Barracharging cimarging11164.0 12128.0 7723.0 tbe12504.0 JacksonvilleCity -900.0 10764.0 11220.0 Assessment 11071.0 12280.0 7931.0 Machine 13072.0 withhot hot 11240.0 air1 air 11776.0 8156.0 12112.0 12000.0 run rim12748.0 time13056.0 theJacksonville timeJacksonville 8363.0 8368.0 Street 12332.0 Railway 12212.0 RnllwayCom RnllwayCompanys -1024.0 CommmCompanys Commmpanys 8559.0 panys 11316.0 13280.0 8583.0 13216.0 11744.0 wblte12288.0 time12140.0 companys companysattorney 10788.0 n11588.0 8991.0 Hartridge HartrfdgcHaitridge12668.0 13236.0 13172.0 bylooking 13416.0 9199.0 9211.0 looking 11615.0 quite 11516.0 12164.0 sober 12168.0 soberand 12992.0 13139.0 9240.0 12996.0 wasasking -280.0 10792.0 asking Darrs11276.0 11792.0 11724.0 wanted 12788.0 13108.0 bust bustthe busttime 10800.0 9619.0 timemachine 12036.0 11688.0 9631.0 12944.0 strainBarrs 13424.0 strainDarrs 10804.0 9839.0 Darrs11456.0 11736.0 11904.0 9844.0 12656.0 Uletime12608.0 9875.0 assess assessmemit 13380.0 10808.0 ment memit11280.0 10059.0 hand omi11640.0 12048.0 dial 12700.0 10052.0 xmlns:ns17 ID23 9156 2648 10808 10259 ns17:type 10259.0 10271.0 raised 11388.0 frolltfrommi11232.0 11716.0 amid12564.0 waspointing 13439.0 10812.0 10467.0 10479.0 pointing 11492.0 11796.0 11632.0 12595.0 12476.0 indi indlImidi13036.0 indicated indlcated Imidicated cated Darrs11564.0 10687.0 bad12028.0 13303.0 iii13228.0 ingetting 13436.0 Ingetting iiigetting 10820.0 time11808.0 assessumentrais rals13136.0 10912.0 tosomething 13428.0 tosommiethimig 11116.0 sommiethimig11112.0 hike11572.0 IIllould12584.0 13224.0 bebTATE beTATB beTATU bTATE TATBTATU11424.0 PRESS PRBSSPRUSS12292.0 CLIPPINGS CLiPPINOSCUPPINUSCLIPPINGSIf CLiPPINOSIrCUPPINUSIf-792.0 13084.0 11631.0 IrtimeSultan 12456.0 wants 12928.0 11655.0 12876.0 13132.0 help helpout 10824.0 11875.0 11180.0 time11524.0 head 11972.0 11864.0 artists iu13188.0 13059.0 thiscountry 12056.0 country lie hevhh111740.0 willclJOp 12240.0 chop 12703.0 off 13008.0 n13200.0 fewheads 10836.0 12268.0 heads 11932.0 once 1516.0 onceApalachicola onceApalacimlcola12260.0 onceApalachicolaI onceApalacimlcolaTimes-1516.0 12487.0 Apalachlcola ApalachlcolaTimes 12491.0 Times TimesIf TimesITimesIftiiatgrand 932.0 Iftiiatgrand 11148.0 11188.0 -752.0 11940.0 11520.0 grand 11484.0 jury Vasbimigtomm12500.0 WashingtonCity WashingtonCltyVasbimigtommCity10840.0 13112.0 Cltyinvestigation nvestlgaUon12116.0 iutointoirregularities iutoirregularities IntoIrregularitIes irregularities 12072.0 11900.0 governmentofficials 13544.0 officials 11612.0 13588.0 12023.0 13560.0 11912.0 12312.0 13539.0 find somctbingsoniethumigsomethingwrong -756.0 13456.0 somctbingwrong soniethumigwrong 10848.0 13800.0 wrong 11368.0 13759.0 1mmhigher 13752.0 circles 12040.0 12640.0 postal postapostaclerks postalclerks 1432.0 13972.0 clerks MetropolisThe MetropolisTIme12276.0 11012.0 14387.0 TIme11372.0 effort 14384.0 enforce cnforceblue bluelaw 11212.0 Sunday Summidny14595.0 iuIii12264.0 14592.0 12888.0 vil113167.0 beknocked 13284.0 13444.0 14812.0 knocked 14824.0 Oltomit11452.0 11812.0 14807.0 time12392.0 first 12784.0 round 12664.0 byan 15063.0 15020.0 overwhelming overwhmelnitng11004.0 15015.0 12676.0 sentiment 12632.0 sentimentIt -716.0 15240.0 11032.0 15232.0 regarded 11144.0 15271.0 arded 12051.0 scheme 12187.0 retail retalireta1l12975.0 retaliation reta1latlon retailation 15435.0 15444.0 ation atlon15483.0 time11496.0 11952.0 15452.0 part 11840.0 tIletimesaloon 12884.0 saloonmen saloonme saloonnmemiTamiipa 10852.0 15643.0 15696.0 1lampa nmemiTamiipa11048.0 11360.0 TribuneCorn 2428.0 11024.0 Corn 11432.0 ami12540.0 12848.0 wheat 13340.0 13275.0 isking Isklllg king klllg11172.0 time11720.0 UilitedUiiited12208.0 isgrown isgrowlI Isgrown 16532.0 growlI11292.0 everyState 12388.0 12464.0 tiletimeUnion Unionand Unionamid amid11096.0 11479.0 16744.0 yenr11852.0 Valued 11968.0 16715.0 1144 1144D 050000 96000016916.0 OOOO 16952.0 11668.0 onefifth 11984.0 16956.0 -616.0 firth 12284.0 entire entireoutput 17140.0 output 11624.0 time11960.0 countrys couutrsproducts productproductsSt productSt1588.0 17331.0 St 11268.0 Augustine Record RecordThe -496.0 RecordTime 17751.0 17756.0 TimeTaU1p111296.0 saloonlsts saloonistsbnv12984.0 havebeen bnvbeen 17964.0 17971.0 17968.0 selling sehhlngUqtJor18007.0 12536.0 Suuday12420.0 13204.0 uninterruptedly 18044.0 18172.0 968.0 18176.0 interruptedly 18179.0 doubt 12844.0 doubtlesssincerely doubtlessaincerely 18247.0 18384.0 lesssincerely lessaincerelysympathize 11779.0 13212.0 thenegro 10832.0 negro 18604.0 18640.0 18616.0 12396.0 18619.0 18596.0 12532.0 12980.0 chain chaingang 18851.0 18812.0 Cor11500.0 18807.0 six montbsmouthsyesterday 12308.0 13240.0 13120.0 forthat fortbat 19024.0 tbatoffense 1232.0 19019.0 offcn5eTampa offenseTampalribuneTribuneSept lribuneSept 19235.0 24 xmlns:ns18 ID24 1852 2628 10792 19655 ns18:type 10988.0 19655.0 19667.0 19659.0 19664.0 12820.0 cause 19676.0 toworry 19872.0 19915.0 worry 11252.0 timefinal result 12836.0 13088.0 elec eJccelections eJcctlons dec dectiomms 19939.0 20080.0 20084.0 tlonstiomms11460.0 lheTime11156.0 876.0 Republicans Republlcaus12776.0 duringthe duringthc20292.0 20299.0 thc11092.0 dark 11036.0 11472.0 20295.0 reconstruction 20336.0 pre precluded preeluded 20503.0 20507.0 cluded eludedpossibility 20512.0 Statesever 13411.0 20715.0 20759.0 20720.0 Republican Repub1lcan11628.0 12620.0 20727.0 12880.0 aboutall aboutal1 20927.0 20932.0 al111088.0 20935.0 worries 20971.0 13064.0 littlefamily 10796.0 21119.0 tilts 11656.0 witbln11596.0 21183.0 21159.0 party partyFlorida partyPlorida 2000.0 10964.0 Plorida21363.0 Crescent Live Oak xmlns:ns19 ID25 8152 2688 21783 ns19:type 2384.0 During 21787.0 timestormu21828.0 Saturdaythe Saturdaytbe21991.0 22000.0 tbe12th 11704.0 IIwet 11636.0 11804.0 wet vet12400.0 election electionwas electionvas22195.0 vas22212.0 iu11832.0 Ij 22215.0 tee 11924.0 22316.0 ee 22219.0 12672.0 13048.0 thecounty 10768.0 22435.0 voted votcd12152.0 twelve twelvemajority 22628.0 22640.0 Fort 11920.0 22635.0 Myers Press Presssays 22843.0 22855.0 11060.0 understood 22847.0 tllatsa 13316.0 13331.0 22915.0 23051.0 23060.0 loon 23055.0 consulting CQnsultin12612.0 lawersinTampa 23263.0 11324.0 vith23271.0 12348.0 12236.0 contesting contcstingcontestingthe contcstingthe2188.0 23475.0 23483.0 10984.0 election1Tamnpa 23480.0 12436.0 TimesNegro 10928.0 23804.0 Negro 23843.0 crap 11751.0 sbe looters mooters23807.0 uot13003.0 noto uotbe notbe compelled compelledthe 0associate 12012.0 withwhite 24219.0 24227.0 blind btlndtiger tlgerther11608.0 12172.0 operators whenire whenthe 24383.0 24459.0 two classes 1re -24.0 ire resent 24447.0 24487.0 samechaingang samechalugaug 24651.0 cbainganchalugaugcamp canfpcanip12864.0 24659.0 12988.0 13184.0 24703.0 nogood 24867.0 24871.0 11140.0 24908.0 reason 11080.0 24915.0 apoorcrap poor 12860.0 24911.0 cmp 24879.0 shoot shooting 13300.0 13312.0 24947.0 25079.0 25084.0 25087.0 toassociate 25287.0 25335.0 25292.0 inferrior iuferrior25299.0 beingunless 25499.0 25504.0 unless 11412.0 25507.0 12444.0 12680.0 25551.0 12856.0 25511.0 chance chanccchanceto chanccto25712.0 10932.0 improve 25719.0 25724.0 morals 11816.0 12752.0 25763.0 nwhiteblind whiteb1lnd 25919.0 b1lnd25923.0 operator opemtor25932.0 25935.0 allowing allowinghim 26132.0 26151.0 26139.0 keep 26183.0 26195.0 agambling 1156.0 26343.0 gambling 26391.0 negrQnegroJoe negrQJoe 10888.0 26691.0 Joe 11176.0 Fryer saS26695.0 tbetime11956.0 whiskey Sher SlierSheriff Slierift 26775.0 26895.0 iff ift26903.0 Fennell FenneUFennelicaptured 12336.0 26911.0 Fryers Fryersplace 13272.0 Fry 13080.0 26956.0 rs rspl place pl 10860.0 10876.0 1ce 27135.0 27115.0 High Springs 27123.0 Tuesdaywas 13348.0 27331.0 10996.0 27335.0 Dr 12416.0 Bollard BallardBa1Jardleft Ba1Jardleftthere -932.0 left leftthere 27535.0 27584.0 27547.0 Bal BatBallard Batlard 27736.0 lard 11064.0 27743.0 dead 27751.0 enn12472.0 27771.0 12356.0 deny 12716.0 27760.0 itbut Itbut 27943.0 27963.0 11728.0 28007.0 are27987.0 notdead 28159.0 28167.0 wUJ28171.0 28175.0 fix 28219.0 npnabetter nbetter 28367.0 defense 28379.0 tban12232.0 28383.0 28399.0 pack p1ckpackhis p1ckhis 2032.0 crime 28579.0 offoi 28627.0 28632.0 28591.0 manRead 10880.0 28927.0 Read thispaper 28975.0 Pa paer 28951.0 carefully enrefn1Jy28963.0 ifyou 29099.0 29139.0 think 10980.0 29108.0 11784.0 29120.0 29167.0 29127.0 29175.0 29179.0 yearsubscribe yearaubGcribc 29267.0 subscribe aubGcribc29275.0 11692.0 29283.0 itI itJ11800.0 29871.0 xmlns:ns20 ID26 8444 2728 13464 1728 ns20:type 1908.0 13875.0 RTIOr3 RTWrPSRTIWP14484.0 OP 14432.0 14712.0 INCURlORATIQN INCORIORATION14607.0 INCURlORATIQNNotice INCORIORATIONNotice15784.0 INCORlORA 15472.0 TIQN 15460.0 TIQNNotice 13603.0 1916.0 Notice 14067.0 14016.0 14216.0 hereby 14688.0 jjivenglvlln14639.0 15096.0 thntthat1952.0 01115352.0 15604.0 lliotho15548.0 15856.0 7411 14lh1411115804.0 7411Jay 16120.0 14lhday 14111tlay 13464.0 2052.0 2068.0 Jay daytlayol13692.0 13996.0 October Octo1crOctoter13912.0 14580.0 14496.0 14624.0 15056.0 2092.0 1903 14900.0 I9 15312.0 15176.0 15204.0 15207.0 15248.0 15412.0 tho15712.0 ullllorumimiter15612.0 underignrd ullllorIgnrd umimiterslgzmrd 2196.0 2204.0 ignrd slgzmrd14044.0 111 14224.0 apply 14656.0 14840.0 Ills His14780.0 15127.0 Excellency Jlcellellcyltxcelleimcy15052.0 15936.0 15840.0 WJennings 16079.0 WS 2336.0 2348.0 13512.0 13547.0 13680.0 Jenmihmgs14391.0 Govornor15004.0 15308.0 tht15228.0 15600.0 Stale StllteSttte15507.0 16012.0 15924.0 ofMorlda ofP101115 13476.0 Morlda Plorll1aP10111514084.0 13936.0 14268.0 14132.0 14388.0 Letters Iolters14960.0 Patmit lahnit1atnt15516.0 llponnpoim15368.0 15932.0 time15824.0 theCharter theChnrter timeCharter 16172.0 2724.0 13467.0 Charter Chnrter14004.0 proposed 13955.0 propo -576.0 14444.0 t1 14376.0 14632.0 hllow helow14704.0 helowTIiI 14784.0 lov lovThis 16176.0 IThl -16.0 16191.0 ThlTIiIlist 13888.0 218hlay 218ttlayOf14180.0 14232.0 14668.0 September 8eplcIItorptoiimber15440.0 115532.0 15676.0 15820.0 190J1903MHDIIN 190JJ 1903II15235.0 15116.0 15328.0 MHDIIN MUDJtftmm11N15263.0 MUDJtfn 15952.0 15496.0 tmm11NU 15 nU15260.0 15155.0 15360.0 WVNN VvNriWVNNI VvNrii15887.0 WV 15740.0 15692.0 15748.0 JN -8.0 15755.0 JNI 15880.0 ltI15104.0 Ii 15436.0 IUIH8 JUrIfSIUrssIUIH8N JUrIfSNIUrssN15816.0 15064.0 3348.0 O 015168.0 15468.0 WADH WAIUCVAIR15371.0 WADHIiriCTKS 15884.0 WAIUCR 15528.0 VAIR4RV1CTRS 13472.0 3540.0 IiriCTKS rIcrus4RV1CTRS13572.0 14104.0 OK OF0113655.0 14460.0 INCORPORATION CORPOItAtIONICORPO1tAION-1032.0 15492.0 OltOP14499.0 15868.0 TH T111THOAINKSVIUH 16096.0 TIm 16044.0 TImOAINItSvnrH 16140.0 T111oAiuusvirT8 OAINKSVIUH OAINItSvnrHoAiuusvirT814808.0 3728.0 IJANINO 1JANINGP1AilNO14756.0 AND MUANDCOlllN 15732.0 ANDCOIIIN MUCoLliN 1188.0 COlllN COIIINCoLliNCOMPANV COIIANCOIPANCOMPANVI COIIANJCOMPANVThe COIIANThe J11Time Time13927.0 4264.0 name nAlI1e14316.0 14512.0 14820.0 corporatlomi14747.0 14888.0 -656.0 15544.0 15179.0 mtlon 15016.0 shall shallliThe 15928.0 16008.0 beThe 16148.0 13495.0 liThe13948.0 GainctivllleGaiiev1lle13832.0 Planlnit 1lanlllltPlaningntlllmid15779.0 CoITi CortinCommi15652.0 CoITilotnpawy CortinC0Il1P1111I 16055.0 CommiCotilpatty 13488.0 lotnpawy C0Il1P1111ICotilpatty14264.0 nnltaiid14088.0 14544.0 ita14492.0 14740.0 15343.0 15716.0 15891.0 bus husmisbusness 16104.0 husIness misIncas 4651.0 Incas Inessness 13840.0 shnllshalt14199.0 14416.0 Cninesvilk14344.0 11lorilla1IorIbi15132.0 FloridaII 11lorillaII1IorIbiII15688.0 14764.0 IIThe 13624.0 general geiieraigenernlnnture 14932.0 15152.0 time15455.0 business buslnue9businees15356.0 16036.0 15980.0 tjc -40.0 16076.0 te totebe 16152.0 13492.0 13524.0 jc 13636.0 13688.0 transacted transactell14400.0 14348.0 11 14548.0 14600.0 saldSMI114471.0 cortxjrallon orxration14852.0 15660.0 16016.0 be-32.0 hethe 16088.0 16092.0 chc 5303.0 hcmanufacture iiiammufacture13700.0 nnd Rlllt1111114552.0 14883.0 15200.0 15136.0 15084.0 15244.0 15464.0 coffins coffinsnllli cofflmmsntmdcoffinsnllliIlIlIIber cofflmmsntmdItmiber 15919.0 amlumber lumber IlIlIIberItmiber14048.0 UIIl14280.0 14644.0 operation operRtlon14576.0 5480.0 Ra15424.0 15632.0 plain 15576.0 5476.0 15943.0 lnlnllll pinliiliigpinliiliigmill 16156.0 15668.0 lnlnllllmill 15708.0 16116.0 nmill mill 13847.0 nmtmidhustnessiitislness15376.0 pertains pertalipertaftis15591.0 pertalitbereto pertainsthereto pertaftisthereto thereto tbereto14736.0 III IIIThe 14904.0 Ulount13896.0 14475.0 14428.0 capital capllalstocl 15319.0 stock stoh15656.0 uutho tuttmo15704.0 uuthorlzeil uuthortzed 15788.0 tuttmothed rlzeil rtzedthed13864.0 13812.0 thin thlllthis14352.0 15479.0 Twenl TwenlThousand Twenty wentyThousand Thousallll14339.0 2000000 14128.0 20 14911.0 14516.0 ouooo Dollars 15584.0 15832.0 nuu nUIl1iiuuinuuber 16112.0 nUIl1ber iiuuiber 13528.0 13784.0 shares 13908.0 IelngIeing14404.0 14844.0 hundred hUllltredjliuitlred15960.0 pavalue 15964.0 par paparvalue 16163.0 13508.0 13892.0 6648.0 14396.0 14880.0 One Hundred lIulIllretIluntlrednol1ol15796.0 Dolars nollars 1ollara 6791.0 lars lara13903.0 6796.0 SIoooo 13739.0 10000 roooo14363.0 Ten Ieu14984.0 ThollsandTliousatid14892.0 Dollar DoHarsDollars15608.0 DoHarstoooo toooo 1000000 oo14320.0 14540.0 14832.0 14744.0 15272.0 15560.0 15908.0 sul15812.0 sulscribed subscribed 16064.0 7071.0 scribed 14011.0 13968.0 14240.0 nndnUltissued lS6uedisaued14944.0 7083.0 15060.0 amid aildntld15723.0 pRld16040.0 icash inIIIcash 16159.0 incash cash 13836.0 vroperty14356.0 15196.0 7211.0 IItock15392.0 ShAll shnshnbe ShAllbe shallbe 13704.0 full pal 14236.0 14296.0 7392.0 Issuel1Isstietl15364.0 allamid15587.0 16027.0 15971.0 Inoniusesslblq habeno hanonasesiibl 13516.0 7496.0 noniusesslblq ttalseslbllnonasesiibl14412.0 7675.0 IV IVThe 14920.0 ivThe 13652.0 7839.0 terni7851.0 14652.0 14572.0 15336.0 15224.0 corporatiocorporatioshall corporationshaH corporationshall2356.0 13519.0 shaH14524.0 14768.0 ninetynine nlnetYlllsilnetynhmc14719.0 15399.0 le 15504.0 15552.0 yenrsyearsV yenrsV15876.0 yearsThe yenrsThe yearsTime V 13660.0 8327.0 8351.0 Timebuslnes14560.0 ot8339.0 sall115019.0 Mia Miabe lhall15896.0 lhallbe 8479.0 8491.0 conducted conducletl13668.0 a14691.0 14775.0 1rcsldent PresldelltIresldentVice VlcelVlceIresi VlceIresident Pres Presdent 15900.0 rcsl rcsldent 8619.0 dent General 14440.0 Manager MnnnKer15028.0 3nd15296.0 Secretary SecretnryamTreasurer arid anltanltTreasurer aridTreasurer Treasurer nnl1Ra14724.0 Board Doarl114628.0 15164.0 Directors iirectorstconsist toconsist 16168.0 consist 14184.0 tbree14555.0 aul1niid15451.0 15835.0 othcothcofficers otherofficers 9059.0 officers 9083.0 IIInyhecreated createllalldamid15148.0 appointed appolntcnprolntetl15448.0 appolntcby nprolntetlbyappointedby13732.0 tue13983.0 DoanlBoant9187.0 14564.0 15324.0 stockhoh stockhoMstocklioldstockhohera stockhoMenstocklioldera9327.0 9375.0 era en13711.0 9339.0 busimiess14156.0 shah14732.0 bI byJ 14 1184.0 13900.0 MedlinPresident 13791.0 Medlin Mcdliii-1184.0 Presldentj Fresidemit15252.0 9479.0 IJ E15291.0 15736.0 Wynn WyntWyiiiiWynnVlcclresldelltj WyiiiiVIccIresld 9580.0 Vicepresident Vlcclresldelltj13540.0 VIccIresld 14468.0 14260.0 14907.0 RileItiles15024.0 9607.0 Genera15512.0 GeneraManager GeneralManager 9759.0 3111111114096.0 14419.0 3nl1amid15108.0 15520.0 Treasureuntil 15427.0 TreasurerIIlItIl Treasure Treasurertreastmrer16124.0 treastmrernmitil 9887.0 IIlItIlnmitiltncre14616.0 hnya14956.0 bccnbeemi9931.0 nn allanelectloll15995.0 oofficers oforofficers ofofficers 10032.0 14028.0 helll14508.0 14799.0 stockholders stockhoilicrs15684.0 ui IInnixmlns:ns21 ID28 11420 2672 13508 10176 ns21:type ill tiltII13676.0 10216.0 sb 14248.0 Jl 14611.0 hnveduly 15580.0 qunllfieiThe 13844.0 annual meeting immeeting15120.0 15671.0 clectiot15619.0 clectiotof electionofelectionofetockhiolilera 10460.0 stockhoMersofetockhiolileraall15284.0 5th sth15596.0 15772.0 10455.0 15999.0 oJanuary oflanuary 16180.0 ofalluary 10583.0 January lanuaryalluary14188.0 14288.0 10619.0 1904 10631.0 19 10643.0 14796.0 14836.0 14991.0 flllltflhIl15315.0 01115572.0 timeFirs Iflrstirirat15768.0 FirsTuesday Iflrstluesdny irirattuesday 13575.0 luesdnyanuary 14848.0 15112.0 15388.0 thereafter -316.0 10887.0 IInlcsschanged 1mvs nwsaws15751.0 15968.0 thcorporation thecorporation 13552.0 14771.0 VI VIThe 14935.0 ViThe 13683.0 11375.0 highest 13932.0 attlount14972.0 15183.0 indebtedness Indebtcdllcss15140.0 15992.0 oliability orliability liability 14091.0 11515.0 14212.0 14864.0 15188.0 corporatloll15160.0 15948.0 ca caat canat 13720.0 subject itself 15347.0 15216.0 liu hebeTe 15828.0 TeThousand TenThousalld TenThousammd 1944.0 ThousalldThousammd14175.0 11827.0 loooooo14360.0 11795.0 DollarsVII Dohars Doharsvim Inrs InrsVII 11979.0 VII vimVIIThe vimThe 12155.0 13980.0 12188.0 names 3111tatutresidences resldenceresideuccatime15904.0 sulsulBcrlbers subBrlbers subscribers 2272.0 13556.0 scribers BcrlbersBrlbers14036.0 proposellcharter areN 12432.0 G 12435.0 Wade Wnde14063.0 Montbrook 1IontbrookMonthrook15615.0 Via FinViashares 15807.0 12460.0 ashares 12455.0 25shar sharesE shar sB B12723.0 UynnFin FlaVIa15476.0 ishares 25shares sharesi 13596.0 12991.0 13039.0 13620.0 13748.0 14056.0 RllusRllcsPlo35shames shatcsshalesshatcsJ shalesIshamesI2284.0 13143.0 IIv Iji14024.0 1Iel1l1l1MedlimiAlbion 15088.0 IliaVia15416.0 3515540.0 sharesState 13564.0 13423.0 ot13880.0 FlorillaPloridaFloridaAlnchua PloridaAlachiua 1160.0 Alnchua AlachiuaCounty 14072.0 CountyIersouialiy 14680.0 13563.0 S13684.0 Personally IersonallyIersouialiycame catne13691.0 rue15192.0 J113699.0 15852.0 RileRileand RilesAnd Rilesand 13831.0 FdWyiiii WynnWtui14052.0 13839.0 14527.0 14988.0 whom behlg15568.0 13848.0 1me tome torite 14015.0 rite13979.0 weJlkIlOIIkimownseverally severaJlyacknowledged acknowledgedthat acknowledgedthnt14119.0 thntsigned 14968.0 tbeabove nbovefore foregoing 14256.0 proposetlilltbemanner mannemummermanneand manneraml mummeranti 14399.0 amlanti14020.0 14311.0 uses uscsUlesanl114568.0 purposes IlIIrposesImUrPOSCS15720.0 therein thercltherelutherclset thereluset thereinset1468.0 14536.0 14556.0 set 14539.0 forth allllamidcontained contaillellcontainedTaken contaillellT31ell 2476.0 Taken T31ellanllmindncknowledged14711.0 Utemime14715.0 othis 011 on011UIIII onthis 14819.0 UIIII13852.0 loth moth14100.0 14827.0 August 15124.0 14831.0 14851.0 1903SKAI 15760.0 1903SJtAJ ioSEAT 13756.0 14964.0 SEAT SKAISJtAJH U14971.0 nli14967.0 VOVIB VOJVovuVOVIBNotary VOJNotary VovuNotary 15744.0 15095.0 15107.0 Notary 14255.0 Public PllbllcSlate14663.0 15099.0 15340.0 JllortdarioridaaLarge atLarge 15247.0 Large 14112.0 My iiiyMycolllmission commission expires Novcn NovemNovemim15628.0 Novcnber November Novemimbar bar13819.0 15411.0 91903 91903State 13992.0 190J 903190JState 903State 15667.0 14108.0 llorll1a14060.0 FloridaLevy lIevy IevyCountyPersonally 14504.0 15944.0 Personnlly15983.0 c1me14816.0 15947.0 mej mne1415859.0 Mc Mclln led IedIedIIn ledliii lln IInliii16099.0 14076.0 16123.0 nlerimevcllkllown14596.0 acknow aeknowtackimowlacknowedged aeknowtel1Kel1 ackimowledged 16220.0 16227.0 edged el1Kel116232.0 14272.0 16235.0 liesigmieti14876.0 alxwcalidamid16367.0 16372.0 16375.0 proposel1III15144.0 15404.0 16404.0 manneniatmncrmanneralllt niatmncranti 16507.0 allltantitime14308.0 16544.0 16548.0 115thereset therelll thereintherelllset thereinset1500.0 16648.0 16660.0 contalneucontalneuTaken 16795.0 16792.0 15408.0 16828.0 mon meall meoil 16928.0 16964.0 alloil16935.0 27th 37thdayof 190J1903SRAt 190JSJtAL 1903SRAL 17080.0 17095.0 SRAt SJtALSRAL17084.0 IURNKV DARrtxvILumv14080.0 COtSON COLSONCOLSONNotary COtSONNotary CotsoNNotary 17215.0 17220.0 Florilla15076.0 17232.0 LargeMy Large1Iy 16128.0 17355.0 1Iy13808.0 comniisslomi17387.0 COlli mission 14635.0 331907 331907State 23 IcyJ7 190715764.0 IcyJ7Stnte 1907State 17631.0 Stnte17635.0 1110rfdalflorlda1110rfdaLevy lflorldaLevy 17783.0 CountypcrsonaUr 17920.0 17952.0 catnecanmebetore 14716.0 meN immeNVadeWadeto Vadeto 18063.0 pcrsonaUr 13672.0 18087.0 tiletuewetImownknowmi14924.0 18060.0 nckuowledgec nckuowledgecthat -848.0 ncknowled 18003.0 15940.0 -888.0 eathat 18196.0 BI 14276.0 nell 18203.0 nboveforegoinforegoinproposed foregoingproposed 18336.0 14160.0 18340.0 18375.0 allllamid15915.0 fothe 18476.0 18479.0 R9asthercin18495.0 act18483.0 fortfortand forthnnd forthanti nndanti13828.0 14436.0 18759.0 beCore18800.0 18896.0 18903.0 17th i7th14144.0 18908.0 18911.0 15332.0 190Jmgo1903siui 15792.0 190JSnAL mgosnL 2104.0 19048.0 19063.0 siui SnALsnLFRANK llRNKPRANKE19051.0 CKAWEOKD CItAWFORUCRMEOkI15043.0 CKAWEOKDNotary CItAWFORUNotary CRMEOkINotary 19184.0 14168.0 19188.0 Stnte19191.0 nt14963.0 19196.0 ConCommission Conmission 19316.0 19319.0 19331.0 101906 1019065IIG 19360.0 zo1C06 zgo61C06oStiDRIIFS zgo6S1IURIVPS 19712.0 19715.0 oStiDRIIFS S1IURIVPS5IIG -696.0 14952.0 14532.0 RUTS SALB SLDSILHSALBUnder SILHUnder 13664.0 19896.0 Under Ululernnd19899.0 14332.0 virtue 14588.0 virtucof 19932.0 nnaimexecution Issued 20036.0 20039.0 sued 13856.0 20048.0 Circuit 20043.0 Court IlloridaFloridaFifth IlloridaFifth 20176.0 Fifth Judicial uttlclnt20179.0 1mmAlnchu AlnchuaMaclmuaAlnchucounty Alnchuacount Maclmuacounty 20319.0 count 13960.0 14203.0 34th l4th24th14456.0 lay16004.0 20331.0 20459.0 20488.0 liifavor 20464.0 15071.0 20468.0 Dunagau DunaJanDimagan20495.0 amagainst null andnullagl1lnst andagainst 20579.0 agl1lnst20611.0 20599.0 Middleton 20608.0 Pen Fen16100.0 Pennell 20739.0 20744.0 20780.0 8 14032.0 caidalII14976.0 20756.0 anl1StnteStatehave Stntehave 20879.0 20884.0 levied levletl20920.0 14227.0 14855.0 20896.0 20887.0 thsaid timetheahl timesaid ahl21036.0 21031.0 21024.0 Middietonnndwitt21027.0 ell21063.0 aSublic 21043.0 atpublic 21164.0 Sublic outcry outcr thme15280.0 house LousLousoor house1100rIn housedoor 21304.0 21307.0 1100rIn 21316.0 21340.0 oor 13872.0 timeGainesvlllcAlachua Alacbua15535.0 Alachuacounty Alachuacount Alacbuacounty 21447.0 21463.0 Ilorilla21483.0 21451.0 sth15912.0 clayxmlns:ns22 ID30 7924 2756 13424 21599 ns22:type 21727.0 hours 21732.0 ofsale 14039.0 21736.0 Bale14304.0 a11altcertain certaimilot piece oparcel orparcel 16144.0 21872.0 parcel 13884.0 land laudsituated lying tylnganl1 21875.0 22015.0 AtachuaFlor 1Ior1IorIda orida 22147.0 ida 22155.0 particularly 22152.0 knowiiauttdescribed afollows asoUows 16135.0 asfollows 22292.0 follows oUowstowit 22304.0 Lot I4otfour 22323.0 block 22331.0 olleonehundred ollehundred 22415.0 22432.0 fortyeight fortyelgbtfortyelght148 14SGibbs GibbsAddition iAddition 22575.0 Addition 22591.0 22572.0 time22587.0 22579.0 IIIghSprimmgsSpringsFlorida SprimmgsFlorida 22707.0 22715.0 Together 01122756.0 enigma enigmathe 22724.0 singular sfugularsfugularthe singularthe22859.0 Hereditaments bereditauments22875.0 berc ltllUlents amlamidappertcnanccs appertenRncesappertenances23000.0 23036.0 belonging 23031.0 14980.0 nnywise tipper apperupper23039.0 tipperUining appertalnlng uppertaming taming UiningtalnlngtalnlngSaid 23259.0 Said 23295.0 23292.0 23283.0 sold s01l115172.0 tbeproper 13480.0 23420.0 23435.0 ty 13608.0 23427.0 23459.0 paysaid payMid MideJccutlonexecutiomi13728.0 amid14728.0 23579.0 costs costsL 23712.0 23715.0 14948.0 FBNNKM FnNNItLLPnNNEILFBNNKMSheriff FnNNItLLSheriff PnNNEILSheriff 14708.0 23855.0 23852.0 AtachuaMaclineCo Fla FlaC 23995.0 23999.0 MATH MAIIIESUN MATnIauNMAIIIESUNPlalntiffaAttorney MATnIauNPlaintiffs 24019.0 ES 24024.0 x xPlaintiffs 24131.0 Plaintiffs PlalntiffaAttorney PlalntiffaAttorneyUXDCUTORS -1244.0 24143.0 AttorneyUXDCUTORS AttorneyI1XIICUTORS 24560.0 UXDCUTORS I1XIICUTORS15047.0 BALD SALBSAUl14996.0 BALDUmter SAUlUnder 24739.0 24743.0 Umternnd15524.0 authority authoritauthorltauthoritvested authorlttsled authorityvested 24883.0 24887.0 vested tsled13860.0 lhetue24920.0 14520.0 Executor 15872.0 willand 25023.0 25031.0 25039.0 testament 14424.0 25027.0 Arthur Miles Milesr deceased dcceasetldeceasedI dcceasetlI25111.0 25176.0 25167.0 sel1nt25164.0 14335.0 vefore25171.0 thecourt 25307.0 bouseItt1mmthcclt Gaines 25376.0 25447.0 25451.0 ville Atachua25459.0 FIQrldaPlQrida25487.0 Tues 25587.0 25591.0 25596.0 29th agth25599.0 flflfor 15699.0 15800.0 190J25727.0 thcbidder bldelerbidderbetween bldelerbetween 25876.0 25879.0 legal aUthatcertain thatcertalu 26011.0 26015.0 certalu26051.0 26019.0 situ 26079.0 13460.0 26155.0 26159.0 IingbeinK26167.0 15976.0 ofAlachua ofAtachua ofAlaehua 26303.0 AtachuaAlaehuapartlcululy26444.0 nnl1describctlnsol1owstowitSouth 16032.0 26584.0 26587.0 South half 14620.0 26611.0 3southeast soutlteastsouthieaatoCofcouthwest oCsoutbwest ofsouthwest 26719.0 southwest couthwestsoutbwest14192.0 X MSection 26751.0 27 37Township Tonshlp26763.0 9t9tRange 26843.0 26876.0 Range 13924.0 26867.0 18 13868.0 26859.0 witb26864.0 1111singu slnsuslnsu1A1thi singularthi 27007.0 27011.0 lar 1A1thi larthi27019.0 tenements tenewentshereditaments herditauicutslItameuts 27016.0 aud27047.0 ap 15844.0 appertenauccs appertenallccs appertenauces 27127.0 27159.0 pertenauccs pertenallccspertenauces27147.0 nme bleaniebetonging27187.0 hiany inany hi1408.0 27283.0 27287.0 appertaining appcrtahuimmgappertainingCHRISTOPHER -812.0 appcrtahuimmgCURISTOIIER 27439.0 CHRISTOPHER CURISTOIIERMATIIUSOV UAtllJsOllATIirs0MATIIUSOVExecutor -704.0 UAtllJsOEJccutQr llATIirs0ExCCUtQF -604.0 EJccutQrExCCUtQFExecutorIf EJccutQrIfExCCUtQFIf2500.0 27971.0 27975.0 printing 28019.0 OU 27999.0 want wantjust 27992.0 sendypur sendQur sendyqurorclerto 28120.0 ypur yqurorclerto Qur -764.0 28132.0 28123.0 btar 28127.0 haehaveprompt haeprompt 28260.0 prompt attention atIl 28267.0 nndRndprices prtcespriceswill prtceswl11 wl11suit Bulttf1592.0 IfHave tflIave 28787.0 Have lIave28831.0 tried Giddings GiddingHair TInIrGrower GrwerGrowerOthers 16023.0 GrwerOthers Others bave28943.0 pronounced itgood itxoodFor 29075.0 xoodFor 29079.0 For sateasic29091.0 atS t3 Drug DrpgDmgStole Stotebtoie29215.0 oAinesvfUeOMnesviUeaud29227.0 Postoffice 1ostofficeiostoffice29239.0 Drugrc 1304.0 29351.0 29355.0 Store 13648.0 29388.0 rc mh111gb29359.0 Spring SprtnKtSpringsxmlns:ns23 ID31 19831 5392 16240 1708 ns23:type 18684.0 fci 18732.0 fcifci 19140.0 16351.0 1964.0 fciI 16440.0 1220.0 16240.0 El 16248.0 16407.0 16340.0 16431.0 16348.0 ci 16384.0 16992.0 16468.0 2639.0 w118015.0 17704.0 B117516.0 1440.0 18287.0 FAGAN PAGAN18091.0 19839.0 SCO 19727.0 SCOrti 20800.0 20271.0 COr 21443.0 20383.0 16304.0 3732.0 16623.0 rti 16552.0 Sells soils16472.0 18296.0 NVAAW 19023.0 19179.0 111I 19472.0 19183.0 allK 19584.0 allt t16336.0 K 16504.0 17640.0 Kinds Killds1136.0 18799.0 19312.0 Fresh 19127.0 FreshMEATS 20215.0 19315.0 FreshIYJEATSI 21460.0 21624.0 21499.0 21491.0 17791.0 MEATS IYJEATSI16487.0 19504.0 4892.0 Try 19060.0 Tryus 20064.0 4896.0 21480.0 20072.0 4UMi 21536.0 16267.0 18104.0 5716.0 1616.0 18108.0 usweoan 18456.0 18123.0 5931.0 UMi -1616.0 19740.0 18648.0 18544.0 18704.0 19064.0 18932.0 v 18872.0 19068.0 canplease 19736.0 19220.0 jail 16484.0 4296.0 16368.0 18028.0 please 18035.0 ploasoyou1 -968.0 19004.0 ploasoyou1I -1752.0 19788.0 19108.0 -680.0 20435.0 6327.0 19699.0 ISPHONE 20560.0 20480.0 ri 20552.0 16752.0 PHONE PHQN PMON-876.0 17627.0 17743.0 ix 4x17439.0 16480.0 oFft oFftESTABLISHIiD 18855.0 18283.0 8547.0 E8TABLI8HBD ESTABLISHIiDE8TABLIBFIO19239.0 tOaD 10001Oe19168.0 1000H 19528.0 tOaDH 1OeH 16936.0 17488.0 F 17240.0 17959.0 DUTTON BUTTON17720.0 20288.0 COCotton 20832.0 16288.0 Cotton 1312.0 19856.0 QAINf5VILLf 2512.0 17344.0 QAINf5VILLfI -1312.0 19999.0 AIHSVI -1168.0 AIHSVIHigh 17504.0 9363.0 1888.0 DepartmentHijjhBfft -1888.0 19392.0 18192.0 9723.0 -1200.0 20944.0 rL 2728.0 18216.0 rLHighp 21199.0 5344.0 HijjhBfft Highp-884.0 17152.0 17056.0 16768.0 17296.0 9916.0 17903.0 17575.0 ice 17579.0 ic 17776.0 18348.0 id 18559.0 18768.0 18555.0 19103.0 9979.0 18984.0 19600.0 19720.0 19895.0 19904.0 Inland IIud19975.0 InlandIn -712.0 20616.0 20120.0 Ibnd 21007.0 ottoq otoqottoqIn otoqIn21607.0 17031.0 Sood Scad17223.0 17760.0 17992.0 Lint 17936.0 Largo LargeSmall 19244.0 19880.0 Quantities Quantlt1I19816.0 QuantitiesAdvances 20875.0 Quantlt1IAdvances -952.0 4936.0 10815.0 Advances 17592.0 1l1fldemde972.0 Warehouse Warel10use19340.0 charges cliargesc1targes19267.0 20083.0 20008.0 20668.0 Firm Iirni20403.0 21184.0 offers 21111.0 offersmade 21631.0 offersIllacle Illacle16787.0 16716.0 17072.0 letter 16996.0 17588.0 17823.0 wire 18447.0 Correspondence 18188.0 19884.0 solicited solicitedjg solicitede20588.0 solicitedEGOCG 11860.0 EGOCG 17083.0 coeeeDO 16763.0 18080.0 CC 17771.0 OQCcccoe 18272.0 19284.0 19172.0 21324.0 ec 12071.0 jg 817892.0 1528.0 16364.0 ESTABLISHED ESTAOLISHED12095.0 1810 tSla1eS19204.0 tSlag 19539.0 19859.0 4THE 19984.0 21527.0 12107.0 1544.0 12184.0 g 16975.0 12228.0 17396.0 12235.0 AlACHUA 17324.0 18280.0 COUNTY ABSTRACT 20016.0 COMPANYi 19919.0 20020.0 COMPANY 20856.0 COMPANYGainesville Oalnesvllle12479.0 FloridaThe 3620.0 17100.0 17383.0 question 17955.0 17907.0 title 18376.0 18540.0 18492.0 18827.0 18784.0 19671.0 12699.0 investor investorAlitot investorAhofront 5360.0 16260.0 12868.0 Alitot Ahofront16592.0 stract 17160.0 17195.0 af17292.0 17364.0 TitlpTonny Title TD 17564.0 To 17987.0 pleccof 18775.0 18607.0 18840.0 19187.0 19116.0 19364.0 Alaclma lacbuaAlachua19960.0 Countv19887.0 20511.0 AnnliMtinri AnnIftfn20420.0 21523.0 12816.0 21283.0 5356.0 HUMIdbl u 17272.0 17408.0 IIIIC 17228.0 13027.0 17484.0 ii 17443.0 13032.0 17568.0 18676.0 furnished 18948.0 19276.0 19131.0 18980.0 19323.0 13095.0 onFAXES 20496.0 Application tlPbduUll 21288.0 ATAXES 21620.0 16496.0 13223.0 fAXES TAXESRETURNED 17800.0 18116.0 13232.0 PAID 18887.0 Anbiulnew 18432.0 13235.0 19643.0 19120.0 19075.0 19692.0 20092.0 20044.0 20603.0 20564.0 20912.0 carefut20847.0 carefulB jB 13339.0 18615.0 13375.0 AttentIon Attentlou2252.0 Attentloug 19216.0 13551.0 18836.0 16360.0 18944.0 COLSON 20059.0 ManagerSchedule 20951.0 Managera ManagerE3 17184.0 13863.0 oOO obODOOODaO obODOOODaOSEABOARD SEABOARD SEABOARDAJa -5328.0 17003.0 E3 -4604.0 17452.0 18391.0 18171.0 Q 18816.0 19468.0 IAMIE 21339.0 15075.0 1044.0 AJa AMIE1536.0 18136.0 xJNE ImINE17976.0 19796.0 IVSchedule 19852.0 aSchedule 20211.0 Schedule Effective 18356.0 19112.0 June Juue28 19464.0 19820.0 15459.0 19688.0 J9 20144.0 19971.0 20068.0 16416.0 37 2716543.0 16731.0 15752.0 J15780.0 31 16756.0 17251.0 15691.0 I5S 17607.0 17480.0 15783.0 55 15759.0 fSOUTHERN 17828.0 souT 18600.0 ERN 18468.0 19036.0 DIVISION DIVlSIO15711.0 IM 20260.0 54 20592.0 134 20947.0 34 20619.0 20880.0 21139.0 66 6 21495.0 15959.0 3sa 35a35516412.0 16815.0 16951.0 oop 16888.0 17167.0 17428.0 15967.0 osp op17368.0 03 17648.0 17788.0 Lv 18572.0 Ar 20252.0 15991.0 20111.0 20439.0 504 Soa30 20655.0 20796.0 20936.0 isa 20860.0 21136.0 J5 -44.0 20979.0 21268.0 321059.0 16000.0 16095.0 IS16808.0 16944.0 55P SSP16876.0 17164.0 17420.0 17359.0 40P 40 17500.0 17560.0 17528.0 18667.0 Baldwin Batdwin20247.0 19192.0 20448.0 16136.0 iaa 124isa20651.0 20923.0 3011 30t21264.0 so21335.0 soii 21540.0 20II 16284.0 16211.0 1146 16392.0 16239.0 io16608.0 45P 4sp17424.0 o3p O3 17644.0 18719.0 Waldo 1164.0 17556.0 16247.0 19144.0 20431.0 2oa 20aoa 20640.0 20776.0 20916.0 04 O421272.0 21052.0 21404.0 So50ft 50i2 16363.0 12 i216379.0 20p 16400.0 536p 16692.0 ft 17784.0 18412.0 GAINESVILLEj 1076.0 16435.0 GAINESVILLE GAINUSVII4L19580.0 19388.0 16452.0 19487.0 19967.0 19576.0 20320.0 16420.0 7S3a 21292.0 16423.0 20664.0 21419.0 30P30755p 21547.0 7g 17288.0 36p 17352.0 19535.0 16560.0 20463.0 16563.0 S3a 20400.0 17279.0 16667.0 755p 17404.0 16672.0 SSP 55P17620.0 17752.0 18583.0 16655.0 Cedar CedarKey 16664.0 Key 16676.0 20303.0 5515a 515aI 20456.0 15a 15aI 16771.0 16800.0 26p 16388.0 17748.0 16684.0 18460.0 Silver 17924.0 18876.0 Sprtngs18831.0 21216.0 16848.0 52P 21348.0 52 52158p258a 16851.0 I158p258a 58p SSp17156.0 16759.0 1258a 583 OcataOeala19416.0 17015.0 19071.0 20808.0 19440.0 551 20852.0 21128.0 21000.0 20972.0 21212.0 4ip 41P21344.0 16344.0 17075.0 255 16396.0 S5P16824.0 2213a 16880.0 16960.0 I3 13a 18587.0 Wildwood VildwoodWllclwood1428.0 WildwoodS 19224.0 20731.0 17128.0 J21508.0 1223a1156p 20940.0 17135.0 2ja 231117131.0 56p 16332.0 5510p720a lop iop17227.0 20aOrlando 1484.0 17271.0 1628.0 17247.0 ioopSs5a 20867.0 17276.0 21156.0 aja 25a17360.0 17363.0 MP 14P16595.0 i8a lSaiSa18564.0 Dade 1404.0 Cfty17411.0 zoa8p 2Sp28p21223.0 17416.0 3a 37a21359.0 SzipP 16811.0 17507.0 39 3911 39aPlant 18907.0 20791.0 3P 2JP20864.0 17563.0 17544.0 945a 45 17619.0 17643.0 16463.0 aSp o8posp17647.0 Ii16871.0 17652.0 17655.0 20a 2oaPalmetto 1460.0 Palm 19176.0 19008.0 17660.0 tto 4SP 45p21279.0 17700.0 21147.0 21415.0 42a 42 17759.0 28p2Sp17792.0 17768.0 463 46a18620.0 Manatee 17843.0 19151.0 Sop 3O 17840.0 21424.0 27a2jaooa 745 17928.0 4S17932.0 I2Ia3op 17935.0 3op 30P18624.0 Sarasota 17988.0 20919.0 17991.0 ooa 21400.0 17983.0 21331.0 18072.0 16820.0 18075.0 45a 4sa18672.0 8oo8oa 8oo8oaNORTh -828.0 18128.0 pop popNORTH 21275.0 21484.0 oaNORTH 5088.0 16403.0 18275.0 NORTH 17432.0 RAST EAST18144.0 17816.0 18972.0 18312.0 WEST 18743.0 19412.0 19612.0 18319.0 NEW NnWNIWORLEANS ORl4UANtJORZUAN819988.0 20888.0 56 S620767.0 57 57r 57Lv 7Lv 18556.0 16520.0 16588.0 -708.0 17132.0 ji 18067.0 S17219.0 18140.0 18404.0 18524.0 18332.0 18663.0 4P 14P18976.0 18712.0 19155.0 19287.0 20003.0 19779.0 19496.0 18652.0 4op20871.0 18647.0 93 jja 18700.0 tAr fArPernandimia Fernandina 16656.0 crnanna 18011.0 18751.0 18199.0 053 05a18516.0 900P ArLakeCity 19136.0 Lake Cfty19520.0 20843.0 SIp sipiioa ip IIaoa At18843.0 Brunswick Drunswlck16424.0 18004.0 18891.0 I21217148.0 oipiofcp Olp 18899.0 18315.0 35P 18967.0 18879.0 19459.0 lamia 1036.0 19759.0 3SP 3p21208.0 18928.0 J2 Ia040 04P040Al O4 19012.0 Al 18983.0 At 18979.0 ArSavanuah19119.0 ArFairfax alrfax 16968.0 18988.0 Th 18212.0 lOp iopIOpII5oa 18416.0 18868.0 18660.0 5oS 19043.0 soa Madison ArMadison19072.0 755p12581 Jsp 21579.0 21160.0 Sp SpAr SSp nffi 18208.0 ogp O9Pop18536.0 19159.0 1324.0 I44aArMoutmcehio 44a 19164.0 ArMonUcello Montlcetlo-892.0 19212.0 19263.0 At19215.0 91O 21076.0 21003.0 op 315 JSPArD 19268.0 Denmark 17076.0 16668.0 nwark mimark19307.0 357P 357k57P 18531.0 220a 20aArTallahassee Tallahassee Tallahasse19924.0 864.0 19355.0 94o325p 4op 40P21260.0 25P21327.0 19403.0 Ar16356.0 Columbia Cotumbla19447.0 S18175.0 30P18112.0 18184.0 18320.0 18644.0 5SP18579.0 35 19211.0 Quincy Qnincy19495.0 17P 1W17PAr 19543.0 ArCanidem 16508.0 19548.0 Camden 16972.0 16899.0 fn 17016.0 74op 18132.0 40P18527.0 19611.0 554 S4a 54a18796.0 ArRlverjunctlon 19592.0 River 20131.0 Junction unctlon19552.0 21251.0 1120.0 21391.0 19640.0 05 05105Ar 21571.0 19824.0 hamlet 16524.0 16528.0 wftLL1 Ivaillelt16580.0 vaillelt 955P 80sa 18736.0 19756.0 Sa ArPensacola PensacotaPensacola19800.0 19780.0 wsop 5op50119855.0 Wilmington Vilmington19860.0 19843.0 ngton 19891.0 oSP 03119875.0 Mobile 19660.0 ssa 55119968.0 Ar20107.0 Southern 16564.0 16644.0 uthern 17059.0 17139.0 19976.0 Pines linM20019.0 iz17476.0 20000.0 I8p 18pIsp20015.0 36a AiNew Orleans 20612.0 20012.0 20063.0 20644.0 3Ar 20060.0 25a ArRaleigh Raleigh 1153p1o45a 18119.0 20167.0 53P JacksonvUJeLvjacksonvifle21255.0 20220.0 8iop 20227.0 20251.0 Portsmouth 20280.0 20244.0 iopiopAr 21603.0 20316.0 18400.0 s20396.0 Richmond 17264.0 20411.0 Va 20348.0 17436.0 35a 18339.0 tn 121 20340.0 Macon 19375.0 co 19591.0 19507.0 40a 21456.0 40aAr 21592.0 aAr 20531.0 3l 2240.0 Atianta 20527.0 sue sueAr 16536.0 hashIngtonWashingtonAr IoIoa 20596.0 104 830p 20671.0 Baltimore altlmoreBaltimoreAr 20732.0 20735.0 2S8 25a2l Chattanooga 20667.0 aop 21320.0 05P 05PAt AtPhiladelphia PblladelpblaArPhiladelphlaPhiladelphiaAr 20855.0 136p 251 Stffv NBBhvllle Naiille19992.0 20816.0 1472.0 19772.0 20807.0 20pAr 250 20903.0 19308.0 StLouis 20911.0 Louis 19716.0 16252.0 20956.0 16836.0 16796.0 18076.0 21012.0 18220.0 ISP 513oa 18864.0 30a Chicago 21092.0 915 1580.0 19684.0 21099.0 Isa IsaConnections 15Connections 21375.0 dnrsJrm daisfronConnections Uainesvllle Gainesville17284.0 17335.0 17659.0 Patmetto17508.0 21299.0 Oneeo Oneco18740.0 19256.0 21311.0 20088.0 20728.0 except exeept20575.0 Satur SMurxmlns:ns24 ID48 8228 5700 16220 21543 ns24:type 4396.0 17188.0 21543.0 Seaboard 18056.0 Express 17980.0 18708.0 drawing 18552.0 room 19228.0 Pullman Putlman21604.0 sleepers steepen20344.0 21608.0 20968.0 21659.0 21671.0 Jacksonl1Ie21688.0 17856.0 21700.0 21712.0 york 18656.0 21719.0 via RIchmond 19675.0 21739.0 21744.0 Wnsnirt Vestibuled 20483.0 Vasnington 20631.0 16243.0 21795.0 21980.0 car 21947.0 service coaches co1ches17040.0 21819.0 21968.0 17612.0 acksonville18276.0 21843.0 lend 18380.0 18440.0 21852.0 21864.0 Wa Wahlnton Vashingtonhln 19451.0 21908.0 21959.0 vla19567.0 WchmonU 21884.0 21891.0 Cafe CafeNo 21096.0 20908.0 4f Vestlbu1ted 21588.0 din dinjug 21383.0 21915.0 IIi 22096.0 No 17035.0 16784.0 22103.0 Sea1 22244.0 Itnd17275.0 17303.0 22111.0 oard 22116.0 Mail fal117996.0 22123.0 clay22135.0 18227.0 18848.0 mail mallwailbaggage baireaeebaggAKe19123.0 22167.0 nndfnn 22171.0 Qpres5 epess20724.0 cans car22176.0 20988.0 btwen 21227.0 22183.0 tween tweenGainesville tw 21508.0 21372.0 22367.0 sonvllle sonville16776.0 22379.0 nndSVashingtoii 22396.0 Vorkhlngton 22275.0 Rnd18484.0 drawirtg18436.0 22328.0 roopi19423.0 22311.0 PuJlmllu20051.0 slecrera ale9era20556.0 twccp IWeCn18113648.0 22515.0 22543.0 S5 16852.0 22548.0 connects 17547.0 17495.0 17711.0 Stark 17668.0 18052.0 18335.0 22563.0 LaCrosse LaCroslacl1ua Mac1ua18900.0 19572.0 22584.0 WIUlford Willilord19500.0 20308.0 22596.0 Wal1l1ee Waunee20836.0 inlet Illter1412.0 22643.0 mediate 22659.0 points 16740.0 22691.0 17491.0 1976.0 22688.0 Archer 18503.0 22700.0 narly Uariy18451.0 22712.0 Dlrd Ilird19232.0 branch 22799.0 Nos 16839.0 22804.0 16979.0 17024.0 17376.0 17256.0 17523.0 22823.0 22835.0 steeper sleeper22852.0 22867.0 19080.0 19420.0 22879.0 20284.0 JackJOnvtlle20243.0 22932.0 Steamers 22944.0 17216.0 22947.0 hey17176.0 22968.0 West 1040.0 18160.0 lIavanalele IlavanaLeave19248.0 23012.0 Port 19559.0 23015.0 19516.0 23027.0 ln1a7 t3uudays20679.0 T1tesdal Titeschap20584.0 16236.0 23072.0 Thursdays 17192.0 23128.0 17108.0 17380.0 23131.0 intnA inA 23224.0 23227.0 023236.0 MACDONELL Asat Aut17812.0 18248.0 Gen 23280.0 Pass Pasa23287.0 Agent 1080.0 23304.0 Jacksouvllle Jacksonville20195.0 P1 23352.0 U23364.0 COBB COnB17120.0 23371.0 Ticket 17020.0 23391.0 GaineiviuleGainesvilleGainesville 18764.0 GaineiviuleGainesville 2120.0 Gulf 24259.0 Rwy 21104.0 CoTime 21108.0 CoTImeTabk 24667.0 Time TImeTabk Table 24700.0 Effect Effed908.0 EftectJuly 19207.0 24719.0 July 51903 19748.0 51903Daii 190J1903No0 190JI 25019.0 IkP 18156.0 24992.0 25155.0 No0 No0Dally 417664.0 25207.0 25212.0 NoDa kP 17888.0 17948.0 25251.0 Dally 16224.0 Dati DaiiNal NalDally 20103.0 20476.0 25263.0 Vp9 20100.0 Vp9DHy 25267.0 24p 20703.0 3Diil Diil 25364.0 5flcept Except JhctplExceptSunday 25383.0 Dilly DUy25420.0 Da DaXT 17819.0 25415.0 STATIONS BTATIONSSTATIONSFalrficU Dab 25475.0 Bund 16707.0 BundI DI1yDallyArP Dall 25471.0 DHy DH720031.0 DHyArA 20772.0 DH7Iy 20692.0 25468.0 JuqIC 1756.0 25944.0 XT Iy16308.0 16728.0 17124.0 25968.0 25971.0 if17204.0 25987.0 5072.0 716616.0 4a ArP 26039.0 PI 19867.0 ArA lor Ar20755.0 UUi Uu Ir ATPJI 2704.0 26120.0 765 26163.0 55FalrficU FtrtiddVaIrSeidFalrficUIrrinc 26236.0 26263.0 80 80016459.0 18688.0 Irvine IrrincImlle2072.0 Irrinci 90 2136.0 26340.0 26367.0 803 S16612.0 26395.0 Dumrarraa DUtXtrvanDumrarraaSonthtlde DUll 18960.0 mll 26447.0 810 26483.0 18628.0 Sonthtlde SoutbaldeSOfltSJdCSonthtldeHkkmtn 340 26480.0 21380.0 26551.0 815 26591.0 Hkkmtn Ukkll1ll2040.0 26579.0 16 830 830R38 26655.0 Iake1996.0 18780.0 26663.0 Slmonton 811110atollSiontoa3B SID 26795.0 R38 16571.0 26799.0 18632.0 26760.0 Mlcanopy MlcallopyMIauopy3i 843 S16604.0 43 Tacomai Tsms0Tcoma 19252.0 21163.0 3sg 19084.0 21376.0 26975.0 tOElrkwood KirkwoodElrkwoodClralt 26999.0 ra S63 Mcia27087.0 Clralt ClraUCiyttClraUII 19040.0 ClraltFlewellea sg 2124.0 27103.0 2764.0 27219.0 901 0IIM 27231.0 G1 OiFlewellea FlCWdlt1lFlewelleaMacahoota 27200.0 e1i IIG1 16448.0 27303.0 Macahoota WcaboQtaYscahootaMacahootaRocky Yscahoota43A 27323.0 444 43A 27403.0 Rocky aockro4lt Rock1otxt18883.0 Rock1otxtGa1eiii 27411.0 Point PointBclltlay 20688.0 27399.0 27431.0 20716.0 27447.0 27531.0 17199.0 si 27559.0 OenUle Ga1eiii1240.0 400 400SCO 19544.0 27603.0 27659.0 19912.0 27611.0 27635.0 sw27675.0 640 17096.0 17136.0 fO 27695.0 Il3 708 108708TSO 17847.0 27719.0 1200 1200MM Bclltlay Bti1iyBclltlayVTTilM BeU 310 3101M 27755.0 27783.0 6C3 19848.0 165 StiS19352.0 20508.0 27763.0 51527803.0 TSO TSOTCT 17736.0 27811.0 Y 17844.0 27859.0 MM isfoMMU 17028.0 27891.0 703 71i57037l5Ar 27895.0 27911.0 TCT T2TY2VTTilM OntlCytfi17851.0 VTTilMMOnuum 27864.0 840 148840SN 20504.0 960 960ss 27876.0 1M 1MI 27939.0 27968.0 me16539.0 o0At 7l5Ar 17143.0 Is17092.0 17300.0 743 v17692.0 18548.0 MOnuum OranalllOanzMOnuumin 28027.0 S19844.0 SN t27955.0 at1W IDss ssLTP 79 28111.0 17624.0 813 18151.0 28091.0 28096.0 18231.0 28043.0 8atBpeoa 18496.0 pimTnondlT 28079.0 19980.0 48 1W 1101WJAS 28075.0 17739.0 28115.0 13 18236.0 iJtkeButirr LakeButkrBaUu 18987.0 081k 18904.0 19384.0 28183.0 758 758seep 28187.0 iii 28231.0 1100 17244.0 11008S3 17728.0 uXi17680.0 JaekwBTilic JaeknlUJackIoBYilJA8W JS 28275.0 Wtake 28287.0 seep 19943.0 28291.0 Ge 20191.0 28323.0 28343.0 8S3 8M1128.0 rakeCItusap raieckydsap17836.0 take -1124.0 19399.0 Ctty 28371.0 08 18820.0 7Wp TIHp754p720184.0 28455.0 51517687.0 28480.0 28459.0 TaUaham TaUbwee28463.0 rallaba 18892.0 28483.0 SAL 8AL1441 YtM fIM1120 28539.0 28555.0 1110 17672.0 Val V4aGLp a1 18576.0 aaOsP aG8 19148.0 Hp 28644.0 20312.0 28608.0 20180.0 94028663.0 410 17236.0 18008.0 28691.0 Maeen 19792.0 11M 28715.0 Me 19900.0 725 725ATAM 28772.0 73 1C37sa73ArPM 17832.0 28827.0 ArPM 28835.0 PM 16584.0 28839.0 16867.0 ATAM ATAMIIArPM 17052.0 28867.0 28871.0 fAU 17808.0 AUataC uscAUatac0a 28799.0 el oic Cm 19295.0 19368.0 20500.0 28819.0 iA 28931.0 20351.0 LTP 20172.0 LYPW LYPWJASTM KJAS 20839.0 29132.0 29199.0 JAS JASTM x19652.0 29211.0 GRAHAM onlLUfGRAULXFmiteit 21083.0 29327.0 29335.0 29343.0 JC E19444.0 ZAUz 29364.0 fojspt 20096.0 fojsptT 20571.0 Sapt SaptILT4cs 21868.0 1228.0 29479.0 29483.0 19099.0 29492.0 JIJ1 29495.0 ILT4cs 29507.0 tc 20264.0 29695.0


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01987\ocr\0097a.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:18259
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.14
splitwords:0
ScansoftOCREngine Character Count:29803
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:30706
Abbyy6OCREngine Character Count:35025
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;35025;4903;44.939;93.2017
language:en
ScansoftOCREngine Predicted Accuracy:69.54%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:9894
ScansoftOCREngine Character Error Ratio:0.3638
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;30706;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:93.2%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:93.2%
ImgPrep Component Range:14723,18259
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;29803;10841;0.76036;69.5398
noPunctuation:1
ImgPrep Component Count Low Estimate:14723
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 10.0 ID4 29.0 ID6 26.0 ID7 23.0 ID8 16.0 ID9 14.0 ID10 11.0 ID11 19.0 ID12 8.0 ID14 9.0 ID16 7.0 ID17 4.0 ID19 12.0 ID27 13.0 ID32 20.0 ID38 27.0 ID39 24.0 ID40 21.0 ID41 17.0 Layout Page ID1 HEIGHT 30364 WIDTH 21064 PHYSICAL_IMG_NR 2 PRINTED_IMG_NR [2] PROCESSING PrintSpace 29739.0 21036.0 HPOS VPOS 96.0 PC 0.932 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 1364 19304 396 96 ns1:type simple language en TextLine 316.0 16792.0 400.0 String 36.0 376.0 CONTENT r WC 0.8095238 280.0 192.0 13331.0 124.0 T SP 12908.0 424.0 304.0 104.0 17088.0 3564.0 13524.0 176.0 14832.0 2612.0 468.0 56.0 68.0 500.0 9 48.0 44.0 3064.0 488.0 k 384.0 2680.0 52.0 148.0 5592.0 512.0 w7 2484.0 3108.0 6104.0 520.0 364.0 5740.0 8200.0 524.0 2072.0 6128.0 92.0 348.0 8316.0 476.0 rvAc 60.0 8256.0 28.0 8912.0 492.0 1 248.0 8664.0 40.0 17403.0 t 8464.0 8940.0 116.0 612.0 736.0 STYLEREFS Ii Iiii -56.0 668.0 172.0 440.0 968.0 100.0 ii 140.0 iij1 -60.0 88.0 528.0 996.0 41 -52.0 580.0 13660.0 464.0 1040.0 80.0 1060.0 j1 14076.0 II 0.96825397 13496.0 IID -48.0 14124.0 324.0 19304.0 396.0 1136.0 236.0 0.82539684 ALTERNATIVE D448.0 1144.0 -184.0 632.0 332.0 9220.0 1264.0 THE 0.95238096 8716.0 504.0 156.0 1468.0 9332.0 1256.0 TWICgAAVECK HFW1CAWK-220.0 9552.0 144.0 212.0 HP -1468.0 10800.0 152.0 9632.0 1260.0 Twort 9544.0 10328.0 W 10136.0 132.0 32.0 10696.0 1272.0 f 224.0 10472.0 10900.0 STAR afAR10728.0 168.0 1288.0 11420.0 1248.0 GAINESVILLE aAINIGVILLlGAINVILLEM11296.0 292.0 12572.0 1244.0 PJsA -136.0 12708.0 12672.0 1252.0 J -192.0 12864.0 14188.0 1452.0 n 1480.0 19672.0 1276.0 L 5440.0 14232.0 xmlns:ns2 ID5 9772 4092 16 1656 ns2:type 360.0 2588.0 1520.0 1656.0 2584.0 WEEVILISRAMPANT WEEVILISRAMPANTTexas -2584.0 4104.0 972.0 WEEVIL 344.0 228.0 2544.0 1668.0 IS 2492.0 352.0 2860.0 1664.0 RAMPANT 2772.0 RAMPANTTexas -1248.0 4108.0 1512.0 2388.0 532.0 2392.0 Texas Toxas208.0 372.0 2100.0 2404.0 Pest Post2044.0 204.0 112.0 P -372.0 2472.0 184.0 2320.0 2428.0 st 108.0 2212.0 456.0 2524.0 2408.0 Ruins 196.0 544.0 3036.0 Cotton 2980.0 444.0 3652.0 West 72.0 3580.0 Westof -444.0 4096.0 256.0 1588.0 2000.0 2668.0 200.0 188.0 2692.0 of 2268.0 tho tiio2188.0 980.0 2608.0 Mississippi Mississippi184.0 932.0 MississippiGLOOMY -980.0 3588.0 MississIppIGLOOMY -932.0 3540.0 2528.0 3271.0 216.0 824.0 3292.0 GLOOMY 784.0 2432.0 3284.0 PICTURE 2344.0 708.0 3340.0 DRAWN 3216.0 DRAWNIn DRAWNWDRAWNc-708.0 4048.0 DRAWNthomillt 640.0 3592.0 4 76.0 3704.0 3404.0 3868.0 c 548.0 1496.0 3892.0 thomillt eIiomIt752.0 744.0 2152.0 In 2380.0 Employ mploy2264.0 2956.0 3888.0 2848.0 120.0 3260.0 3884.0 Qovernment Governmont180.0 3080.0 QovernmentMakes -784.0 4044.0 780.0 GovernmontMakel 568.0 Qovcrnm -780.0 4040.0 3920.0 n4 3828.0 n4I -124.0 3752.0 4080.0 4128.0 I 4088.0 408.0 1652.0 Makes Makel936.0 716.0 4100.0 Tour 2060.0 2540.0 4092.0 2456.0 136.0 2756.0 4084.0 Infected 2664.0 128.0 3372.0 Beetloni 6cctlonl8ectlons3268.0 Beetloniand 6cctlonlI8ectlonsI-528.0 3900.0 1980.0 1788.0 4288.0 232.0 4304.0 and 1876.0 nd -144.0 2020.0 2148.0 4296.0 Predicts 264.0 2808.0 4292.0 Dire 2672.0 572.0 3196.0 Calamity CatrnIty3072.0 Calamityj CalamityICatrnItyI-572.0 3768.0 1492.0 4392.0 240.0 1744.0 1484.0 4456.0 j2296.0 4512.0 for 776.0 4504.0 forthe 2480.0 the -200.0 2740.0 420.0 4508.0 Future FutureCharles -420.0 3228.0 FutureOhar 3912.0 4852.0 1632.0 4904.0 Charles Charlea164.0 320.0 Ohar -504.0 2136.0 2008.0 4936.0 e8 1952.0 2204.0 4916.0 McLano 2988.0 a 2896.0 3112.0 4900.0 chemist chowIL3056.0 3660.0 4892.0 3604.0 3848.0 Ibo liolito3780.0 Iboploy -188.0 4036.0 litompIoy lioemploy 2552.0 5084.0 484.0 5108.0 employ mpIoy276.0 1692.0 ploy -276.0 1968.0 2032.0 5112.0 64.0 ottbo -128.0 2160.0 2228.0 5104.0 agricultural 732.0 3304.0 department deputmontdopartznontdepartmentof deputmontotdopartznontof-732.0 5296.0 5308.0 ot1704.0 5304.0 1624.0 United 1912.0 388.0 2516.0 Slates statesStflto32424.0 2984.0 covernmont goverflfl3Oflt2904.0 3864.0 5311.0 ur ar3736.0 arrived 4000.0 urrJved urtj 4004.0 5344.0 4008.0 5472.0 5475.0 tj 160.0 rived rJvedrivod1308.0 1944.0 5507.0 at 1824.0 596.0 5492.0 Knoxvlllo Kuoxvi1Io2068.0 2936.0 Tonn 2784.0 3444.0 5488.0 Saturday Saturdn3252.0 Saturdayfrom -596.0 SaturdntrOm Saturdaytrom -512.0 3956.0 2576.0 1476.0 5676.0 trOm from368.0 1888.0 5708.0 TexnsTome1796.0 220.0 5692.0 2256.0 604.0 2660.0 5688.0 Arkansas ArltansasArllansas2564.0 3400.0 5680.0 whoro whQro3264.0 5684.0 ho 3796.0 hohad -160.0 4052.0 hoad hol 3300.0 5888.0 5911.0 l 5900.0 had Iad704.0 772.0 1572.0 ad -140.0 1712.0 1812.0 5904.0 been boen268.0 2172.0 sent soul2088.0 5892.0 by lIy2440.0 2768.0 792.0 3048.0 government 2968.0 govern -792.0 3840.0 3628.0 enl 3488.0 3924.0 to tntoInvcsUgato tofnveslgato tnlnyestlgato 6080.0 6088.0 InvcsUgato fnveslgatolnyestlgato2276.0 th -212.0 2488.0 damago dl1masodtmago308.0 6084.0 dono 3088.0 540.0 donoln -308.0 3504.0 3608.0 6092.0 la hi3856.0 thethecotton 4056.0 thocotton 1436.0 6280.0 6292.0 cotton 1928.0 bolt 1852.0 480.0 boitby -248.0 2176.0 2252.0 6288.0 -156.0 b 416.0 wesvll weljvllweuvfl2324.0 wesvllHo weuvflHo-416.0 2888.0 2464.0 1596.0 6484.0 6488.0 Ho 1101860.0 has 1780.0 2156.0 6492.0 npont apont2076.0 2604.0 6496.0 two 2928.0 months montheinonthe2840.0 3492.0 ntudylng Btudylnatudyin3416.0 ntudylngtho -568.0 4060.0 Btudylntho atudyintho1444.0 6631.0 6688.0 1776.0 6680.0 Insects inseciB2216.0 2824.0 admits admita2688.0 3464.0 tliat that Ual-264.0 3728.0 3852.0 tuo thottio6692.0 tuofuturo thotuturo ttiouturo 2596.0 1448.0 6880.0 6884.0 futuro tuturouturo1956.0 ot1856.0 2184.0 lliocottongrowing oUongrowlngcottongrowlngsection 3472.0 sectionweal -464.0 sectionWesl 6912.0 ec 244.0 3800.0 tlon 3712.0 tlonwe3t -244.0 7067.0 7088.0 weal Weslwe3t1840.0 7084.0 1756.0 2048.0 7079.0 the1964.0 720.0 7076.0 MsslflmpplMsslIppI2248.0 3164.0 Is Ia684.0 3360.0 exceeding cxccedlnexceedingly -684.0 7108.0 exc 560.0 cxccedlnly 3572.0 260.0 edln -260.0 edlngloomy 692.0 1432.0 7263.0 ly 7280.0 gloomy 1576.0 gloomyMr -468.0 2124.0 2436.0 7471.0 7484.0 Mr 508.0 1920.0 7480.0 McVmoMctno1784.0 284.0 2520.0 7492.0 cays IHi7Sorty2908.0 7476.0 thnt2804.0 3256.0 3624.0 colton3460.0 cottoncrop -408.0 4032.0 coltoncrop cottonlJ 4016.0 7664.0 7764.0 lJ 296.0 7708.0 crop 1820.0 7676.0 1748.0 628.0 2012.0 7672.0 ninetysix nlnotytx1940.0 328.0 nlnot -628.0 2640.0 < 2340.0 0.0 lx 392.0 2712.0 Teas3180.0 counties countlcount13104.0 7696.0 s will willbe -232.0 willlie 1456.0 7863.0 7884.0 be lie1684.0 7880.0 almost nlmost1612.0 2192.0 7907.0 n2128.0 7875.0 total 2260.0 -292.0 2616.0 lnl 2368.0 460.0 failure falluro1756.0 7868.0 falluronnd -460.0 3140.0 3208.0 -228.0 3436.0 3508.0 tbat3832.0 3772.0 thowestern thoMeslern thovoetorn 2580.0 8004.0 8076.0 western Meslernvoetorn8080.0 part 2448.0 2352.0 -44.0 2568.0 608.0 ArKansas ArKanuu496.0 rllanlaq -496.0 8024.0 especially especitliYospccIalyespeciallyHempatcad especitliYlIempsteall 8064.0 ospccIalyI 8223.0 1464.0 8260.0 8267.0 Hempatcad lIempsteallllompntoacl432.0 8272.0 county 2208.0 2796.0 presents prosentsprOSOfltB2696.0 3388.0 8296.0 n3336.0 3516.0 desolate 110801atolOsototO8264.0 desolatecppoaranco -524.0 110801atoPlOOrance 3544.0 lOsototOspp 1460.0 8460.0 8492.0 cppoaranco PlOOrance8496.0 spp -752.0 1708.0 1696.0 436.0 aranco 2412.0 8472.0 110lb -180.0 2592.0 516.0 predicts predlctprodIct2512.0 8468.0 3204.0 3644.0 8463.0 3560.0 cottoncrowing -396.0 cottongrowlnc 4028.0 8659.0 8724.0 536.0 8668.0 crowing growlncgrowing1380.0 8671.0 to1996.0 ho660.0 southwest southwostaouthwost2476.0 3280.0 3212.0 452.0 decline declluodcclluodeclinela declluoIndcclluon-452.0 904.0 8856.0 8864.0 In1516.0 8892.0 -84.0 1600.0 1680.0 1976.0 8867.0 futurO fulurOfutur1892.0 futurOAll 2372.0 fulurOAll futurMI 9056.0 9060.0 All MI1936.0 9068.0 efforts ertortsofforte9063.0 2356.0 472.0 2728.0 doatroy dOBtrodootroy3332.0 ho3200.0 412.0 3640.0 weovll weovil3524.0 weovllhavo -412.0 weovllIlnvo weovilIiaV 1472.0 9244.0 9252.0 havo IlnvoIiaV9264.0 proved provecl340.0 futile rutllo2708.0 9256.0 the3032.0 3376.0 people pooplo9280.0 arc nre3788.0 arcdiscouraged nrediscouraged 9448.0 discouraged 2452.0 9456.0 ArltansasArkanaae3156.0 9452.0 das flaslies3060.0 9464.0 not 3760.0 boon beonbeen3676.0 boonn beonIIIbeent3816.0 9631.0 9680.0 a1212.0 III -72.0 1548.0 9652.0 hard hatI1584.0 2104.0 hit bllbit2384.0 this thlllthi52284.0 288.0 2720.0 9663.0 year yooryoar2620.0 3100.0 9684.0 as 3008.0 380.0 3328.0 9660.0 TeXae3236.0 3844.0 9643.0 but bllt3708.0 butlie -208.0 blltlfI butbe 9812.0 lie lfIbeprodicte1636.0 2272.0 9820.0 tholtho 2532.0 -196.0 9824.0 devastating dovostatlng1216.0 9815.0 dovatatIngwcovll dovatatIngwcovllwill -1216.0 weovllwill weovllwilt 9947.0 wilt428.0 9979.0 spread 1724.0 rapidly rapid9984.0 -108.0 10008.0 over ovor2648.0 3124.0 9988.0 the3384.0 9968.0 entire ontlroentlro3324.0 9996.0 cut Clttcotscutton 4072.0 Cltton 4024.0 cotson 10143.0 ton 1540.0 10164.0 on -152.0 1764.0 lands londslande10148.0 the2300.0 648.0 2628.0 Bouthweatwithin wltbln3276.0 3836.0 3756.0 twoyears 4068.0 twofERrIl twoycare 10304.0 years fERrIlycare2036.0 10312.0 Pew FewF1cw1836.0 10307.0 If it2304.0 10336.0 any nny840.0 2944.0 evidences ovldencesotoy1cnccs2820.0 3656.0 10316.0 3784.0 3872.0 theappearance -204.0 4076.0 theaPPOIU1nco theappearaneo 576.0 10471.0 10496.0 bf 748.0 1488.0 10492.0 appearance aPPOIU1ncoappearaneo2328.0 10476.0 ot2236.0 2560.0 the2460.0 woovll oovllwoovil2764.0 3368.0 have havohovo3272.0 3776.0 bon lidcnlidonlidcnBeen -304.0 lidonse bonl652.0 10616.0 10623.0 10655.0 Been COfl804.0 10652.0 se 10660.0 1620.0 1868.0 cast cnlteaBt1736.0 10640.0 thetheS 2636.0 724.0 2724.0 10628.0 MtulsSIPplMississippiLOOKS -724.0 3448.0 MtulsSIPplLOOKS 940.0 10963.0 S 1648.0 LOOKS LOOKG680.0 2224.0 10972.0 BAD DAD10976.0 FOR 2948.0 CURTIS GURrIB2880.0 3556.0 JETT JErrJETTNew 3928.0 JNew 3616.0 JErrNew 11276.0 New 1880.0 11279.0 Witness Wltnus1816.0 11299.0 Gwara 8warsBwoaui2416.0 He 2960.0 3152.0 11328.0 o 3288.0 11304.0 Saw BawOaw3632.0 11292.0 Defend DefonllDefenti3552.0 xmlns:ns3 ID13 9540 4140 24 11451 ns3:type 1224.0 11451.0 11463.0 end IIndhoot QhoothoQt2912.0 cockrlll CockrillCockriIIcockrlllIn Cockrill1nCockriIIIn1660.0 11612.0 1nthe1808.0 2144.0 trial trlat2080.0 11615.0 ot 588.0 ofOurtl otCurtieOurtli 3076.0 3136.0 11620.0 Jolt JottJetl3456.0 tor3392.0 the3964.0 al 3908.0 alleged -112.0 allogod alS 11671.0 11756.0 11772.0 leged logodiogod872.0 11776.0 assassination naeas1nation1872.0 li8Sas -872.0 2376.0 lnatlon 11779.0 ot404.0 James Janica3024.0 11784.0 Janicaf -404.0 Cockrlll CockrillCockrlllof Cockrillaf-508.0 1524.0 11920.0 af-40.0 1772.0 11936.0 Jackson JaCkROD11948.0 Ky Icy2292.0 2828.0 11940.0 hocommonwealth commonwealthSaturday -968.0 11968.0 commonw commonwealthfturday -640.0 alth -240.0 althSMurday 12095.0 600.0 12104.0 SMurdayfturday12100.0 introduced IntroducodWilliam 2872.0 12112.0 Copo Cope3880.0 nn1 3820.0 nn1James -224.0 12128.0 nn nnI 712.0 12252.0 12335.0 728.0 12356.0 -24.0 12264.0 12259.0 Qlanton Dlanlonfllanton2624.0 who 2508.0 2964.0 corroborated eorfoborntedcoroboratodoth ot11others ot11tfS 12320.0 1528.0 12411.0 12447.0 ers tfS1832.0 12452.0 1732.0 12432.0 aato -120.0 2180.0 12423.0 Jott Jeltbeing4 be1ng984.0 belntlntront 3052.0 -544.0 3596.0 12428.0 front 3176.0 3688.0 3812.0 thecourt 4112.0 thecourl 12587.0 12675.0 5 1532.0 12592.0 court courlhomo houlloboiioImmediately Immedlato1y312.0 3408.0 after IIftor3916.0 3720.0 thoshooting 4116.0 thoshoolln thohootlngand 12739.0 12748.0 shooting shoolln1608.0 hootlngand 12756.0 nnd12751.0 theshots ehotecoming 3220.0 3804.0 from frUm3740.0 fromtho frUmhe fromS 1924.0 12903.0 1536.0 tho820.0 he 12920.0 2244.0 12912.0 house houllohou5ohouseTho houlloTho hou5oThe 13055.0 13072.0 Tho The2052.0 feature tbaturo13099.0 was WOIwaa13076.0 2864.0 13079.0 testimony tcstlmonytoetimony3896.0 ofCharles 4120.0 ofCharlcs ofChance 13231.0 CharlcsChance13236.0 Croon Green2056.0 -376.0 13260.0 l1On wltnttfs wltllMwltnciln13243.0 wbo3960.0 13268.0 es osescaped -132.0 oscaped 13300.0 13339.0 1544.0 13392.0 caped 13395.0 nodsaid soldeald2644.0 13424.0 afraid alraldairald3600.0 13407.0 3536.0 13400.0 bohg bolgbohgkilled -344.0 4132.0 bol bolkUlodU 3972.0 bolgV 3984.0 13552.0 13584.0 V killed killod1348.0 kUlodU -388.0 1932.0 13556.0 Lf-104.0 13559.0 2196.0 testified tostllted3352.0 13564.0 Green Oroen3904.0 13596.0 wan WIIIwt3724.0 wanfcrpugh -236.0 4140.0 WIIIIJrpuch wti 13679.0 13708.0 i 1552.0 fcrpugh IJrpuch1356.0 13716.0 ugh 2120.0 13723.0 back ba 2348.0 13728.0 ll under 2992.0 13687.0 arrest arrostarront300.0 3468.0 13731.0 Lex LoxLexington LexSn Loxh 13780.0 4064.0 13831.0 13960.0 h ington 1424.0 13872.0 Sn ln-432.0 13880.0 1672.0 13884.0 13887.0 2536.0 13892.0 Io 2656.0 2744.0 telltlnodtostiflodthnlhQha13912.0 WAS Wj1SWASabout 4148.0 Wj1Sabout wt wtabout 1556.0 14012.0 about 14044.0 14039.0 toot foottromockrlllCockrill2892.0 336.0 14047.0 when wlic3952.0 3876.0 4152.0 thhootlna thoA 14176.0 A 14191.0 hootlnaehooting796.0 14203.0 began boganhogan2736.0 14216.0 Jloliennd14208.0 CoclfUlIJCocicrill14211.0 boih IJOh-68.0 3936.0 boihran 4144.0 hran 14320.0 Li 14384.0 ran Ton1384.0 1960.0 14364.0 Ha Jlo2140.0 14392.0 saw soweaw2064.0 14360.0 sliota14372.0 comlnr3132.0 3732.0 14375.0 14380.0 twovolleys twoVPl1o twoit 14519.0 14551.0 it volleys volIoa1368.0 1568.0 VPl1o 2028.0 14548.0 14527.0 frqm trQtIrrem2496.0 14524.0 thobo -148.0 14544.0 3172.0 14532.0 houlohouvo3620.0 14539.0 window windowend -492.0 14536.0 windownd windowI1 14664.0 I1 14688.0 tind1304.0 252.0 1644.0 1800.0 1904.0 14712.0 caw nw14691.0 Curtle Curtis14696.0 Jelt3096.0 firing tirIng3000.0 14703.0 trom3440.0 3948.0 14700.0 tbothocptirt tboc thoI3944.0 14828.0 356.0 1560.0 14852.0 cOurt cptirt14876.0 -356.0 1916.0 14847.0 urthol1so 1988.0 houso hotiso2360.0 2444.0 nt at564.0 Coclcr11lCocicrilL3356.0 14860.0 11014864.0 toatflc tostlne1totlfloltostlne1that 4136.0 14923.0 > -64.0 1that -36.0 14987.0 M 15007.0 644.0 twoother 15011.0 other 2548.0 15040.0 men 15048.0 were wero2884.0 15024.0 3532.0 the3808.0 15028.0 cOllrtcourthouso -332.0 cOllrthoulo courthouuo 15168.0 houlohouuo2024.0 15171.0 whom 1948.0 15176.0 hedidnt 15183.0 recognize rocogno3092.0 15195.0 nnd andnndthai nndthat andw 812.0 15327.0 15335.0 w thai916.0 hut1848.0 15340.0 little UUlo1ItUo2748.0 sraoko Bmotloamoho2572.0 15376.0 wno WAO3692.0 15347.0 visible vlslb1eylaiblo3512.0 visiblewhich -424.0 15352.0 vlslb1eWbleh ylaibloWhicli 15476.0 which WblehWhicli816.0 2040.0 15496.0 corroborates corroboratee15499.0 othor2856.0 624.0 15508.0 witnessed wltn witn-624.0 15511.0 ssei Seo15479.0 Ieft15516.0 Insaying Ierlng -116.0 836.0 15636.0 7 15648.0 saying eaing672.0 896.0 1716.0 rlng -288.0 2004.0 2108.0 15651.0 thai15656.0 they tMythoy15663.0 believed bellevod2760.0 15672.0 smokolors amotelorsimoholoe3396.0 amotelorslowdor -660.0 4164.0 imoholoeS 15815.0 15915.0 15844.0 1000.0 powder lowdorpwdor15839.0 waa wnu15827.0 wanuaod -252.0 used ull0112836.0 JoltJottTWO 3308.0 JoltTWO 16140.0 TWO 16152.0 MORE MOne1108.0 2792.0 16143.0 RESIGNATIONS RE6GNAIONSflE8IONATIONORESIGNATIONSOne RE6GNAIONSOne-1108.0 16300.0 3320.0 16464.0 16532.0 One 844.0 16496.0 2092.0 16468.0 Member MeberMounber1992.0 2716.0 16471.0 584.0 16476.0 Rdwardo FdwardEdwarde16483.0 Cabinet Cblnet3528.0 CabinetFvo 4124.0 CblnetFtvo 16623.0 Fvo Ftvo16628.0 Vacancies VllcanclOi3184.0 16643.0 16635.0 toFII toFIIA -380.0 Fill -168.0 FillA -216.0 3612.0 2396.0 16780.0 16787.0 1896.0 London 16784.0 special spocl111epacIjI16819.0 says lOyseaya2900.0 3484.0 Lord 16799.0 orll 16804.0 Hal nal13a1Halfour nalfour 13a1tour 16939.0 four tour16948.0 bf2084.0 2168.0 Durlolgh BurleIghflurleigh2844.0 16956.0 secretary sccrotarysecrotnry16959.0 tor16951.0 Seal uCnScotSealland -280.0 uCnJand 16963.0 ScotI 17103.0 17144.0 land Jand1396.0 17112.0 IIlId2240.0 Arthur Artbur17115.0 Ralph nnlph2676.0 3188.0 Douglas DOIIsins17120.0 Eliot 3700.0 Eliotfinancial -312.0 3976.0 17240.0 556.0 17267.0 financial 1312.0 17279.0 eocrotary2116.0 832.0 lIocrotnryto 2916.0 117304.0 2972.0 3160.0 17316.0 17291.0 treasury treasurtroasur17287.0 treasurhavo -540.0 troasurS 3380.0 17428.0 17524.0 have760.0 resigned reslgnoltrcignol17443.0 anll17463.0 ant 2816.0 2920.0 17436.0 their 2776.0 17439.0 resignations reslgnntlollrosignatloni3224.0 resignationsliavo rosignatloniitavo-796.0 reslgnntlolll1avo 17588.0 liavo l1avoitavo17595.0 been17603.0 accepted nccoptod2220.0 2932.0 3432.0 king 17612.0 3716.0 MrKlllottwas MrI1liotLwas 17615.0 tr trJllotlwa 17744.0 Klllottwas JllotlwaI1liotLwas17755.0 2288.0 2632.0 17759.0 17791.0 2752.0 17764.0 thecabinet clnoLcabinetThoeo -480.0 clnoLS 3168.0 lnot lnotThoso 3576.0 3344.0 768.0 17879.0 17935.0 17911.0 Thoeo ThosoThoo17916.0 17904.0 tworesfgnaUonomaTlo resfgnationnmarto-1200.0 17928.0 nialto 3684.0 17960.0 tol toll tolit-164.0 tolitof tollof 17940.0 lot 18072.0 ot18080.0 1676.0 18087.0 vacant vacanl2600.0 18083.0 cablnol18095.0 posts poata3568.0 nnd18124.0 one ono18127.0 onesecretaryship onoe oneaCcretaryahtp 18244.0 868.0 secretaryship crotar8hlplllaCcretaryahtp18264.0 e -868.0 18251.0 864.0 18247.0 Premier lromler592.0 3240.0 18256.0 Dalfoura DolfourBalfoura18259.0 dli d11diidliposltlqn d111OsltlQn diiS 18388.0 18475.0 posltlqn 1OsltlQnttOOitiQflposltlqnWith 1OsltlQnWlt 18548.0 18552.0 1688.0 18560.0 With 920.0 Wlt -324.0 18563.0 tito888.0 18567.0 resignation relllgnlitlonofresignatlonof3084.0 18580.0 18584.0 18587.0 Balfoiir nalfollrflnltoiirBalfoiirand -488.0 nalfollrand 18683.0 18704.0 18727.0 Financial Fhtllncllli18744.0 Secretary Bocrotnry2468.0 BocretaryE11ott -608.0 Elliott 18751.0 both bothBtiong -284.0 bothshong bothBttoulg 18888.0 Btiong shongBttoulgtree froo2308.0 18923.0 2164.0 18895.0 traders tradoretrador18903.0 It 18908.0 18915.0 understood understodundersto3dunderstoodthat understodthatundersto3dthat-716.0 2556.0 19040.0 19047.0 hotb 2112.0 19043.0 ministerial mlnl8torlrainlatorlid19064.0 788.0 2996.0 slgnatlonlrOsignationa19104.0 -788.0 19111.0 are nronranrocompleted nramp1etcd areS 19207.0 19315.0 completed mp1etcd800.0 completedIt 19211.0 mp1etcdIll 19368.0 19375.0 19371.0 Ill 1792.0 1864.0 le1900.0 676.0 practically racticalIy1972.0 19395.0 certain cortaln3312.0 19400.0 thBt3636.0 19391.0 Austen AustonAttten19527.0 Chamberlain Obomborlnln19555.0 2364.0 Mllnor Mimer2800.0 3500.0 19571.0 Mid ntJdthd19576.0 Mrf 4020.0 19691.0 Brodrlck JJrodrJckBrodrick19708.0 19704.0 tako take19719.0 the2732.0 19728.0 19792.0 exchequer exchequor3792.0 19743.0 colo cole3696.0 colonies coloI1lel 19795.0 19848.0 19851.0 nice niesI1lel828.0 19875.0 nnd19868.0 Indian portfolios pdrtfdilpe19907.0 p -600.0 rtf 19883.0 llpsr08p 664.0 19895.0 respective roipoctiye-272.0 respectiveand -664.0 19900.0 tIc 20015.0 20027.0 nndanti2096.0 tbotho272.0 20032.0 only 20047.0 surprlso urprlsoTn Tfl3248.0 20059.0 the3824.0 20091.0 now nolYnowappointments nolYappoln nowS 3348.0 20184.0 20211.0 appointments appolatmentaappoln 20196.0 ments 20199.0 is IIlikely IIkoly3068.0 20208.0 20220.0 be3192.0 thothonoml thonomlnation -580.0 20228.0 nomi -320.0 nomination 20279.0 20343.0 nation 20360.0 ot20380.0 2132.0 2336.0 strong trongtrotig2812.0 man ninnalantile tbotlio20411.0 war 20395.0 or20424.0 0 20455.0 3988.0 20504.0 flee ficefico20512.0 1760.0 determine dotormtno20527.0 how holY20536.0 far fortar3028.0 20539.0 the20575.0 recom rec01llrecoinrecommendations -384.0 rec01llmondatlons recoinxnondatlona 20607.0 20668.0 mendations mondatlonsxnondatlona20679.0 atof20688.0 tbo the20695.0 South BouthAfrican AtrIan20744.0 wur wuwr3764.0 wurcommission wucommlulon wrcommaelon 20828.0 commission commluloncommaelon20872.0 can 20847.0 ho20852.0 carried carrlodcarrod3428.0 20867.0 ut xmlns:ns4 ID15 7704 4020 52 21279 ns4:type 21279.0 21396.0 908.0 ATLANTAN8 ITLANTAN6ATLANTANS1284.0 21311.0 ARE Ag1112.0 21320.0 DISAPPOINTED DiSAppONDDISAPPOINTEDf DiSAppONDVIorou-1112.0 DIMPPOI 21344.0 D DVlaoroua 21592.0 21604.0 Vigorous VlaorouaVIorou21616.0 Kick 21636.0 Made 2500.0 21639.0 Madeon 2924.0 21671.0 21624.0 Surprisingly SurprliinalyGurprlingiy21648.0 Gurprlingiy10w -804.0 -360.0 21807.0 Low 10w2316.0 21824.0 Coat Coet21827.0 21835.0 21856.0 Depot 3144.0 DepotThe DepotThoannouncelUent DepotTh 21979.0 21996.0 The ThoannouncelUent -256.0 Th -1284.0 22023.0 announcement announcolnent22031.0 tbal22043.0 ho22079.0 22128.0 l1Io3engOr nay nOTnoy1908.0 naypassenger noyaiingcr 22184.0 passenger 1Io3engOraiingcr22204.0 station etatlon22216.0 22227.0 be3120.0 22236.0 erected eroctell22239.0 22243.0 3860.0 22248.0 tha thethaAtlanta 22251.0 thaAtlnntn theAtlanta 1508.0 22383.0 Atlanta Atlnntn22391.0 Terminal Termlnnl22415.0 Company COlUpanyConpany22432.0 22451.0 cost costS 22547.0 22615.0 less IcssIces22552.0 than titan1752.0 22567.0 350000 31i0OOO3OO0OInstead 22571.0 InstCdot -456.0 22599.0 3584.0 750000 ThOOO750000as 750000liS-436.0 ThOOOa 2504.0 22707.0 22731.0 liS22740.0 1804.0 22728.0 generally 22743.0 understoolltho22760.0 22767.0 do doyot 22772.0 IIJot 3940.0 740.0 22875.0 22936.0 1504.0 Jot yot22899.0 W81waa22883.0 22887.0 tocosl tocogt22895.0 lias 22924.0 os ina-176.0 22915.0 caused cousell22947.0 II22927.0 number numberot numberornumberjL-472.0 23027.0 23079.0 jL 23184.0 orof23044.0 counc4 councM1640.0 23056.0 members membermembera23067.0 23091.0 express oxpresoxprcs3040.0 23088.0 them tbcnvtbcnvselves -328.0 themsetve 23196.0 selves setveacivea23228.0 liSUB23223.0 most moatdisappointed dlsapPolntell23247.0 nnd23275.0 some somoRomosomoof Romoor someor 23351.0 23355.0 or ofthtm thtru23363.0 havo23387.0 declared Iteclared2400.0 23383.0 thai3004.0 23404.0 1II123416.0 d 3520.0 23512.0 known lmownlinown23519.0 thotbo23536.0 depot Ite1ot23559.0 would 2684.0 23571.0 coat23583.0 onlj onl un123676.0 J3GOOOO U50OOO36OOOO23691.0 23715.0 23727.0 23732.0 havohoo23752.0 vote 23764.0 Va vo3968.0 23743.0 tal talor 23831.0 23855.0 23840.0 tboho23847.0 city 23859.0 2280.0 23867.0 readjust readJhst23891.0 thegrades grllrJelgrnlcz23911.0 nl 01ni23992.0 the24004.0 street treel8treet1720.0 696.0 24036.0 approaches approachesA -696.0 24339.0 24343.0 FATAL 24364.0 HIGH HtGH24396.0 COLLAR COLLARMan -560.0 24636.0 24648.0 Man 24663.0 24659.0 Olean -368.0 24695.0 -8.0 24683.0 Ncw2940.0 24703.0 York 24727.0 Choked 3232.0 24751.0 24815.0 Death 24832.0 2420.0 24839.0 Late 2332.0 24856.0 Style 24876.0 Neckwear 656.0 24976.0 25099.0 964.0 dispatch 24996.0 froll25011.0 Oloan OIeanOlean25031.0 N K25040.0 Y 25087.0 sa 3548.0 881125123.0 C 25135.0 O25139.0 Slater Siater25175.0 25167.0 mechanic mcchanlc25195.0 choked choUcdcholiCd25223.0 1500.0 25283.0 death 25299.0 25336.0 n25312.0 high blgh25324.0 collar 25339.0 3496.0 25359.0 ho3424.0 25395.0 wore WarworeS -296.0 3996.0 3420.0 25456.0 25543.0 Was 25467.0 tna 1616.0 25476.0 fl8 25459.0 found 25471.0 dead 25483.0 Friday Priday25488.0 Frlda 25511.0 lying 1lng25532.0 25575.0 J25611.0 fence 25655.0 corner 25643.0 His JIIsills25652.0 body hotly1I0d -300.0 25691.0 25684.0 double dOlbldonble25707.0 25783.0 25751.0 25799.0 so 80sotbntfhls 25779.0 thathls thathte25795.0 head hoad25811.0 hung huns25823.0 between botweenbotwc -516.0 25871.0 25855.0 his hiB25935.0 knees ltn 1844.0 25971.0 25951.0 Hla JII Hl25968.0 taco face26000.0 wns was25988.0 bhck biscicbh -340.0 26007.0 and26015.0 hI -172.0 26095.0 htgh1828.0 26111.0 atlff atlrratirr26123.0 26135.0 hodbod26147.0 Into 3044.0 26159.0 thothe3672.0 26196.0 mans -364.0 26252.0 neck bockneckEXBANDIT 26255.0 bockEXBANDIT 884.0 26467.0 1r 26591.0 EXBANDIT EXI3ANDIT26632.0 IN 26644.0 MORI26659.0 TROUBLE TROUBLtTROUBLEColo -712.0 TROUBLtCole 26907.0 27063.0 Colo Cole26919.0 Younaer YourilcrYouper26939.0 -96.0 26960.0 Now 26972.0 Charged 26992.0 27043.0 if 1072.0 27119.0 Embezzlement fErnbezzIement27159.0 27171.0 6000 00006000from 6000A 0000AcIspatch 27307.0 27311.0 AcIspatch 27335.0 81 jch 27315.0 tramNevada Neld1flevada27364.0 Mo MoA 27391.0 sty siy27499.0 27507.0 charge chargch -448.0 irg of892.0 27516.0 embezzlement 688.0 cmbczzlcm -892.0 27555.0 27560.0 27567.0 JGOOO 27571.0 6001 6001has 636.0 27651.0 27844.0 27683.0 1740.0 27703.0 cri -76.0 27712.0 mado nuldo -348.0 against IIglInst27731.0 Cole ColoColc3016.0 27747.0 Younger YoungOrYoungerformer YoungOrtormer 27879.0 former tormer27895.0 bandit bndlt27911.0 byjho byho27931.0 2704.0 Jbo 27939.0 management 27943.0 mlllegOhl manegoni27955.0 27964.0 rt rf28040.0 28119.0 28043.0 the1372.0 28055.0 wild wesl28072.0 sb 28063.0 sljOWJvfth 28095.0 sjow ow with vith28067.0 28103.0 blch 28099.0 Frank Frar1t28192.0 Iamca28231.0 28243.0 an 28199.0 Sotingz4YOlng -584.0 2852.0 28227.0 baobavo28248.0 28280.0 een 28287.0 asio 1110aso28347.0 elated cintodclal 28375.0 since Sinte28391.0 cuortly iiorjly28419.0 ort1y 28407.0 Cter lter 28471.0 IV4 UI4UftU 28439.0 ollngo ollngopardon oqngoa B 4012.0 28511.0 pardon I5rdn28531.0 28559.0 rom 28552.0 28564.0 li 616.0 SuUtiosota iThuoaota28575.0 nlloabta pcnlten pcnHenpencnpcnltenn7 -476.0 28659.0 tlarr 28687.0 n7 28684.0 where whcrc28695.0 28735.0 wn wnQ 2976.0 28723.0 servhis sCrhllfafo 28739.0 fO 28831.0 28836.0 pcn ionicnc9i 28851.0 q 28859.0 1884.0 xmlns:ns5 ID18 9880 2756 4180 1488 ns5:type 1728.0 4348.0 5988.0 1592.0 4396.0 AADVICE -88.0 6076.0 1628.0 ADVICE 5336.0 TO 5136.0 1116.0 5716.0 PRESIDENT PRESIDENTS5588.0 1080.0 PRESIDENTChicago PRESIDENTChloaaoPRESIDENTSChioao-1116.0 6832.0 4248.0 Chicago ChloaaoChioao4908.0 Federation Ferlerltlon4776.0 5736.0 or5604.0 5980.0 Labor Lebor5864.0 6464.0 Send Sendi6352.0 SendRoosevelt 6840.0 SendRoo -316.0 6780.0 SendiRoosevelt Roosevelt Roo 5096.0 4780.0 ovelt 4696.0 5156.0 5300.0 Long 5224.0 5696.0 Letter Lotter5616.0 6160.0 Express ExpreExpresaExpressing 6664.0 ExpreIng Expresatng 6524.0 6668.0 4600.0 ing tng764.0 4884.0 Displeasure Dltpleaoure4796.0 Dl -764.0 5648.0 5092.0 pleuuro 5016.0 5720.0 5916.0 Attitude 5848.0 AttitudePresident 6440.0 6024.0 ttltudo ttltudoProsldent 4372.0 2700.0 President Prosldent5120.0 Iloosovoit5872.0 5764.0 6216.0 voted 6108.0 6560.0 bytho 6824.0 btbo 6748.0 4228.0 tbo4532.0 Ohlcago4432.0 5172.0 FOderatlonFodoratlon5068.0 5960.0 ot5868.0 6180.0 6700.0 6568.0 ata 6828.0 4220.0 114364.0 mooting meotngmeeting4988.0 Sunday SUllllay5572.0 5464.0 0000word O000word5640.0 O 6384.0 5896.0 OOword 5780.0 6468.0 letter lottl3rlottorletterof lottl3roflottorof4216.0 3296.0 4408.0 advice advlco4340.0 4836.0 5028.0 5552.0 fault fauU5480.0 Isfa5852.0 6020.0 6540.0 withtho withthe 4212.0 the4520.0 presidents prcsldenVproeldefla4420.0 5332.0 attitude attitudo5232.0 5932.0 5836.0 6192.0 thoquell quesque6400.0 question 6804.0 quelltfon quetion 6808.0 6728.0 4208.0 tion tfon4560.0 4788.0 3748.0 open 4692.0 5192.0 ohops abopsThe5556.0 6124.0 leUer6588.0 waBwasprompted 6844.0 waBprompted wasjromptod 2652.0 4196.0 prompted jromptod3915.0 4824.0 5116.0 the5048.0 5384.0 decision 5316.0 6004.0 6204.0 PresldJnl6132.0 PresidentItoosovclt -644.0 6848.0 PresidentRoosevelt 4180.0 ItoosovcltltooQvelt4844.0 the5388.0 Mlllor Milloi5312.0 Ml1or 5792.0 5860.0 case 5796.0 ca 6148.0 5936.0 apo 6256.0 6460.0 wblohwhichtho wblohthe whichthe 4284.0 4300.0 tho4480.0 president presldonl5544.0 Uutthrt5460.0 5908.0 Miller Mlllor5820.0 6388.0 4332.0 6308.0 6608.0 4324.0 IIn16528.0 anyother IIn1other 4192.0 4428.0 4460.0 4636.0 4488.0 5032.0 4471.0 must musl4920.0 bOl5368.0 bo4452.0 discharged dlscharaoddischargedfrom dlscharaodfrom4188.0 4628.0 4556.0 4632.0 thothog 4772.0 808.0 4635.0 woruineut4664.0 g -808.0 5644.0 1192.0 5036.0 i9rnn1nlprlllllus 5704.0 printing 6228.0 6284.0 office omco6676.0 onaccount 6820.0 4640.0 onaccounlof Onaccount 4184.0 4768.0 4800.0 account accounlof -520.0 4704.0 4764.0 4896.0 4848.0 1104.0 4956.0 nonmembership nonmemborsblpnthcmborshlp4820.0 -1104.0 6060.0 6120.0 4792.0 1088.0 6300.0 4812.0 n6236.0 6428.0 union unloD6372.0 unloDDellcT 6784.0 unionDelicIously 6432.0 unionDollcTouBly -352.0 4400.0 4912.0 DelicIously DollcTouBlyDellcT -756.0 ul 4804.0 4960.0 lunaware 5004.0 unaware unawaroof6044.0 4948.0 5984.0 hypocrl hypocUhypocri6240.0 4932.0 hypocrlsy hypocriBy-484.0 5147.0 sy By6 5128.0 ot4668.0 5124.0 the4976.0 world 5452.0 ot5352.0 5672.0 finance Itnance5580.0 honest honoithonoitnnd -428.0 6816.0 hon1 honestnnd 6776.0 tnnd 5272.0 5284.0 4544.0 liumnno Humanohiumano5228.0 5292.0 5088.0 uninformed unlntormeduninformcd5448.0 6500.0 5280.0 woroworenorno 6812.0 woron worenOnio 5420.0 norno nOnio4540.0 4344.0 mo 4256.0 4624.0 of5456.0 4756.0 5148.0 clauses clausos5060.0 5700.0 5444.0 usod5612.0 6068.0 6264.0 describe 6184.0 describetho -548.0 describetiO 4200.0 5627.0 tiO 5620.0 proidntprosl 4856.0 5624.0 5632.0 5184.0 5380.0 t1olong Inngloog5595.0 5912.0 6332.0 6604.0 theopca theo theopen 5768.0 5808.0 opca5812.0 4516.0 5788.0 el1hol1 4272.0 4596.0 ehop committee commltteocommitteeIta commltteoItocommitteeIto-668.0 5656.0 5955.0 Ito Ita4612.0 5948.0 opening 4524.0 5976.0 5132.0 enlng 4684.0 5216.0 5928.0 paragraphs paragrnphscontained contnlncdncontnlncdndefinlto 6740.0 5940.0 ndefinite 6112.0 definite definlto6100.0 disclaimer dlscl31mer4708.0 5536.0 6096.0 nny5660.0 6052.0 wish 5968.0 6656.0 nt6572.0 nttnck 6792.0 attnck attack 6276.0 tnck tack4572.0 4496.0 4864.0 5600.0 the5876.0 6252.0 blame blarao5800.0 6340.0 6244.0 6268.0 6612.0 tliolh36532.0 tliochief lh3chlet thechief 6404.0 chief chletexecutives oxecuthes4536.0 5372.0 6412.0 attltudo attitude5956.0 5884.0 6144.0 the6072.0 6420.0 6408.0 Millar MII1BrMlUar6356.0 Millaraffair MII1Brntrnlr MlUaraffair affair ntrnlr6600.0 being 6584.0 placed 1laced5520.0 5952.0 5776.0 coterie cotorlocoterlo6032.0 6596.0 ofcertain ofcortaln 6764.0 cortaln4728.0 6760.0 wellknown welJmownwolIknoWfl5516.0 6744.0 Interests Interostsintorosts6156.0 taro aronro6552.0 aroconstantly taroconstantly nroconstjintly 6903.0 6924.0 constantly constjintly4952.0 6947.0 4888.0 5160.0 6915.0 guard gUllrd5100.0 6908.0 around 5524.0 6188.0 tIm thotbo6048.0 white whllowhlto6396.0 whllolipiiBo whltohpusQ whitehpuso 7064.0 lipiiBo hpusQhpusoThe7072.0 presldont7100.0 5748.0 6208.0 told 6564.0 U1IIt6456.0 thatho U1IItIro 7224.0 7244.0 Iro4436.0 foil fell4740.0 7252.0 into Jnto4648.0 7256.0 error 5000.0 7268.0 err 5416.0 5360.0 7272.0 5504.0 7236.0 5712.0 7231.0 Illslila7240.0 viow vlow6624.0 thotbothoquestion 6836.0 7228.0 tboQlostlOI1 thequQsttoil 7400.0 7412.0 QlostlOI1quQsttoilbocauo bocauso5540.0 ot5756.0 tbat5668.0 Impetuous Impotuo11i1ImpetuouImpetuousity Impotuo11i1ItyImpetuoufLy-692.0 6800.0 7564.0 7576.0 ity fLy4444.0 7580.0 tor4356.0 7568.0 5196.0 7596.0 we wo5468.0 lovo love5376.0 5828.0 7591.0 you 6348.0 7584.0 copy 6444.0 copycf copytt7728.0 7748.0 cf tt4252.0 7740.0 1016.0 4656.0 communication ccmmunlcatlonccmmunlcation4584.0 7732.0 w1l1be6272.0 forward forwaraforwarded forwardcdforwaraCd-532.0 7780.0 7888.0 cd ed4412.0 7896.0 7900.0 toOrstcr 4620.0 7904.0 Oyster Ojator5072.0 Day flayDayal 5412.0 5628.0 atonco 7924.0 onco 6012.0 7892.0 undordate datodalo6476.0 datoof daloof dateof 8048.0 8068.0 4380.0 8059.0 Llbor4308.0 4860.0 day dnySeptember Beptemboptembor5880.0 8088.0 7Tho 7The 4328.0 8212.0 8232.0 The8228.0 reading rpadlngroadlns4580.0 5432.0 8220.0 ho5636.0 8216.0 before hoforehoforo6636.0 thethofederationmeeting thofederntfon thefcdoratoit 6932.0 8299.0 8355.0 1316.0 federationmeeting federntfon fcdoratoit-1316.0 5508.0 4972.0 8387.0 meeting cetlng4868.0 8384.0 occupied occltpled6296.0 8408.0 6696.0 8392.0 IIn8404.0 anlioUr IIn11Our anhour 8536.0 8560.0 hour lioUr11Ouranti nndnnl14968.0 8551.0 excited cIcltwocitW5548.0 8548.0 applause applausotram6644.0 8539.0 thqtbocrowd 6852.0 tbcrowd 6768.0 thqcrowd 1332.0 crowd 4680.0 ot4588.0 620.0 delegates delegatesNEQRO -620.0 5532.0 delegatesL delegatesNEGRO 8936.0 9036.0 NEGRO NEQRO9052.0 BAPTISTS DAPTISTS4732.0 9048.0 ON ASSAULTS A08AULT3AOBAULTSA08AULT3Resolution ASSAULTSfloaolutlon AOBAULTSiesoiutlon 9364.0 700.0 9376.0 Resolution floaolutloniesoiutlon9379.0 5200.0 9372.0 Philadelphia Convention ConvenUOI1ConventionDenounces 6856.0 ConvenUOI1tenouncca Conventionfl0uflcce 2200.0 9564.0 9584.0 Denounces tenouncca4604.0 9599.0 fl0uflcce 5204.0 By Dy9568.0 Members 6040.0 Race RacRaceLynching 6620.0 RacLynchIng 4360.0 9707.0 9763.0 Lynching 9768.0 4992.0 5396.0 the9756.0 crimes crlntoscritiloswhrchwbl -400.0 9744.0 ui Uluiually 9772.0 Uluolly u uunIty 9795.0 9908.0 9928.0 unIty uallyuollyresult resull5176.0 5056.0 9920.0 mob law 6248.0 9940.0 woro9932.0 woroo woroonouncedtn co do9924.0 conouncod donouncod 4224.0 10072.0 10104.0 nouncod 10096.0 nouncedtn 4828.0 hi tn5020.0 10123.0 5144.0 10088.0 resolution 10076.0 adopted bytllO bytllONatlonat 6876.0 thothoNational theNational 10231.0 10252.0 National Natlonat10248.0 Nbgro NQsroBaptise DaptfstBptt5288.0 5944.0 10236.0 convention 6756.0 in insession Instsalon 4240.0 10404.0 10424.0 session stsalon4816.0 10427.0 III4712.0 10415.0 I1hlladelphlaPhlladoiphin4944.0 Tho6436.0 roiolti feloll1rololil6344.0 10408.0 roioltiU6n feloll1lI rololilIOn 10552.0 10584.0 IOn U6nlI 10612.0 4336.0 10588.0 presented proaontodpre8 5240.0 ntod 4880.0 5328.0 Rev Rov5484.0 10576.0 5824.0 10579.0 6328.0 10568.0 Dart 6196.0 6628.0 ofSouth 6888.0 ofSouth5 4260.0 10723.0 South54716.0 10740.0 Carolina Cl1rolln14660.0 10764.0 Willfollows followlfollow95840.0 followsWhereas followlWherot1S follow9Whoreas 6380.0 4484.0 10884.0 10907.0 Whereas Wherot1SWhoreasmoot z1ost10892.0 thebloodcurd b100dcurd6056.0 bloodcurdling bloodcurdhagb100dcurdlIns 11052.0 11064.0 ling lInshag11059.0 outrages committed IIgalnsthotboiniro 6900.0 11056.0 hopure 11076.0 o1lIro 11208.0 11255.0 pure iniro1lIro11228.0 womanhood 4564.0 5752.0 11248.0 our 5664.0 11220.0 country 6660.0 arid nndnadxmlns:ns6 ID20 9536 2704 4224 11392 ns6:type 4280.0 11392.0 11396.0 whlchlofld lead lend11399.0 5256.0 11404.0 1300.0 5528.0 1Ing 6864.0 11544.0 11560.0 Ing lug4576.0 11583.0 arooro4476.0 11551.0 charged chargod4784.0 mambom6452.0 of11563.0 ourrace 4276.0 11735.0 11747.0 race racelloDolvod raceItoaolvod4552.0 raceno 11879.0 lloDolvod Itoaolvod11888.0 no 4736.0 olved 11904.0 wo wexnaho Ula1o11911.0 11908.0 6116.0 11867.0 11860.0 IIpoclnlpla spoc1nlplaIIpoclnlplaorcjtCUBO -800.0 6916.0 spoc1nlplaor 6648.0 11855.0 ploa -268.0 ploaor 12036.0 12072.0 orcjtCUBO 4404.0 excuse ciccuso12043.0 far12040.0 ouch puch5248.0 criminals crjminals5652.0 crlml -612.0 6368.0 nls at12051.0 curourroco ourrneo currace 12192.0 12236.0 rocorneo12227.0 12212.0 frown upon 5356.0 IIny5760.0 12224.0 OM12195.0 6376.0 U ItIiUguilty -100.0 Itgel1ly Iigi1ty 12359.0 12368.0 guilty gel1lygi1ty12376.0 ot4984.0 tbocrln1o crlnio crinlo12391.0 assault all8auH12384.0 onwoman 6904.0 onwomnn 12511.0 12560.0 woman womnn4876.0 wo4744.0 12531.0 the1012.0 representatives repreaelltatlvesroproseritatives12523.0 ot6672.0 12528.0 tworullllon twomillion 12692.0 rullllon millionpOOPO12695.0 ot5476.0 12687.0 thd5428.0 5732.0 black blatllblabic5596.0 6140.0 12712.0 raco6508.0 dcolro doolrodonirodcolroto doolrotndonirotO12844.0 12852.0 tn12856.0 placo place4940.0 ourselves ourselvel12883.0 record rcld12876.0 6312.0 12868.0 say 12871.0 sayIng saytog 6872.0 12896.0 13003.0 13020.0 tog13047.0 nny5168.0 13016.0 assaults ossaults13008.0 helpless holpQSSholp1es6684.0 13032.0 13167.0 13180.0 manhood le IPIie13184.0 pot5212.0 worthy 5920.0 The6200.0 13172.0 benefits benent6712.0 cflife cfUfo 13324.0 life Ufo111013344.0 should IIhou113348.0 begiven glvon5568.0 13368.0 n13327.0 fair 6504.0 trlnltrlnlRoaolved trialResolved 13491.0 13500.0 Resolved RoaolvedThat Proaident13508.0 I1re ldent ItoosevoltItoosevohtRooseveltIs ItoosevoltIIItoosevohtIs13644.0 II4676.0 13667.0 be13664.0 commended commendQd13655.0 pooplotJr 6168.0 pooplotJrhlB -688.0 6232.0 6732.0 6652.0 forhis forhI 4312.0 13812.0 hlB4500.0 13819.0 fearless loarlossfearioss4424.0 13824.0 stand 13816.0 favor 6576.0 13848.0 oven ovonovenhanded ovonbanded ovenbanded 4316.0 13976.0 13980.0 banded handed4872.0 13983.0 Justice JuallcoIIndtrlllitorall allcriminals 11 -80.0 11criminals -32.0 lcriminals 14135.0 5008.0 14147.0 ntllland4924.0 14152.0 tor14144.0 5496.0 declaration dcclarnllon14172.0 IIatime 6920.0 IItime alimo 14276.0 14304.0 time limo5080.0 passions passlonepasiono14336.0 14308.0 nnd14311.0 pub public 6892.0 publie 14463.0 lic1104548.0 14472.0 Bontlmont sntlmontsontiniont14500.0 wnawns14468.0 uncontrolled uncontrolledTho -816.0 4440.0 14624.0 14632.0 educational edlleatlonnl4700.0 board boarl1860.0 6064.0 headquarter heni1quartonten1quartoriheadquarterwill heni1quartonwllten1quartoriwill-860.0 14791.0 wll14796.0 ho14803.0 removed mQvedrmovedWashington WaalJlngtolVasIingtontoNashville toNashvlllo to1ashviilo 14940.0 Nashville Nashvlllo1ashviilo5024.0 14955.0 during 4928.0 14948.0 ho14960.0 yellryearOEORQ1A yellrGEORGIA yearOSORGIA 15283.0 GEORGIA OEORQ1AOSORGIA5076.0 15288.0 TOWN TQWNWN LOSES Lq61SL9BEO15291.0 HEAVILY HEAVILVHEAVILVfolro HEAVILYFire -680.0 HEAVILYhr0 15599.0 Fire folrohr04688.0 15616.0 Causes CaUIOI5320.0 15611.0 100000 15619.0 Damage 15604.0 lnoir 6616.0 6708.0 Mc MeMeDonough 6896.0 McDonouoh McDonouh 15760.0 15763.0 Donough DonouohDonouhSmall Bmall8maiI15771.0 Insurance hieuranceihauranceInsuranceFlro hieuranceFlro ihauranceFiro 4472.0 15920.0 Flro Firobroke brokoIIrollo5252.0 15932.0 out 5188.0 15952.0 ou 15923.0 5400.0 5728.0 the6008.0 building bulltllng15956.0 occi 6536.0 occi1lod 15959.0 ocr occocr10led occi1od 16076.0 1lod 10ledi1odtilo16096.0 16087.0 116091.0 OreenOroenat6720.0 ntMcDonough atMeflonough 16243.0 McDonough Meflonough16260.0 Oa Ga16256.0 Snnllayafternoon afternoJ1aftornoiafternoonand afternoJ1nndaftornoiand16403.0 16407.0 nnd4644.0 ontlroenUro5408.0 structure structuro16415.0 16439.0 occu OCW16444.0 OCWrlbd occuptod 16564.0 pied rlbdptod16596.0 n16571.0 block 16603.0 5152.0 16579.0 Macon MaronMncon16584.0 16608.0 WIIS16576.0 dedestroyed dostrayed doslroyed 16736.0 strayed stroyedslroyedTho16743.0 16740.0 buildings 6516.0 16748.0 thethorcrir thOredr thercitr 16892.0 rcrir redrrcitr16916.0 also nlo16900.0 deatroroddentroyod5236.0 destroyedTho deatrorodThodentroyodThe17044.0 The4752.0 17059.0 ClrconOreon5208.0 17064.0 6172.0 17056.0 henry Honrv6424.0 HonrvCounty 17068.0 henryCounty 17096.0 om omCountyWeOllly 17208.0 County 1100.0 CountyWeOllly 4760.0 17211.0 Weekly Wcokly17243.0 weroworo17220.0 the17228.0 prlnclpil prlnclpl1principilprlnclpillosers prlnclpl11080rs principillosers 17363.0 losers 1080rs17375.0 Theontlroentlro17387.0 Outfit outnt5996.0 17384.0 otThoTha17392.0 Henry HonryhoaryHenryCounty HonryCounty hoaryCounty 17531.0 17539.0 Weoilly17568.0 wnvna5348.0 17551.0 11estroedThloss VheVheloss 17580.0 17679.0 loss 108817696.0 sustained lIustnlnol1euatained4528.0 17712.0 5264.0 17708.0 the6028.0 17720.0 fl17715.0 Gr Grin OrifIOrifIlCo111pon GrinIqompany 17740.0 onCompany 17852.0 lCo111ponIqompany17891.0 WlIs17867.0 tho5500.0 5576.0 17864.0 heaviest hOlVleatheaviestTbo hOlVleatTbo heaviestTim 18007.0 Tbo Tim18028.0 ontlroentlrolivery Ilycry18031.0 business hnelneulJ11sln 18039.0 at18043.0 33JSmith 6868.0 JEiIUlh 3Eiuith 18180.0 Smith EiIUlhEiuith18192.0 Co Ca4672.0 5364.0 18200.0 located tocated18195.0 111thotbe6512.0 18207.0 Qroou OrolJUOrou6392.0 Qrooubullying OrolJUbllllllnll Oroubruiking 18347.0 bullying bllllllnllbruiking18379.0 wag woeWO 18359.0 110ltrolcddotroyocl18367.0 Fully jnlly18371.0 Jo llIy 6548.0 J10V 101 18376.0 10 18487.0 1000 18508.0 000 18516.0 worth 18535.0 rth 18531.0 property vropertywnsWIIS5804.0 6220.0 18523.0 c1ostroyedestroyedwith c1ostroyeVllt 18672.0 Vllt 18680.0 I03S4464.0 18675.0 10000 10COO10CO018687.0 InsurmceInsuranceWEDDING -636.0 InsurmceWEDDING insuranceWEODINOPLAN 19008.0 WEDDING 1208.0 19011.0 WEODINOPLAN 19020.0 PLAN 952.0 19023.0 UNCHANGED UNCHAI4QEDUNCHANGEDRoacmnn -952.0 6704.0 UNCHANGEDRoumnn UNCHAI4QEDflossman 4268.0 19331.0 Roacmnn Roumnnflossman19348.0 Oayo ScQayc5324.0 19336.0 Dispatcher plpatchcsDipatche19351.0 6316.0 19344.0 the19359.0 Con CmiContrary CO COtrnry Cmitrory 19415.0 19503.0 19508.0 trary trnrytroryWcro WeroVcro5140.0 5564.0 19511.0 Fakes rakcltakceFakesJnmos rakclJl1mo takceJitmo 19655.0 Jnmos Jl1moJitmo19664.0 OURossmari nossmallh1osmni4964.0 moat moalmost19667.0 omphallcnl emphnthnlemphntientomphallcnlly emphnthnlIemphntientI-720.0 19816.0 4368.0 donlos 1I0lle5dotics5268.0 19824.0 there thrrothtro19855.0 wcroworo19860.0 nny19836.0 change ChmtcIiangechangeIn cIiangeInlIn 19975.0 19980.0 hoUl cloctrlo eloetrll1electrict552.0 19988.0 wedding wodlhn20020.0 program progrU1orany 6788.0 20024.0 1rirony 1rnylntertorO1cQ 20035.0 20144.0 20167.0 ony1096.0 nylntertorO1cQ Interference -824.0 intcrr 20176.0 rcnce 20147.0 whatsoever whtsoovor20155.0 thaIhethapart Ihepart thepart 20291.0 20299.0 or20311.0 thebishop blsJlOpbi8hop20316.0 Brooklyn Droollhnflrooklvn20319.0 V6592.0 Yns -92.0 20323.0 4244.0 20471.0 20495.0 ns 88wooWII 4808.0 stated stalOd20475.0 tolejrama toor3mstoeroms20480.0 6176.0 20483.0 thooast thcast 20632.0 oast cast20635.0 TileTue20664.0 prOjnnrlprorariW3scarrlecl20676.0 ex oxexncHy exn oxadHy 20791.0 ncHy adHy20820.0 My 20823.0 20799.0 hallhind20803.0 heenboon5816.0 nnnounce1 RnnounceJannounceixmlns:ns7 ID21 8636 2712 4168 21144 ns7:type 21144.0 LONGSHOREMEN LONG6HOREMEN21163.0 STRIKE 6TRIKE21171.0 AGAIN AGAINTrouble 4236.0 21464.0 Trouble 21479.0 5040.0 21491.0 Orleans 5992.0 21487.0 848.0 laRcsumcd laRcsumcdAfter -848.0 21496.0 Resumed flcsumod-588.0 ResumedAfter flcsumodAfter 21611.0 After Supposed Suppoled21655.0 Settlement SettlementTho 21788.0 commerce commerco4608.0 21803.0 atho21815.0 6324.0 Orl01nOrlo2nsOrleansport Orl01nrort Orlo2nsport 21952.0 21955.0 port rort19Iatied up 4996.0 21964.0 tight 21976.0 thestrike strlllostrko21984.0 nfoftho nftho ofthe 22107.0 the22116.0 longshoremen longahoremon5404.0 22140.0 22172.0 ro roo22167.0 rovivod roovlved 4204.0 22268.0 vivod vlved22283.0 Not 22312.0 II22287.0 ship sblp22292.0 22299.0 loaded loadedA loadedAcontroet loadedAcontract 22444.0 contract AcontroetAcontract4448.0 22447.0 botween5784.0 22459.0 the8hlp22471.0 agents nscnlsagentsnnd nscnlsniid agentsa 22596.0 niid22623.0 dIho 924.0 22608.0 longshoromenlongsbor -924.0 5424.0 22640.0 5340.0 bad had22628.0 boen22631.0 RhInO Rlcnosignelsignelon 22643.0 1on 22763.0 22787.0 Monday 4352.0 last 22807.0 22783.0 hollered bollcvcd1I0Ileedbollcvcdsettled -536.0 1I0Ileedsottlot1 holleredsettled settled sottlot1ho5044.0 ttrlkotrlko22939.0 peaceably 5436.0 956.0 peaceablynnd riud 22975.0 22956.0 id 6580.0 22980.0 pcr perpermanontly 6796.0 pcrmallontly pcrmanontly manontly mallontlymanontlyTho mallontlyThemanontlyTiio23252.0 ThoTiio23255.0 rank rnnle5064.0 nndf1lo 23263.0 file flloot23259.0 thotholongshoro tholongshoromen -920.0 23267.0 longshore longahorolongahoromer23436.0 mernowrcfuso 23423.0 now1r nowr-768.0 fuBa fuso23419.0 abide abldoallido23431.0 the6556.0 23471.0 ccn COlcoiccntrad COltract coitract 23575.0 tract trad4568.0 nnd23607.0 accuse nccuso23595.0 commltte23603.0 6448.0 whoIt whonought 23735.0 nought ought23739.0 thotbosettlement BettleDlont23771.0 atoftreachery attreacbery 23896.0 treachery treacberytreacheryON treacberyON24227.0 CHARGE OHARGE5244.0 24235.0 OF Or1184.0 WHITECAPPINQ WHITECAPPINGWHITECAPpINOWHITECAPPINQFive WHITECAPPINGFiveWHITECAPpINOFive-1184.0 24543.0 Five 24551.0 Prominent Prominont24555.0 Citizens 24567.0 24579.0 Barbour flarbourBarbourCounty flarbourCounty 2312.0 24756.0 An Aa24779.0 Irearc5052.0 Hold 24763.0 Under UooerUrier24775.0 Dond BondBondBefore DondBctofe DondBefore 24935.0 Before Bctofe 4832.0 24939.0 UnltelStates Btlites24952.0 Commissioner CommisslonerCommissionerTutwllor -936.0 Commlss CommisslonerTutwiler 24987.0 nrr nrrTutwiler 4168.0 25119.0 25128.0 Tutwiler TutwllorntTroy i4Eoy25131.0 -20.0 25163.0 oy 25143.0 Ala John Jolan25160.0 GreonOreol1GreonJesse 6752.0 Oreol1Jesso CroonJesse 25216.0 Jesse Jesso25303.0 reenOreonJim 25343.0 Sanders 6224.0 25351.0 Bcauiurt De3uuDoauutBcauiurtMcCall DoauutMcCall 25368.0 ttcCall McCall tcCall25503.0 25499.0 Richard ilichard25508.0 Mann Monn5560.0 25535.0 wcrowero6520.0 25520.0 hell heUhellIn heUIn4176.0 25659.0 500 hOO25663.0 bond boncbOll each 25667.0 880.0 25672.0 whltccapplng hltecappltlgwhitecappiug25807.0 The25843.0 25851.0 aro IIro25831.0 prominent 25839.0 citizens nr25959.0 Harbour 25991.0 cOllnt 5392.0 and26023.0 crooroallowed alleedallo3od26012.0 6716.0 26035.0 26115.0 havohl1ve26132.0 intimidated Intlmltlall11tintimidator4468.0 26179.0 negroes negroenegroennegroesFOURTH 26183.0 negroeFOURTH negroenFOURTH -440.0 26443.0 FOURTH 26463.0 26471.0 ONDrlckmasoni 26475.0 ONDrlckmaaons ONDrickmaons 26743.0 Drlckmasoni DrlckmaaonsDrickmaons26783.0 Refuse 26796.0 Work 5772.0 26831.0 6212.0 26811.0 Ccl Cel26899.0 dlert dlerldiers26923.0 Home 26947.0 26943.0 Johnson JohnloJohnsoa26951.0 City 6320.0 26963.0 27059.0 The27075.0 brick 27095.0 construction cOnBtruction27135.0 27115.0 the27127.0 feV fcr fera 27227.0 ml 27247.0 cr era 4388.0 27232.0 soldiers otdleraL0Idior27255.0 home homo5608.0 27263.0 27283.0 Cltv City6364.0 27375.0 Tcnn Tonn4652.0 27396.0 27419.0 suspended 27411.0 27451.0 n27423.0 27435.0 ct cfef6304.0 27443.0 fto to27475.0 4172.0 27543.0 American Aln 27551.0 rlcan riean852.0 Drlckmosons DrlcllmlllSonsflrickniasons5832.0 27595.0 cuscd27599.0 27607.0 thetlJamlssal dismissal tlJamlssal27727.0 thotbo27751.0 27743.0 27771.0 misons muonamscns27759.0 Crfcralleged CrAliegod 27795.0 rtllegod 27867.0 tllegodAliegod27883.0 lack laek27899.0 otdiligence dlllgonce27907.0 27903.0 thalr27920.0 work 6360.0 28023.0 This1 28031.0 Tbi hI9ls 28035.0 28047.0 28051.0 fourth tourth28059.0 strlloIltthotbo28084.0 sol 01 28135.0 28183.0 dicta diersdlershome 4592.0 home28223.0 nndRnd28219.0 ts28236.0 thothllthogovernment thllKovernment thegovernmefl 28363.0 Kovernmentgovernmeflmay ma talcetahco5744.0 28387.0 steps atetlsstehs28379.0 off 28383.0 etro oftot 28415.0 28400.0 28491.0 Ivoiy IvolrIveiy28527.0 put 28547.0 28535.0 28543.0 28539.0 labor troubles trouhles28643.0 28655.0 boehlcbh1vObrive28699.0 considerably consldcrllb1128716.0 lo 10In992.0 28795.0 Ibe llaec1tho kiyed -604.0 28819.0 tbo28847.0 woflYor 29723.0 -4.0 xmlns:ns8 ID22 9748 6944 1640 ns8:type 7004.0 1364.0 ODDFELLOWS 000FELLOWS8368.0 8748.0 SESSION 8652.0 SESSIONAnnual SESSIONAnn-840.0 9588.0 6980.0 Annual Ann 7440.0 7336.0 7504.0 8300.0 8244.0 Soyerelrjn Soverolan8oVercIn8432.0 9212.0 Grand Grnnd9152.0 GrandLodge 9612.0 GrnndLodoo 7200.0 Lodge Lodoo7688.0 Assembles Aasemblell7592.0 8488.0 8388.0 8700.0 Baltimore DaltlmoroDaItimoro8608.0 BaltimoreAccorded -652.0 9352.0 DaltlmoroAccorded DaItimoroAccorded 7356.0 Accorded 8096.0 Royal 7976.0 8576.0 Welcome WelcomeTho 9188.0 7436.0 7372.0 openln oponln7964.0 8028.0 orerclsca ororclsoaeorcIeoa7872.0 8704.0 2780.0 8648.0 tim8832.0 9172.0 anniil annII1anniii9108.0 anniilconvention 9604.0 annII1convontlon anniiicoflvefltion 6968.0 convontloncoflvefltion7804.0 ot7700.0 8112.0 7928.0 8420.0 tovorclsn oovorolgnvovoroign8312.0 9228.0 grand grnndgrandlodgO 9600.0 grnndlodg grandlodgo 6972.0 lodgO lodg7408.0 ot7324.0 7628.0 Odd 7540.0 Follows 3116.0 9044.0 8952.0 9248.0 nnll flaII9164.0 nnllmoro 9556.0 flaIImore 9348.0 IIIII IIIIImoro moro more7388.0 Monda7308.0 7988.0 7908.0 8192.0 Fords 8676.0 opera 8600.0 9112.0 housa houlhou3housaGrand 9484.0 houlOrand hou3Grand 9404.0 7124.0 Orand7620.0 Master 7528.0 8160.0 Edward 8752.0 llossman IlossmanItoesman8660.0 ot9324.0 ofho ottho Ofho 6984.0 7036.0 7192.0 7248.0 7692.0 lodge 7624.0 ot8032.0 Maryland Mnryl1od8976.0 delivered doUverPd8880.0 deliveredon doUverPdondeliveredan9572.0 an7216.0 address nddress7136.0 7788.0 7716.0 welcome welcornowoicoiflo7912.0 8632.0 8544.0 9080.0 3744.0 8996.0 re raresponded 9540.0 rasponded 9472.0 eepondod sponded epondod7640.0 7512.0 7760.0 8144.0 Governor Ooverner8020.0 8868.0 rm finparmtho fintho pathe 6988.0 the7264.0 7188.0 7600.0 ot7796.0 8528.0 nod8844.0 Mayor 8760.0 9344.0 Ida9260.0 9536.0 IdaLane 1324.0 6976.0 Lano Lanetortar7296.0 7656.0 DaltlmoroflaltimoroBaltimoreGrand DaltlmoroOrand flaltimoroJrnnd 7112.0 OrandJrnnd7612.0 4384.0 Sire SIroSlro7496.0 7980.0 7876.0 JohnD 8412.0 B8508.0 8732.0 Goodwin Oool1IlnCoodwinor9292.0 ofGeorgia 9580.0 orGeorgln 6960.0 Georgia Georglnthen 7460.0 7952.0 made madomnlle7864.0 nn8636.0 nttnraUnr9136.0 nttnrwhich aUnrwhich afterwhich 6956.0 7424.0 tbo7332.0 covcrolgn rverolgnrveroIgn4711.0 8332.0 8888.0 8800.0 lad 9240.0 9096.0 pro proceeded 9548.0 pr prceeded 9468.0 procoodod 6952.0 ceeded coodod7648.0 4875.0 7968.0 F 8484.0 llows 8588.0 temple templotomplo9408.0 hehean 9488.0 csan 6944.0 san gan7028.0 7180.0 Its secret secreldeliberations deUborntioIlsdoliberatiousdeliberationsTho deUborntioIlsThodoliberatiousTho-864.0 7092.0 7404.0 annual 7348.0 report 7844.0 at8564.0 Orand9028.0 SIro Sire8964.0 andCommander andCpmmol1d andCommaildor 5355.0 Commander Cpmmol1dCommaildorChief 7932.0 8092.0 hlof 8340.0 8400.0 8788.0 B8984.0 OoodwlnGoodwinwhich Ooodwlnwhich 7416.0 wos7344.0 read 7660.0 8136.0 show sbow8016.0 ho8816.0 order be9368.0 boin boIn bein 6948.0 5671.0 7148.0 5724.0 nflourishing 7220.0 fiourl blng 7636.0 condition condltlotfconditlodconditionTho 8696.0 condltlotfThe conditlodThe -648.0 7096.0 Thototat7352.0 7820.0 5856.0 membership moinbqrahip7736.0 moinb 8644.0 8360.0 shlp 8916.0 the8848.0 9208.0 ordcc orl1eordoordccWhich orl1eWhich ordowhich 9500.0 Which Includes 8044.0 thoho7956.0 8320.0 suoordlnato sUDordlnatoauoordinato8252.0 iodc9 lodl1iOdt99104.0 iodc9membership lodl1mombershlp iOdt9membership mombershlp8116.0 8552.0 sitters IlIEiterelders8440.0 9088.0 9480.0 cfcftho 9608.0 6964.0 the7284.0 Rebokah RebekahRobokah7172.0 lodgo7860.0 8336.0 9340.0 1320050 13290501329050Tho 7536.0 1320050Tho 1320050The ThetotnltoUt17368.0 7848.0 revenues rovenues8532.0 1002 11026871.0 Were wero11053005 11GIi3005116530058512.0 8904.0 8796.0 3 9288.0 7012.0 893220 032207032.0 weroworoexpended 8572.0 hiiii8504.0 8764.0 relief reliefTho reliefThe 7120.0 Thestreets 7380.0 7944.0 7176.0 hotels hotols8396.0 7184.0 nnd8688.0 lbllo 9092.0 9156.0 resorts resortaresortsworo 9620.0 7204.0 resor resorwero -336.0 9492.0 resortawore 7360.0 worowerofilled 7836.0 fUh7340.0 pooplopeoplo8124.0 8776.0 wearing wcarlng8672.0 9416.0 the9300.0 thoI theI7500.0 7508.0 7152.0 OO7468.0 7680.0 7784.0 7503.0 designs doslgns8356.0 8276.0 8684.0 Mondny8592.0 9272.0 night nlght9196.0 nighttho nlghttho 9616.0 nightthe thethoroughfares thorouhtaretiiorouhfaror8516.0 the8416.0 central centrlllpnrtpartof pnrtot7816.0 7828.0 ot7824.0 the7116.0 7448.0 7792.0 7856.0 ns8000.0 well wollwolllls pubUc9012.0 8944.0 buildingsand bulltlln 9560.0 9460.0 sIInd 7992.0 7995.0 IIndmany mnny7812.0 mercantile mercantllo8640.0 houses 8520.0 8012.0 wore9076.0 werebrilliantly werebrJllnntly worebrilliantly 6992.0 brilliantly brJllnntly7772.0 8152.0 Illuminated J1Iumlnated8147.0 During 9420.0 the9224.0 thoevening 9624.0 theevening 8311.0 evening 8343.0 7756.0 reception rocoptlonrocoption8828.0 tendered tenderodtondored8728.0 9496.0 8328.0 W9396.0 WGrand loGrand oGrand 8475.0 8480.0 SIroSlro7832.0 Ooodwln7744.0 nndGeneral GenorallIaPaHamt 9596.0 lIambY Pamy 8627.0 mt mbY myy commanding 8284.0 thePatriarchs patrlarehMill MmMilltaut 9592.0 Mmtanto Mi Mitaut 8804.0 8808.0 taut tanto7428.0 aranl1Grant7292.0 8812.0 Zlnster9000.0 Rossman ROBsmanTtostman8932.0 Rossmanof ROBsmanotTtostmanof8968.0 ot8972.0 Mnryland7916.0 9004.0 wasmaster 8164.0 of8928.0 cermonlos cermonlo9cermonio98876.0 cermonlosTho cermonlo9Thocermonio9Tho9132.0 rocoptlon8060.0 consisted contlatcdcondatedot8992.0 the8900.0 9284.0 Intro lntroIntroduction lntroductign 9183.0 9296.0 duction ductignotthe7704.0 loading 7996.0 momborsinornbora8568.0 on4andtheir 9636.0 on4their ndtholr tholrfamilies famlllol9467.0 the8128.0 heads hoadlbonds8924.0 9128.0 the9412.0 twobraucbcs 9644.0 twobrauches twobranches branches braucbcsbrauchesot7920.0 9628.0 thoordor order8768.0 9619.0 At 9016.0 tho9304.0 9648.0 same SBmeeamosametlmo SBmetlmo eamotime 7016.0 9780.0 9783.0 tlmo time7384.0 niiconcert 7456.0 9792.0 lit8292.0 tho8224.0 8584.0 9360.0 Mili 11111MiiiMilitant 11111tanl Miiiant 9839.0 7024.0 9952.0 tanttanlheadquarters 7288.0 9976.0 was9956.0 tn9972.0 progroca proarOt1progrotaprogrocaAt proarOt1AlprogrotaAt-556.0 9400.0 7168.0 10099.0 10108.0 Alho7328.0 Initial Inlll1l18176.0 meotlneof meeUnufotrneeting9ot10111.0 thotboPatri Patrl9200.0 Patrlarchs Patriarche 10268.0 10272.0 archs archeMllltllnt10300.0 8196.0 10275.0 roso1ullon8860.0 adopt allopl9184.0 adoptod alloplod10432.0 10439.0 od 7232.0 10436.0 7420.0 permit pormlt7364.0 the8172.0 militant 8756.0 branch IIranchat9204.0 tlO llo9388.0 tlOordor 9656.0 lloorder tlootdor 10591.0 10596.0 ordorotdor10600.0 recruit rocrullrcrult8240.0 he8500.0 10603.0 forces rain8896.0 BIIJ BIIJordinato 811 aut811ordtnato autordinato 10752.0 10755.0 ordinato ordtnato7684.0 lodges lodge3iodgcs10760.0 Therisolutlon10787.0 9308.0 soiutlon willbo 7044.0 10919.0 be10924.0 10928.0 the8148.0 8556.0 sovereign Boverolgngranrt gronrlgranrigranrtlodge gronrllad granrilodgo 11080.0 11083.0 lodgo11112.0 go 11088.0 the11092.0 acceptance accoptanco8780.0 the8712.0 latter lattorlielieIng beIng 11135.0 7048.0 11244.0 7312.0 required requlrcdbeforo8344.0 11252.0 become bccomccbecomeu9192.0 n9328.0 tawxmlns:ns9 ID23 9636 7008 11576 ns9:type 7316.0 11576.0 TAX PAYERS 7632.0 8376.0 RAISE 8304.0 HOWL HOWLThey 7056.0 They 7452.0 Also AlaoGet 8104.0 Out 8036.0 Ou 11899.0 Injunction InJunotion8280.0 9160.0 11896.0 Against AjalnAgnlOllt9084.0 AgnlOlltCollector 9668.0 AgainstCollector tCollector 9664.0 12063.0 Collector Good 8744.0 Reasons ReIIlonReaeorn8656.0 ReasonsTax ReIIlonTax ReaeornTax 12220.0 Tax 7532.0 Colloetor8208.0 C12232.0 8 B08624.0 Wi WII9316.0 Wicox WIIcox Vll Vllcox 7052.0 12379.0 12408.0 cox 12388.0 Go oacia7808.0 notified notltledComptroller ComplrolrComptroliorComptrollerGeneral ComplrolrOenoral ComptroliorGeneral 12536.0 12540.0 OenoralWright 7552.0 12548.0 12552.0 thai8680.0 9020.0 tnx 9392.0 tnxpayers tnxpaers 9524.0 12575.0 cx cxpayers 12704.0 12728.0 payers paersorho7668.0 12716.0 12707.0 enjoined enjoltlelthim himfrom thocollection 8324.0 thetaxes latho9384.0 thocounty thecounty 13028.0 7984.0 13060.0 oar 13040.0 inquiring It9516.0 lie9428.0 homuftt homUl liemust 13196.0 muftt13216.0 mUl 7376.0 7304.0 13251.0 7320.0 proceed 13192.0 colicotioncoll 8820.0 9276.0 13199.0 13187.0 thohothestate thostate hostate 13351.0 state 13356.0 rate rl1toot13360.0 613383.0 per porparlOMi001000Tho lOMTho i00The 7196.0 The7544.0 8308.0 13515.0 hay hallhui8628.0 13520.0 boenoxpocid expecdoxpocdoxpocidsince expecdsince oxpocdsince 7060.0 13692.0 announcemont8708.0 wa 13676.0 8948.0 9528.0 13704.0 uy9444.0 oytho IIthe uythe 13836.0 tho13843.0 cOllnty13840.0 commissioners cbmmlsslQncrsthai9476.0 thltherato 9672.0 thlrnto therate 9640.0 7068.0 13992.0 ratornto7444.0 13995.0 hocount114004.0 tbls14032.0 9424.0 14036.0 WAa wna14156.0 13730 7140.0 14159.0 3736 7516.0 14167.0 7724.0 8348.0 As 14196.0 soon 11ftan9148.0 tho14200.0 rio rornoriowas 9676.0 rowas rnowee 14323.0 14343.0 wee7396.0 14328.0 announced allnounced8180.0 thoro there8616.0 14355.0 8524.0 wasn 9008.0 storm torm14331.0 ofprotests ofprohatstrom 14475.0 protests prohatstrom 8056.0 14480.0 the14492.0 tax 8620.0 14516.0 payorsAdvice AdvlcoAchlco9040.0 Advlcoof AchlcoorAdviceof14636.0 orattorneys nttordb14644.0 attor 14676.0 ys WDR wnflwnrr14656.0 at14680.0 once nnco8428.0 8692.0 Bought noughtsought9440.0 14652.0 onlt9336.0 andan onltan 14808.0 served 14835.0 upcn upon8908.0 14811.0 tlie8840.0 9180.0 14820.0 9380.0 colector 14823.0 cal coJcoJlector calleetor lector leetor14975.0 preventing preontlngproonting8268.0 14984.0 mivdug mrJdugmriiiugmivdugany mrJduganmriiiugany944.0 15127.0 15148.0 15151.0 7208.0 collectionIt 8008.0 undorstoounderstoo47520.0 8448.0 15296.0 tha15300.0 ho9124.0 15308.0 wai waiImposed 15332.0 W1 waW1Impolled waimposer 15443.0 Imposed Impolledimposer15447.0 tor7604.0 7936.0 15452.0 the15484.0 purpose purpoao8140.0 15487.0 purpo 15464.0 n9532.0 nnow anow 15631.0 houoo 7768.0 aCtor15624.0 rhorhe15628.0 pooplopOQplo0otho pf pfthe 0ho 15768.0 thoho15780.0 cOllnty7852.0 15776.0 8156.0 declined 15792.0 Otovnte15788.0 ban bonIsto 15935.0 oo BOsoThlngn ThlnSIJThingn15971.0 arooro8248.0 15947.0 8920.0 be9320.0 9520.0 tovor tover toveT 16119.0 veT vorverheat hcat16131.0 a16099.0 the16116.0 coullty16136.0 16108.0 the8980.0 enor onlronorenormous onlrmous onormou 16175.0 16280.0 mous mou rato rate16263.0 ot16268.0 laxalton axallontnxaiten8784.0 16275.0 woull wou1wotulwoullhavo wou1Ilavo IhaVe haVe havoIlavo16420.0 tp tQtu 7572.0 16424.0 hopaid pllid16427.0 8720.0 assessment nssessment16588.0 cOllntywee wae8792.0 16599.0 nJl01feriallowedto nJl01ferito-500.0 stonllstandComptroller stonllComptrolllr 16895.0 Comptrolllr16907.0 16912.0 Wrlghtwroto 16924.0 wrote CollectrCollectorMcCall CollectrMcCall 17047.0 17071.0 thecould ouldfouldnotapply notnppl 7040.0 17223.0 apply nppl17235.0 7720.0 theBtatostatornto17247.0 fer9312.0 himto hitto begin 17396.0 17424.0 onco17404.0 enforce entorco17407.0 the17416.0 collec collocollotlon 17475.0 17548.0 tlon17559.0 110 Ho7644.0 17563.0 Hint tbatthat8884.0 17571.0 17576.0 opin oplnopinion oplnon 17635.0 ion 17735.0 thoInjunllIoninjuntlonWBl8236.0 nolIIgalnstthethestab 17875.0 stabrato17884.0 bntbat8072.0 17896.0 agtnst agltlstagrinatthecount 17908.0 ratorntlratonnd rntlanl1 rateand 18036.0 nndanl17752.0 the8052.0 18048.0 18055.0 thoho18060.0 stall statostatestatolevy stallIQvy statelovy 1360.0 levy IQvylovy18220.0 wnElviiaImperative ImtfQratlvolmihrativoImperativeIt ImtfQratlvoItlmihrativoIt18355.0 theIntention Intoftlonottho18384.0 Wilcox WllcoxWllcoxcounty Wilcoxcounty 18519.0 18528.0 pllyorscarry enrry18572.0 casocaSItotho tothe thohighest Itlghest7948.0 18700.0 courts COl1tscouits8476.0 18695.0 beforobetorowillsubmit 18835.0 submit 7548.0 18851.0 ho18859.0 payment pament18864.0 18868.0 such 9140.0 blGhhighrato blGhrato highmb mb taxation tRxatlonthe19035.0 ratornloratoat rnloat rateat 19172.0 19175.0 3730 3736373t319180.0 nndnnl17608.0 tholieBtato8204.0 19192.0 rata ratorate19199.0 Ii9144.0 19195.0 IhotheIhop thepeople hopeople 19327.0 olllo 7560.0 residing lie19356.0 ceunlryceuntrydill disdtsdistricts dilltrlct dtsnets 19412.0 19491.0 nets trictstrlct19500.0 110iorequlrod8108.0 19520.0 19540.0 pay 9432.0 19515.0 thothlthoamount thlamount Itoamount amount 7616.0 42JC 42016424019699.0 por19679.0 1GQOwhile wlilowlJllowlilothose wlJllothoso whilethose those thososvhiolived Ihed19831.0 thto8372.0 clllcp cllietlcube19843.0 wnulllwouldhavo wnulllhavo wouldhave 9708.0 7020.0 havelnypyan7960.0 19995.0 addition nlldltlon20007.0 20003.0 tht thatthatamount thtamount owing owln 20152.0 tho8184.0 ratorate9236.0 whtchwhichthey whtchtboy 20304.0 tboy20308.0 Voult1youItihavoundergo ulldergoundergoTho ulldergoTho undergoThe 20463.0 TheWllcox20492.0 rote20487.0 ha attract 8988.0 attracted attracte1attracteti9576.0 ed e1eti7212.0 unusual 7144.0 1152.0 IInusualattentlon 7776.0 20644.0 attention 8364.0 20647.0 20656.0 tho20659.0 atnt Rtntaatntia Rtnta3j 9504.0 tata 20784.0 ia 3j35ii20796.0 therateot9072.0 taxationover j 7008.0 20984.0 Qer20955.0 20960.0 20967.0 imitate 20975.0 stato20935.0 1032.0 9704.0 xmlns:ns10 ID24 2908 2652 6968 21355 ns10:type 21355.0 REV 21359.0 RE 7712.0 21367.0 SAM GAM8AM8288.0 21376.0 GOES 21384.0 FREE FREFREEHis FREHIs FREEHI HI 21675.0 Fight Flaht7160.0 21683.0 8168.0 21695.0 CartersvlfTe CarterlvllTlCartersvifTe21715.0 Postmas Poatml1Po3tmasPostmaster Po3tmastarPoatml1tcr 21768.0 21876.0 tar tertcr21879.0 Aired Alred21895.0 Mayors Mayor21903.0 Court CourtWhen CourtVbon 22059.0 When Vbon22067.0 Arraigned 7524.0 armlgned arrnignod22072.0 mayors JDl1yors22104.0 22099.0 ulittatCartorovlllo ulCartoravillo ittCartoravihlo 6996.0 22211.0 Cartorovlllo CartoravilloCartoravihlo22275.0 Altcrmiu Allorm1IIAliormaitAltcrmiupleaded Allorm1IIplenllot1 Aliormaitpleaded pleaded plenllot122464.0 sullty22476.0 22467.0 thochllrgo22488.0 22491.0 dis dlsdisci dlsc1derly discidorly 22655.0 22679.0 ci dorly c1derlycidorly22663.0 eonduct conduct7464.0 8084.0 22675.0 wblcb9120.0 he22684.0 anti9268.0 andllov andl1ev anti11ev 22824.0 llov l1ev11ev22827.0 Sam 22831.0 Jones 22855.0 wcro weroverochllrged22851.0 ond9216.0 andwas ondWIIB andSwaB 22988.0 23007.0 WIIBSwaBfined finett22991.0 7972.0 23000.0 22995.0 costs costsRov costsnO costsRev 7132.0 23147.0 RovnO 23152.0 JonoaJonos23159.0 entered lnterell8612.0 23187.0 ft na23164.0 plea ploa23171.0 23179.0 notguilty notGul1t 23303.0 Gul1t23307.0 23311.0 brought forw3rdforwhrd23340.0 promi poomlpooml11enl promineat 23395.0 neat nent11enlcltlzencitizona7276.0 23503.0 liS23480.0 witnesses wltnelsolwinosses23499.0 prove 23495.0 bbs bljhlabljctntoraent hlactatemont bbsntntoment 23632.0 ctntoraent ctatemontntntoment7800.0 23647.0 23651.0 thewltneS3esWitnoiics8452.0 23683.0 SWQO swposwpothat 23688.0 SWQOthat swqothat 23791.0 23799.0 thotbo23803.0 evangelist WIIS8352.0 8824.0 ott23823.0 thode dodefensive cl clttcelvo dofCl51VO 23884.0 -12.0 23960.0 fensive ttcelvofCl51VO23967.0 the23972.0 difficulty dlalcultydifilculty23987.0 he24016.0 WMWMdischarged wasdischarged 24019.0 Vadischarged 24124.0 xmlns:ns11 ID25 4680 2732 6904 24487 ns11:type 24487.0 HORSE 24503.0 DEALS 1076.0 24516.0 DESTRUCTION DESTRUCTIONFive -1076.0 24807.0 24827.0 Injured 24835.0 24844.0 Wild 24859.0 Runa Runaway 9512.0 Ru RunawayThree 24915.0 24932.0 24991.0 way 24979.0 wayThroe wayThreeThree May 25003.0 Recover RecoverI RecoverAtpallntln SJallltlpaliatip7260.0 TennMonllll25199.0 run rllnrunaway rllnaWIlY 25231.0 25292.0 25315.0 away aWIlYhorso horse25307.0 attached attacbedattacbetndelivery waon Waon 0on 25479.0 smashed 7840.0 25463.0 through several severa1soveralvehicles vehlclovehtcioqvehiclesseriously vehlcloseriously vehtcioqseriously 25615.0 seriously 25619.0 Injuring 25640.0 five flvo6e8580.0 perrons three tbrpethreefatally tbrpefntllIy 6940.0 25772.0 fatally fntllIyfatallyTbo 25775.0 fntllIyTho fatallyThe 7080.0 25939.0 TboTho25943.0 animal anlmnlvhen25963.0 finally finnll 25975.0 caught caughtwas 26107.0 7472.0 26139.0 nstato orfrenzy trenzyItwas 26143.0 itwas 26267.0 26287.0 26272.0 Whllo Whiio26284.0 hitched 26295.0 thotbo26303.0 horse hcnohCrJohcnobecame hCrJobecamo horsebecame 26431.0 became becamofrightened trlghtonetl26448.0 at8456.0 26480.0 26459.0 toy 26455.0 balloon balloonGRAND 9356.0 blllo 26495.0 IGRAND 26791.0 GRAND JURY AFTER 26827.0 BOOKIES DOOKIES000KIESBOOKIESSurprising DOOKIEStlurprlalng 000KIESOurprlsing Surprising tlurprlalngOurprlsingWave Wav27139.0 Morality Moralfty27156.0 Hits Hit27163.0 Chi 27223.0 1416.0 27331.0 27352.0 cago Law 27339.0 Preservers PreaervcrsPreserversAt PreaervcrsAt27511.0 Chlcllgo27519.0 Fidoy27535.0 Indictments Indictmentsftcro IndictmentscroIndictmentsWero-772.0 6928.0 27719.0 ftcro Werocro returned return8120.0 27724.0 IIgalnslthirty 27735.0 tJ thirtythrce thirtythrceLoojtmakers -748.0 lrtyth 27739.0 thra thraLookroakcrs 27763.0 cclookmakers 27888.0 Lookroakcrs lookmakersLoojtmakers27915.0 dolng 40lng4oingbuelncssbuiiness27959.0 9100.0 27927.0 Jal JI JIcal lecal 9436.0 28107.0 28087.0 28116.0 racotracks trackThechargocbllrgoagalnttngalnu8956.0 28275.0 Wlsmatlo 28271.0 mado28283.0 tho1056.0 tblgenorallaw tblgenorallawratnot -1056.0 28295.0 general lawTalnot lawsltainat 1140.0 Talnot ratnotsltainat28427.0 gambling gambllngambllnSomo Somo Some28579.0 ovldcnco Cvtdcncoovidenco28623.0 WaaWA 28611.0 offered orteredefereIagalnit pIstn1tftgalnlitthotbo28731.0 officials ojflclals28743.0 28751.0 thothoracing 28771.0 racing 8604.0 28792.0 ttnl 28775.0 associations lIssoclatoUII28867.0 28907.0 28887.0 nObill blllq 7652.0 bihI 28931.0 veroVer 28924.0 rtlurnefl 28935.0 tf1lrq Iurq 9032.0 28939.0 osnlQlSt29031.0 tiCm29063.0 m xmlns:ns12 ID26 9732 2752 9728 1672 ns12:type 9752.0 TRIALISPOSTPONED TRIALISPOSTPONEDDelay -2632.0 1048.0 1700.0 TRIALIS POSTPONED POSTPONEDDolay POSTPONEDDelay-1496.0 12380.0 12476.0 9800.0 Delay Dolay10364.0 10296.0 1232.0 ofSovonDays SovonDays11656.0 Grantee Grantci11596.0 Granteeto Granteern12372.0 GrantcirnCase -672.0 12328.0 9960.0 rnrnCase 10168.0 Caso 10668.0 ofi 10856.0 10908.0 10964.0 11144.0 H 11408.0 Tlllman TillmanTIIImanTlllmanLEXINGTON 12096.0 TillmanLEXINGTON TIIImanLEXINGTON 1128.0 LEXINGTON 10956.0 OVERCROWED 10872.0 OVERCROWEDGreat OVERCROWEDI-1416.0 OVERCR OWED 11744.0 OWEDGreat 10608.0 9728.0 Great 10144.0 Throng 10704.0 Gathered 10644.0 11384.0 11312.0 11572.0 Little Llttlo11500.0 12000.0 60uth11932.0 SouthCarolina 60uthCarollnn SouthCaroilna CarollnnCaroilna10548.0 Town 10488.0 10988.0 10936.0 11388.0 Expectation Ixpectotlon11316.0 Expectationof Ixpectotlonor12172.0 10132.0 or10380.0 Witnessing Wltnelslng10264.0 11260.0 Interesting Interoltlno11128.0 InterestingCourt InteroltlnoCourt-728.0 11988.0 1268.0 10864.0 Proceedings ProcedI119sProcedinge10784.0 ProceedingsOn ProcedI119sOnProcedingeOn-812.0 11676.0 9884.0 On 10188.0 recommendation recommendallon10068.0 11424.0 11300.0 11680.0 ho12008.0 graddgral1rt11884.0 graddjury gral1rtJury grandjury 9736.0 jury 10100.0 ot10020.0 10324.0 Loxlngton11100.0 11000.0 11684.0 BS11552.0 11900.0 11764.0 12156.0 amiQUI1amitho QUI1tho andthe the10028.0 bar ot10244.0 10520.0 10444.0 10808.0 town 10724.0 11124.0 10948.0 lYn 10844.0 11200.0 11412.0 11332.0 12196.0 12080.0 thocaso 12400.0 thcnso thcase casocnso10116.0 ot10032.0 10348.0 hoStato vs 11364.0 Jnmca11875.0 H11788.0 12120.0 Till Tillroan 12352.0 Tillman 12348.0 9748.0 roan10024.0 postponed 10340.0 11168.0 Mond3Y11696.0 11820.0 11956.0 12024.0 seven seCcusevendayo 12392.0 sevend seCcudayo 11024.0 dayo dayoIt 10056.0 yo 9816.0 yoIt 9896.0 10004.0 10308.0 unlerstooduniorstootl10208.0 11148.0 tbnt11048.0 11512.0 otat11644.0 time12012.0 tlmot tlmomotion timemotion 9876.0 motion 10396.0 tor10632.0 n10768.0 further turther10712.0 continuance contlnuanco12168.0 12108.0 willho willhn willhii 9760.0 hnhii9964.0 nadopiado10412.0 10332.0 10564.0 10648.0 thoho10484.0 defense 10852.0 1180.0 defonsegrounds defensegrounds11440.0 11584.0 grounds 12116.0 ifritnotstated 12404.0 ifritstated 12360.0 tstated 9764.0 10372.0 U10160.0 10560.0 lasupposed 11460.0 11360.0 11816.0 his11724.0 12144.0 12056.0 12336.0 6719.0 a12248.0 npoint apoint point 10172.0 attnvorot11012.0 tim thotbo10932.0 dcronso11216.0 ne11800.0 12124.0 12044.0 theyworo theywero theyvoie 12412.0 woro werovoieIIfrnJr1afralti10084.0 10664.0 ot10888.0 tno tao10796.0 11180.0 11096.0 juryTho 11464.0 JuryTho juryThu Thu10240.0 10700.0 11060.0 mado10980.0 11480.0 n11628.0 spoclalpecial11556.0 12164.0 prnr priv12084.0 prnrsontmcnt prFi3nhnent 12296.0 privE3fltIflOflt 7392.0 sontmcnt Fi3nhnentE3fltIflOflt7383.0 requesting relltestlngreqteatlng10388.0 11204.0 thot11140.0 11548.0 the11476.0 six 11748.0 12060.0 othcrothermurder othcrmurder murder 7547.0 trials trlalo10744.0 boo10672.0 botalcon taken tallen11340.0 bpfore bpforo11580.0 12068.0 11812.0 fore 11720.0 12148.0 thtthntthtat thntof 12200.0 hitof at7711.0 TJ1Jm1nTiliman9892.0 10528.0 10880.0 orIcr11236.0 11108.0 11020.0 11736.0 Loxlngtnn LoxlngllnLoxingtn11632.0 Loxlngtnncounty Loxlngllncounty Loxingtncounty might xtiight10212.0 10716.0 10984.0 bq be11188.0 burdened burdoncdburden 11796.0 11640.0 11852.0 IheIheexpenso 12416.0 theexpense hoexpense expense expenso10376.0 8039.0 ot10580.0 holding 10500.0 11116.0 wltnesslsThoy 11072.0 11152.0 wltnesslswItneasswitnessesThey wItneassThey 9912.0 Thoyweren6tntconcerned 11760.0 8191.0 nbout11688.0 tho12132.0 theTlllman thoTJ1Iman ito itoTiUman 9776.0 TJ1ImanTiUman10356.0 10292.0 10736.0 because becous11324.0 Rlchlahd fltchlriidnlchll ud 11704.0 11976.0 countymust 1604.0 boar 10524.0 10460.0 oxponso10788.0 expenseSolicitor oxponsoSolicitor Solicitor Thurmond 11380.0 malle11272.0 8715.0 12064.0 effort offoterrllrloffotto errllrltoeffortto12424.0 8852.0 havohnvethoccsocnsoset 11040.0 11452.0 8872.0 lor br11344.0 Thursday Thurad3ThuradaThursdaybut -676.0 Thurad3but Thuradabut9024.0 he10012.0 Dotprevail pr01al1provailprevailAmong 11508.0 pr01al1Among provailAmong 9176.0 Among 10464.0 tlu thothio10400.0 fourteen lawyers 11912.0 RO12176.0 nopoared ROpoared poared 9347.0 10228.0 10512.0 thecao cascaeo10720.0 11004.0 11084.0 -16.0 11156.0 thero therewasa wasn9796.0 n9948.0 congressman 9868.0 excongressman excongrellsmancxcongrcsamanexcongrellsmanformer -1048.0 12228.0 aformer attorney attornoy9695.0 gene 11436.0 rat 11516.0 11832.0 nformal formnrformerformnrcircuit formalcircuit formercircuit 9827.0 circuit 10280.0 9832.0 judge judgojudgeLexington 9836.0 judgoI 9944.0 xlngton10000.0 10023.0 n9992.0 10003.0 11232.0 at11160.0 11428.0 9991.0 normal 11964.0 popula popl111poputiapopulation popl111tlon poputiation 10044.0 9808.0 10152.0 tlonotDOO10155.0 hold heldfully futly10996.0 11492.0 11836.0 thousand 11728.0 thousandpcoplo thousandpeopto thousandpeople pcoplopeoptoNewspaper Nowsp3per10224.0 werovoro11484.0 11944.0 present presott11872.0 presentfrom presotttram 10483.0 tram10176.0 10508.0 aRastar10624.0 artflow11400.0 11336.0 YorkTlllmans YorkTillman YorkTilimans 10676.0 10679.0 Tlllmans TillmanTilimansThird 10992.0 11504.0 Trial TrllliTrialTho 11828.0 TrllliTho TrialThe The10875.0 10204.0 trlaf 10592.0 granted srmtellTlllmnnTiilmnntnn tiletnnthird tilethird 11036.0 11039.0 third hearing honingboaring10124.0 10840.0 11044.0 the10732.0 tormor11768.0 lieutenant 1I0utenant11600.0 lieutenantgovernor 1I0utenantgovernor 11196.0 11235.0 governor 10480.0 10780.0 11203.0 slnco since11520.0 thothQ11804.0 killing lrlllln ht1iin12304.0 ot12140.0 otOL 11368.0 OL 10516.0 xmlns:ns13 ID28 9664 2708 9768 11524 ns13:type 11524.0 11536.0 11532.0 preliminary prellmlnnryprohirninaryhe3rlng11864.0 hearingFebruary he3rlngl February obruary10504.0 11700.0 199864.0 11691.0 10636.0 hp hI11376.0 11715.0 11624.0 11564.0 sqcnlcd tented deniedball baitbailballand baitnnd bailand 11848.0 nndordered ordored10792.0 bo10916.0 confined confinotconfino4thetbocounty 12436.0 tbocOllnty 11996.0 12016.0 cOllnty10320.0 jail 10256.0 JaUat 10540.0 10828.0 Columbia COlumbln11568.0 w11erewhore11444.0 he12272.0 roremained romnlnOll remainod 12183.0 mained mnlnOllmainod10368.0 12180.0 until 10288.0 hJs10940.0 April 11288.0 8Tho 8The 11960.0 12244.0 12340.0 The12344.0 detenso10876.0 claimed elJ mod 11472.0 absence Ibsencoitbscuco12312.0 nfofotwitnesses nfwltn ofwitndssos 12460.0 12504.0 witndssos10452.0 10184.0 sses prevented proventod12499.0 11164.0 12464.0 1ng ready rendYreadyand rendYand 12660.0 12668.0 12663.0 thohotrlJ 10684.0 11104.0 postpone postponeQpostponorrIIntll11780.0 tliothoSeptember thoSoptomber tlioSeptember 12827.0 Soptomber12832.0 term ot11284.0 12836.0 courtTlllmans courtTJllmans courtTiIlmnna 12984.0 12988.0 TJllmansTiIlmnnaIIUegodJll1t ahiegodiliat11668.0 11732.0 12048.0 12996.0 W01waiImpotalolo W01Impooolole waimpomlolo 13140.0 Impotalolo Impooololeimpomlolo13155.0 13152.0 obtain 10756.0 nflur11468.0 11924.0 tr1at12316.0 13148.0 tnInItkhland tnRl inIllebland 13312.0 Itkhland IlleblandRl 10040.0 hland 10468.0 13316.0 11016.0 13319.0 10904.0 Judge JudgoTownsend TowneondTownsonl1Towneondordered Townsonl1ordered Townsendordered 13459.0 13476.0 10384.0 tuat tllattitat13471.0 trlat10912.0 13480.0 ho11256.0 hoard heardhenEti12160.0 Ier12396.0 IerIngton lexington 13527.0 13632.0 13640.0 countyTllmaua countyrUmans countyTillmann 13792.0 Tllmaua rUmansTillmann10680.0 13799.0 attornos13828.0 oroamong 11608.0 12136.0 ong iongthemost 13956.0 Inwyerslawyors13963.0 at11496.0 oftIlo 11716.0 11792.0 tlioIItatetatostateGeorgo IItateeorgo tatoGeorge 9828.0 George Georgoeorgo Croft CroCthaving hnvlng11652.0 14127.0 a12208.0 lawpartner lawparhier lawpartflor 14284.0 14287.0 partner parhierpartflor10392.0 10604.0 TIHman TnlmanTiWman11240.0 IIndanti14296.0 Nelson NelllnNolsnnNelsonbolng Nelllnbolo Nolsnnboinl 14443.0 bolng boinlbolo 10196.0 14448.0 considered conslderell10092.0 cno thoWo14460.0 mostprumfnont mostprumfnol1t mostprumneqt 14595.0 prumfnont prumfnol1tprumneqt14607.0 Inwors11280.0 14612.0 the11824.0 14620.0 state14615.0 ItSoutb 14767.0 SoutbCarolinaNO -552.0 2016.0 15092.0 15104.0 NO 15100.0 11068.0 15095.0 ARKANSAS 11212.0 ARKANSASPeport -828.0 ARr ARKANSASreport 15107.0 MiSAS MiSASreport 15428.0 Peport10656.0 15432.0 Government GovrnmentChemist ChemlChemlet11456.0 15435.0 12092.0 12256.0 Al Alleged Aleoed Alteged 15491.0 15587.0 leoedteged10536.0 10896.0 Somewhat omcwkatMisleading MlslclldlngMeleadlngMisleadingArkansas MlslclldlngArl MeleadlngArkansas 15807.0 Arl 15836.0 10216.0 ansas 15820.0 colton11100incaondoipocKI OJpoclloapaeiIoipocKIly OJpocllIyoapaeiIly16003.0 Iy16008.0 thoso those9936.0 Llttlo Little11120.0 16011.0 Rock noclRoci11032.0 16040.0 v hlch blcnhich11636.0 Ip III11952.0 16016.0 thot1l0thochief t1l0chief 16163.0 10232.0 market 10804.0 16172.0 16167.0 tho16180.0 discredit dlacretllldiscreditthe dlacretllltht-564.0 16327.0 tht16363.0 16331.0 statements 10812.0 16336.0 theInterview IntervlolY12076.0 givenout 16491.0 ntKnoxville16500.0 Inox -632.0 10920.0 lIIo Tenn16503.0 11352.0 Oliarlos QhirJesqharlos12300.0 PMcLano PMcLane 16652.0 16655.0 McLane16684.0 16664.0 16660.0 thotheemploy 16676.0 ftho 16811.0 the10120.0 16816.0 agriculttia1dopnrtment16828.0 orthe12052.0 thoUnited theUnited 16976.0 10352.0 16988.0 16983.0 hasspent 12420.0 haGpent haspent 17135.0 spent Gpent17147.0 studying studln17152.0 12188.0 boll bollweovll bollweevil 9804.0 17296.0 weevillu 111iii10220.0 17308.0 the10824.0 17311.0 producing 17343.0 coun 17367.0 17468.0 try 10532.0 17472.0 southwestMr southwest1Ir-656.0 17627.0 17632.0 1IrMcLono10128.0 17659.0 8lYS11264.0 17664.0 n11432.0 portion 17639.0 12216.0 Ar kansas hns17799.0 17796.0 devastated devnstated17803.0 thotheboll thoboll 17952.0 17955.0 weeviltbathat17963.0 Arltnnaaa ArlmnllArknnbas11740.0 Arltnnaaaand Arknnbasand-616.0 17992.0 snM 18115.0 nMespoclnllyHempstead Hempstcadhlempatcad18131.0 cQqntycgqnty18151.0 pre lIratire12088.0 lIrasonts tiresonts 18271.0 sonts sents18308.0 18279.0 doaolato11916.0 18288.0 Aftel18315.0 12260.0 ahasty 18440.0 hasty 18443.0 thorough thorougb18447.0 Investigation Investlgntlon12324.0 18452.0 Ithas ithaa 18595.0 haa18604.0 established estnbllshed11320.0 18607.0 boyond beyond11224.0 11880.0 18611.0 the18639.0 par paradventure Isr arIsradvonture aradventure 18763.0 adventure advonture18768.0 ot18792.0 doubt doubl10772.0 thaithero11980.0 18800.0 lro18803.0 noboll 10112.0 18927.0 weevils woovllsweovileArllansa8ArlcansnsArkansasFARMER Arllansa8FARMER ArlcansnsFARMER 19251.0 19255.0 FARMER 19260.0 KERR 10572.0 19268.0 GOLDBRICKED QOLDDR1CKEDGOLDBRICKEDSwindlers -1088.0 GOLDBRICKEDSwIndlers QOLDDR1CKEDSwindlers 12472.0 19427.0 Swindlers 19588.0 10440.0 19591.0 3000 19596.0 19628.0 arcareAfterward 19748.0 Afterward 10848.0 19755.0 Prisoners PrIIl0l10rlPrisopars11268.0 PrisonersTwo PrisoparsTwo12468.0 iTwo Two alle 19912.0 confidence confidencocontldenceJ1en 11592.0 11708.0 19944.0 pen19919.0 wilt wli3whowli3aro wiltaro whonra 12364.0 19948.0 9784.0 20051.0 20088.0 nra20064.0 20071.0 havohnoswindled swlndlellswindied11664.0 20079.0 Kerr KorrHerr11972.0 Korra HerraIa 20235.0 20255.0 farmer 9852.0 10420.0 20240.0 East EaBt10968.0 Springfield BprlngOelSpringfielc20243.0 Ohio outof 20392.0 20419.0 worowero20407.0 captured 10832.0 11616.0 20404.0 Monda 12240.0 byfarmers 20443.0 20551.0 farmers tarmers20556.0 niter10284.0 20583.0 n20563.0 fight fighlwltb20571.0 shotguns shotgulIahotgun11604.0 shotgunsTho shotgulITho ahotgunThe12280.0 20715.0 Themon20747.0 gavo gave20723.0 10708.0 20752.0 names 20759.0 aDan20739.0 20735.0 Blake flIaeBlakeof flIaeofDlo Dlof 20879.0 9844.0 Cincinnati Olnclnnatl20891.0 20884.0 CharlosHIggins Hlgglns20899.0 12152.0 ofPlttsburg of1Htsburg ofPlttaburg 21039.0 Plttsburg 1HtsburgPlttaburgxmlns:ns14 ID29 3056 2696 9740 21376 ns14:type 21403.0 21408.0 1FOIl 21484.0 FonFOIlPHILIPPINE PmINE -880.0 SCHOOLS COHOOLSSCHOOLSMew -700.0 21504.0 tC COHOOLSflew 11588.0 21499.0 OOLS OOLSNew Mew Newflew21819.0 Education Educ 21832.0 Measure McaauroMeanureProvides PravldOlPravldOle72oo0 9904.0 22015.0 72000 e72oo010428.0 First Firat10620.0 22028.0 Years Ycar22035.0 Expenses qxpensciExpensesA qxpensciA12204.0 9900.0 22219.0 Manila speclnlspeciaP10556.0 8I1S11172.0 22231.0 Tholnl Tholnloducatlon newnoweducation neweducation 22412.0 22419.0 education oducatlonbill 22427.0 haDbaajust ust 22435.0 bccQmobocmolawIt 22620.0 appropriates 9860.0 thesum oCo72000 tptocover tpcoer 22819.0 22843.0 cover coerthotboexpenses eXllonscsexpansesatthojlrst 22836.0 first yoir yeryoirIt yerIt23019.0 turtJaerprovides 10960.0 ldes 10868.0 thaCIh3 23023.0 hun tunhundred tundrat hundrod 23076.0 drat dreddrodthothl23231.0 best qimllQcd qtiahif1dQI1 11648.0 llo students studentssecuring 23427.0 securing least lesst23439.0 75 11192.0 23463.0 porcent 23460.0 c1cbeachsubject c1cbsubject subject 23623.0 23600.0 nnnuillexamination oumlnaUoaexaminationehall -820.0 12288.0 oumlnaUoaIball examinationshall23747.0 shall ehallIballhavethe23767.0 privilege prhtleoprlviloeotgoing 23779.0 intohe inthe 23919.0 the10052.0 23928.0 23935.0 Stttea23943.0 complete completotheireducation 23931.0 theireducatln 24075.0 24087.0 educatln24099.0 Institutions InatltutloIinstittitioth24095.0 Institutionsby 24131.0 deslrnohd dosinattddosinattdby -704.0 9740.0 24251.0 24256.0 9888.0 24288.0 overuor10180.0 xmlns:ns15 ID30 5076 2724 9680 24759 ns15:type 9688.0 24759.0 24768.0 KRUPP HEIRS DAR BAR11028.0 UNIONS UNIONSLaborers -576.0 UNIONSLaborcrs 9732.0 25096.0 Laborers Laborcrs25107.0 GrcsA GrcaGrcat25111.0 Gun GutQur25103.0 Worka WorkllWorkoMutt MudMustMuttQuit MudQuit MustQuit 1240.0 25259.0 Quit 25268.0 25263.0 Societies Socletlc10952.0 SocietiesA SocletlcA25400.0 25419.0 10064.0 froD25427.0 Hsscn Esso25432.0 rss 25451.0 Germany OormanrGermanycays Oormanr68SGermanysays25579.0 25599.0 cays68STho25583.0 Krupp heirs belrsnra nr3am 25587.0 ruling 25591.0 theten Ulten 12276.0 25735.0 25739.0 ten 25743.0 25748.0 vrorklnpmcn worklnlmenworkinginen11844.0 depend depenl1depending 12308.0 depenl1Ing 25804.0 25895.0 25931.0 IIpon10456.0 25903.0 thornwllhwhitan25912.0 iron Iro1iroa25915.0 hanl haoihanihanlTheir haoi1lelr haniTheir 9724.0 26063.0 Their 1lelrlatest btest26067.0 ukato ukatcukate26076.0 No Xornoromoreun unions unionsall InIonsall 26223.0 ions Ionsall 26227.0 laborers 26231.0 belonging belcngtngbolenging26243.0 11672.0 socie sociaaocesocieties aoceties 26392.0 ties 26399.0 26419.0 mu 10448.0 either quit 26395.0 thcm26411.0 cxpcit expedctxpevtcxpcitto expedtectxpevtIC9720.0 26551.0 26556.0 teICbo9840.0 tlschared26559.0 26595.0 30areIndignant 30Indisnant 9712.0 26688.0 Indignant Indisnant26727.0 26752.0 26723.0 strlko strike11348.0 26755.0 ensue ensuePETER 26707.0 PETER REPORTED KILLED KILLEDUnconfirmed 27440.0 Unconfirmed 27459.0 News 27463.0 912.0 Assassination 27467.0 Aacl -912.0 lnlltion 11528.0 27472.0 ofServian ofServlan 27636.0 Servian Servlan27648.0 Ruler Rulcr27659.0 Gent GClntSentBroadcast BroadcatDroadcatBroadcastIt BroadcatItDroadcatIt27815.0 10036.0 27847.0 reported 27871.0 11184.0 Bourse Dourseflouree27851.0 InParis lParis 9700.0 28011.0 Paris 28019.0 10692.0 King lng Peter Ser Sec11992.0 Servla 12284.0 Secvia 28015.0 Ivia 9696.0 28207.0 via vla28211.0 liedbecnassassinated assasenatodassassinatedTho assasenatodThe-832.0 28255.0 aBSas nated natedTho 28368.0 The28403.0 rumor unconfirmed bulbutServian Servlanbonds 10192.0 quickly fell fcUcne 28591.0 cno11928.0 28571.0 fran trantraniC franQ 9692.0 70 iCQ 9880.0 centimes Thin ThoThQ28719.0 foreign forei8nofficooflico11868.0 ii3SIias28767.0 noIntimation 28799.0 28855.0 Intimation 28883.0 regarding regarllingtherumored rt1morcdrLmoredrt1morcdaulBlUon rLmoredeaeslaatlon afisslaatlon 29015.0 fisslaatlon aulBlUoneaeslaatlon29035.0 of10688.0 the29051.0 lung29055.0 ServlServiaServlII ServiaSS 11856.0 29459.0 29799.0 SS xmlns:ns16 ID31 22752 2736 12512 1596 ns16:type 12556.0 1084.0 frHHHll 12628.0 + -1012.0 12776.0 JHll 12788.0 13272.0 Hi 13223.0 13668.0 I1111 13672.0 13972.0 13820.0 14072.0 14020.0 14180.0 HHHH HHHHCream 14936.0 14760.0 14859.0 14856.0 14972.0 15088.0 15056.0 12544.0 12620.0 -28.0 12648.0 Cream Crea 13376.0 13352.0 13756.0 NewsJ -1000.0 NewsH 1004.0 Newsj 14872.0 15172.0 15060.0 TBrief 12616.0 12744.0 12848.0 12924.0 13168.0 13475.0 13472.0 13528.0 13680.0 13856.0 13964.0 foH 14228.0 14239.0 14383.0 HT4 HT4BrIef 14768.0 12564.0 Brief Summary 13080.0 14352.0 oiMost MostImportant MostIm Important Im -1084.0 13996.0 13340.0 ortant 13176.0 14112.0 Events Eventsof 1328.0 Each Eoch13367.0 14084.0 13987.0 DayA 14496.0 12824.0 13012.0 reign 12932.0 13432.0 13652.0 terror 14116.0 111Bald 81ldnaid14660.0 3412.0 14576.0 exist oxltt14787.0 oxlttIn existIn15180.0 oxl oxlIn 12740.0 the12664.0 westcrn12944.0 13604.0 Boctlonsoction13536.0 of14344.0 Worth Warth14272.0 14840.0 cowi14764.0 15144.0 cowity 15152.0 ty 12780.0 Oeorgla12584.0 13464.0 13284.0 3751.0 the13600.0 13932.0 lnst13879.0 14248.0 flvotivo14535.0 14912.0 mou14844.0 mouhayo menharo menhayo hayo haroboenbeenmurdered murlltredmtirdercdand13948.0 14347.0 14256.0 14704.0 3932.0 ono one14628.0 onol 15016.0 ar or15147.0 orrost arrosthas 15155.0 rest rostrosthas 12808.0 13092.0 made13904.0 consequence 14095.0 consequenceMcDonough 15003.0 consequencetcDonough 4275.0 tcDonough13768.0 Ga Oa13612.0 hBd13940.0 n14736.0 10POO1Oi000100000flro 15108.0 1Oi000firo flro tlrofiroSundny12768.0 aftornoon13336.0 14244.0 Tho14056.0 14584.0 tyazo llazo14504.0 14668.0 Iazo 14928.0 15008.0 beboaon 15160.0 bolIon 15196.0 lIon aongan12860.0 nt12783.0 13068.0 4616.0 13204.0 oclock 13132.0 13732.0 onl1anti14048.0 14300.0 notchoc1led 14588.0 notchoc1ledntll 15188.0 checked cheehcodcheckeduntil cheehcoduntil 4748.0 ntll12948.0 whole 13568.0 whaler -392.0 4755.0 wholqbusiness buslne3814684.0 blocks blocltblocksvero blocltv blockscrovero ero crodestroyedColumbus 12840.0 Columbus 13628.0 0a 13488.0 13736.0 a13800.0 haa has5115.0 lut14440.0 14880.0 14780.0 beengranted beengrantel1 grantel113160.0 thu13056.0 13456.0 JhroughIbrough14092.0 line IInlIIn 14428.0 orBloopers leoper1nlooperl14556.0 Bloopersfrom nlooperlfrom 14720.0 leoper1trom tromWnBhlnktonWnahiinjton13740.0 whlcb14571.0 14484.0 14751.0 so14967.0 rolong solong 15111.0 olong 12928.0 besought b0SUghtbos -592.0 13228.0 ught 13136.0 theSouthern SouthornSou 14160.0 thorn 14592.0 railway railwaySouth 15084.0 Cnrollnnstatostata13896.0 14412.0 officers 14316.0 14980.0 arp 14884.0 arppuzzled arpruzzled puzzled ruzzled13116.0 lover tovor13048.0 13460.0 5972.0 what wbal14008.0 14131.0 14508.0 14400.0 14744.0 Saludn SalullaSaluuiaSaludncounty Salullaounty Saluuiacounty ountyThg 13004.0 13504.0 6136.0 sheriff sherltstands stonds13928.0 accused accusod14419.0 Ifof14992.0 cfmurder ofmurder 15096.0 Ifmurder 12567.0 bulrefuses 14052.0 13951.0 14268.0 surrender alUrrenderaurrender15000.0 hisoffice hisofilco 6480.0 ofilco12972.0 6472.0 thQ13096.0 coroner 13364.0 14000.0 thestnte14964.0 linv14892.0 lawforbids linvIrblds lawfcrblds forbids Irbldsfcrblds13144.0 thegovernors 14264.0 removing rcmovlng14988.0 thothefhorlff 15191.0 thorherfff thesheriff 1440.0 6783.0 6795.0 fhorlff rherfffsheriff13064.0 tor12992.0 ally13256.0 cause cBuseciiusecBuseAt ciiuseAtcauseAt7000.0 6991.0 Frankfort Franllrort13908.0 Bundaythrnotb110thrnonegroes tb110Degroes threenegroes 7187.0 Degroesmndonuide13636.0 13532.0 daring 13712.0 escapo cscapotram14804.0 fromull tramjllI fromjuil jllI juilull Ono One13588.0 7319.0 thorn13484.0 split lIpllthplit14424.0 7307.0 thio14724.0 jailors jollorsjullorsjailorshead jollorsltead jullorsbend 7488.0 lteadbend13304.0 7515.0 n13232.0 bottle 13384.0 and14220.0 tIloTie14136.0 14491.0 thrcothroo14908.0 thvnthllnthvnrondo thllnrondo thenmade rondo maden12916.0 successful succe3fuldash dllsh13808.0 7635.0 14512.0 liberty libertyIn 13288.0 attempt nttempt13212.0 14088.0 escape oacnpoe3capo14016.0 tramthothp14904.0 thoouth thpauth theouh outh authouhCarollnn12956.0 penitentiary 14464.0 14679.0 convict convictGrant 8179.0 Grant McNeil wnswaa13984.0 Preatrfn Pre3t6nProat6nPreatrfnJtfforscn Pre3t6nJcrtorscn Proat6ncfferson 12576.0 Jtfforscn Jcrtorscncffersonn13428.0 trusty whITwlia14212.0 doubtless 14499.0 doubtlessbo 8507.0 pardonod pardoned12732.0 13408.0 consequenceAt consequencet12872.0 12980.0 8703.0 13088.0 tbonegro 13772.0 Baptist Doptlst13720.0 876.0 conference eonterencolneonterencolnDoston -876.0 15072.0 InBoston inhioston Boston DostonhiostonDr Booker Dooker14068.0 presldenl13944.0 tholle14895.0 thoArkansas lleArkansas theArkansas 12588.0 13276.0 DaptlstI3aptlst13208.0 ocllcge ocflogo13748.0 14604.0 14920.0 mao racorMeracothat rMethat maothat 12600.0 9168.0 13547.0 thing 13888.0 14728.0 14952.0 wasto 12596.0 9359.0 12796.0 Imitate Imltatoimitaohowhltowhllo14436.0 14756.0 Imbibe ImblblImbibecome Imblblwme imbibesome 9543.0 come wmesomeot9511.0 blshii13124.0 13444.0 9508.0 13380.0 ontcrprlv onterprlentcrprhontcrprlvChicago 14812.0 onterprlChicago entcrprhChicago orIaborsends senl19sendsPresident senl19President 12603.0 9871.0 Roosovelt09859.0 lellertak talctaking takIng talcing exceptions oxceptlons12792.0 13752.0 altitude atutudoattltudo10048.0 opoopotopenstops opostops opotstops stops 12964.0 demonstrated asdemonstrntcd10187.0 tho14416.0 MlI1erMillercase MlI1ercose cose12888.0 10559.0 Posses Possa13648.0 Montana 13544.0 aropursuing purlilnlfpurMllflrfpursuingKid purMllflrfKid15200.0 purlilnlfIld 10699.0 Kid IldCurry 12900.0 13608.0 thetrain 14356.0 robber whoescaped whoecllpod ecllpodtrom13108.0 13580.0 Knoxville KnoxvllloTennTonn14800.0 jllll14643.0 jailSultan 15012.0 jllllBultlln Sultan Bultllnot13292.0 Turkey Turke13492.0 expresses exprossos14023.0 14784.0 rogrot regrtmograt14715.0 rogrotat regrtatmogratat12608.0 11223.0 12819.0 the13112.0 atrocities ntrocltles13024.0 perpetrated perpetrnteG13727.0 14900.0 ItJditidItJdIroops itidtroops 15052.0 boroops troops roopsIroops13084.0 13403.0 promises promlocs13308.0 14064.0 tbotbeRussian Husslan14956.0 11419.0 14868.0 ambasmdor 15140.0 amb18rl1l1or 12612.0 basmdor b18rl1l1or13592.0 hey13511.0 13936.0 13864.0 be14452.0 repeat rep01tmepot14672.0 repeated rep01ttdmepoted15164.0 tdBulgarians ofDulgarlansboVhowever boVocr howover 15120.0 11923.0 ever ocrovercontinues continuesLord 13280.0 Balfour DallourDalfourat13764.0 14120.0 Burlclgh DurlelghBurleigh14816.0 sflcro Recrosecrosflcrotnry Recrotory secroamy tory tnry12652.0 12283.0 amy Scotland 13868.0 nndrthur14732.0 12239.0 Elliottfnandnl Elliottrnanclnl ElliottIlnancial 12403.0 fnandnl rnanclnlIlnancialIccretar13156.0 thotrclsur14432.0 treasuryhave trclsurhllvo 15080.0 12580.0 hllvorC3lgnotlreaignotl12904.0 13684.0 Tho14288.0 accopt14560.0 acceptedtho acceptedlao1d 1dtloe 1068.0 lao thotloerrslgnatlonsresignationsTho rrslgnatlonsThoresignationsThe12884.0 12935.0 The12927.0 Linares LlnoresLinaros13691.0 14488.0 Mexico 19Isdead 19dood dood13087.0 commercially commerctaUycommercrahiy12892.0 13123.0 13860.0 ynl yolynllow yollow 13111.0 ye yelow low fever tever13320.0 There Thera14224.0 OVC11tIVOtwohundred tIVOhundred 13420.0 13452.0 cases 13128.0 13784.0 LlnllreLinareaLinaresTho LlnllreTho LinareaTim 12880.0 13616.0 13620.0 Tim1008.0 longshoremens longsboremensstrlkoBtrlke15064.0 it14888.0 ntBrunswick itBrunswick tDrunswlck Brunswick Drunswlck13787.0 da OaGa13295.0 hns13920.0 14292.0 15124.0 13804.0 naclose ncoso acioso close cosociosoThoarbitrators award nward14184.0 ot14 14cents 14ccnta 14108.0 cents ccnta14140.0 12936.0 13220.0 pleases 14128.0 14563.0 sides anJantiandall anJnil antinil nil all12828.0 hands hando12760.0 14299.0 nre14279.0 worleagain agnlnagainTho agnlnThe againTue ThoTueat13396.0 Mnconfears tearsfearswero tearswero fearsworo wero woro14627.0 entertained reached roacbodSavannah iavannahSavannahsafely iavannahsafely 14788.0 safely The13560.0 passengers pl1ssengersteU14275.0 harharrowing barrowing 14843.0 rowing 13104.0 expediences oxperhbcesoxperitibces13044.0 13924.0 14404.0 thestormIn 15156.0 theAlabama senate sensto13968.0 nmotionwas 15315.0 mache15323.0 15320.0 rescind the14104.0 resotutlonresolutiongiving resotutlonelvlng 15472.0 giving elvlng13576.0 Ih13788.0 Id13900.0 nplace14976.0 instatuary Instntuary 15640.0 statuary stntuaryhall hail15643.0 Tho14520.0 OS ruled ruleltruletruledout ruleltoul ruletout 15803.0 oulotorl er 13264.0 14192.0 bo15812.0 14340.0 15032.0 upaaln upaLnln upanin 15964.0 aaln aLnlnanin15967.0 15996.0 purpoe15979.0 14080.0 14455.0 1mown14388.0 knownTho 1mownTho 16160.0 13240.0 NewOrloanslongshorem03nlongshoremanlongshoremenhavo longshorem03nhnvelongshoremanhave-904.0 16319.0 havohnve16351.0 gone gono16356.0 another anotbereti stlsts7e 14580.0 eTheynow 16512.0 claim 16488.0 thnt13619.0 leaders betrayed botrayalbetrayedthem botrayalthem betrayeditem 15136.0 16647.0 itemsigning Ufotlfoconfract14616.0 hotholumbermen tholumbormen hoiumbormen lumbermen lumbormeniumbormenlumbermenBooker lumbormenDookor iumbormenBooker 17007.0 Dookor13436.0 17020.0 mndoonanmIadmldioss 15132.0 mIdless addsess 17171.0 dioss dlessdsesstho17176.0 delogatos17179.0 colored coloreclcoloredBaptist coloreclDnptlst coloredhiaptist Dnptlsthiaptistconferenco17352.0 17348.0 Inwhjch Inwhich inwhich 17500.0 whjch17504.0 he17507.0 17536.0 111 17512.0 14324.0 the17519.0 problems problemsihead problemstlhead problemstiead 17668.0 ihead tlheadtiead17671.0 wout12960.0 beho13448.0 17676.0 13700.0 find employment employmentfor employmentor17823.0 12636.0 the17855.0 13052.0 negroDetective negroDotectlve 18019.0 Detective DotectlveThomas Hutchens JIutcheP9hiutchene14100.0 15075.0 rtitEvansvlllo ItEvansville rtEvansville Evansville Evansvlllo13388.0 18188.0 Ind mdfatatlyatnliywounds ChlsfChlt14740.0 Chlsfof ChltotChiefof18344.0 18352.0 ot12812.0 Police PollcoHouke HeukohleukeantI and14059.0 Captain CaptainBronnccko CaptaInl1ronnceko CaptaInl3ronnccko 18504.0 Bronnccko l1ronncekol3ronnccko18511.0 Injures 14396.0 Councilman CouncilmanLutz CouncilmanIutzCouncilmanhutsLutz IutzhutsHutchonshiutchtonsthan14164.0 commlttodsul Bul14848.0 sulcldo Bulcldo suldde 18827.0 cldo dde19032.0 Frosts Illinois Missouri Miasquri14040.0 Mln Mlni Mlnlesotn Mm 19219.0 1csota lesotnesota19204.0 ondantiWisconsin Thumlay14028.0 nightUnited 19388.0 Stato3 StntoaMinister Mlnlsler19407.0 Pow Powell POWQIIPOWQIIsends Powellsends 15068.0 llsends 15244.0 19495.0 19552.0 19567.0 13583.0 19559.0 protest San Domingo DOlrlnilDomingogovernment DOlrlnilcoernmenl 19564.0 19723.0 coernmenl13412.0 agndnstagwnstlie14252.0 19731.0 project 19740.0 ot19767.0 0otabllshlng 15020.0 19763.0 Jr Jrtabllshing 15116.0 19880.0 tabllshlng tObllshlngtabllshing19892.0 neutrality neutralltetDominican Dominicantsaters 20044.0 waters aterstsaters13000.0 making mnldng20056.0 corbincortainports fri3 rrn14792.0 fri3Mrs rrnMrs fr frMrs Mrs 20247.0 13776.0 Griffin Orlffin20252.0 charSJd20372.0 20399.0 theher husband husblnd11113Iun3bcn14772.0 beencarried 15219.0 Icarrled 15240.0 carrledbacll20580.0 Eatonton 20591.0 Oawhore14599.0 whoreshe wheresho whereshe 20727.0 she sho20732.0 bearraigned arralgnollarralgncUPutnan Ptitnan20767.0 supo1 suposupo1rlor 15236.0 20776.0 GUpe 15212.0 IrJor Inor 20887.0 nor rlorrJor12800.0 courtJudge courtJudgo 21183.0 Judgo21188.0 21195.0 D21191.0 Estes 14280.0 21200.0 Jio 21203.0 Las Lns21227.0 won wonfame Wonfamo 21339.0 fame famo12940.0 21347.0 21352.0 Oeorglasoldier Boldler21364.0 jurist jurhcJurl1t14368.0 14916.0 21371.0 anllandlegislator anlllegIslator andlegIslator legislator 13252.0 21511.0 died 13164.0 13572.0 21519.0 early 03rly13516.0 21523.0 Wednesday Wednetd1Wedneiday21560.0 morn DarnmornIng morntog DarnIng 21663.0 tog12752.0 13036.0 21668.0 21680.0 homef1Gnlnesvllto Onlnesvlli4GalneavilieGnlnesvlltoPostal Onlnesvlli4l1ostal GalneaviliePostal 21867.0 Postal l1ostalInspector 21883.0 Erwin Erwln21888.0 Indicted Inellcte1Indictedby Inellcte1by15128.0 thefederal Cederal22047.0 22052.0 Washing 22195.0 chllrgedconspiracy cOlIsplracy022224.0 dodefraud detraud dofraud 22280.0 22356.0 fraud traud22359.0 22380.0 soornmont22375.0 hon bonararrested orrosted orroated 22523.0 rested rostedroated22527.0 lit22532.0 SonFrancisco FranciscoTho FranciscoThe22716.0 The22719.0 Al3bnma22723.0 leglslatnre legisintare13724.0 Wednoa WAdneaWedneaWednoaday WAdneaday Wedneaday 22880.0 pasted pasredpastod22912.0 13744.0 22892.0 paying p3lng22907.0 allomepattorneypallomeptor attorneypfor12524.0 23039.0 tor12816.0 fighting 23051.0 thefranchise frnnchlSo13624.0 23059.0 suits Bullsfiled 111ellmcii23064.0 filedby mciiby 23095.0 Iby 15216.0 23199.0 23203.0 tbo23235.0 ngro23211.0 Giles OllesCuesGilesTho OllesTbo CuesThe 12804.0 ThoTbo23407.0 frequent treQuent23443.0 escapes otprisoners 1Jonerspthoncrsprisonersfrom pthoncrsfrom1Jonersfront 12520.0 23563.0 fronthoNorth 23580.0 Carollnn23588.0 penltentlarj14236.0 12516.0 23723.0 haveled 13372.0 thebelief tbat23755.0 IIrlsonN6prisonershavo IIrlsonN6havo prisonershave 12512.0 have23923.0 13328.0 glv giv23903.0 aid ald23916.0 Investlga InvlstlgninvestigaInvestlgatlon 23899.0 IUon 15208.0 ILion 24043.0 24051.0 Lion tlonUon24055.0 progress 1428.0 xmlns:ns17 ID33 4820 2720 12456 24359 ns17:type 24359.0 24387.0 14444.0 hog bog24371.0 MrsLoulso MrsLouIse MrsLouise 12508.0 LouIse Loulso24511.0 Tldeman Tideman24523.0 Pcnsacob PensacollPensacola24535.0 Fla F1aFlakilled 15039.0 F1akilled 24671.0 ayoung girl 13540.0 24687.0 the24692.0 daughter daugntcrdaugnteratofWilliam atWl ofilhiam Wl 12656.0 llam ilhiam12684.0 Douglass Iuglnasnear ncsr24851.0 neighbor neighborSix neighborSlx14931.0 25035.0 Six Slxmasked mnskCtl25063.0 25047.0 rob the14568.0 25055.0 flank HankofDouglasvllle ofDo ofDouglasrlhie Douglasvllle Douglasrlhie25204.0 Do 12764.0 glaBV1IIe 13439.0 Oklahoma Oklahum1Oklahomi25248.0 ovelover512500.0 15000 25363.0 5000 5000A 15000A25555.0 25564.0 girls industrial Industrla1homeborne13inboestablished bocstsbllshec1 15044.0 ocstabllshed 12492.0 25716.0 cstsbllshec1cstabllshed13468.0 25728.0 Thornasvlllc ThomnavllleThomasvllle13416.0 Oa25760.0 site sltasltahas sitehas sl slhas 25883.0 25887.0 donated 25899.0 thotbopUrpQ8purposeProat purposeFrost Frost ProatPr 26120.0 taKansas XansasNebraska Nehraska26152.0 nndnndIowa andIown andIowa 26279.0 Iowa Iownhs26299.0 great gre3tdamage damagodllmngo26316.0 thethocorn thecorn 12488.0 corn cropGek cropGoge 26627.0 Gek Oege Goge26663.0 26647.0 aJldDarancas 26651.0 Barancas larancas14476.0 Coby CosbyCobyof CosbyofCeb Cebof 12484.0 Alabom126803.0 serving 26815.0 terms Atlantafederal 26819.0 Uantl 26835.0 tederalprison 26995.0 peonage 13688.0 14408.0 26979.0 hao hl 26983.0 beenpardoned 27015.0 oni pardoned ard 27124.0 ned brtbepresidentA 27191.0 27320.0 27323.0 orintense Intensoforce torco27355.0 swept 27379.0 27387.0 the27484.0 Jersey 12688.0 Jerse 27495.0 coast cosst13760.0 doing doingconsiderable 27639.0 considerable 27655.0 damsgo27671.0 Atlantic 27675.0 Cityand 27803.0 12772.0 27807.0 ether tthersther27839.0 summer resortsSir 27823.0 27999.0 Sir 28008.0 12952.0 Lipton UptonLptonsuffering suffrthgsufferingwith lua suffrthgwith 28167.0 28171.0 appendicitis IIppendlcltls28195.0 Physi rhslIhyslPhysicians rhslclans Ihyslcian 28259.0 28324.0 clans cianscian28335.0 hope operation opctatlon28371.0 opel 13852.0 aUon 28356.0 wlUwilinoL DOL14836.0 benecessary benecessnr 28515.0 necessary necessnrnecessnrTbo necessaryTho iTbo 28691.0 ThoBritish Drltlshtrill 14596.0 give glvogiroglvocotton girocotlon givecotton cotlon12976.0 28863.0 growing 11128871.0 thobo28875.0 DrlttstI3rltisii28880.0 WestIndies West1ndlo IIndlea 12456.0 29019.0 Indies Indlea1ndloits 1t8utmost utinosttmo 29039.0 eupport supportxmlns:ns18 ID34 11648 2680 15327 1516 ns18:type 15536.0 1564.0 RACES nACIG16088.0 WILL 16024.0 16556.0 BE 16484.0 flEA 16752.0 16908.0 16980.0 FEATURE FEA1URIFEATUREDirectors 17691.0 FEA1URIDlrcctoro 17644.0 15344.0 Directors Dlrcctoro15988.0 15928.0 16171.0 16732.0 Fair pair16668.0 Secure Securo3ccuroMany ManyNovel 17936.0 Novel 16456.0 Attraction Attractlon3Attractions16379.0 AttractionTho -744.0 17200.0 Attractlon3The AttractionsThe17132.0 15468.0 Thodirectors dlrcctorsdlrcctora15720.0 16428.0 OX16368.0 16632.0 tho16560.0 Bouthern16836.0 Intostate 17832.0 Intostata stata15740.0 15644.0 16063.0 16284.0 be16184.0 16528.0 held 16899.0 16800.0 17128.0 AJlantnAtanta17028.0 17672.0 iar 17624.0 iarbUllY 17860.0 17724.0 aroarobusy arebusy busy bUllY15724.0 getting goUlngeverytljlng 16387.0 overyt 17192.0 ovorytiin3jln 16896.0 16996.0 ln3 17411.0 lnfiptJP fiptJPshape 17932.0 17547.0 ipt 17616.0 pIJP 17776.0 pIJPshopo 17815.0 ip ipshapo shape shoposhapo15808.0 Cor15700.0 15991.0 16408.0 2868.0 event ovit16304.0 eV 16760.0 1t 16548.0 16891.0 iVhljh Vrhlch tvbihWill vtilullf 17788.0 bs be17704.0 bshold bhold 17856.0 behold 15676.0 October 15596.0 16404.0 16320.0 16675.0 4By 16728.0 4Dy 413y 15471.0 Dy13y15756.0 tLlO16060.0 tlmotlme16343.0 16572.0 16492.0 16744.0 tljotlo17060.0 openlna17583.0 dv dtv17768.0 dvthero dtvthere vthere thero15731.0 15668.0 16044.0 be15968.0 nothing notblngleft leltundono undone17048.0 nndnlldnndthiage nlldthlge andthIngs thIngs thiagethlge15811.0 wfll wniwfil15744.0 16120.0 move 16531.0 16459.0 16747.0 smoothly smo thly 17004.0 os17652.0 17564.0 10011Y10011YJII1VO mayhave yliavo liavoJII1VOthe15908.0 16279.0 past pll16192.0 soveralyearsH yearsII17528.0 17256.0 el1rs el1rsII HKolloy Iol1oyICailoy15543.0 16112.0 16396.0 Kcrr IcrrICcmr16708.0 17164.0 17488.0 knownhorso knownhorse horse15684.0 16104.0 4035.0 havoh1voalready alreadorrived16944.0 tbotho17660.0 tbocity thocity thecity 15572.0 A16148.0 carload corlolld16700.0 16616.0 running 17496.0 horsi harsshorsiwhich hors horswhich 17784.0 harsswhich 4376.0 15784.0 15712.0 16080.0 ho16288.0 16224.0 usodln 16639.0 16755.0 16872.0 17024.0 races 17492.0 duringtho duringthe duringho4492.0 thoho15608.0 talr15540.0 16019.0 Additional 16768.0 4515.0 horses 16692.0 wII17187.0 comefrom com comtram 17848.0 tram15716.0 Sprlngflod SprlngnedSpringiledU1Ifl16372.0 16788.0 Henderson lIendorsoJHendersonKy lIendorsoJIyhendersonICyIyICySome Bome15524.0 16052.0 16324.0 16248.0 16376.0 16520.0 finest 4840.0 horws hOrE3Short3317456.0 17444.0 JhoIhoJhocountry Ihocountry thecountry 5027.0 15832.0 16196.0 16135.0 16412.0 seen 16544.0 16764.0 16984.0 the17248.0 4995.0 track tra 17511.0 kafirl kafirlsomo andsome somo15748.0 5191.0 15659.0 the15880.0 16271.0 rllC0316536.0 ever16971.0 17432.0 bold heldhold17344.0 Intnmtho 17923.0 Intho tnthe thesoutH soutnsoutll16027.0 15955.0 bo16552.0 witnessedTho witnessedTheThe5512.0 JalrAsnoclatlon AsnoclatlenAenociation16935.0 16868.0 palng17040.0 17604.0 csp cspclal cspclol cspcliii 17828.0 clolcliii15556.0 16312.0 the16783.0 17284.0 thie17608.0 your 1ellryourand 17900.0 1ellrnnd 5844.0 nnd15664.0 15560.0 15888.0 16524.0 hiorso16952.0 5835.0 racosraceshero racosthero racesthere hero therothere15736.0 6000.0 be16124.0 6031.0 16188.0 somo80me16656.0 ot16848.0 the17124.0 moatdaringautomobile daringutomobllo 6164.0 automobile utomobllo16516.0 evor16448.0 16855.0 Let LotLetters 17892.0 Lottori 17851.0 ttors ters torstori6336.0 havo15576.0 16055.0 6315.0 received 16348.0 17212.0 17292.0 8ecrctav SecretavSecretni8ecrctavFrank SecretavFr3nk SecretniFrank Fr3nkWoldon Wol 16176.0 16084.0 trom16827.0 Barney 16724.0 Dnrne 17300.0 17395.0 Oldflell OldnellOldfleil17215.0 Oldflelltho OldnellthoOldfleilho15388.0 6663.0 15532.0 champion racer 17172.0 17804.0 ofAmerica fAmerlcn America Amerlcn16012.0 16228.0 16132.0 hestates 16852.0 17323.0 boboIs heIs heis 6959.0 15911.0 15856.0 16036.0 few tow16711.0 stunts stuntestun handling bandllng17295.0 handlingono bandllngonohandlingoneone15632.0 ottho15816.0 7143.0 big IIIggasoline gasollnomachines 16940.0 HItIs HIs Itis 15520.0 15864.0 tbtlt16199.0 16620.0 Oldflolds OldnoldsOldiloldsmacblneround machinesround macblneround n15708.0 15983.0 curve curvo15883.0 thoy theysometimes somotlmeselide eltdo61u10eltdoforty 61u10fort elideforty forty fort feet feetTho 17807.0 TheFisher Flsber15728.0 7787.0 Automobile 16235.0 17136.0 17732.0 the17648.0 thoFord thoPord theFord Ford PordMotor MolorCar Cor16127.0 16863.0 havohnve17272.0 7940.0 nlconoti notlnott17532.0 notlfied 17887.0 nottfled 8100.0 fied fled8132.0 15564.0 Weldon 16960.0 17596.0 17516.0 behand 15695.0 16168.0 take takotnke16719.0 pnrl16644.0 8279.0 16992.0 17259.0 the17184.0 racoj roceJTACO317460.0 racojTho roceJTho TACO3The Thecontests 15580.0 16384.0 16212.0 8444.0 thenin 1111mitninchinos 1111chines mitchines chines chinos15828.0 15752.0 16360.0 16292.0 16796.0 be17012.0 n17159.0 groat 17084.0 draw drnwdrawing drnwIng drawtog 8759.0 8779.0 togcard nndwilt1176.0 aUraclthousonds thousands 8791.0 optoplo oploplo ofpop1o 8943.0 ptoplo ploplopop1o8955.0 Exposition xposltlonltxpoaltion15940.0 16772.0 park pnrk16696.0 parkThe pnrkTho 15551.0 9107.0 Tho15875.0 Plko I1lkoPiko15800.0 16315.0 boenboonofficially olflcialiy16904.0 dies eiIOScitesdiesCn citesoneiIOSon 9259.0 Cn11815488.0 9271.0 thoname namo16672.0 thomidway mldwant17655.0 thefair thetalr 9435.0 talr15764.0 Th3t15568.0 place amusement ofnmusementwillno longer longorbo15972.0 16683.0 17052.0 9587.0 Vanity Ylinlty17555.0 Fo1lr17480.0 FairThis 17840.0 Fo1lrThl9 This Thl9fall taUtail9751.0 the15944.0 pleasure ploasureseekers seokcrsVIIIwillspeak 17727.0 VIIIspeak speak 15892.0 down Ilown9915.0 Plkp PilcpI1l1t 17619.0 lh3tIhat17336.0 Thatname lh3tnamo Ihatname 18004.0 10079.0 namo15772.0 wlU wili15688.0 ho16000.0 16704.0 16920.0 tho16832.0 17204.0 eomlncSt 17680.0 StLoula StLou StLouia 10243.0 Loula LouiaLou 15592.0 Worlds 16423.0 Folr16307.0 16844.0 and17195.0 17076.0 Atlant117328.0 Atlantacannot Atlant1cannot 10395.0 cannot 15852.0 afford be16432.0 second thodlrcc d1recdrccdlrcctors 17907.0 d1rectors drcctore 15348.0 tors toreattho15767.0 havohaodecided dcclded17464.0 Initiate InltlatoInitiatetho Inltlatothe initiatethetho15620.0 unique unlquounlQtlotitle titleChief 16400.0 titleChlot Chlot15900.0 15824.0 R It16048.0 Joyner JornerToynor16264.0 tho17079.0 17447.0 Atlantt AlInntAtianti17359.0 Atlanttflro AtiantifiroAlInntflro 10951.0 firodeparlment16495.0 trip north norlhnorlhto northtohto attend attenllnational naUonal16999.0 concntlon17812.0 offlro offiro firo flro15652.0 chiefs chletschiofsecured mIIlYattractions attractionsfor attractionstOltOltbetalromong16144.0 16808.0 the17107.0 Impor ImIJlrimiorImIJlrtant imiortent 11712.0 tant tentbeingthotef16592.0 monkey monkoymonlloy17760.0 asisconds IIcends 17824.0 asconda 11876.0 conds cendsconda15704.0 tbo15916.0 cutting hlmsolf hlmsJUhimso117356.0 hlmsolfloose himso1loose loose 10080IInddescending descondlng16880.0 nparachute pnraehuteparachuteafter pnraehuteaneranerreaching roaching16392.0 16539.0 height 12207.0 hc ght 16688.0 17035.0 12215.0 ot17251.0 tent feet17560.0 tentOther tentOtbor feetOther Other OtborIncluding 16480.0 Dlavalo fliaraloDlavalotbo fliaralothethefamous tamous15548.0 loop thespoclalls speclallsfspocia1is17104.0 spoclallswho spocia1iswhospeclallsfwho 15692.0 performed pertormed15600.0 16440.0 16636.0 12700.0 Atl1ntn12724.0 somosarno17636.0 tlmotlmoago 17920.0 timeago ago 12859.0 wllh16252.0 Foropaugh Forep3ugh17151.0 circus circus1 17684.0 17915.0 beInterestfng13023.0 features featureaxmlns:ns19 ID35 10836 2672 15276 13356 ns19:type ACTION 15924.0 YET VET16968.0 TAKEN TAKENMatters TAKENMa Matters Ma ter 15896.0 Regard 16004.0 13699.0 AffaIrs AffatraAffalrln16716.0 TurkeyIn 17912.0 13863.0 QuIescent QuleecentQulucentState StatStateTho Statl1bo StateThe Thol1boBtatedoputmentroreceIved rocalved ceived calvedn15872.0 cablegram 16204.0 16927.0 17364.0 MlnlstJfMinisterLolschman MlnlstJfLelschmln MinisterLoischinan Lolschman LelschmlnLoischinan14387.0 Constantinople Constantlnopcbll17483.0 butnothing bllnothing vasOllt16884.0 regardlns16824.0 Ilcxexcept cxcopt cept copttImlriformil Irttormtlliflformalstatement statoment17820.0 Itcontained itcontained alarming IIlarmlng14911.0 news 17339.0 17572.0 wasIn wasin 15036.0 15448.0 15043.0 concerning concernlnsroutine bud bti1budness 17871.0 bI bti1fleas Iness 15224.0 ness fleasWithdrawals Wlthdrawnls15207.0 ot16611.0 tbotho17276.0 AmorlcamAmorlcatlli17143.0 Amorlcamsquadron 17943.0 Amorlcatllisqlllldron Americansquadron 15359.0 squadron sqlllldron15367.0 15371.0 Beirut Dolruthloirut15400.0 old oildlid hasnot 15531.0 yet 16207.0 determined detrmincd15567.0 pnpaIInd17148.0 17540.0 17756.0 Intentlon intention 15687.0 tention tentlonhilsrecolvedtrlmfromOyotor trlmOoter fromOyator Oyotor OoterOyatorBay Day16068.0 16340.0 15868.0 15859.0 thepreslrIents17544.0 IntenintciIntentions Intotlons intcitions 17792.0 tions tlons16020.0 thematter maUermatterCommunications 16624.0 maUerComlI1unlcationo matterCommunlcattono Communications ComlI1unlcationoCommunlcattono16187.0 haveroach 17452.0 17716.0 thQthestato thQstate 15324.0 stato16344.0 16580.0 urging tbls16383.0 17876.0 16388.0 governmeat 16508.0 16515.0 ment meatcay 15976.0 16535.0 ay16600.0 something 16523.0 tbat17280.0 wll wilwllput wilput 1I 1Iput stop sLop16072.0 16679.0 the17140.0 TurlwyTurkeyit TurlwyIt16831.0 15416.0 sold saJdsaid15919.0 16332.0 pressure pressurodocs doeltdoo16856.0 16875.0 ema emilemanate 17868.0 emilnato 16995.0 17000.0 nate natotroln17003.0 thomissionary mlsslofaryhiAttho hitho Atthe 17156.0 thesta6depllrtmentomciais17196.0 uncommunicative uncommunlcatlvo uncommunicativo 17232.0 communicative communlcatlvocommunicativo17360.0 nsas17340.0 17331.0 the17092.0 feeling withwhich tho17487.0 allegedatrocltlcs 17495.0 17244.0 TurkoyTurkeyare Turkoylire15316.0 17647.0 lireviewed vlowed17656.0 thohe16276.0 pooplb people16567.0 theUni Unl17552.0 Unlted Unitori 17808.0 ted tori17811.0 15515.0 tbeyreports roportsreportsfrom Ifrom 17948.0 17967.0 17975.0 Turkoy17980.0 17984.0 17995.0 thoho17168.0 deeds dallv dailydallvperpetrated dallvperpotrated dailyperpetrated 18136.0 perpotrated18144.0 18148.0 sections Goctlonsneetlona18156.0 lint18171.0 countycountryaro countynrecountryare18300.0 18320.0 aronre15584.0 sllch18303.0 character chnrncter18327.0 17231.0 shock shoclc18323.0 civ clv17600.0 civilization clvIIIzatlon civlliaation 18455.0 ilization IIIzatlonlliaation15936.0 18472.0 18479.0 necessarily aro18491.0 atdeep deopdeepconcern deopconcern 18636.0 18648.0 concern the18651.0 StatesAdvices StatesAdvlces 18783.0 Advices Advlces18795.0 18812.0 Sofia So 18839.0 16860.0 18815.0 bat18820.0 theunfavorable 18824.0 theuDlavorablo 15312.0 18944.0 unfavorable uDlavorablo18964.0 replies 18979.0 Austria 18988.0 ardanianiRusslll andRussia Russia Russlll19128.0 Bulgarias DulgarlaDBulgarlao19140.0 19148.0 note nato17380.0 19155.0 nnd19152.0 tho19271.0 fact tact19275.0 19312.0 none nono19292.0 19295.0 tho19339.0 pow powers powera 19439.0 19464.0 ers15507.0 19451.0 replied 19468.0 coupled 17312.0 19471.0 wllh19476.0 thothoallegations 19479.0 Ih theallegations allegations nllegatlons19615.0 19647.0 01116364.0 ota17699.0 3encouraging aencOllraglng 17843.0 3oncotraging 15304.0 19772.0 encouraging encOllraglngoncotraging19780.0 tho19784.0 military mllitory19807.0 party 1tYlldlz YIdlz15796.0 19936.0 Kiosk 19956.0 tend 19968.0 create crento19983.0 lens len20068.0 hopeful 20100.0 20111.0 thenCtbere20120.0 20135.0 hoy hoyover hoever 17748.0 20272.0 over20287.0 perceptible perceptlblochango change17420.0 20296.0 thosit situation sitlIation sitnatIon 20416.0 natIon uationlIation20431.0 Various Vllrlous20451.0 aro20460.0 circa circu20519.0 lation laUon20600.0 negotlatfons negoUaHonsnegotiatfong20619.0 15299.0 20755.0 20779.0 Ilutlon 20764.0 Bulgaria Dulgarln20771.0 looking 20815.0 20904.0 lution lutlon20916.0 20919.0 the16216.0 20928.0 Macedonian MacedonldifilcultydifficultyA difilcultyA17640.0 15504.0 21323.0 15680.0 VANDERBILT VANEERBILTQUOTATION QUOTATIONCoal -888.0 Coal 21643.0 Miner Suggests SUggcats16840.0 Combine WItI1WithOwners WItI1Owner withOwners 21847.0 Owners Owner21859.0 Gouge 21871.0 Public PublicJames IJames Mooney Mooncy22084.0 ncoal miner 22087.0 antiIIamember Imember 15284.0 member attho22255.0 attbotboUnited Mine Workers 22511.0 sug augsuggested auggested 22508.0 Igested 22635.0 gested 22667.0 15904.0 22647.0 speech speochconrerencoconferencewith Ilb 15440.0 15623.0 22839.0 operators 16240.0 22848.0 Kan8817016.0 22863.0 22871.0 17663.0 thp thJthpcoal thJcoal thcoal 15280.0 23032.0 miners anll23047.0 tbothomine mlno17043.0 23083.0 owners 23103.0 17508.0 combine coblno coin coinbino 17835.0 23132.0 1400.0 23220.0 bine blnobino15847.0 Increaso Increase23240.0 thoprice at17303.0 sothat the23455.0 make mako23492.0 ngood goodprofit 15276.0 23615.0 profit 23627.0 16328.0 17400.0 23667.0 receive recehrecoivoreceivehigh recehhigh recoivohigh wages regardless olwbal17763.0 Itmight Itmlgbl imight 24007.0 mlgbl24027.0 cosl24011.0 the24031.0 coalconsuming coalconsumlngxmlns:ns20 ID36 5324 2664 15208 24355 ns20:type 15407.0 24355.0 24440.0 JUDGE 15960.0 24459.0 FRRANK FRRA 24472.0 GARY ARicHOBEN ARicHOBENTo 24484.0 CHOSEN CHOSENTo 15268.0 To 24771.0 Preside Prcalde24783.0 Curing24791.0 24803.0 917264.0 TiltTiltmln TIllman 24999.0 mlnCaroitnaCarolinaJudge CarolinaJudgo CaroitnaJudge Judgo25183.0 DGary OaryAbbeville AbbcvUlAbbevilleS AbbcvUlS16436.0 25379.0 appointed 25403.0 presldo presidepresldoever 25383.0 25407.0 presideCYer 15260.0 CYerthotbo25571.0 IAlxlngtonatVhlcb 17408.0 15255.0 a25719.0 nii25723.0 TilInianTlImanwll1 16220.0 botried 17100.0 MOriUay MOnilay17032.0 niJntor 25763.0 25880.0 thoLaaasalislnatlonat25907.0 25919.0 G OGonzales Gonza1es15399.0 26044.0 26079.0 caso case26071.0 TillmanTillinanwlll26083.0 be26103.0 it26208.0 tliotIlO26219.0 firslcalled 26235.0 Theroare26263.0 600500witnesses 500WitnosEe 26375.0 wltneslesWitnosEewitnessesTHE WitnosEeTHE 1156.0 UNCONQUERED UNCO -1156.0 26847.0 RED 26855.0 MOROS MOROBMOROSAttack 26859.0 27131.0 Attack 27151.0 Detachment DetaehlllertDetachmert27168.0 27175.0 TwentyEighth TwentyElghthTwentyEighh27303.0 Infantry 928.0 InfantryOne InfantryOn016472.0 27347.0 Killed KilledA 27491.0 Adetarh Adetarht11ent 27547.0 detach detachment detachmeat 27611.0 15232.0 27699.0 27707.0 meat mentt11entthe948.0 Twentyeighth TwentyelghthTwentyeightlafantr infantryembarked 15227.0 27891.0 embarked boats bont527923.0 badsharp 27979.0 engagement 27983.0 enGagement engagernent gagement gagernent28128.0 15860.0 TOro Toros28139.0 roll Lake 28131.0 Lanao Ianao28179.0 Inonthe Inthe 10th instant 28307.0 16296.0 28319.0 band hand28343.0 fan fantlcal fan4 famsfan4tical famsteal 28483.0 teal tlcaltical28495.0 Moros Mores28499.0 durlDg28523.0 Private PrJvotoO28651.0 E Baructt BarAcitBar 28667.0 cttwl1s 28672.0 Jellied killedIdliedJelliedOn killedOn IdliedOat 15360.0 28811.0 28815.0 Oat 28843.0 t28823.0 ciUQe3dera 28839.0 eaders 16932.0 thoenemy 28899.0 aprlcct apret apriect 28975.0 prlcct pretpriect28987.0 singlehanded vlnglohandedattacked 29059.0 IIaload ahQa OOlt 29143.0 29147.0 load 29151.0 IQa hQaQfpf15396.0 Eoldlers soidier8soldl 29187.0 29171.0 HO 16156.0 110118 29196.0 wea29179.0 hilled kl11edkilledkilledC killedg29391.0 29587.0 xmlns:ns21 ID37 11604 3028 18023 ns21:type 18076.0 TORRENT TORRENTOF19424.0 19903.0 BUND BlUODB10DBUNDi BlUODIBlUODt20719.0 BUNDFlowed 20716.0 B10Drioied 19456.0 18712.0 18100.0 Flowed rioied18424.0 18728.0 18856.0 18460.0 19132.0 Appalling AppIIingButch Butchery 20631.0 ButchS 20639.0 18092.0 18292.0 ery cry18103.0 18692.0 18571.0 Inlown 18840.0 18900.0 19376.0 988.0 Kastoria olKastoria19659.0 olKastoriaREPORTS -988.0 19716.0 KastoriaREPORTS -736.0 3148.0 REPORTS 19088.0 18975.0 19556.0 CONFIRMED CONFIRMEDLatest CONFIRMEDLatcat20711.0 Latest Latcat18615.0 Dispatches DIpatches18499.0 19443.0 Stated 19332.0 19872.0 20248.0 TownWas 20703.0 TownWa Wa18588.0 Burning BurnlnoTen ourningTenTen 19579.0 Thousand ThoUlnndpeo peepeoplo 20544.0 peeplo 18512.0 4155.0 plo 18787.0 Fall Fail19039.0 18959.0 18872.0 19116.0 Bloody DloodyDloodySword 19800.0 DloodySwordg -948.0 4160.0 Sword SwordI 20083.0 ord 19955.0 ordI 19083.0 ofIurcs 19216.0 ofIurcsSofia 19276.0 Turks urka4416.0 20559.0 g20595.0 18280.0 20683.0 JiSofia JSoO1 18216.0 SoO1DillgnrJa18540.0 Soptember20124.0 18 20055.0 18Fur 20251.0 18Furthor 20667.0 20439.0 Fur Furthor 4980.0 thor 18400.0 reportsfrpm roportsfrpm19248.0 18931.0 frlm 18808.0 19299.0 Kastoriasay Itastorlasny1Caator1aiy20207.0 20143.0 20464.0 20412.0 cityIs 5164.0 18275.0 5180.0 burning 18887.0 19224.0 19119.0 19584.0 the19496.0 massacre CltofotIta CltItG ofita Ita ItGpopulntlonopulation18252.0 estimated etlmotod19003.0 19844.0 havohnve20387.0 num nUlunutu20332.0 numbered 20672.0 nUluttred nutuhered 5431.0 20655.0 bered ttredhered18543.0 18432.0 19036.0 persons porionspersonaW0919532.0 Indescrib IndescrlblndoscrlbIndescribably Indescrlbabty lndoscrlbably ably abtyterrible terrlblotorriblo19108.0 rho18928.0 19448.0 Turlls19932.0 slaughtered slaughtero1slaughterol19852.0 slaughteredIndiscriminately -776.0 20708.0 slaughtero1Indiscriminately slaughterolindiscrimlnately 5867.0 Indiscriminately indiscrimlnatelyDulgorll1ns19160.0 anllanti20192.0 andGreeks anllOreells antiGreeks Greeks Oreells18527.0 women 18916.0 19595.0 6036.0 19507.0 19908.0 children childrenTho 20448.0 childrenThe 18211.0 TheTurcsTurCa18476.0 burned liurnodhiurned18939.0 6195.0 eighteen olghtoouelghteon19460.0 20168.0 cblldro120099.0 childrento cblldro1to20696.0 child 6227.0 ea eato 18272.0 doatb18632.0 18836.0 19056.0 baking 18984.0 ovon19504.0 19972.0 19891.0 PIsollir jsmHrittPisUtrittPisUtrnear 20660.0 20171.0 PIsollirnear 20271.0 jsmHrnear 18480.0 Armonsko Armensko18368.0 19640.0 SoptemberSoptombor19523.0 12 20356.0 12They 12J 6724.0 18412.0 18139.0 18496.0 massacred mas641crcd200 19188.0 20116.0 chill chilcbll20348.0 cblldren chilldren dren 18364.0 Jcrvan JervanJcrvnn19067.0 19316.0 rovcngofor rovengeforrovcngoor19252.0 20163.0 20300.0 dofcot dOfotdefotdofcotat dOfotadefotat18203.0 18283.0 tim18576.0 19163.0 19240.0 the19528.0 Insurgents Insurgenlsinsugona7023.0 InsurgentsFifty InsurgenlsFUly insugonaFifty Fifty FUly18656.0 7199.0 nndchldron1cbUd 19963.0 19888.0 return toturnioturn20112.0 returning toturning ioturnlug 7351.0 lug18391.0 starved 19000.0 Itomftom18880.0 19432.0 19307.0 19484.0 19764.0 mountains mountalnstotheir devnstatedhomes 19208.0 wcrowero19752.0 mur mum20224.0 mumdomed dered domed18427.0 Between Detween20179.0 Septem Septoni20080.0 SeptemborSeptoniber7743.0 ber bor18383.0 18628.0 18524.0 18972.0 Beptemher19788.0 t219684.0 tbotho20336.0 BashI DasblBashIBazouks DasblDazouks BashiBazottks Bazouks DazouksBazottks18715.0 18624.0 dostroYedtour 19352.0 villages viliagcsnov novKrUEhovo ne noneKruEhevo 20564.0 noS 18023.0 KrUEhovo KruEhevoICruehovotbopresence prescncopresenoothoho20104.0 kit kltlknl20384.0 kitnakan kltlmakan knlnakan nakan makan18748.0 admlnltrator ndmlnltrotoradminitmatorotKrushevo KrushovoKrushevoraassacrelng Jtrus Krushovomassacroing 20351.0 20400.0 1evn 1evnmassacrelngl1nd raassacrelng massacrelngl1ndmassacroingmutilating mutlIotingthe20307.0 Inhab InhainhahInhabitants 20675.0 InhallInts inhahitants itants llIntsitantsA 18448.0 18128.0 llIntsA 21007.0 18404.0 Turkish 18319.0 19031.0 8879.0 20148.0 reporter roportoreportedreportertc reportedC20691.0 21048.0 Ite 21051.0 18084.0 tc tehnve9031.0 18568.0 8een19324.0 hovering tboho20156.0 lastthreO 20467.0 20700.0 lastthree ttrethreOdays day18419.0 18831.0 19435.0 the20052.0 Bulgarian Dulgllrl1BulgaritiBulgarianfrontier BulgaritifrontIer 21043.0 IIItrontl frontier trontltbotho18823.0 vicinity 19103.0 vlclnlt 19692.0 at19952.0 Haakovo JIaBkovohhaskovoHaakovoA JIaBkovoAhhaskovoA20523.0 sovcro sovoro18828.0 fishtlighthnB19568.0 occurred occurrOd20232.0 9499.0 Uli UbUla20364.0 Ulivltza Ubvltzaln Ulavitsa vltza vitsavltzaln 18396.0 18668.0 18784.0 19096.0 18992.0 19896.0 19783.0 Kratovo IratovohCratovoKratovobetween hCratovobetween 9856.0 bolween18740.0 9848.0 2000 19052.0 19548.0 20008.0 800 Insu Insir20215.0 Insirgcnts Insugenls insugoats 20592.0 goats gcntsgenls18640.0 continued contlnuodtoreight bOtmhonrahourTho bOtmTho honraTho hisursentsInaurgont518332.0 uaoduOQdbombs bombs 19939.0 10140.0 dealldeadly deallIyIy10351.0 effect orrcctAbout Abolll10360.0 hunl1rei1Turksore Turksare10319.0 Tur 20628.0 8aro 10459.0 ore aroareported reported19028.0 19227.0 have19147.0 19623.0 19536.0 20011.0 ll1liodIcillod19924.0 anl ant20376.0 anlmany 20680.0 antmSbywero mSbywero 18436.0 werowounded TheInauigelltoInsurgentshad InauigelltoI10836.0 18311.0 18643.0 19072.0 woundeilwoundedA woundeilI19636.0 2832.0 11008.0 18324.0 reportdto 19864.0 20076.0 hovett20459.0 liken ttken 20572.0 20652.0 11027.0 10983.0 Iken ken placoRupel RupalRupol18952.0 19492.0 Paso I1I1S019404.0 ne3r19803.0 SOres SdrcjSdro3Sdrcjtthero Sdro3hero SOreswhero 11331.0 ttherowhero11323.0 Insurgent 19320.0 11311.0 bands 19808.0 recently recenUy19700.0 sur surrounded 11355.0 rounded 18676.0 annihilated annlbllatedwhqlo wholo19867.0 11495.0 cant20328.0 company compony cantpany 11627.0 11683.0 pany pony18484.0 11659.0 et18707.0 18612.0 11639.0 The19100.0 del 20368.0 delto tietieto 20608.0 ttt 11808.0 11823.0 tt tho18164.0 thomountolns thomountolnsDulgarllMoblllzlng mountainsBulgaria mountainsDuigariaMObiIIZIflg 11987.0 12004.0 DulgarllMoblllzlng DuigariaMObiIIZIflg19075.0 Mobilizing Troops TrcQpsTroopsAdvices TroopsAdvlees TrcQpsAdvices 12151.0 12171.0 Advlees18980.0 thatho18920.0 19235.0 officoParisfrom Paristrom ParIsfrom 12315.0 trom18471.0 sonn19191.0 12327.0 thQ13000 beingmobilised beingIrooblllled beingmobiliied 12496.0 mobilised Irooblllledmobiliied18804.0 18696.0 DUlgnrlalirlngliming19927.0 20484.0 the20379.0 tbopiosont tboplosent thepresent 12640.0 piosontplosent12651.0 effective errectlvo18556.0 lorco loree12680.0 19648.0 19911.0 60000 1i0OOO5000060000loops 1i0OOOtI 50000loops 12815.0 12839.0 tI 18123.0 12847.0 loops 18260.0 Op3 Ixmlns:ns22 ID42 11140 2972 18000 13143 ns22:type 13143.0 Appalllntf AppallnetAppaitlfltlLlt 19092.0 19144.0 List LIt19396.0 Mnssacrca MnutlcrclofMasacrCoofMasacrCoSmerdeseb 20312.0 MnutlcrclBmcrdosch JSmerdesch 18208.0 13332.0 Smerdesch BmcrdoschSmerdesebHay May21 19244.0 21150 21150Bald 21150Safda 19703.0 1BO 1BOSafda 13503.0 Safda BaldAlgeria Algerln19291.0 Juno 19604.0 13512.0 2Co 2Cu19756.0 2CoMonastlr 2CuMonastir CoMonastlr Monastlr MonastirAugust Auguit23 19384.0 2350 2350fialonica 50 19819.0 50Salonlca Salonlca fialonicaAugusl18756.0 Bulgorlonu llulgarlanuBulgarlanu19651.0 18059.0 14015.0 300 SSalonica BalonlcaSalonica18876.0 Auut14179.0 AU 19343.0 19428.0 19687.0 OroeksGO CrooksCOOroeksGOSalonlc3 60 60Salonlca 14240.0 Salonlc3SalonicaViachs VlachB30 Viachs30Viachs30Sofia 20420.0 30 iSofla tSofia 14507.0 SoflaDlllgarlR14495.0 3150 23G5019996.0 23G50S 3150Solta C50 C50Sofia 18000.0 14671.0 Solta18015.0 Dulgarln14659.0 30G 3OG019999.0 3OG0Sofia 20359.0 C0 C0Sofla 0BoO BoO SoflaSofia18520.0 18664.0 DUlgnrlB19363.0 SeptomberImca meamenmca1EO 18056.0 14999.0 1EO 1601801EOSofla 160Bona180Sofia15163.0 Bona SoflaSofiaDulgnrlBptembcr19620.0 tembcr 20204.0 1men 20260.0 1menI 1menand menand 1132.0 18051.0 15356.0 women20 wemen200women20SoOa wemen200Sofia 19183.0 200Sofia 15467.0 SoOaDulgarla19379.0 Bul DIIDiii20268.0 DIIgsrlon65000 Diiigurian65000 15523.0 garians 1020.0 gsrlon65000 gurian65000gsrlon65000Sofia -1020.0 19080.0 65000 65000Sofia 20927.0 SSofia DblgarlnSeptomber20140.0 It20060.0 20415.0 Gen gongenera gonoral 20636.0 1296.0 18008.0 oral eral18012.0 roport60OOO reportC000018776.0 roport60OOOItastorlR -928.0 15984.0 reportC0000Iastoria COOOO COOOOKastoria ITho ItastorlRIastoria18892.0 Septembor18764.0 19680.0 IE 19592.0 1610000 10000Tho IIThe Theot18967.0 lhotowns 19284.0 thotowns Indicate IndlcatoIndicatefrom Indlcatofrom indicatefrom whence whenco18759.0 19440.0 portsrelchct 20016.0 mcrlctLhmericaAmericaKilled 20616.0 hmericaKilled mcrlctLKlodbydlsea 20611.0 Klodbydlsea 19288.0 disease diioa 16667.0 nuil19775.0 deprivation deprlatlondeprivationwomen deprlatlonomen 18044.0 omen16807.0 18867.0 chlldren50000 19399.0 50000 50000Villages 20932.0 16851.0 SVilftea chldren50000 chldren50000Vlo -1072.0 Villages VilfteaVlo 18720.0 e3 plundered pluntered burnt burntl 20276.0 burntlit burntlitRecent 20603.0 20423.0 111Recent IRecei 17127.0 Recent Recei18599.0 separate sOparateDulgarongoamgoamment governmont montroportsotmasacre murd17319.0 auJ aniauJrapine auJraplne131 anitapinelSl 18040.0 17451.0 rapine raplne131 raplne131Men tapinelSlMootapinelSl 131 131Men 17607.0 17620.0 Men MooIIndchidren 20119.0 driven drivenInto drleo drleoInto driveninto 17779.0 otbor18296.0 dlstrlcs3OO dlstrlcs3OOCast dustricts3t00 dustricts3t00Cast 3000Cast 1580.0 Cast prIEon2SOO prlson20019296.0 prIEon2SOOShot prlson200Shot 2800 2800Shot 18104.0 18112.0 Shot 18848.0 18772.0 19551.0 18107.0 bmordesch mordeseh200 imerdesch2O020264.0 imerdesch2O01houses mordeseh200Houses -972.0 200Houses 18276.0 Houses 1housesjn jaSraerdosch merdesch250 merdesch250Houses 250 250Houses 18435.0 SalonicaAuguct AugurtAuguetAugurtH575 24575 H57524575Sofla 24575Sofia H575BoOa SoflaBoOa18671.0 Burgarla DurgarlaBurgaria18775.0 repott18771.0 ot19828.0 20188.0 AuguctAuguet18172.0 18935.0 burned22 bumned22burned22Turkl 19487.0 bumned22Turkish 22 22Turkish 19091.0 Turkl 19099.0 18635.0 engaged 19839.0 murdcrmurdering murdcrand murderlag lag ingpillaging plaglng200000 plaglng200000SOUTHERN pillaging200000 200000 200000SOUTHERN SSOUTHERN 20896.0 SOUTHERN 19599.0 MAKING 18884.0 19720.0 19603.0 BIG DIG19612.0 MONEY MONEYAnnual 18596.0 Report Shows 6howlLarge Gains 20004.0 InProfit inProfit Profit Proft 20108.0 Over 19420.0 Last Lal 19712.0 Year YearA Viar ViarA 20127.0 20132.0 arA 18372.0 Yprk Yqrkqrkdlpntcl di5atch19759.0 safsaasTheTboannual Tboannualroport Theannual annualroport 20428.0 SouLhors20436.0 hel railroad railroadjust llroa 20568.0 JUSIIsued Issuedshows 19392.0 Uinlhi19676.0 hitbo 20315.0 fiscal fiscalyear 20588.0 fisca rearended endo18328.0 end0 18936.0 June gross grosa20787.0 grs 20096.0 earnings osruingsearningsworo osruingsworeeailngt eailngtwore 20931.0 woro18532.0 42354069 4285405025489 20948.0 20923.0 Increase ot20508.0 21075.0 641811 6481 21107.0 21092.0 1231 19127.0 21115.0 percont percontMiliONAIE centMILI centMILl MILl MILIMiliONAIE 18592.0 IONAIRE 1148.0 21507.0 ASSASSINATED ABSAS6INATEDASSASSINATEDOrbncfo -1148.0 ABSAS6INATEDOrlndo ASSASSiNATEDOrlando Orlando OrbncfoOrlndo21839.0 18956.0 21844.0 Dexter DeterNev NevYork Nt NeNtVorker 20528.0 NeYorker prminent 21967.0 21991.0 Vorker Yorker 18684.0 22040.0 21999.0 Chef 18736.0 ChctDown hcf Down 19847.0 22003.0 Highway HlahWayHighwayA HlahWayA22155.0 22160.0 dltpatch ditpatchdlt 22163.0 atch tromMalone MalonoK N22175.0 saTesayc20284.0 saysWhllo saTeWblo saycWhile 22319.0 While WhlloWblo 22327.0 driving n22336.0 thoroughbred 19196.0 hoNe horJehorsehoNealong 20624.0 horJealong horsealong 22479.0 along 22515.0 ono22500.0 otthe18948.0 22503.0 roads 19811.0 22483.0 hlsgr01t groit groat7000 acre aero22659.0 estate estato22672.0 LakoDexlr 20444.0 th9tMth9Adlrondacks tMAdirondacks theAdirondacks Adirondacks AdlrondacksBatUr 22860.0 ay 19280.0 rlnllo Bet DOlD0ZBetter DOltor D0Ztom tom tertor23003.0 WI 18620.0 nsasslnatod Hs slayer slayerconcealed wu wuconcealed concealed 23155.0 conccoed heavy heavyfollge foliage tho20040.0 roid rodroidand rodend rOIdand 23299.0 endshot 23319.0 twice twlco23331.0 19024.0 23328.0 thotbo19543.0 millionaire miionaire bothbullets bothbulot bothbuhloto 23468.0 bullets buhlotobulot 23483.0 striking trlklnghlm trlklnghlmMr 19124.0 himMr 20824.0 23539.0 SMr 20835.0 18184.0 23635.0 23639.0 18468.0 Doxter23659.0 besides bosldesbosides23656.0 elngnmillion miin miinalre millionniro 23679.0 aire alreniro23835.0 23843.0 awel 19644.0 23852.0 oown 23828.0 Jewew 23815.0 rk 20472.0 otottorney attomnoy torney tomnoy23983.0 noted geologist geooglstnnd20063.0 prom proS20212.0 20567.0 23999.0 proInent proSmeat inent meat24147.0 momber24156.0 24159.0 hoNewhIls24179.0 xmlns:ns23 ID43 5444 2868 17968 24303 ns23:type 24303.0 Society SocietyNOEL 18995.0 Bolety BoletyNOELICARS 20160.0 24463.0 20827.0 24531.0 24572.0 24607.0 NOEL WOELNOELICARS 24627.0 FEARS PEARSHYDROPHOBIA HYDR0PHOmIAHYDROPHOBIAErstwhile -1100.0 HYDROtOIIA HYDROtOIIAErtwh -1224.0 20503.0 HYDR0PHOmIAErstwhile 24927.0 24947.0 Erstwhile Ertwh 24955.0 24964.0 Mlssisiippi24971.0 24967.0 19139.0 19060.0 1164.0 lppIGubrtcrl 19168.0 lppIGubrtcrlCandlaie -1164.0 Gubernatorial GuberflatOrl53GubernatorialCandidate GuberflatOrl53Candidate Candidate Candlaie 25148.0 Pasteur Pateur 19736.0 Institute JatItuieInstituteStato hlUue hlUueStato JatItuieState 18159.0 25271.0 StateSenator BP25280.0 19572.0 25287.0 Noel Noefoel otMlssl IdissiSMlssldppl IdissiSsippl 20500.0 1l 1lppl dppl sippl25439.0 ppl 18444.0 25447.0 arrved AUnit CIa 25444.0 Bnndiy SundilBnndiymorning Sun Sundilmorning l1 l1mornlog 25608.0 morning mornlog25623.0 xeinJntiOland 20340.0 tlO1 20552.0 tlO1an 25631.0 fexamjnatloi xeinJntiOlfexamjnatloiand XI 25767.0 25787.0 18236.0 18316.0 possibly poulblytreatment teatment tboPasteurInstitute pa Pasteurinstitute teur teurInstute 25827.0 Instute 25947.0 tor25983.0 dog bite bltoblo horcelvetl rcelVe rceived 26091.0 celvetl ceivedcelVe 18416.0 sevenldarsaro aroatAckcrmw AckormlaAckcrmwMiss 20547.0 Ackerl AckerlMin AckormlaMiss Miss Min18463.0 IIsmall rnahl81al village vJllagoyiilage19587.0 miles mies 26275.0 ftOflfromMs frol ftOflhIs Ms NshIs26427.0 homeThedogthlt bit bllblmblmuPPod himUpposed 26451.0 iuppoBcd 20516.0 26607.0 uppoBcd uPPodUpposed26615.0 hove bnehave26623.0 mndmadmodNEGRO mndNEGRO madNEGRO 26928.0 26931.0 LYNCHED LVNCHEDBY NEGROES NEGROE8NEGROESSheriff NEGROESShcrl NEGROE8Sheriff Sheriff Shcrl27267.0 Gives GlveaIJp lp ypAaulfart Asallar4 27291.0 Als ofGirls 20320.0 Tw TWSTwGirls TWSGirls 20511.0 27427.0 Girls qn18743.0 pemand DemandMeb McbMebAt McbAt 27579.0 27583.0 27592.0 Luxora LuxemaLxor Ark Tom TootHellom Eellon19631.0 HelloD 27604.0 Sue uegro uc Ugro 27715.0 27768.0 gro wioassaulted 27787.0 aSB ledtwo 27775.0 27783.0 glrlgirllglrlages girlages girllages bn bl bln fa 17987.0 ages 618507.0 27935.0 jews ICSyeralynched 1rched a18152.0 snobcomposed 28111.0 compose 19263.0 of28091.0 totoown bWn bcwn 17979.0 own cwn18064.0 28263.0 Wn 2iwater 2water 18340.0 racomcowhic 28267.0 strung strlng bimwater 28411.0 tank tnk19044.0 28423.0 riddled rddle 20292.0 boil bolyb11bolywith boilvh b11wth vhwth18267.0 bulets 28587.0 bucksnoL bttckanoLbucksnoLHellom bckaoL bckaoLHIUom bttckanoLHeilom 18116.0 28703.0 28728.0 HIUom 18120.0 Heilombsdhatben 19335.0 28747.0 Jborob 1rtob bO bOmob 17976.0 28891.0 rtobthreatened threatpnedtircatpned arerc 28911.0 bailer baljer19947.0 dOWDi8 Ihai8Jail IhaJafl 17968.0 Jail JaflrefUsed trefusedtrellsed 29079.0 lio thoate 29067.0 aerl 29120.0 erIf 19991.0 29071.0 29076.0 gay gave29087.0 29044.0 tup therrioe efrlo 1388.0 29223.0 rrioe 29240.0 tbea tbeaS frlo 29263.0 tgtl 29735.0


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01987\ocr\0097b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:22431
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.234
splitwords:0
ScansoftOCREngine Character Count:26963
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:29522
Abbyy6OCREngine Character Count:29918
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;29918;7001;43.9238;81.9192
language:en
ScansoftOCREngine Predicted Accuracy:54.58%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:10310
ScansoftOCREngine Character Error Ratio:0.5378
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;29522;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:81.92%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:81.92%
ImgPrep Component Range:19642,22431
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;26963;14502;0.632459;54.5842
noPunctuation:1
ImgPrep Component Count Low Estimate:19642
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 10.0 ID5 11.0 ID6 9.0 ID7 13.0 ID8 16.0 ID10 15.0 ID11 8.0 ID12 14.0 ID13 18.0 ID14 37.0 ID15 25.0 ID16 20.0 ID18 7.0 ID21 32.0 ID24 33.0 ID25 27.0 ID26 22.0 ID27 6.0 ID28 12.0 ID30 30.0 ID31 21.0 ID32 19.0 ID33 17.0 ID34 26.0 ID36 31.0 ID37 4.0 Layout Page ID1 HEIGHT 30936 WIDTH 21208 PHYSICAL_IMG_NR 3 PRINTED_IMG_NR [3] PROCESSING PrintSpace 29163.0 21176.0 HPOS VPOS 1400.0 PC 0.8192 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 724 19948 12 1400 ns1:type simple language en TextLine 144.0 4976.0 12568.0 String 24.0 1408.0 CONTENT S WC 0.8095238 64.0 52.0 13924.0 I SP 1332.0 12592.0 120.0 56.0 17487.0 1424.0 7 3512.0 13976.0 7I -56.0 17543.0 116.0 14004.0 5956.0 1592.0 1664.0 0 17380.0 11412.0 5968.0 18575.0 1644.0 5 1176.0 17399.0 88.0 40.0 19919.0 1620.0 a 1324.0 18596.0 aI -40.0 19960.0 324.0 7688.0 1608.0 236.0 7680.0 1780.0 7432.0 248.0 17352.0 1976.0 1844.0 STYLEREFS 80.0 l 92.0 48.0 2332.0 1960.0 f 276.0 2056.0 152.0 332.0 8616.0 1888.0 THH 6236.0 2380.0 128.0 96.0 10100.0 1900.0 K 1152.0 8948.0 132.0 396.0 10304.0 1904.0 BiAn 108.0 10196.0 1020.0 10804.0 OAINEQVILLE 104.0 10700.0 140.0 280.0 11936.0 1912.0 FLA 112.0 11824.0 12696.0 1932.0 480.0 12216.0 19275.0 t 6556.0 12720.0 tu -52.0 19328.0 18480.0 876.0 1980.0 68.0 148.0 2012.0 136.0 19219.0 4t 18196.0 1024.0 14660.0 4056.0 2020.0 28.0 2052.0 J 84.0 12176.0 2116.0 u 8092.0 4084.0 17664.0 2064.0 5404.0 12260.0 36.0 17972.0 2036.0 17692.0 18172.0 2040.0 164.0 18008.0 18660.0 460.0 18199.0 xmlns:ns2 ID4 27707 2820 620 2172 ns2:type 520.0 808.0 2172.0 416.0 H 516.0 1876.0 2176.0 Househok -416.0 1224.0 Househokj -1876.0 2684.0 360.0 1304.0 1464.0 usehold -1220.0 useholdJ -1304.0 2768.0 624.0 1240.0 2664.0 76.0 0.96825397 1532.0 2672.0 1 216.0 1316.0 60.0 1832.0 224.0 1i -32.0 1864.0 312.0 668.0 2740.0 2772.0 ters tersI -668.0 3408.0 ters1f71 284.0 1612.0 772.0 2968.0 3168.0 252.0 440.0 1944.0 1f71 1144.0 800.0 1f71Qur -440.0 2384.0 212.0 1568.0 816.0 3420.0 i 608.0 1776.0 VgurDpg 0.82539684 896.0 880.0 VgurDpgHo -608.0 300.0 Vgtir -604.0 208.0 1872.0 3448.0 Qur -208.0 2080.0 172.0 2132.0 3432.0 Dp Dpno -172.0 2304.0 XJpg 192.0 2632.0 728.0 3560.0 124.0 200.0 916.0 3588.0 Ho ALTERNATIVE no792.0 n -200.0 1116.0 432.0 1188.0 3576.0 Btioufa rtoui1048.0 1252.0 3584.0 110U -368.0 388.0 1768.0 3596.0 lways iways1488.0 2220.0 3600.0 havo hl1Olffiyo2156.0 2600.0 3612.0 fresh 0.95238096 2532.0 tr -332.0 2932.0 504.0 2856.0 3620.0 hdrlnk 2716.0 316.0 3008.0 3624.0 drlnl 1rIn1-352.0 3360.0 drlnlIng -316.0 3324.0 264.0 3040.0 1rIn1Ing -284.0 340.0 2000.0 796.0 3592.0 3752.0 Ing 111 -212.0 1008.0 72.0 928.0 3832.0 o 920.0 384.0 1072.0 3756.0 water watcr1000.0 waterA watcrA-384.0 1456.0 336.0 488.0 1668.0 f1W43S 2368.0 3844.0 184.0 2416.0 2764.0 3740.0 2628.0 Io 2796.0 2388.0 3812.0 3916.0 A 456.0 1124.0 3920.0 pnpptf VL1PIY1032.0 3936.0 PIlP -456.0 1580.0 344.0 1640.0 jrbctt lvhcti268.0 1372.0 3924.0 eli -140.0 1984.0 372.0 2092.0 3908.0 ubout ftbodt3951.0 -372.0 2464.0 2252.0 3960.0 100.0 2152.0 2412.0 3932.0 2316.0 180.0 2560.0 3904.0 tjirJo -336.0 2896.0 156.0 748.0 throlye6i -48.0 2608.0 throlye6i1d -748.0 3308.0 2700.0 3968.0 r 2736.0 -24.0 2760.0 2824.0 2816.0 296.0 3000.0 wc6l wc6lpld -296.0 3296.0 3120.0 c -176.0 3256.0 3943.0 3188.0 lJld 2548.0 744.0 244.0 4068.0 pld Jld868.0 1d -120.0 988.0 4052.0 shoulil 8hotllft4076.0 8IUI -432.0 1480.0 B5 1388.0 1536.0 4072.0 D -160.0 1696.0 1628.0 3940.0 1616.0 1748.0 4048.0 encouraged ciZourgti1740.0 4103.0 -744.0 2492.0 1856.0 44.0 1812.0 1968.0 4108.0 OUm 4088.0 tl 168.0 2248.0 2552.0 tb tf -124.0 2676.0 lap ntfinf2688.0 292.0 4060.0 nfllk niik2948.0 4080.0 nfllkMilk -292.0 3292.0 niikftIk 288.0 3124.0 lIt -168.0 lItll 160.0 2476.0 4216.0 Milk ftIkll -300.0 1216.0 1096.0 4228.0 lk 1036.0 1292.0 4232.0 for Cor1352.0 4255.0 or 1492.0 1552.0 4264.0 a400.0 1712.0 4260.0 puppy PUpp1636.0 428.0 2188.0 4244.0 should Bliould2112.0 2692.0 4247.0 bo be2616.0 476.0 2916.0 scnlilc scalelcllscahie2836.0 scnlilcnot -476.0 3392.0 scalelcllnot -400.0 3316.0 392.0 scahienot 840.0 4384.0 4388.0 not boiled bollcdJO1Iet11052.0 1584.0 4396.0 nnd 011ahlti496.0 4399.0 slightly sJJShtJ680.0 2424.0 4412.0 uwcqtoucd weqtouctlawcqtoned2372.0 3148.0 4444.0 nm an3104.0 nmfed -180.0 3328.0 3152.0 4424.0 aUtl aUtlell -236.0 3388.0 antet1 2204.0 4540.0 4548.0 fed tet1856.0 ell 996.0 1068.0 4551.0 to 992.0 1260.0 4544.0 him hhu1Ifl1196.0 368.0 1588.0 4576.0 warm vavm1512.0 320.0 vavmI -320.0 1956.0 1704.0 4584.0 -252.0 1784.0 Im 2732.0 4608.0 776.0 2840.0 II -28.0 2868.0 4627.0 tV 2644.0 736.0 4700.0 4728.0 V 912.0 When Whon4736.0 nit1300.0 111I1IIYI11V1Y2100.0 4716.0 Is 1992.0 4724.0 four COllr2208.0 2696.0 frocks 2592.0 2812.0 oek aek-276.0 3088.0 3196.0 4740.0 oli ohl013036.0 olisoup -184.0 3380.0 ohlIOUI -132.0 010up 176.0 2536.0 4860.0 4884.0 soup IOUI0up636.0 1168.0 thickened 1084.0 1892.0 4872.0 with 1804.0 308.0 2272.0 4880.0 stnlo stalotn1a2184.0 356.0 bread tironbrenI2580.0 220.0 3108.0 4924.0 mnj 3020.0 ma urn-220.0 maIJcgln 3288.0 urnbegin 2584.0 5012.0 5028.0 begin IJcgln1220.0 5024.0 1132.0 1432.0 5020.0 1348.0 628.0 5032.0 gradually IIralluall1radun1I -544.0 2292.0 652.0 2444.0 substituted sulJsututcdubsl1tuted240.0 3192.0 5056.0 fo to3096.0 foUo -112.0 3304.0 tor tortlJo 3376.0 toLLio 5152.0 5192.0 Uo tlJoLLio364.0 1076.0 5188.0 IJrcadIJrcadIt breadIf-364.0 1440.0 2168.0 j 2468.0 5280.0 5344.0 If It5376.0 1028.0 408.0 1328.0 Imppy1uppy1212.0 1848.0 5352.0 ho1736.0 2076.0 5364.0 McifoUwhen 2160.0 Jen -908.0 3068.0 tcakI 204.0 2428.0 lclf -192.0 2620.0 5319.0 2724.0 whcu 228.0 hen -228.0 3064.0 3180.0 shweeks 3184.0 sh six-148.0 3332.0 s 3364.0 s1veek 3240.0 2636.0 724.0 5484.0 196.0 5508.0 1veek 412.0 weeks -340.0 904.0 cekB 1296.0 old ohloIil436.0 5512.0 theres tIioros788.0 therosleBs -436.0 2044.0 2068.0 5536.0 v -328.0 2396.0 5516.0 Icsd 1cs2104.0 2500.0 5488.0 Iroublo 2564.0 5524.0 rouble roulJlo-396.0 2960.0 3072.0 vltt wHhv1tIwHh8tolUlich -288.0 3116.0 vlttstomnch -244.0 v1tI8tornncll -216.0 720.0 5648.0 5664.0 540.0 stomnch 8tolUlich8tornncll5696.0 worms ivomwormst wormsWcllbollctl ivom1Ve11 2648.0 712.0 5808.0 5919.0 892.0 5820.0 Wellboiled Wcllbollctl836.0 1Ve11 5824.0 bole 1204.0 5836.0 meat 1560.0 2140.0 5840.0 and n1n111 -240.0 5848.0 vegetables yegetablea2376.0 5868.0 -592.0 3144.0 380.0 talJles 3232.0 5860.0 ol ot5864.0 olqll -128.0 5884.0 -100.0 oqIl -64.0 5948.0 5984.0 qll 111qIl352.0 5980.0 kinds 1119lclndi936.0 1380.0 1060.0 6012.0 < 1056.0 420.0 1520.0 5992.0 except 1100.0 1044.0 2016.0 potatoesjwlilch 1940.0 5976.0 POt1 potn1-1044.0 3060.0 2440.0 6024.0 08 2348.0 620.0 eaJwhjc1i 376.0 6003.0 which -376.0 6040.0 art 110anartbard annrd 3428.0 6108.0 IIlinld -8.0 3436.0 6132.0 6140.0 bard Ilinld6144.0 nrd 1160.0 tordogs 1356.0 1808.0 6152.0 1728.0 932.0 2008.0 dlgcstisltould dIgqst1iouId1928.0 6147.0 tllgqst -932.0 2940.0 468.0 1s1ioultl 2392.0 3024.0 6164.0 grad 3320.0 gradnlly gradUaIIy 2656.0 780.0 6268.0 6299.0 ually nllyUaIIy492.0 1148.0 6292.0 becoino becolilobecoifio1692.0 6307.0 tho Ilia1948.0 6316.0 tlogs1896.0 232.0 t1og 2280.0 2320.0 6320.0 Tood ToooToad2180.0 ToodM Toadi824.0 2588.0 6459.0 6472.0 M -108.0 508.0 888.0 Though Xhough764.0 1452.0 the tbotho1396.0 1716.0 6468.0 dog tlogaog1660.0 1996.0 by 6484.0 nature nnturonaturo2360.0 2900.0 cnrnlr cnrnhcarnlv2844.0 carnlv4rous -412.0 3312.0 2544.0 6600.0 drous kous4rous6616.0 tbotho1472.0 6624.0 cooling eoollng6628.0 effect ectectofftt 2336.0 6640.0 ot ofi-280.0 2660.0 pnrt 616.0 phrfege partvege-264.0 2964.0 partvegetabIe -616.0 3016.0 6668.0 vege vegetable 768.0 6748.0 6776.0 table tabIefnblo 1108.0 260.0 6780.0 diet makes 1916.0 6784.0 turn960.0 2212.0 6771.0 uiorqueJhnblo rnorode1iatio6820.0 nlolo -960.0 3172.0 6768.0 deSia 6800.0 le 3224.0 6831.0 as 6804.0 lis 3336.0 lisllof 3356.0 6836.0 z ztLOt 404.0 6940.0 6956.0 8 tLOt -80.0 844.0 tLOtTwo -380.0 pet llofpetTwo -232.0 lloftxwo 2472.0 884.0 7092.0 Two txwo1280.0 7100.0 meals nicnlsmenls1184.0 1744.0 7132.0 n1656.0 1908.0 7108.0 day dllYt1y1820.0 2236.0 7112.0 102144.0 7116.0 enough enoulhenoughBrown 7120.0 tOl7148.0 nwn -68.0 r5rown -36.0 7256.0 Brown 5rown188.0 7279.0 wn -188.0 1248.0 7260.0 llog348.0 7264.0 when 1476.0 ho bo7268.0 has hns7272.0 1a -224.0 2488.0 buLoiiq bpopq2352.0 7276.0 2996.0 po 3080.0 7308.0 io -116.0 It IsIiIso IiH 3260.0 Ito 2612.0 760.0 7431.0 832.0 7444.0 944.0 7408.0 hungry bungryhungly908.0 7420.0 that tbntflint1420.0 7424.0 bo1972.0 bolts lIOlts7428.0 2296.0 2340.0 Itjep8n -104.0 7460.0 2484.0 7404.0 adfebtBdy -72.0 2556.0 adfebtBdy4PJepsln -760.0 3244.0 blOtl -756.0 2860.0 Ct -44.0 2904.0 7384.0 fdyist 2972.0 696.0 7540.0 7548.0 4PJepsln 472.0 700.0 7599.0 jep8n -472.0 1172.0 860.0 7572.0 epaln -312.0 424.0 1360.0 7580.0 Plenty 1852.0 7583.0 828.0 2048.0 oxorcljojoifu oxerclqjItTtf7588.0 mrercl -828.0 2876.0 lId 2436.0 plenty plcntploubplentyof ploub5ot-392.0 3340.0 328.0 plcntot 740.0 7716.0 7732.0 of ot5ot7735.0 good 10011goot1312.0 food tooll1256.0 1652.0 7740.0 make makomnko7772.0 a7748.0 fine 2128.0 2512.0 strong stroug2420.0 2976.0 d6g d6s2920.0 d6gItecord 3208.0 d6sl1JIlell 7788.0 3132.0 7776.0 g g4l1UadCI1bIfl -76.0 672.0 7887.0 4l1UadCI1bIfl l1JIlell -684.0 1344.0 7924.0 > -4.0 1392.0 7895.0 hla 452.0 1672.0 7903.0 Record ItecordItccord448.0 1676.0 Itecordj RecordI-448.0 2124.0 8136.0 I1924.0 8196.0 8232.0 8240.0 708.0 8236.0 Novel Nonl1572.0 568.0 2024.0 Ilooltcnie DookroleflookenseIlooltcnien DookroleItflookensei4-568.0 8404.0 8508.0 8472.0 i4 820.0 8427.0 seems 80emsscorns1004.0 1596.0 8440.0 os1500.0 8412.0 though thougbthere tharotliero8416.0 could couh2892.0 couldscarcely -344.0 couh8cnrcel couldecareebo 3300.0 8564.0 524.0 8568.0 scarcely 8cnrcelecareebo -524.0 1284.0 1336.0 -152.0 588.0 anything outblng8595.0 now 1I0W2120.0 In 2668.0 8571.0 Urn tbotllo8576.0 lino UnoIlno2872.0 3212.0 8579.0 ot3160.0 oft ottin1iffur 8604.0 oI 3280.0 8692.0 8844.0 656.0 952.0 XiVfiftuYcvfct fItuTiVt552.0 8696.0 tin1iffur -952.0 8704.0 fet 8708.0 lf 1688.0 1376.0 fhTreorpvariations iiiPTq11nt10n9ifiin1iuTons8736.0 otofold -136.0 3344.0 ototl1 8764.0 ooki 8868.0 otl1oki8872.0 designs deagns1540.0 8888.0 avlilch1484.0 hleh -268.0 8891.0 bavo Ijavohn 2308.0 2240.0 8924.0 nil nUall8883.0 tbo2524.0 2852.0 8908.0 appear nllICar2792.0 8920.0 appearnUWjaLBQMttL nllICarnll appearflttQQLflQYItr 9043.0 nUWjaLBQMttL flttQQLflQYItr9068.0 nll -1096.0 984.0 QglJ1QX 9048.0 Ur 256.0 QPO QpooLtbClQls QpoJ1io-256.0 500.0 2456.0 IJbcsQ -708.0 3164.0 3056.0 9051.0 2956.0 9080.0 11jtnfather 11ather jttathcr 9192.0 9200.0 father athertathcr9203.0 low 1504.0 broad brontl1920.0 9208.0 bookcase bookcasl9212.0 at 2508.0 each cadiezwhend cudcudo2 endo endof 9352.0 9360.0 o2 of9384.0 -144.0 Mch 1384.0 9364.0 9392.0 ncloset closot2096.0 484.0 2288.0 cabinet calilnet1012.0 cablnctelttellll -484.0 cablnctelttellllIng -1012.0 9368.0 extend otont1extendIng 2864.0 otont1lug 9423.0 9507.0 9512.0 lug9516.0 tlto964.0 9520.0 entire cntlroentlro1276.0 height helsh1764.0 9524.0 ot2312.0 2720.0 the2568.0 3032.0 book lIootboo1bookshelves lIootIIhehes boo1bhelyes 756.0 9668.0 464.0 shelves IIhehesbhelyes1404.0 9676.0 1h Tliey rh -324.0 9696.0 Y 3r9700.0 are aronro9680.0 closed 2028.0 cJosettyltl1 2504.0 yUU yith2952.0 doors doorsdecorated do doOrsdecorattV 9704.0 1fl 1flIlecorat 9800.0 9828.0 decorated IlecoratdecorattV9863.0 1524.0 wltlicarving 1340.0 9803.0 V1t11 -892.0 2460.0 1964.0 9860.0 ca 9832.0 Vng ftuif tiUIt2848.0 9876.0 -12.0 2980.0 mothl methluoth19819.0 mothlhinges -360.0 methlhinges uoth1tikiges 9963.0 9980.0 hinges tikiges9988.0 anti1180.0 fastenings tnstenlngs1516.0 2404.0 Tho The544.0 combina comlJltlacoinbina9984.0 combination comlJltlatlon coinbinalou 10039.0 10132.0 tion tlonlou 10144.0 ot968.0 1236.0 10140.0 chair 1192.0 10152.0 nntlarnitnblotablocalled clIetlthe10148.0 cbahebair2924.0 chairtnblpJOldWeiVaMtlms cbahtnblpjdl ebairto 10284.0 10300.0 tnblpJOldWeiVaMtlms 872.0 604.0 10288.0 tnblpjdl bIpI1-1628.0 1448.0 10292.0 1368.0 tibtIi 1th 2284.0 11J hi2624.0 tho2880.0 10327.0 process procsprocessotyjta -468.0 3348.0 10332.0 procsot1tq 304.0 llOCe llOCearltl -304.0 3220.0 10432.0 10448.0 otyjta ot1tqarltl 1140.0 10456.0 evolution ollutlonevslution1880.0 10460.0 become becol1lo10492.0 nmuchmore 2520.0 muchmorenWdctlVo much milch10468.0 moaic rnorc3004.0 moaicnt 10484.0 rnorcn1Uattvo 10584.0 640.0 nWdctlVo n1Uattvo10615.0 nt -640.0 10620.0 rd 1164.0 tIo 1080.0 10647.0 atlclo wt1eloUclo than 2224.0 was wtisils 560.0 2752.0 formerly forlDelIformerlyAorrtncHt -560.0 forlDelIAi formerlyA5t7neitt 10767.0 10775.0 AorrtncHt Ai -808.0 A5t7neitt 1088.0 elt 732.0 specimenpf poc1nonpteJl1 10807.0 2324.0 10780.0 2356.0 2480.0 Its 2704.0 knd Inllkjnd3048.0 III3156.0 3200.0 ofl 3216.0 offcroBlifln o41II 10912.0 10943.0 704.0 10896.0 jft 1308.0 fcroBlifln 1436.0 10959.0 reB 272.0 WeC 1624.0 10964.0 -196.0 10940.0 tal p 10932.0 64k ilc 536.0 10900.0 fnlln tlbh -536.0 3044.0 41II 2776.0 l1lln jin 10935.0 slzq slCQsIzqslzqvlhB sIzqsuu 11108.0 suu 11087.0 11 Iirtvlng 1128.0 11071.0 vlhB yhg 1556.0 11008.0 nWWaVw 11120.0 11100.0 11064.0 11095.0 baI 11079.0 fdp t3p 11048.0 wIiili11076.0 qnlfo quUtiqnlfoInconspicuous 11124.0 q quUtiinconspicuous 3092.0 11084.0 III 3236.0 ft ftIUCOl1SplcuOl1S 11247.0 Inconspicuous IUCOl1SplcuOl1Sniien2164.0 11252.0 folded foilled2084.0 back baelFor PmFora 3352.0 Pmhall Forhail 11372.0 11432.0 11404.0 ball hallhailortoiajMuUtrybombwllcro orTorniuUfjyhorntw1icroortoiajMuUtrybombwllcroeconomy orTorniuUfjyhorntw1icroeconomy-2112.0 1244.0 11436.0 -2108.0 1460.0 toi 11415.0 11396.0 uuti 11391.0 bomt 2800.0 11444.0 11407.0 Uero 2828.0 Ueroeconomy 2572.0 11564.0 11592.0 economy of1496.0 space SOCO2108.0 11588.0 nn nl1an2216.0 object 3100.0 this thlllhuHthissthlrtabfo thllllldrtAIjo 11576.0 huHbtr 11708.0 sthlrtabfo lldrtAIjobtr -644.0 11724.0 tn1o 1104.0 especially esllccJallyeSCC1ahi684.0 2232.0 commends conlUcnl1sconlinenda11728.0 Itself ItsclfItceltItselfEqually ItsclfEqually ItceltIqtntly 11880.0 Equally Iqtntly11884.0 practical prnctlcalls11912.0 n2264.0 tea 2200.0 2516.0 tablo2452.0 11888.0 ot3076.0 oak 001onkoakwith 001with onkwith 3264.0 12040.0 1136.0 metal lDetol1064.0 trimmings tmnigstthnmll 12067.0 12044.0 shelf slelrsltunder lIll1er2908.0 underand 3012.0 lIll1ernml 12175.0 12200.0 nml12196.0 tho12224.0 same sarnosfzo 12227.0 sze szo2004.0 2072.0 tbo thottio2604.0 squuro SCIIIIlOsquitro2528.0 12204.0 3028.0 toIs tOl tOl18closell -164.0 3268.0 12352.0 12360.0 12356.0 18closell -388.0 two 12384.0 wo 528.0 2344.0 oppoBlto Olipollltoopposite2988.0 sides sit1esideswhile sill sit1ewhite 3248.0 3whllo 12504.0 while whllowhite12520.0 nt12512.0 lieother 12539.0 arc 110arelittle llttloIIttio3052.0 12515.0 drop t1rolldropincut t1rollPJie21 dropgIiee 12656.0 12675.0 gIiee wluctj 12667.0 Vhl 12672.0 jiLl IW1I4 ahIZ -156.0 U 2496.0 Ul upetcioe 2780.0 etcioeiiic lclo 3284.0 cJh -60.0 12812.0 Jh 12804.0 iiic PJie21 12832.0 shl -248.0 12783.0 8lri 1468.0 12800.0 krn iitr0boi1ul8 1860.0 jox -688.0 2408.0 12827.0 Th 12851.0 co cornpart cornpartS 12843.0 12856.0 llU 3176.0 3228.0 tUlellt 648.0 12984.0 13084.0 12992.0 mont incutUlellt664.0 be12987.0 used Corten tea2328.0 things thlnJtliingutorforclo torlowlnf forsowing 2576.0 13123.0 13144.0 sowing lowlnf13171.0 U1 13128.0 uutt1dlor 13139.0 -624.0 1600.0 ddWor 13152.0 tnCIl bven13176.0 13131.0 tlin 2540.0 2832.0 rcchHot rcjiitnfrcchHotelo rcjiitnfeta-520.0 13299.0 13304.0 eta cloelo13307.0 tor948.0 13336.0 n572.0 1364.0 smokers smolclsset sot1936.0 2228.0 lit IIIIn13332.0 IIinnnjs 13328.0 IIIIIS iiuusdcu dcuUroolJyn d uulll1roJldyu uuUro3klyn 13459.0 600.0 13464.0 UroolJyn l1roJldyuUro3klynEagle EuSllEzigkEaglelnE 1792.0 1412.0 EuSllJ EzigkIEuSll1Jnrnl 812.0 13728.0 848.0 13796.0 13844.0 tAuIuI 980.0 13807.0 1Jnrnl 1648.0 13799.0 1708.0 lnE lngDainty DnlnlrUattit -420.0 Fabric lIbrltPibticFabricThuTaVinaoring lIbrltThi PibticTuu 13912.0 ThuTaVinaoring 13944.0 Thi Tuu-1004.0 13988.0 ununauring 1232.0 13915.0 -656.0 13940.0 n1ij 1684.0 lnc 13967.0 ot13964.0 embroidered emIJIohlerell1111embrolderetilinens llucnallucnarequires linensroptlros 11S 11Stoq 14075.0 532.0 14127.0 requires roptlros14148.0 toq -532.0 hos 976.0 14132.0 almost nlmot14156.0 14108.0 14124.0 l11uchlunchskill 2432.0 is ns14151.0 2992.0 2936.0 2884.0 does 110radoestho 110ratho doesthe 14276.0 14287.0 themanufacture 1IImltocturo14284.0 ottito2060.0 14279.0 dainty tll1ll1tythiluutyfabrics fIlIJrknbrksfabricsCarclcssjiis fIlIJrkCarclc8JI1 2912.0 nbrksCnrcics1uys 14436.0 14447.0 Carclcssjiis Carclc8JI1Cnrcics1uys14444.0 Jjs JaJILJills 1836.0 556.0 1868.0 JJlsrcll1 J1 -556.0 respect rospect14468.0 2652.0 14472.0 2708.0 14463.0 jnny 1ln 3fl3 JIIIJarow IJrow -96.0 ntow 14591.0 14620.0 row tow512.0 14607.0 minutes tnluutcsmillutes14599.0 ruin rulllwoccs14624.0 weee -404.0 ot14596.0 work wOikAn AllAnembroidered Allcfilbiohletcll AnDflbrOitteCl 14751.0 14759.0 cfilbiohletcllDflbrOitteCl1632.0 14764.0 piece plctohOllhlhould14776.0 novel nlelitrerput putIn putIII putin 14908.0 14924.0 III14919.0 the1228.0 14916.0 regular regulor14911.0 wash VL13I1lIsh 2744.0 fairly CnhI -348.0 hot linthotwater hotwntel lintwater 15071.0 15080.0 wntel01111nna1156.0 1544.0 15107.0 15076.0 light JIht1ihtcuds sUIIstudsot15096.0 some 1i01111annieannievloco 15088.0 puro tlllllIpurosoapdip tlllllIli 15128.0 15199.0 15215.0 soapdip 15223.0 li 15272.0 15267.0 940.0 15212.0 fptl 1604.0 15204.0 thosolledprecoqiilcftTy 15259.0 e -1452.0 1700.0 so1T 15207.0 15256.0 vloco lc qlll qtu1ctTy qtu1ctTyiuewniy 2820.0 fifv sbv sbvHluso str 2680.0 15380.0 15424.0 15392.0 UIUelJ 1796.0 15388.0 0.0 2088.0 15416.0 IICJlSRI 15411.0 iuewniy 2984.0 41I 11tuIy11tuIyanoJapojjubJIt 15419.0 15527.0 15544.0 15584.0 Dno anoJapojjubJIt 1092.0 15579.0 spo -820.0 1564.0 15555.0 ut 1816.0 15552.0 15571.0 gan 15540.0 gentAbotcen boh 15563.0 can 2756.0 3140.0 tUII thutUIIhllll thuiuitnUe -204.0 15560.0 15712.0 hllll iuitnUe Hra 15704.0 lhit 1528.0 avdtd 1760.0 15707.0 1l111s 1884.0 15736.0 agner 2148.0 ner 15728.0 rU 15696.0 rubbIng 15699.0 blnl 15663.0 6snttbls 6stbIs 15851.0 15867.0 tbls tbIs15872.0 1016.0 Ipt tWt1208.0 900.0 15864.0 UioJUSIllIIlIO tOJJ2IJT8O2596.0 15859.0 th tiIttsnaotlI tiIttsnaotlIsurtttcepCtjinjcvny HIOolh -452.0 HIOolh6U 15996.0 16056.0 6U 1752.0 surtttcepCtjinjcvny 924.0 16059.0 -1604.0 16027.0 t1cep 16032.0 16019.0 16051.0 lI fIJC DJY 16011.0 nQl11 paj1tlICs paj1tlICsItluso -736.0 tICIli tICIliIUnso -356.0 16171.0 16187.0 Hluso IUnsoItluso16184.0 thoroughly tlloloushltboroughiyIII16176.0 cold clean clemcleauiwutervnterwaterTo vnterao 16328.0 16344.0 To 10aodry 1ry16376.0 Jay Inylay1800.0 16339.0 between botweentwo1tWdtowcla towc1qtowea16352.0 orJhlek orjllicl ori1uicI 16480.0 16504.0 Jhlek jllicli1uicI16499.0 III1QIlnQcloths cloUlsiclutlis16496.0 16488.0 ondlQILJeocl rqlllooscly VQILIOOSCIY-612.0 1111111011 mi uitili uitilift 3272.0 h ha 16640.0 16687.0 ftway WilYtIy 16659.0 UmtOlatno aopart plIItpnrt16656.0 It16651.0 theombibldery euibrOhleryeuibrOhlery1n1l ombiblderyshall -732.0 16643.0 cmIJI -728.0 c1r c1r1nlCtoud 16787.0 16800.0 shall 1nlCtoud 1n1l 1444.0 16803.0 touch toueii16844.0 any IlY iuy1840.0 oUler16811.0 lIart16792.0 oftho16836.0 plcc pLecplccNever pLcctorertohl pLect 16868.0 16832.0 16939.0 16979.0 Never torertohl 16984.0 -704.0 17004.0 ovcr fold 17007.0 1756.0 16971.0 hang han 16996.0 up 1988.0 2192.0 16999.0 n16963.0 wet 2448.0 16960.0 plctoplero16955.0 orofembroidery orembroltlet 17115.0 17131.0 embroidery embroltlet17156.0 nor 11011508.0 1828.0 17128.0 leave Icao1772.0 17123.0 lu InnUtiletlninp dnllllidamp2944.0 tlninpheap dnlllli1eoll 17120.0 dampbeat 17275.0 17292.0 heap 1eollbeat17295.0 Just Cot17319.0 a17283.0 lulnuto IIIlnutominutewhllo wiullo17300.0 sptiir 1IllIIrsptiirthing 1IllIIrthing 17303.0 nnc nnctb1zi 17427.0 17447.0 thing tb1zi 17455.0 clso elsoetsu17452.0 17435.0 attended nUemletlntternlcd2276.0 Hut lJutButrolled 1olellroledrolledbetween 1olelletecl roledbetween 17587.0 17604.0 17615.0 etecl 17612.0 drY 1268.0 716.0 drytbwcls drtbwclstowels 17623.0 nn17591.0 bewrung wtuugwtuugtwisted -408.0 WIln WIlntwlstcslll wrunghylstqtl 17743.0 17772.0 twisted hylstqtltwlstcslll 17788.0 17759.0 lightly lIh1li1btlypounded IlolilldClliouiitled17756.0 2928.0 hasten hnstcIIhnsteuhastenHip hnstcII1hp 17748.0 hnsteuThp 17908.0 Hip 1hpThp17911.0 dicing 17935.0 17951.0 tg 17932.0 prociSs17948.0 InOCI 9 2256.0 without wlllJolltritboutdanger llrllldangerVhc dangerime 17927.0 IWhenqllito 784.0 18055.0 18084.0 Whenqllito 18087.0 Vhc -752.0 ime quito qiiltoI1r 18079.0 it Jt18095.0 may urny18103.0 I1In 18060.0 lIubu2808.0 removed 1llIlontremovedfromtha -540.0 1llIlontfLOIU removed1vom -496.0 18215.0 18244.0 fromtha 18247.0 fLOIU 1vomtho18236.0 towc111towelnnud IIUlImmmi18231.0 18255.0 18223.0 Ironing Iloallllmouth3112.0 mliitaco laid 1111mliilaidface 1111rlcO 18375.0 18407.0 face rlcOtaco18404.0 down clown18427.0 on alla18396.0 thickly thleleli18383.0 covered cororedcoclClllronhll coclClllronhllboart1 -1008.0 irouuluig-460.0 Ironingboard -464.0 irouuluigboard 18540.0 18556.0 board boart118559.0 ruts ThlHhIH gives GIlgIes18584.0 a18548.0 soft Eortsurface SlI1IucoCorfortho CorIho forlimo 18692.0 18716.0 limo thoIhorelief rollero1if18719.0 ottime18700.0 ctnhrolderetlde18695.0 design toglvo totlro togive 18855.0 18868.0 give glvotlro18871.0 bite IrttolltOOtherwise Otherwlso18863.0 these thesosurfaces snrfncrll2712.0 surfaceswould snrfncrllourJ surfacesiluttoned 19012.0 19035.0 would ourJ 19031.0 564.0 flattened iluttoned19020.0 fiuttcillcilamltho -564.0 19028.0 -504.0 2364.0 time tho19015.0 chief hletbeau beamibeauty lJ beamity nu nuIy 19051.0 19164.0 19195.0 ty Iyat19191.0 thoplcco IUtOpl 19208.0 444.0 19183.0 rumcU ruitldd19187.0 tllltl -444.0 2244.0 l1 19175.0 Bprcad Sptcallipteatl19180.0 i1cleail leautcleailwhite 3084.0 leautblto 19167.0 Ot Otwhite 19327.0 19347.0 white blto 19352.0 doth cotb19339.0 cothmolstlcll niolstened inolstene119335.0 IIIcleon1111 ui1111soapeld 1111SOtlp uisoApad 19479.0 19512.0 soapeld soApad19528.0 SOtlp llvntcI 1288.0 19523.0 1732.0 19531.0 over oel19499.0 timo19504.0 reyerso reyerse2300.0 19515.0 re crllQ 19484.0 side sldcotofUio otIho ofthe 19639.0 19656.0 UioIholinen lltN111ne19664.0 11111umimil19688.0 pass pnss19651.0 tboIron lIonqulcldy lIonqulcldy1l1l1IJzltl -824.0 quickly ulcklyquicklymid ulcklymit 19795.0 19851.0 mit 19824.0 mid 19811.0 1l1l1IJzltl 1hJty1548.0 19843.0 jverdYCr 19819.0 timewhole wholo19803.0 BllraClahmnracebe IJebeing IJeIng belug 19947.0 19979.0 ing lug19984.0 careful nrpCIII1I0t19987.0 19995.0 press prcs20003.0 19976.0 csst t6o 20000.0 19955.0 heavily lleayl1rlicayily3128.0 ontho onth1I 20115.0 20144.0 th1I20120.0 mbrolllclyethiroktcry20131.0 itself HaWIts1f20128.0 Damp Dompllucti IInelllinemilluctiflry IInellI1ry linemidry 20272.0 20304.0 flryI1rysilk tlllteIIk 20296.0 Itot20299.0 iron Irolliromu20288.0 anti nndonl120280.0 quick qlllc1qtiic1action ncllollactionaro ncllollIrQ actionar 20383.0 20487.0 aro IrQar 20456.0 tim20459.0 llor 580.0 20451.0 elements clelllents20443.0 otsuccess fJUCCeHItcceHs20427.0 111in3136.0 lutho inthe 3412.0 Ithostnoothlllg 20411.0 20587.0 20619.0 tho972.0 20616.0 thostnoothlllg smoothing rnnootlilng-680.0 at20631.0 caim 1272.0 20600.0 el1broldclIOw el1broldclIOwlork -1272.0 ombrolderle 864.0 UlcrleXov UlcrleXovYork -864.0 20608.0 OW OWyork 20684.0 20775.0 York lork20779.0 Tribune tlrill1nCTribuneRECIPES TribuneS 21116.0 21255.0 RECIPES RECIPESBlack -1276.0 21140.0 R 21135.0 Eel 21132.0 pIack EC 21412.0 21447.0 Black 21452.0 Iack -272.0 692.0 Raspberry 1428.0 21428.0 nnspbcryJllmr 21420.0 JaraTnko Jarn7n1nfourbqgkets fourJ4Sket3 21436.0 ollr ollrqslctJ 21551.0 21604.0 bqgkets qslctJJ4Sket321611.0 ot21596.0 black 21607.0 lueC raspbcrrlcsnud pIJerricBputlraspbcidespud21632.0 rl -1032.0 21567.0 crush Clll3hcru9lmcrushthem Clll3hthem cru9lmthem 21727.0 21771.0 them bring brIll 21775.0 21763.0 time21748.0 simmering sllUlUollugsimuionlng21735.0 point polut110lntIIIIna IIIa 21819.0 ia 21843.0 21887.0 21960.0 21931.0 preserving prcscryJug21923.0 bottle kettle1ottie21915.0 thontben21900.0 Ilhtptttthrough 3276.0 21911.0 asieve aove 3416.0 21979.0 I1110c -20.0 22047.0 22091.0 sieve 1110c22120.0 ove 22088.0 It51tthero there22107.0 ore22071.0 I1lelltjienty22060.0 ot22052.0 red rOllcur cdr22063.0 currants cdrrnnU curranth 22204.0 22248.0 rants rnnUranth22235.0 onhand nlilnddnliantl22264.0 uso use22243.0 bno 22259.0 uo no22219.0 basket bnllkot22212.0 otthonthenithemInstead thonhlstelld thenilnstead 22351.0 22403.0 Instead hlstelldlnstead22408.0 ot22432.0 np22395.0 22427.0 kct 2032.0 22400.0 et 22387.0 ot22375.0 berries 22356.0 Add Addtq Addto AddtQ 22527.0 22563.0 tq to956.0 22552.0 tl1022547.0 Juice JulcoJukoQUIfur22539.0 baskets tJaketsIm5ketSot2640.0 bincicblncttrMP blncttrMPbenlM -672.0 22543.0 riwp rnspriwpbenlea rnspborr1em 22679.0 22723.0 benlea benlMborr1emnud22720.0 cook 22704.0 gently 22695.0 ton tOilmin mluiminute minlItell mluiittcs 22831.0 22896.0 ute lItellittcs1120.0 22883.0 then thellodd otldaddma22859.0 pounds 1oUOIlsiouuds22856.0 ot22867.0 sugar sligar22835.0 outlandboll 22987.0 23043.0 boll 23071.0 011 852.0 n23040.0 Jam 23032.0 Put lut23019.0 111-84.0 23011.0 glasses audnutIaudcover nutICcr andcover 23195.0 23231.0 cover CcrTUb576.0 paramne parnfflncparnfflncTomato -576.0 paramneTomnto paramneTomato 23359.0 23396.0 Tomato Tomnto23379.0 TonstSIIco TOAstSliceTostSllco23375.0 flrm firm2260.0 ripe toma tomntomflfltomatoes 23363.0 tomflfltoeswlthout 23391.0 23455.0 Itoe3wlt1101t 23496.0 23556.0 toes 23543.0 toe3wlt1101t toeswlthout-260.0 peeling pecllng23531.0 theh1itbern23535.0 season cnsollc1ch cnsollc1chslico -696.0 eachslice eachs1co 23656.0 23711.0 slice slicos1co23708.0 23735.0 w 23700.0 thI11lncb -508.0 pinch pluch23687.0 tsalt salt Bait23675.0 anl1n 23703.0 flfl 23695.0 daslt tInsltdnnlt23659.0 dasltof dnnltofw1i1ta 23679.0 IotwltltopOPllcr 23823.0 23871.0 vwhlto ofw1i1taotwltltopOPllcr 23879.0 p6ppcr papier23860.0 dust 23844.0 lUt 23839.0 flour flaurIIOt2Z23852.0 ord111 ord111brcad -480.0 dm7dm7bread drybread 23983.0 24028.0 brcad1200.0 crumbs crllmhs24020.0 nn11680.0 fry C1123991.0 24036.0 nllttloIIttiobatter untterbl1ttcrbl1ttcr1ntll batteruntil untteruntil 24143.0 24187.0 until 1ntll24215.0 24180.0 rich 24183.0 brown blonn24191.0 24159.0 both botb24151.0 Bideshave Havo11110Havomado 11110malIe 24148.0 havemade 24291.0 24347.0 made madomalIeready reuy24363.0 24327.0 slices 024308.0 wheat whentbreadtoasted 24295.0 br 3204.0 atl 3368.0 atltonstCll 24452.0 24503.0 toasted tonstCll1320.0 ana omlanti24487.0 sligIltl72196.0 24463.0 moistened lUolsteuct1wIthIItUe 24471.0 anlittle alittle 24607.0 24659.0 IItUe24663.0 botwntcr24651.0 Layji LIly Lay24671.0 24636.0 sllci sllc81ICs24623.0 tomato tOJnllto24612.0 tomatoon tOJnlltootomatooil 24764.0 24851.0 24811.0 oil 24803.0 cacTT 1rr 24799.0 rotimT riiiTffiT 24791.0 offcast orioifit24780.0 lni1aiiI2784.0 24775.0 Ifcci 1eticJ not24772.0 notwhllo 3372.0 hotfbll hOtwhile 24924.0 24979.0 whllofbll 25008.0 you ron25000.0 YOl1lunto 24975.0 mako lnao24984.0 sauce nre 548.0 24947.0 Measure MC18Urethotbothosamo tbo1n thecat 25084.0 25123.0 1n cat25139.0 left Iet25107.0 jfo14cbJ1 25155.0 oP -632.0 25160.0 G 25103.0 IiitI1f i11 2748.0 tQm tQ1fltOS tQ1fltOSr -580.0 ocs ocsihUl 632.0 25187.0 25299.0 25275.0 ihUl tht425304.0 25247.0 htofi 25283.0 el tlIICSpOdIiU8 25236.0 1L1c1 nddnddamuo 25403.0 25479.0 samo amuo25483.0 11110 1112.0 25435.0 nm3mt nmmntnmt 25448.0 otConrflonr1824.0 25431.0 Stir oUretir25411.0 smooth thou tbontIIontbonadd tIIonhlll1 thouathi 25555.0 25619.0 add hlll1athi25643.0 ono 011025608.0 cupful 25591.0 cuptulffeilti ffrslf fe9h25583.0 mlU tnlUCIUIUC25571.0 nnU aptlsUrQc aptlsUrQccoot 25567.0 ni1t1V stir find tadfindcook tadcook 25707.0 25771.0 cootnntll until25760.0 ItlJollsuP bolls boils25779.0 25739.0 thick tblcktbJck25752.0 n2888.0 lich ilclirich25715.0 ilclicreamj lichcrenm richcream 25879.0 25955.0 cream creamjcrenmsenson25915.0 Tlth25939.0 n25891.0 sprinkle sprlnklo25899.0 cay cA7cayenne CAyenne cA7enno 25920.0 26051.0 26111.0 enne enno26095.0 26119.0 n26083.0 plncb1lncb26072.0 ot26064.0 snIt26056.0 2400.0 26067.0 pour oerovertblj oerni overfothatqpgarn1s1 26183.0 26227.0 inotl 26219.0 26199.0 parsley nnanndnndserves 26195.0 nnaTurkish andSf 26235.0 tblj ni fotnat9p3JBarnlsh fothatqpgarn1s1Pjlr1rnlh -720.0 26439.0 Sf serves servesTurkish 26551.0 26599.0 Turkish 26575.0 Turklsb04lckenSlngo CblckcnSlngo C1tckenSthgo26559.0 nnddrnT dravf26563.0 aRgood 3384.0 1Sood aood 26699.0 26727.0 Sood26756.0 ood 26748.0 Bfzcd 1264.0 rz fzi1 26759.0 26743.0 fowl towl26740.0 tben26723.0 split splltspilt26707.0 anacut cntcuteatiiploco cntC1cl1plc cutcupke 26879.0 676.0 26916.0 eatiiploco C1cl1plccupke26931.0 26903.0 Th26919.0 ttrojivealargo nlnrgosaucepan BauwpansaucepaltBauwpanmelt -600.0 saucepanmelt saucepaltmeit 27007.0 27075.0 melt meit27103.0 one27047.0 tablespoonful tablcspoonfulnblespoontul27039.0 ot27031.0 butter nail naaaMnailot1 27027.0 naaon aMon 27171.0 27255.0 ot127227.0 27223.0 tablezpoonfultnblelpoontul27220.0 ot27191.0 chopped cboppedebopped27187.0 onion ontonnnd27179.0 nndonehalf 27199.0 IIn midonehalf 1anehalt 27327.0 27387.0 onehalf anehaltoC27415.0 n27399.0 green 27372.0 pepper seeded sewoll27339.0 seedednnfl -428.0 sewollJ seedednui1 27491.0 27539.0 nnfl nui127571.0 llcllopped 27547.0 choppedj choppcd-528.0 27535.0 Cor27500.0 moment lay larlayIn larlu layin 27643.0 27699.0 lu27707.0 tlote27703.0 chicken cblchen27691.0 and27687.0 draw dnnv27655.0 tbothobot tot27652.0 totfire botQrt bottire 27799.0 27863.0 fire Qrttire27867.0 turning turntng27851.0 27843.0 27835.0 piccopieco2788.0 27820.0 IIlIgbtly27804.0 lightlybrowned -424.0 27964.0 28015.0 browned rowned28043.0 28019.0 28035.0 one ono27995.0 quart 27979.0 otbroth brotuorwatcr orIter orWxtcr 28119.0 28184.0 watcr WxtcrIter 28179.0 three 28163.0 cupfuls cupfnlscuptuls28151.0 at28131.0 strained strnlnedto strnlnedtomnt9 -768.0 28159.0 28271.0 28344.0 mato mnt928367.0 01100mb 28315.0 teaspoonful tcaspoonful28311.0 ot2268.0 28299.0 MIloneball onebaltone4laIConeballof onebaltDCone4laICof28431.0 28496.0 DC28523.0 n28487.0 tcftspoontul teapoontu128499.0 tet1 -764.0 28479.0 nCult 28463.0 paprika pallrlkn2804.0 28475.0 0128435.0 whltopopper whltowhIto3396.0 whItooper whitepepper 28591.0 28663.0 popper operpepper28679.0 28659.0 28648.0 tociOre cloves dovCt28651.0 n28615.0 stalk italk3th1128607.0 ot28595.0 celery celeryfnfl cele ceerceletnl 28619.0 ceerma 804.0 28747.0 28808.0 fnfl tnlma28819.0 28787.0 sprigs SprJgs28800.0 otpawlerpanlerl28775.0 Cover CorrwlU28755.0 wlUllltlo withlittle 28903.0 28995.0 28967.0 llltlo lIUlolittle28960.0 saffron saifronsaltr 28987.0 28955.0 ndl1no 2136.0 28971.0 One28919.0 cupfut28911.0 of28915.0 ycl yclwasbed Wet Wetw1sbed YCW YCWwasbed 29059.0 29127.0 wasbed w1sbed29123.0 rico rlcorice29115.0 aud29147.0 1720.0 1952.0 29107.0 hro motivo29067.0 tablespoonfuls tablespoonfalsofprated 3400.0 oftCll ofgrated 29219.0 29251.0 nntllnntU29247.0 time29223.0 brotu brotJtbroUl29227.0 Isbsorbcd IS IiISsbsorbediintI 3404.0 Iisbaorbed 29267.0 29283.0 prated gratedtCll 29279.0 cbecrie cbeuecb 29307.0 co9t29375.0 29439.0 sbsorbcd sbaorbed29435.0 sbsorbediintI -584.0 rntl29431.0 tbe29423.0 rice29416.0 IB29395.0 tender 29387.0 inJlshln5 in IIIInllsbIng IIIiialilng 29551.0 29587.0 Jlshln5 llsbIngiialilng29595.0 usS 29555.0 usg 29619.0 us 29560.0 Ii29583.0 deep deed29591.0 dce 29563.0 platter phittcrnnt129579.0 IL1U nrrangf firrAUInrrangftie -512.0 firrAUItLo nITnII nITnIIttio 29703.0 29751.0 tie tLottio29755.0 cblckca29771.0 orcrQTCr29743.0 UifrU1e29720.0 nwnaa moua4WOUDI29707.0 ofrice IjCCxmlns:ns3 ID9 28387 2656 3444 2176 ns3:type 4340.0 Tried b74668.0 4908.0 T1 4868.0 T1Eugene 5040.0 4912.0 Tltni TJITltniEugono 5208.0 TJIEngono 3460.0 r3656.0 Eugene EugonoEngono3516.0 4152.0 4456.0 Larlo LnrfoLanlo4332.0 ot4804.0 5120.0 701 7M7515048.0 5408.0 Twentlctlavenue 5336.0 5412.0 Twentlctl TwcnttethTiventietI6056.0 Twcnttethtlck -676.0 6088.0 TiventietIftVOflu 3540.0 avenue ftVOflu4104.0 ticket 4000.0 tlck 4464.0 4416.0 4336.0 4524.0 seller 4932.0 5112.0 tho5316.0 5248.0 5236.0 5380.0 Union 5832.0 Sin Sta5760.0 3464.0 3544.0 lont tlont3496.0 3640.0 3712.0 3700.0 Denver 4496.0 Col 4852.0 says SOs4692.0 5340.0 You roulou5124.0 aronro5580.0 ai 5872.0 ailiberty ntliberty 6100.0 aliberty 6032.0 liberty 3964.0 4296.0 repeat repeot4188.0 4792.0 what Wbo5068.0 5108.0 5216.0 Iflrat 5272.0 3468.0 3556.0 first flrat3492.0 stated Bfa 4316.0 4136.0 tell 4116.0 throuhthtougli5052.0 our otir4936.0 5628.0 5I -16.0 5644.0 Iencr4036.0 papcrsnbontDoans 4012.0 papers -1248.0 5284.0 4468.0 ooout 4440.0 4848.0 Dons 4816.0 3548.0 Kidney IChlnylCitineyIlJIs IIl1sIIlis4020.0 4472.0 4676.0 thotbe4596.0 4964.0 sum Slustunsummcrof 4968.0 Slul1er 3524.0 3532.0 mcrof met l1er3956.0 3828.0 of3792.0 1SO lS1JlSX4360.0 tor4240.0 4588.0 3552.0 4536.0 4684.0 hno4632.0 had bml4992.0 hadno 5276.0 bmlo 3672.0 3680.0 3684.0 3628.0 3692.0 3688.0 3744.0 reason teasoU4204.0 tliotllo4320.0 4624.0 Interim 4568.0 3704.0 5092.0 tochange toclnge to1inge 3536.0 3816.0 change clnge3644.0 3848.0 1inge 3976.0 3860.0 my hll3980.0 4312.0 opinion ot4776.0 5060.0 3856.0 theremedy 4988.0 5064.0 tbotboremedy theI 3988.0 remedy rem 3996.0 3788.0 3768.0 4172.0 13912.0 4284.0 4004.0 sold sahlsaki4212.0 4008.0 wileniien4532.0 5008.0 4016.0 4940.0 4132.0 Interviewed IntervlewooifltOtyiOwd3488.0 4328.0 4156.0 tbot4276.0 4636.0 4160.0 It4592.0 4171.0 4904.0 bodbad4840.0 4200.0 a5136.0 nfriend 5268.0 nrlenl afriend 4292.0 friend rlenl nndnnll3868.0 4408.0 acquaintance ocqualntancoacqunintanco4272.0 acquaintancesuffering ocqualntancosurterlng acqunintanco81fterIng 4460.0 suffering surterlng81fterIngfrom 4096.0 4580.0 4480.0 buck IJlckbrick4484.0 4972.0 ache ndleacheor ndleor4616.0 4640.0 3724.0 kidney kidnoykl 4656.0 3836.0 troublo trouble4744.0 14664.0 woulllwouldunhesitatingly 5264.0 woulllt1 wouldflljlmesltatlmigly 4768.0 unhesitatingly hesltnt1l1slyflljlmesltatlmigly4796.0 t1 4508.0 advisethcni advisethcnito IIllvllJO ut1V1504948.0 tben4920.0 tbento themto3528.0 3784.0 4944.0 tako tokotnke4208.0 Doans DOln84952.0 I11I1ne1ICIIflOy5091.0 Pills 4032.0 5104.0 3808.0 5132.0 nas WISwms4560.0 subject Hubject4452.0 5140.0 5036.0 tosevere tolIecro severe lIecro4064.0 attacks nttncksot4960.0 bnck4808.0 backqcho 5260.0 bncklIbe backiche qcho lIbeiche3896.0 5416.0 always nivflhs3800.0 3900.0 01 4356.0 5440.0 Vn8 5428.0 aggravated aggrnntc44352.0 4428.0 5452.0 oggrn 5156.0 5456.0 4784.0 tcil 5228.0 If5532.0 5432.0 sat 5468.0 5732.0 5680.0 5592.0 5796.0 long 5728.0 longat 6068.0 5800.0 lon lonat 5572.0 5600.0 0a3636.0 desk tleakdsk4268.0 4100.0 4436.0 5584.0 strliek strlllkstrnek4376.0 4900.0 5612.0 mo 1U0ma4836.0 5084.0 5472.0 ItDoan DoansDonnsDoansKidney 6076.0 DonnsIChluy DoanICk1tny 5724.0 IChluyICk1tnyIIUIsIerCorl1led 4364.0 5744.0 performed 5088.0 half hnlt5740.0 wbat5356.0 5788.0 5748.0 they the1tliejtheypromised the1promls tliejpromniseti 5888.0 promised promlspromniseti5892.0 4092.0 thy5896.0 might mlchtumiglit5904.0 nt5900.0 least leost5424.0 help 5384.0 5776.0 This Timh5692.0 ThisIhduced Thisihl1u Timhhumu1ued 6072.0 6028.0 Ihduced humu1uedihl1u 6048.0 me4288.0 try 4688.0 the6060.0 rcmel14888.0 5576.0 5736.0 abso abo5688.0 absolutely abolutcly 5856.0 6096.0 110 110lutelystollPNI 6128.0 6196.0 lutely lutclylutelystollPNI 3880.0 3944.0 6208.0 stopped 4512.0 6212.0 thotimebnck4708.0 5148.0 6220.0 nchcnehe5632.0 6223.0 bavohno5684.0 bavonever hnonoer -308.0 havenever 3520.0 6360.0 6375.0 never noerbad hol1had3876.0 6396.0 4344.0 6368.0 pain patti4660.0 6400.0 014844.0 6404.0 n4800.0 twinge twlngo5476.0 sInce elncelnceelnceA sInceA5804.0 5480.0 6408.0 5548.0 lnceImm 3632.0 6504.0 6516.0 Fmr Imm3732.0 4224.0 6524.0 TIHAL TnlALTnzt4144.0 6527.0 ot4612.0 4896.0 5212.0 6540.0 great 6535.0 killne1kidneymedicine killne1mCllIchto kIdneymetlicimie 6672.0 medicine mCllIchtometlicimie4164.0 6679.0 ivhleiihlh 6687.0 cured curl15076.0 6692.0 Mr 4984.0 5204.0 6720.0 5400.0 6695.0 111110 ianio5560.0 rlo will 5936.0 110be3720.0 6808.0 moiled mol11mailed3664.0 4256.0 6824.0 4168.0 6847.0 4372.0 pnrtot5044.0 limo5256.0 United 5540.0 6952.0 States Btnt116983.0 4248.0 6960.0 application nJllI1Rl1nn4148.0 5160.0 6972.0 Address 6975.0 fros IosfrosterMllhurn Iostr IoterMIlburn 5952.0 terMllhurn terMIlburn7096.0 4252.0 lIIhurn 3696.0 Co 7104.0 Buffalo DuttnloRulYnlo5292.0 N 5528.0 15396.0 5620.0 Forsale ForSlIle 7227.0 7232.0 sale SlIleIJy7236.0 alldruggists Itrusslsls7252.0 price IIrlco00 COcents ccuts5420.0 7284.0 per parperbox parbox box boxI boxJ3608.0 7528.0 7636.0 J7708.0 SONLY ONLY 7759.0 WAY 7768.0 TO 4760.0 DO IT 115332.0 ITTho 11Tho ITThe 3648.0 7911.0 The7916.0 fair talr3892.0 7948.0 young jrpungaunc4832.0 7928.0 7940.0 5172.0 5624.0 tolling telllnstelllnsabout 6044.0 tollingabout 8072.0 about bout3952.0 8076.0 bow holhmmv4304.0 Happy IIlipPY4780.0 8088.0 slio shoso4696.0 5080.0 8123.0 wns8104.0 5828.0 8115.0 sho sheshosaw shosow shesaw 3508.0 8264.0 saw sowher htr3748.0 brothers brctbrsbrctb 4712.0 4492.0 8308.0 4476.0 4564.0 8275.0 rs 8252.0 bweball blscbnllbuebali8267.0 toam t03mtoani5312.0 8272.0 win 5716.0 wintho winthe 8396.0 the8400.0 Intercollegiate Intercollsglnt3intercoilegiatagame g3mogameOh 4812.0 g3moOh 5144.0 Oh ehe she4404.0 gurgles 8584.0 5308.0 8612.0 WIIS5200.0 8620.0 so BO5544.0 dolighted 8720.0 lighted 4028.0 8728.0 Umttlilit18731.0 4824.0 hugged hU 8747.0 ced 8752.0 myself myseUtorforJoy 6052.0 torjoyl forjoyl 3504.0 joyl JoyJoyHero joyllIeroHero lIero3708.0 Ioro 9056.0 9084.0 gravo gravu9088.0 gr 592.0 professor IrOressorprotcssor5348.0 9076.0 orpsychol psychology psycholgy6008.0 6016.0 9136.0 9236.0 ogy gy looks 1001e94180.0 9244.0 4120.0 4400.0 9220.0 9252.0 nn4680.0 4956.0 9228.0 Ir ot5392.0 9232.0 Interest 5328.0 InterestHugged interestIltigged 9376.0 Hugged Iltiggedyourself younclfourlcIU5072.0 9388.0 5320.0 9396.0 asks 5224.0 5880.0 9404.0 laladcetl 6020.0 Ind deed dcetl9532.0 3668.0 9536.0 9564.0 3972.0 4124.0 4196.0 must 9548.0 navo iU1TOnaoben bwn4864.0 5288.0 9556.0 quite qultoquito5672.0 9559.0 bsaldd bs1ddbsalddyourself b bs1ddurse1 5812.0 sldd slddrOlrselt rOlrselt 4044.0 urse1 tQ 9724.0 4192.0 4528.0 thlitJudgo thatJudgothlitJudgoA -884.0 thatJudgoNoflene 9711.0 Judge JudgeA 10008.0 10015.0 10012.0 Nonsense NonscnseNoflene584.0 Calendar CalendarTho CalendarhoCalendarIho5492.0 10191.0 Iho3888.0 10204.0 Oyetcr OjrerOyrcr10199.0 IB Isin4392.0 10228.0 4552.0 stupid stuphlthlng stuphlthlngHo -800.0 thingHo thinglie 10356.0 lie10364.0 cannot cllnnpt3824.0 10368.0 danco dance4324.0 4856.0 he hocnnnot10360.0 sing singHo 5844.0 singlie 10524.0 lie10532.0 10552.0 oven oenroad rC311read10555.0 10528.0 write wrlto5240.0 wrltoIndewl writeIndend 5652.0 rlto rltoIndold 10680.0 Indewl IndoldIndend4184.0 10684.0 lletio4420.0 10688.0 Isnt 4772.0 10720.0 very erybright IJrlghtbrightWhen IJrlghtWhen 10691.0 11011.0 4220.0 11016.0 September Septomberschool 5000.0 begins logins5500.0 beginsA loginsA6000.0 11171.0 11179.0 11176.0 ehcol11184.0 af11208.0 fish 11187.0 4928.0 mean I1Iclnrnen5100.0 meanTim I1IclnJhO rnenZha 3652.0 11336.0 Tim JhOZhaMoi fIheJfiI1o3como come4308.0 4764.0 11344.0 shining fins 5588.0 finsAnd finsnd 11491.0 11496.0 And 11504.0 nd 3884.0 sit slLsR11532.0 11mi4380.0 rows rosIth 11500.0 happy halpy5564.0 grins 5496.0 grinsUut grinsJJut grinshut 3776.0 11664.0 hut UutJJut11672.0 Oyster 01stc4572.0 11668.0 4500.0 4916.0 11700.0 seen seenHo 5196.0 seenlie 11991.0 110lielies 12004.0 lazy 132111996.0 his lilahl bed bcdbedAltlioughtls bcdAHh bedMtlm 3780.0 12148.0 Altlioughtls AHh Mtlm12151.0 ugh 4040.0 12156.0 tis 12159.0 iay12184.0 iayAnd doAnd dayAnd 12311.0 12344.0 12324.0 Bolo 12319.0 gystormcn lslermC1ystormncn612.0 oearhcad 0earhc3doeanlicadoearhcadHo oeanlicadho12476.0 110falls fnlls4348.0 12508.0 proy Pr0Y12644.0 12652.0 St NicholasGreta 5324.0 Nicholas NlcholRsNicholasQrcts NlcholRsGrers 4112.0 12976.0 Greta QrctsGrersCaralessncss CaroleclmcssCarnlcrnncssCaralessncssMiss CaroleclmcssMIssCarnlcrnncssMiss13160.0 Miss Elllcott 3928.0 EllicottWhy EfllcottWhy4644.0 13163.0 Why did IJldilid13192.0 OU till dlstlIsdlsqbnrgo tillcJargQ tlIsclargQ 5996.0 3500.0 13320.0 qbnrgo cJargQclargQ13351.0 yqur 596.0 chauffeur rhauffeiirchaurteur110liemadonlado5772.0 such sucha 13492.0 13516.0 fino flno3564.0 13511.0 appearance Appeaance3864.0 appearanceMra AppeaanceMra13640.0 Mra 13652.0 Llpplocott 11plucottDllt Iifplucottrlut4828.0 13660.0 But 5164.0 13655.0 the13679.0 man mall5368.0 haul lia1hl1lia1no hl1IIC haulno 13815.0 13836.0 IIC13820.0 tact tartWlyVlyonce oncowholl5360.0 1wnswosdoz dozing dozlng dozlug 6036.0 13875.0 13975.0 lug inglng13991.0 rim nut3948.0 rll 14007.0 oer13980.0 fnt fatwoman 13983.0 nnll5912.0 Iiimdtlmoat Iiimoat mdmoat moat Jostled JoatledJosliad14168.0 1U0me4300.0 out 14143.0 or14172.0 soatl 5300.0 644.0 soaUOc soatOcsoaUOctober soatOctober Oc October 14195.0 14300.0 tober 14311.0 Smart SrtortSriart14308.0 Set SotSetr4u SetS 14675.0 14784.0 14683.0 r4u r4uc11 4432.0 4516.0 tliaSame SlrIcSameHoDo SlrIclItrDo SamelieDo 14868.0 14871.0 HoDo lItrDolieDo14900.0 14892.0 suppose BUIiPOSO5184.0 after nftcr14887.0 wearonra5756.0 aronmrrlod 6064.0 arcmarried 15028.0 nmrrlod ulllrrledmarried15031.0 well 15036.0 tot tetLettired tlrel15096.0 oacholch5220.0 5640.0 oilieroilierSh otherSho otherWIWn 5988.0 15188.0 Sho Sh 15196.0 WUT WIWn15191.0 WUtibt Wo Wa5016.0 mightBut 5460.0 mIghtflut 3716.0 15348.0 15364.0 DlItflut15359.0 how 11015384.0 4752.0 InowV Imow1ino Vouvo 15375.0 0110 OtVOnoer 5944.0 flOenorlell flOeorJecn 15511.0 er 15532.0 orJecn becn lell marrloJ mtrot1marrloJNo -500.0 15547.0 D1 15516.0 mtrot1Nobut rlcll rlclll 15652.0 15684.0 No obul Nobutbut 15688.0 Ive been boen15676.0 engaged ongngcdOlgngedlOc 5568.0 OlgngedlOclober -984.0 Itber 5616.0 Oclaber 15844.0 15848.0 laber lobertberSot SotMrs Sotr 16119.0 17683.0 4600.0 4628.0 uus 4820.0 4748.0 18524.0 usMrs 19059.0 Mrs 19056.0 Tupman Tiiprnan3992.0 19096.0 prominent promrnentprominentlady prominentlaaypromrnentlady-788.0 19248.0 19271.0 lady laay19267.0 752.0 19259.0 Richmond 19251.0 Va 19292.0 n5232.0 greatsufferer greatsqffcrcr greatsulferer 19447.0 sufferer sqffcrcrsulferer4176.0 19471.0 688.0 womans 4520.0 troubles troublesteils troublesteJs -628.0 troublestells 19667.0 tells teilsteJs19683.0 3840.0 19675.0 she slic19715.0 curedFor 19900.0 19927.0 tome tamcyears 19911.0 19903.0 suffered Ieuf1eredeufered5704.0 withbacknclio 6004.0 withb3ckncbe withbackache 20039.0 20063.0 backache backncliob3ckncbe20087.0 BcycrofiCTcra4652.0 20044.0 bearingdown bcaringdownbCILrlngd 20076.0 wD pains painsIcucorrhcca 5960.0 painslelcorrhol1lInll painsIcticorrhaa 20175.0 20204.0 Icucorrhcca Icticorrhaa20191.0 lelcorrhol1lInll -716.0 nndfalling 11I111nS20183.0 or20179.0 thowomb wombI 20312.0 20351.0 20340.0 tried 3580.0 20367.0 many mODY20327.0 remedies 20320.0 nothing nothingravo nothingC3VO nothingEavo 20448.0 20516.0 ravo C3VOEavo20508.0 IIony4140.0 posUlvo posltlvo1osttlvo20464.0 reUefrchiefreliefI reUefIrchiefI3660.0 20584.0 20627.0 3772.0 20624.0 3736.0 20603.0 commenced taking Lydia LyulftLydl5180.0 EPInlcliarn5 20592.0 E 5964.0 EPlnlclmmsVccrotnblo EXlnlrhntfs 20720.0 20731.0 PlnlclmmsVccrotnblo 20752.0 Xlnlrhntfs PInlcliarn5-1620.0 Vcctnblo Vciotab1o5176.0 Compound CompouDdCompoundIn CompouDdIn-832.0 20855.0 20907.0 20904.0 June Junl20899.0 1001 190120859.0 Vfhea 20883.0 W Hlen 20888.0 lien 20875.0 20867.0 IIndhadtaken Utenthothefirst thollrllt thefirt 20999.0 21048.0 llrlltfirt21032.0 hnte3796.0 21027.0 21019.0 4704.0 21015.0 felt bit21043.0 a21003.0 vast vnataat 5372.0 Improve hnproTcimprochnproTcme 5436.0 Improvement improcmeat 21179.0 ment21216.0 me 3852.0 21167.0 aDd nndandhavohno21187.0 110Wsow21151.0 taleen21148.0 bottles bottlcibottlelbottlciwith bottlelwith bottleswtth 21276.0 21315.0 wtth21311.0 the21300.0 result rciultrcsult21295.0 thnt21292.0 121287.0 feel fcdUko like llko21307.0 21303.0 new newwoman ne neomnD 21407.0 21483.0 omnD21439.0 Whoa When21431.0 21415.0 commcncedUklmrtbo 5520.0 Uklmrtakingtho takingthe21543.0 21599.0 tbotho21580.0 Vegetable VeretnbloVegetablo21559.0 Comiwund ComlNunlCompoiua121556.0 121547.0 feUall aUaUworn allTom allorn 3572.0 21683.0 worn Tom21767.0 orn 21743.0 21716.0 21740.0 WnB21703.0 fast approaching approachlnrspuroaching5128.0 21687.0 approachlnrcomplete -812.0 approachingcomplcto spuroachingcomplete 21811.0 21868.0 complete complcto21879.0 nervous ncnous4672.0 21839.0 collapse collllPleIwebbed welibedweighedwebbedonly weighedonly 22012.0 only 3872.0 03 09083804.0 21987.0 4732.0 Now 21971.0 J21963.0 weigh 5700.0 109K logU109Krunds logUpounds 1nounds 22096.0 22143.0 nounds22131.0 anti3984.0 22167.0 I1n 22155.0 am Improving 22112.0 every eTcrydayrfadly 5972.0 dAyI runds 22291.0 22280.0 gladly rfadlyglndlytestify tCRtUytctifithe5252.0 22239.0 benefits rcrcccivcdMRLIt received 22367.0 22419.0 ceived celvcd22371.0 ccivcdMRLIt MssU MRs C 22391.0 Turin TUllUNTurrA2c22383.0 423 West SVestWest30th SVest30th 5752.0 VCI VCI30th 22560.0 30th Si22531.0 BlcnmondnlcnmondVnVassooo 5296.0 aooo OOOfotftltlf fofltIfotftltlfej forf1t fofltIIgIsual IIolgllloo1I6oc 22647.0 ej 22683.0 olgllloo1I6oc 22691.0 IgIsual 22715.0 ac -88.0 22687.0 abOot 22655.0 Ittlirpwlni 22675.0 Inl lcfltproving provlngtmlntntu flnwIflflO22671.0 nllnII 5656.0 5708.0 ttiuttt c1Moettiutttti c1Moebi22663.0 CINfO CINfOpr 22791.0 22807.0 ti bi22815.0 prouct prouctWhen 22823.0 pr prodcd 3764.0 prodcdWhen ductd ductdVIlen 22911.0 22951.0 VIlen22919.0 nmcdlclnolms 22975.0 a-1104.0 4280.0 22923.0 n1cIUclne660.0 hns1Jccn tins -660.0 5660.0 22927.0 sue sucIIUCsuccessful IIUCccssful suecessful 22948.0 23087.0 cessful ccssful23079.0 23100.0 more snore23063.0 tillmn amillioncases 5464.0 million -552.0 millioncnscs millioncmlclI 23176.0 23255.0 cases cnscscmlclI23223.0 23211.0 23203.0 Jrstlco Jstlcojistlco23200.0 yourlloJf5116.0 23179.0 toBay tosaYr toE9 23315.0 23331.0 tryliieit 23339.0 trying 23323.0 15168.0 23320.0 notbelfevo notbel notbeitevo 23399.0 23447.0 belfevo 23515.0 bel saYr 23407.0 Bay E923507.0 beitevo it23483.0 woultlVOUIL4788.0 23475.0 23491.0 memoSurely 23595.0 23643.0 Surely Rurelyyou -488.0 4556.0 23619.0 wish wsh23599.0 23616.0 roicremain rontaln icmaIn 23635.0 23747.0 23792.0 main ntaln23776.0 weak wenlcweaic23759.0 nnclalclr lcksichalclrSirs sichMrs 23936.0 Sirs JlrsMrs23911.0 rinWmm lnthqlU11nkhimtu23923.0 23891.0 whoso wliosowhoseaddress nddressnlelrc8snddressIs nlelrc8sladdressIs23975.0 24075.0 24080.0 Lynn 1111124059.0 Mass na8SviUnn8Vcr 24047.0 answer 24015.0 cheer choerchoerf cheeruJly cheerlilly 24156.0 24224.0 24219.0 lilly ullyuJly24203.0 nnd24172.0 cost nlllctters nlllcttersnrlltrcslcll letters Ictteralettersaddressed Ictteranddrcsscil 24303.0 24335.0 addressed nrlltrcslcllnddrcsscil24339.0 24319.0 hy llYbysick slcltsleic24316.0 women womenPcrhnuii -548.0 womenPerhaps CD 24427.0 24491.0 Perhaps Pcrhnuii24476.0 perhn18l1hO -636.0 Kho24468.0 lini1U1824455.0 24443.0 the24439.0 knowledge knowl ImowI-492.0 ImowIeftgc knowleige 24460.0 24563.0 24631.0 edge eftgceige24628.0 24620.0 tmnt 4024.0 lOt 24639.0 vilL 24604.0 m 24591.0 hoippp your yuryouicase ca110casetry fisr 24699.0 24727.0 24723.0 costs notbtDJrnothingMAN -620.0 notbtDJrTH nothingTII3820.0 24739.0 today 24756.0 dny1t -588.0 25039.0 25099.0 TH TII25063.0 MAN 25087.0 25068.0 NJI lIP B NEEDED NEEDEDMike NEEDEDMIkeAre NEEDEDMikoATS 25183.0 25223.0 ranch nuchlIueb25199.0 buried hurled5780.0 Pat PaU25191.0 PatDo PaUDo 25259.0 25267.0 Mike MIkeAre MikoATSAre ye 107025388.0 25443.0 Do 25456.0 yo 7025419.0 want wnn aMocthor adoctaor725391.0 aMocthorPatA adoctaor7PatA 25439.0 1L -692.0 1oeti 25415.0 orPatA 4980.0 5676.0 25515.0 afther aClheraftherbeln 6080.0 aClherbeln aftherboin 25532.0 PatA docthor doclhoro 25575.0 lute fuletule25687.0 25763.0 beln boin25735.0 runned 25747.0 OTerILthrolley throl1e25703.0 car carPhat 25847.0 25928.0 Phat 25904.0 25887.0 25907.0 II25875.0 lawyer lawyerJudI lawyerJud awyerJudga-776.0 awyerJudgaFREE -936.0 5448.0 Jndga JndgaSTUARTS 3444.0 26163.0 26259.0 26208.0 FREE 3472.0 FREEwho 26460.0 CINand STUARTSCiNand 4604.0 STUARTS -1260.0 STUARTSCINand 26444.0 BUCHU BUCHUTo 26683.0 nStror IUfter rnT26735.0 26715.0 26688.0 ths lhatIs26691.0 friends trttatfrlndtIbo lhoaholhoKliney aho12Ior Ibov2o who wllo26840.0 IIllh tIb26783.0 Kliney KldiI1KtDe7KlineyCOLDS 26811.0 Ltur Uyer26787.0 UearIJI 26803.0 heart Bliddtr Bliddtror 6084.0 5908.0 der deror 26851.0 26863.0 12Ior v2o 26875.0 ii flu fer1416.0 26900.0 26951.0 sample sampleboltl boPtiStnan 8tnaflStnanOln 8tnaflOlo 26947.0 DII DIeue 26959.0 26987.0 3728.0 JlIIO Blu26992.0 aad acdacdLiter 27003.0 27044.0 27035.0 trut 27019.0 ollahrn iotithefllKldne Xldae727052.0 J1l1chu 1112Ch027055.0 te 27060.0 27071.0 Oln Olo27095.0 27144.0 27107.0 abiolutil 011lteJ1 free otoot 6092.0 4720.0 27139.0 27159.0 Ufdltlpe iledlelnewils27151.0 itnLiter STUoUtT thUARrSTUoUtTDRUO thUARrDRUG 27263.0 lfnUon JJtnUOn4448.0 27251.0 thl hI pa TpeT Addrs 27288.0 oot 27315.0 Os 5720.0 OsG 5792.0 27323.0 Atlanta 27379.0 DRUG DRUOU1O i1iO27364.0 CO 29aIl8t 29SVIl27563.0 27683.0 + 27671.0 27668.0 27660.0 27639.0 G27631.0 O27619.0 O27615.0 27611.0 O27603.0 4996.0 27599.0 C27595.0 O5304.0 27592.0 27579.0 O5504.0 27584.0 27576.0 O5784.0 O27567.0 O0CAPUDlNE OCAPUD1N 3760.0 27751.0 CAPUDlNE CAPUD1NCAPUDlNEOOLDS CAPUD1NCOLDS28167.0 28171.0 COLDS OOLDSandFEVCItISIt andFEVIRIsh1 28451.0 28504.0 FEVCItISIt FEVIRIsh1CONUITION5 CONIImONSCONIImONSis 10 28675.0 28656.0 fln1l1J auil 28643.0 LOest UIIU 28627.0 atDrntstoti DrultoreL Drntstot0o 28735.0 28843.0 28835.0 28831.0 28827.0 O 28811.0 28803.0 28795.0 28783.0 28779.0 28771.0 28767.0 28763.0 28759.0 28751.0 28739.0 4368.0 30480.0 30503.0 xmlns:ns4 ID17 28184 2720 6176 2304 ns4:type 6596.0 6884.0 6680.0 7376.0 6968.0 gg93D 7464.0 gg93DjJ 8160.0 6300.0 jJ jJAGRICULTURAL -2004.0 8304.0 AGRICULTURAL llIllllllAL7044.0 llIllllllALCeiiiicit 8344.0 6592.0 ee 6876.0 GG 6772.0 7068.0 7564.0 3252.0 EeEEGeEGEe 7352.0 EeEEGeEGEeChemltl -976.0 8540.0 Clicinlcrtl ChemltlCeiiiicitStudy Stitj7184.0 Shill 7576.0 7628.0 3480.0 IIf if7496.0 7704.0 7752.0 7796.0 3476.0 Uio Iholiii8044.0 lotto Volaioiolato7988.0 VolaioTho lottoTho iolatoTime Time6764.0 llltnola JlllnolIllinoIs6644.0 7324.0 3647.0 experiment ospcrlmoutlXperlll1cnt7212.0 8168.0 station Btntlonstotlon8056.0 8732.0 I8608.0 1conducting 8768.0 IscolHlucting 8840.0 Iconthicting 6280.0 conducting colHluctingconthicting7032.0 an I1nnum6988.0 7248.0 Interesting luterosllng7188.0 8000.0 3799.0 InvcsllBntloi hlcstlgotlollInvestigatloInvcsllBntloito hlcstlgotlolltoInvestigatloto8760.0 6272.0 6464.0 clotoruilno detormlnedeternilnu6388.0 7192.0 osnct elllctcauct7884.0 chonilcnl chllulcalelienuical7812.0 8528.0 coin comcoir8448.0 coinposition 8784.0 com110sIIIon 8780.0 coirPosition 4095.0 position 110sIIIonat7036.0 time7300.0 potato 110toto7876.0 7696.0 8080.0 addition ntlt1ltlon8012.0 8672.0 8600.0 nieffort onorrort 8832.0 neftort effort orrorteftort6712.0 6620.0 6912.0 beIng bolus6816.0 7356.0 uiiulolIIallo8004.0 ImprovoI1nproo7912.0 8624.0 tin thotimtinyield 8828.0 thoIehl timyield 6256.0 yield 6348.0 Iehl 6576.0 6632.0 allllanti6572.0 6936.0 increase lucrcnsoIncrcaso7524.0 tlio7472.0 protein llrotclniroteln7736.0 content conteni8248.0 contentThis 8312.0 conteniThis 8788.0 6752.0 olk wns vas7360.0 suggested suggestcllstuggesteul8068.0 lJy8296.0 the8216.0 8572.0 taothnt 8504.0 tao fncfoctfncthnt 8824.0 foctthnt 8772.0 6260.0 thnt time6528.0 6832.0 potnto7280.0 probably Irobobl 7848.0 7908.0 forms torllls7764.0 8332.0 timstn sin8532.0 stnl sintile tile 6296.0 6456.0 lo 6336.0 6536.0 tootl6892.0 otimmure niorolIIora7028.0 7504.0 liumnn hUIII1I1hutmumman8032.0 beings beluga8524.0 thnithnnthninny thnnnn thatany nny6492.0 othorsoil eollsoliproduct lirollnct7164.0 lIClpt8292.0 rtceItIII IIs IIIIs6452.0 tbotho6364.0 6744.0 fifth firth6652.0 crop croletOII7012.0 7336.0 5243.0 7372.0 ot7676.0 value vnluooluo8108.0 8020.0 8328.0 Illinois Illinoiswhich IllinoIswhich 6252.0 la6948.0 1I0thot6852.0 generally Kentrallygenroly7160.0 considered consiMret17952.0 consideredgreat 8640.0 8744.0 tgreat 8748.0 5444.0 8816.0 IC1t 8892.0 6248.0 6392.0 C1t 6580.0 pototo7076.0 State StnteStote7568.0 7720.0 IIItrue tniotrJe7824.0 8228.0 however howoer8140.0 howeverthat howoer11mt 11mt6588.0 the6864.0 110tntohOtnto6792.0 7340.0 nlono olonoalono7760.0 Las boshas7684.0 8064.0 too 7980.0 8336.0 large8256.0 5712.0 8664.0 rstarch 8820.0 istarch starch stnrch5843.0 contellt6648.0 umko7476.0 5876.0 7936.0 bnlnncct bnlancctlbainueci8120.0 bnlnncctfood 8800.0 bnlancctlCaod bainuecifood 8884.0 5995.0 CaodfoodThis 6512.0 CaodrXhls foodrhis 6356.0 6155.0 rXhlsrhis6704.0 bns6984.0 6920.0 7348.0 6160.0 time7608.0 6188.0 cause causacouso7544.0 8024.0 7972.0 nuich8644.0 ill 111UJ111feeding UJelt1Jng illtcedluig 6312.0 feeding elt1Jngtcedluigstarvation stanatlon6324.0 and7480.0 disease dlscasol1lseaso7780.0 8380.0 8316.0 6344.0 sec seclions 8776.0 sections 6240.0 tions lions6604.0 6476.0 nudnll6548.0 6900.0 countries 6840.0 where whclo7492.0 8008.0 potatoes votatoesIotntoesoro 8548.0 Iotntoesorollontltnl 6500.0 anarcplentiful 8792.0 anilontltul plentiful llontltnlilontltul6856.0 ond6788.0 7168.0 piotclnploteln6636.0 foods 7620.0 7896.0 lIs 8100.0 6660.0 scarce scnrcoscorcoami omlamicostly omlcosUy 6656.0 ant antcostly 6232.0 costly cosUy6796.0 Individual 1I1111hlnalIumdlvldunl6608.0 pototOCIJ7452.0 havolIao8516.0 beci8444.0 beenfound becifound 8660.0 enfaund 6944.0 found faund6664.0 6848.0 their tllellpresent 111cS 7692.0 7556.0 state statl8124.0 atcultlviv cnlth1cuhtivacultlvivtloit cnlth1tlon cuhtivation tloit tlontion6560.0 special speclnl7080.0 7660.0 selection 8340.0 7124.0 con 8468.0 contain contnln contam tain tnlntam 6488.0 6568.0 flOmone011117172.0 7552.0 7287.0 a7712.0 halt7976.0 tour four8172.0 pot pci101pcicent 101ccnt potcent 6224.0 7416.0 cent ccntotproteill6728.0 7412.0 calculated cnlenlatctl7996.0 8224.0 tbotho8176.0 8476.0 freshsubstance 8480.0 frcsh8796.0 frcshIIlIbstollel 6228.0 substance IIlIbstollelnndond6868.0 seven seen7828.0 twelve tWe1o7591.0 pcv llalimem8492.0 pcvcent llalccnt imemcent 7724.0 ccnt6612.0 7728.0 clculntetltime8128.0 sllIJstanco8048.0 substancetho sllIJstancothosubstancethetheremainder romalnller6428.0 7196.0 lIelng7144.0 7596.0 oilnilstarcll7756.0 starchIt starcllIt8208.0 8039.0 6460.0 6700.0 thought 7204.0 ht 6980.0 that7604.0 n7536.0 variety arloty7672.0 8276.0 otpota 110tn8756.0 110tntocs 1mm 1mmtoes 8131.0 8191.0 8199.0 tocsgiving 1Jlnlgvlng7008.0 11a7152.0 tnlrylahl7392.0 of8028.0 tubers 7968.0 8500.0 8436.0 withnn withan 6216.0 8356.0 8384.0 an6436.0 average melogo6380.0 7016.0 7020.0 IIr teln 8359.0 8084.0 nshigh bllh8652.0 Oft8580.0 astho 8656.0 Ofttho astime time8511.0 best heat6424.0 figure I1gnrfigures6760.0 7344.0 already nhcolly7904.0 Dumlwoulwoul4wouldbo woulho 8671.0 ho106444.0 ot8668.0 Incalculable Incaleulablo7516.0 benefit beneftt8036.0 thecont contRl1mer coulcoinfltimcr coulnumer 8823.0 8852.0 fltimcr Rl1mernumer6688.0 nnll6996.0 ot6924.0 time7128.0 7932.0 sees 8456.0 seesno 8980.0 9008.0 9012.0 rOJson6376.0 8984.0 why 7072.0 7224.0 7312.0 7136.0 7624.0 7992.0 protelucoumcontont coumtent 9132.0 9144.0 tent tont6564.0 connot7084.0 1J09140.0 secured securcdInasmuch Inasl1luh7800.0 9160.0 ItS8560.0 asprotein ItSprotein 9292.0 9296.0 6736.0 hnsbeenlnclcosellln 7364.0 Increased 8164.0 8220.0 9320.0 corn conui9316.0 su SI1SI1gar 9448.0 9480.0 gar 6480.0 9452.0 beets ieots6440.0 9460.0 acts 6812.0 9456.0 etc IIio7484.0 outcome 0lltC01l10outcoumoot9476.0 ex ox8552.0 exl exllerh oxtorlthemmt 9600.0 9604.0 crlnicut torlthemmtllerh -572.0 9628.0 6264.0 9635.0 9612.0 cllt 6860.0 9608.0 11I be7088.0 looked looketl7304.0 7840.0 tJrfrgre1t grctgroAtgre1tInterest grctInterestAU1erlcnn groAttnterestArnenlcat 9760.0 9764.0 InterestAU1erlcnn tnterestArnenlcat6716.0 6872.0 American Agriculturist AgdcuJturlstAgriculturistItnmlllni -844.0 AgdcuJturlstJlnntlUnl Agriculturistikindllng 10064.0 Itnmlllni JlnntlUnlikindllng7656.0 10068.0 Htei JlttlIleeHteiIn 7920.0 JlttlIn IleeIn 10232.0 subduing lIuMulngsubdultig10236.0 bees boeshoes7468.0 7892.0 smoke smoko61110108360.0 notoverdo 8588.0 1I0t1I0toycrdo 10384.0 10392.0 overdo oycrdotimetIming7488.0 If7328.0 10416.0 7612.0 emuko11111010theui8388.0 themfor 8460.0 themtor theuifor 10539.0 10547.0 tor6532.0 tholimo6420.0 10576.0 purpose vurposo6724.0 1IIIl 7332.0 OSO 7440.0 otremoving rmolnlhouoy liommoy8288.0 houoyfrom hono honotrom liommoynoun 10699.0 10707.0 trom6284.0 10731.0 noun 10704.0 timesuper suprstuportIo7200.0 miot7400.0 drive llrho7668.0 8116.0 tlmo8376.0 smolesmokei smokeIn10851.0 10859.0 In6304.0 10888.0 10864.0 otthothoentrnllce entrance Thnt Thmmmt10856.0 vIIldllyc8348.0 driveI dllyctho drivelImo tholImo11027.0 6432.0 11019.0 trolllfroumitime7176.0 brood blOotlchamber chombertoIho totho totime 11168.0 Ihotho11200.0 8111CrsimperThe ThoTimefewer tewcr7808.0 beel11196.0 8392.0 tiara hnvo11110hnvoto 11110totiarato6244.0 11323.0 11331.0 contend conteml6340.0 6992.0 wllhIII11328.0 time7832.0 11352.0 I1l1persimper8260.0 time8188.0 het8464.0 hotter hetter hotten 11480.0 ter tenTurn TmnUl 6904.0 11512.0 7216.0 0110onecorner 7436.0 11483.0 ot8200.0 timequilt quiltand quiltIInl1 11627.0 11648.0 IInl111643.0 BiusUo smmmehoBlll 11676.0 troll1promth61IIO7560.0 top 7508.0 7860.0 11640.0 tbls8152.0 11635.0 11632.0 I1rhedriveho I1rhetho drivethe 11787.0 11804.0 thothe11800.0 IJeesbcs11795.0 below helowimen yon YOI1you11820.0 remove remootime8520.0 thequilt timequilt 11944.0 11960.0 l10do6520.0 11952.0 11956.0 hold hoMimohitimenozzle 1I0zzi07744.0 ot8244.0 timethesmoker the8mokel timesnmoker 12108.0 12116.0 smoker 8mokelsnmoker12124.0 7040.0 close closotimebec3boeVy 1yly8648.0 12132.0 110soloins 110t10lug sotoitmg 12268.0 12272.0 loins t10lugtoitmg12276.0 havohao12295.0 moro inoromore7592.0 titan7960.0 12292.0 onco oucesOcu soum12287.0 nalovlco nnoJco ammovlco 12420.0 12428.0 lovlco noJcommovlcoBingo slngosinge7060.0 12424.0 the7316.0 wings wlngottime8192.0 bcobcOl8596.0 loDolot Dotlot lohot 12572.0 12588.0 lot tlothot12584.0 drlo12580.0 thotime12576.0 smoku sl1IeleusmuokuJIIIn12604.0 osIt8300.0 12599.0 intended Incmlcd 8740.0 Intemlclt 12732.0 12740.0 tended cmlcdtemlclt12736.0 heat heltimept6928.0 12764.0 a7368.0 smelting smmmelting7512.0 furnace turnoce8156.0 furnaceTlicro turnoceThero furnaceThere 12888.0 12895.0 There TlicroTheroJI12919.0 reasoim12924.0 7228.0 n80n 7292.0 12892.0 lu011nitthlnstimhmigsKuoiiRU IIOIlrhIumouilmIumouilmFs IIOIlrhIs 13040.0 13052.0 Fs13079.0 ns6552.0 IoodliS6844.0 nfeast tent7640.0 13044.0 187520.0 7792.0 13076.0 on7944.0 01l1111OC1b 01l1111OC1bAIns proverb proverbAlnayfl proverbAnays 6328.0 13196.0 13212.0 Alnayfl AInsAnays13231.0 use 7220.0 13236.0 it7396.0 13204.0 bcovcll IJeo1Ibeovcil7296.0 8212.0 handling halllllllhmnuidlhuighandlingbeet hmnuidlhuigbooshalllllllbacH 13348.0 13367.0 beet bacHboosBy Dr6496.0 13359.0 cxpcrlcnca ctpellencoopon1eumeo13383.0 3011ycim13356.0 riii8496.0 gain golllgaimigainconfidence golllconf1t1ellcl gaimionfidcnce 13524.0 confidence conf1t1ellclonfidcnceEven BenEveui6880.0 13519.0 thouolos7804.0 l1aoimave8368.0 haveyour l1aoour imaveyour 13663.0 13703.0 6288.0 13708.0 6508.0 veil 0117156.0 13671.0 hat hiltlustroally7644.0 13676.0 protect protcctprotectvour protcctourprotectrout13823.0 13864.0 vourrout13839.0 tllco6888.0 13831.0 shoulll6828.0 time13828.0 lJees7956.0 suddenly slldelllystithlcmmiy8592.0 boohoboocOll1e hooIne 13868.0 6204.0 14024.0 come cOll1eoIneangered onuelcl1angeredIn onuelcl1In14119.0 6544.0 hnlldllngimamidling14176.0 manipulating mnnlplllatingnmnnIpu1ntng7320.0 14140.0 frames fromesframesnf fromesotframesf14292.0 nf otbrooll14331.0 7000.0 honey honl 110111imold14295.0 timom7700.0 8144.0 wllhwhimbothlands bothmantis 14455.0 lands 1101118mantis14491.0 6896.0 14460.0 theymo 14480.0 IInnglmnimg7856.0 pcrpon pelponperpoimpcrponllcularly pelponl1lculnrl perpoimIicuinrl3 14604.0 llcularly l1lculnrlIicuinrl314612.0 otherwise otherwlso14635.0 3OU14640.0 aio 110ntoliable Halllotorcnk totlrenl toLmrcnlc 14756.0 rcnk tlrenlLmrcnlc14800.0 6684.0 time14767.0 combs cOIIIIJSShould SlIoulll7388.0 14787.0 YOIIotm meet metmootmeetwith metwith mootwith 14928.0 lueh6976.0 14952.0 nnaccident aecillelltwhim14947.0 a8132.0 IJroollbroodcomb IJroollcomb broodoumb comb oumb15084.0 JtIttimeport pnrtopartsmviiihnnsbangtogether togcthertogetimer8148.0 togetherreturn togctherretllrn togetimeroturii 15232.0 15248.0 return retllrnoturii15243.0 15240.0 oncoallCo15236.0 time7852.0 hlvo hhoImivo7784.0 the8512.0 beellbeesvlll beellwill beesiviii 15400.0 vlll williviiiery soon BOOHlIoon7240.0 repair 15395.0 timedamage 11nmageIe8488.0 Ift IeIt bq hgcompletely comllletclysevered lIorctl15576.0 7864.0 a111l1lgcrdangerhereof 111l1lgcrthereot hereof thereotIJrlng6676.0 timebroken rolen7632.0 edges cllgestogcthcr tootlmer 15747.0 gether gcthcrotlmer15896.0 807244.0 time15856.0 be8432.0 1mm8372.0 8556.0 itrlginnl -92.0 8712.0 ite 111iterlglnal 111orlslnal 16008.0 rlglnal orlslnalrlginnland16016.0 tlo 7616.0 tlicro Ulerotimero8016.0 8484.0 withinrrow withnnrrow withrnrrow 16160.0 16208.0 inrrow nnrrowrnrrow6740.0 16179.0 bits ortape topeItcturn Uctllrnhtetmmrn8180.0 16168.0 timecomlJcombo comlJto16323.0 16371.0 0thotbo6708.0 16331.0 hive hlvobho16336.0 hnduttcrnbout8284.0 twenty twentyour twentyrom 16475.0 rom 16520.0 16491.0 hours 16515.0 rell1ootimetapes tape316483.0 w111beill benil beiH 16648.0 niliHrlghtAmerlcm rghmtArnorlcanright CultivatorJiuwane Cultivator OnlthatolCultivatorHuman -664.0 OnlthatolJlulUlme 16944.0 Human JlulUlmeJiuwaneFtcit lItel1rectling 13iglingAny 8052.0 Jln JlnAny 13igAny 17067.0 17083.0 Any 17107.0 one6964.0 17080.0 wliolIDSimas17099.0 ocr17096.0 weenIIccn7868.0 ahorse horso8364.0 horseniggling horsostrugglIng horsetrimggllng 6276.0 17224.0 17240.0 niggling strugglIngtrimggllng17235.0 7140.0 17259.0 securo sccuro17227.0 timecontents coutentsot8716.0 17248.0 0accd 0teed acod 17379.0 17403.0 teed ccdcod17395.0 bag IJIIS17392.0 fastened talltcnet17400.0 17384.0 imi head hem1henilw111ntatnco ntonco 17536.0 17584.0 nco onco17552.0 rccognlzo recognIze17547.0 thotlio17539.0 necessity necell81tyof17560.0 soma 801U0somesomaraproveincnt 801U0Improvemcnt somemprovement 17696.0 17707.0 raproveincnt Improvemcntmprovement17704.0 timo7288.0 dcslS17600.0 ottllesotimesa8352.0 thesehlugs tllesothlugs timesahmings 17843.0 17867.0 hlugs thlugshmings17859.0 purely trom17883.0 a17856.0 humane humanohum -516.0 17880.0 8060.0 stand standpoint standmint 17895.0 18003.0 18024.0 mintTime ThoThulIag18011.0 JB Is7380.0 tlllltonell7456.0 sucb18027.0 navay nway aray 18160.0 18212.0 vayray18179.0 tbat18171.0 18168.0 timeanimal muilnmni7584.0 bas18184.0 coumconutncd consUned coumtuned 18315.0 18336.0 tuned utncdsUned6696.0 Ilort18356.0 Pnr 18331.0 ot6908.0 18323.0 hililila18320.0 meal menlmeattimoromnlnderremaindereposes romnlnderlepose8 remaInderOPOaCH 18472.0 18519.0 eposes lepose8OPOaCH6756.0 18491.0 18488.0 the18483.0 bottom otthe18475.0 bog8452.0 nacvel nloel aeve 18624.0 18651.0 cvel loel18679.0 eve 18648.0 just 18640.0 Imolowhelo 18635.0 thntot7836.0 18632.0 imis18627.0 mouth anllandut anllout andalt 18779.0 18815.0 alt18807.0 ot18803.0 the18795.0 animals onlmals18787.0 reach rcaeh18784.0 bin hilIhis8628.0 otoforts otforts ofarts 18931.0 18964.0 orts fortsarts18959.0 get gat18952.0 thefooui18947.0 fool1ho hetosses tossos18939.0 heallhmomiheadvlldly heallwildly hmomiviidly 19091.0 19119.0 wildly vlldlyviidly19111.0 around orounll19104.0 anti011111 7500.0 thus securing securlt1gscctmritmg8040.0 19115.0 0aow 0fow aew 19279.0 fow 19303.0 ow ewgrains ItInlosha19263.0 scatters scatterathegreater grenterpartit parttpartmf19408.0 19439.0 mf19436.0 6352.0 19419.0 menl19415.0 hopelessly hopele8slynroulltlthethoground 8804.0 theroumn1 19591.0 groundThero ground roumn1groundThere roumn1There 6332.0 19740.0 Thero1I0sImna19735.0 bcon19727.0 recently recontlyintroduced hltroducct1Iqtrodncetlintroducedfor hltroducct1torIqtrodncetlor19875.0 19908.0 tor19932.0 purposonnoso 1I0Soimoso7900.0 19887.0 19884.0 JIIwhlqh whlqhho 19879.0 whl wlmi8724.0 1J bbbe 1J1ho 20036.0 1ho be20055.0 level 10felioveiot7048.0 20047.0 timgrain aralnJI7648.0 7880.0 maintained malntnlnetlatntho nt1ho atho 20220.0 20239.0 annie Bamonmo20207.0 POiuit20196.0 constantly constnntly8184.0 thotimetheupply tholIlIpply timeuppiy 20343.0 20372.0 upply lIlIpplyuppiy20359.0 compietely20348.0 exhausted cxhaustctlThegeneral Theotmcrtii 20524.0 general otmcrtii20540.0 appeoranco7652.0 otthllImproOoImprovencnt ImproOoment Improvenent 20655.0 20687.0 ncnt mentnentU20679.0 shown 8hownsimowmm20671.0 20668.0 theaccompanying occompanyJnGaccompanyingcut occompanyJnGItaccompanyingmmt-916.0 20812.0 20880.0 20851.0 mmt20836.0 ThoTbo20831.0 baslet20823.0 nmnium7984.0 20815.0 receptacle receptaclo8700.0 la 18is8636.0 laDf 18CJt isIf 20972.0 Df CJtIf20996.0 time20983.0 ordinary circular clrC llnr 20980.0 form tormforumaiinHat aJJnt iilat 21127.0 21159.0 Hat JJntlat21143.0 maclishallower shaiiowershallowernan shaiiowerbanshallower1hal1 21279.0 1hal1 nan banusual usunltime21319.0 purllo80purposootgllnggivingho gllng1ho 21467.0 21459.0 nnlinalonlmol21455.0 21444.0 breathing IJrcathlngbreatimingfrccdoniIho treetlQm1ho frccdoni treetlQmreedqrnreedqrnrho 21623.0 Iho 1horho21615.0 supply 7024.0 tube tuboof21627.0 canvas cnnaalllamid21619.0 com comecomnunlcatcs 8808.0 comJDunlclltes comenunicaes 21779.0 JDunlclltes nunlcatcs nunicaes21759.0 21751.0 thathothaTcW thoJf timeitihich 21903.0 21939.0 Jf 21927.0 TcW 6384.0 Hfvbleh itihichot7180.0 l1IetolontI21908.0 contains contnlnscoimtnlnsu8680.0 ubutterfly IIlJUttcr iiutterfiy lJUttcr butterfly utterfiyy 22083.0 valve valvoaho22079.0 tor7208.0 7532.0 22075.0 thoWopurposoorrcg regrcgilatlug rcgulatlng regminting minting ilatlugulatlngtime22227.0 otfeed CectlTlilsreguntlou 8420.0 regu regulotion ntlou lotionhoneerfanecessary lIeccsar1onl1onlyvhcn onl1hen onlythou vhcnthou22555.0 the6584.0 ot7664.0 22535.0 theotfluefluey fineyfineil1 il1 22744.0 22712.0 grolnd6932.0 grnln22699.0 Drtimlsarrangement nrrangemenlarrangerneninrrangemenlho arrangement1hoarrangerneniho22875.0 22864.0 10elotthotlloItInln22851.0 22843.0 thebnsketIIftlinlwnys IIinlwns ftmiwnys 22995.0 23024.0 nlwnys inlwnsmiwnyskept kCltnt23016.0 thotile23003.0 ot7888.0 22999.0 nbout8096.0 tbtthu8544.0 tbtop thetop 23151.0 op 01123187.0 thegates atcs 23160.0 tlmrouglm23155.0 fhlcbononers ent eners 23307.0 23355.0 23367.0 ers 23344.0 time23347.0 source sourcoot23312.0 sUfJplauhuplyXlaTheubo Thetube 8860.0 1tubo 23504.0 ubotuboholding boldlnltho tho23499.0 reserve rcserve23464.0 1111111111suiiplyheld beldholdheldu holdUbeldin 23663.0 I1nfl 23640.0 upright 23624.0 pONIUon23627.0 tutfeettutonett feetmmcd 23779.0 23815.0 ened onettmmcd23831.0 oer23800.0 23787.0 nnlmall7820.0 neck hy8112.0 23795.0 meant menmmenus8408.0 meantDf menmofmenusif23939.0 23971.0 ofif23996.0 23967.0 Htrap strnpstrep23952.0 TheroTimere23944.0 thllstlmus23960.0 23955.0 reaSODreasonwhatever reaSODwhntover reasonvhatover 24083.0 24127.0 whatever whntovervhatover24115.0 24107.0 time24104.0 imorso24099.0 7844.0 24088.0 throw 8632.0 lilt lilticad 8812.0 Imihlhonl1ln Imisend 24227.0 24283.0 honl1ln send icad24271.0 the24263.0 aIr nlr24267.0 7448.0 24259.0 24248.0 possession pOllsesslon8428.0 24243.0 otthfi tlld24235.0 thfibut tlldJPJalu tim timraIn 24395.0 JPJalu raIn 24431.0 lJut24423.0 ifliebe7052.0 24408.0 24411.0 havohovocontracted cootractctlcontractedHCJIAHB cootractctlEVJU2fB contractedS contractedEVUAXZ 25092.0 26867.0 HCJIAHB EVJU2fBEVUAXZNOSE X08BiOSBnAG DAOflAG7816.0 DAObe nAGtbe flAGbehabit tbe 6308.0 27083.0 behabit habit hllblt27079.0 thoroIIIprovision provfsJol127068.0 rondo modomadefcrureventing fct fcrfctirevcntlng IllrerenOng 27239.0 irevcntlng llrerenOngureventing27231.0 spilling spl1llnapIllInottbothoIIItiminbo timbe 27235.0 Itbe 27383.0 27411.0 be27395.0 begfastening talltcnlngtliotimO27391.0 topnothcr topAnother toptnother 27555.0 Another nothcrtnother27543.0 similar alplllllrjlevlce JlevJcoilevlca7964.0 tImebottomuts bottomciabottomcuts 27695.0 27723.0 cuts cia utsoff orrotTthotimeentirely cntlreJrIloslred Idodrcd isosired loslred dodrcdosired27859.0 27888.0 Philadelphia IIDPhlladelphlasoPbiiadclpbfaRecorJ RccorJflecoriRccorJSllenee RecorJSilence 4 28155.0 Silence SlleneeIIIsOolden GoldenOoldenA GoldenA28283.0 28295.0 thoughtful timougbtfuitliOugbtCnllooklnj looking waDwnl28291.0 eating eatingbis tllUn cntlntllUnbll cntlnmis 28447.0 28467.0 bis bllmis28455.0 lunch Junchmunchrestaurant reslaurantSuddenly 8688.0 110liehosaid 110I lieaid 6176.0 28575.0 28623.0 said laidaid28603.0 musingly muslnglrwonder 28599.0 Invent Inventcd Inventdinventacd aphrase ph 28791.0 rille SlIencoIIgolden gldcnfgcildcngoldenProbably gldcnflrobabl110mo gcildcnIrobably 28927.0 Probably Irobablylrobabl110mo 28943.0 poor fellow CeUo 11110ivijoImd UIIImndaawife IIIfe iirife 29091.0 wife rifeIfe IL29079.0 parrot 6732.0 29099.0 ILleftnyearollf sevenyearohfev -868.0 29071.0 nyearold boy b0129095.0 anphonograph npboJJograpb abonograplm 29239.0 phonograph pboJJograpbbonograplm29231.0 Rnd29259.0 barber berbernlllsaidhi hicompanion hil JpehilCOll1jlInlon Jpeoznrnnion 29383.0 companion COll1jlInlonoznrnnion29391.0 tbcbitterness bltterneIblterneot29411.0 oue0110ouesrlo 8848.0 oneLo 29539.0 29568.0 srlo Lokaow kaowskao wbcrcof whereotwbercof29543.0 lie peaketb peatetlszpeaketbzpeaketbS 30463.0 xmlns:ns5 ID19 25976 2680 8896 2328 ns5:type OEQQAFI DIQQAnIIIIQOAR9864.0 TAUGHT TAUQHTrAUaHT9752.0 10500.0 LEOSON LIGSONLtoSoN10696.0 LEOSONWhat 11384.0 10808.0 LIGSONWhd 10812.0 LtoSoNWhet 11380.0 9024.0 What WhdWhetHappened 10160.0 10504.0 anenAblebodle AblebodledAbIebodlc10660.0 AblebodleTramp 11568.0 AblebodledTrzmp 11484.0 AbIebodlclramp Tramp Trzmplramp9924.0 Who 9820.0 10320.0 Asked AikedAaked10220.0 10824.0 Aim AimsAimA 11160.0 AimsA 9128.0 9284.0 beggar beggnrapproached Appr03cbcd9740.0 10596.0 n10548.0 10736.0 husky bUBkyyounman 11180.0 youn Olng11476.0 11488.0 11260.0 Olngman 8996.0 9380.0 9268.0 9620.0 Broadway DrondwliYanti10280.0 nnl 10616.0 10740.0 Wall Wailotroo otrectetrocotrooand otrectand etrocand 8992.0 exhibiting oxhlbltlng10048.0 threo three9992.0 centoccnte10396.0 10860.0 10800.0 11052.0 a10984.0 grimhand 11188.0 grim grlm1grini11492.0 grlm1hnnd grinihand hand hnndtold 9812.0 n10000.0 piteous 9888.0 into tnlo10464.0 10636.0 ah 10832.0 oC10796.0 n11360.0 jo 11256.0 jonear Job Jobnt13r 11572.0 Jonear 3676.0 near nt13r9372.0 llCth llGth9276.0 UGthstroot 9808.0 street stroct10180.0 10312.0 nnt 10544.0 10640.0 conts conl3contalockln lackin10988.0 locklnto lackinto11204.0 cklng 11116.0 cklngto 9172.0 3867.0 ray laYpay9108.0 9744.0 faro tare9672.0 tareSure 9748.0 faroSure 9804.0 aroSure 9196.0 Sure 9656.0 ald tnlllsaid9488.0 tim9920.0 10240.0 ycuns ycmg10184.0 lng 10632.0 10692.0 11224.0 Han HardliarHanluck 11556.0 Hardluck liarluck 8988.0 luck 9408.0 9248.0 HT 9688.0 9968.0 9916.0 9896.0 10116.0 Havent Unoot10732.0 the11056.0 changocimangchangebut 11520.0 changobut cimangbut 9272.0 4331.0 11rop9648.0 aboard nboartl9568.0 10172.0 the10096.0 10452.0 ear10372.0 aoll10664.0 11060.0 Ill 10976.0 11312.0 pi pmt11232.0 pitho 11464.0 11316.0 py pytho 11548.0 pmttho conductor conJuctor9188.0 10084.0 ItoItii9904.0 10352.0 4504.0 coodgoadtor10644.0 10968.0 Humlrci lundrelflundre10908.0 Humlrcinnd flundreand 11036.0 lundrelIlnd 11460.0 nndIlndsteenth stoonth9868.0 otreotetroot9796.0 10308.0 audlIud10244.0 10604.0 moro11032.0 nnd11340.0 thitho11264.0 thiJobs 11544.0 tholobs timlobs lobs Jobsyoura yournyouraTho 9708.0 yournrho 9436.0 ouro ourorho 9116.0 rho Thotramp 9964.0 Jupprostcd supprosleduppreseed10784.0 10676.0 dingus dismiadingusas dismiaasdl ual ualnEl 5167.0 nElboat boot9112.0 9496.0 cauIIlaudnud10040.0 10428.0 theathletic 10624.0 chat cbnlcbachathustled cbnlhlstloll cbatmustiod hustled hlstlolltmustiod9540.0 9872.0 9780.0 10076.0 thecnr10648.0 5311.0 10572.0 11020.0 10936.0 laugt loughinugi11092.0 laugtand 11536.0 loughand inugiand 5471.0 9288.0 nslap sl 9632.0 9544.0 9776.0 10020.0 the9940.0 shoulder simouldorshoulderAt shoulderAsimouldorAtAt Liberty 9216.0 streol9840.0 10376.0 the10296.0 5636.0 panhandlor1 llathnndlorpamhandior10580.0 panhandlor1mado llathnndlorIMdopamhandiormademadoIMdo9324.0 9616.0 the10036.0 door 9932.0 10496.0 I11Hl10844.0 thoro thora10728.0 11292.0 mol motmoltho mottho 11508.0 inc incthe the9264.0 9176.0 9732.0 youngman 10128.0 10216.0 10480.0 10608.0 10956.0 playful plaI1yplaytuhl10872.0 playfulpushed 11452.0 plaI1yIushcd playtuhlpushed 6116.0 6120.0 pushed Iushcd9428.0 9852.0 bael9756.0 minl10472.0 10404.0 10568.0 6124.0 raid caldtldUIsni ISltIsaIsniHundred 11528.0 ISltHundred IsaHundred 8976.0 Hundred 9596.0 9928.0 stconth atconthetcontimyet 10840.0 11088.0 Donl DonDonlyou DonlOU Donyou 8972.0 6451.0 be9504.0 anxious anxlouB9424.0 10112.0 tor10380.0 10652.0 going A1t11311244.0 tinway t113way timway 6611.0 9300.0 mrsoUmyselfAt mrsoUAt9328.0 Cnnnl Canal9692.0 thin10136.0 boggarboggllr10400.0 10960.0 appealed nppenlel1appeniom10904.0 appealedto nppenlel1toappeniomto9204.0 9100.0 ednductoredaductor10512.0 Get Gel10164.0 10836.0 attIf10996.0 11308.0 yamyouwant yamwant 01wnnt wnnt9500.0 sahlsati9280.0 10168.0 11028.0 11132.0 11304.0 bndhunhadboon bndb hunboon boon 9044.0 takonU1kou9816.0 Into 10156.0 thin10440.0 secret secrotbillUn ImIms11248.0 Unthinking Imthinking Imsthinking 7295.0 thinking 9660.0 7447.0 youro 3ouro10208.0 better bolterbettorort10972.0 7455.0 andthats nndam11516.0 nndthata amthats thats thata9336.0 9652.0 jolo joho9576.0 Look timefists fIts10944.0 onox11296.0 orUio onUIO oxLimo 7743.0 Limo9260.0 manAt manAl 9104.0 Al9332.0 houston HouetonUaudon9952.0 Direct Dtrectstreetthe10328.0 10668.0 applicant npIlIcant11348.0 tom foitor11280.0 foialms tomalms 8964.0 alms sneakod snealodsneahedtorthefront rront10916.0 loorbulbuttho bulthe theImportunate Importunato9168.0 mnn10052.0 10536.0 10408.0 WI8wanonand 11408.0 8956.0 9304.0 threatened lrc1tonodthratonod9308.0 10016.0 10124.0 blm10488.0 demolition l1omolltlondomolitton11356.0 So Sc11172.0 Soho Sobo Scho 8960.0 boplanned 9784.0 astrategic strntegloatratoglo10592.0 movement movoDvmtznovonpnt10520.0 11392.0 hitime 11272.0 hiIntho time9224.0 execution ot9844.0 10108.0 10044.0 10556.0 heiso10776.0 worked workel111324.0 hiswar hIswar war 8899.0 sent Bent8896.0 scat 9824.0 10764.0 doorAt 9096.0 9060.0 Sixteenth IIlreotstreot9956.0 whore whorowhcro10424.0 tixocarstopped 9528.0 tartransfers trondorstrausfors9712.0 10444.0 10628.0 nnllend10564.0 tromthc11240.0 thocrostown thocroutawn thccroutown crostown croutawncroutownlines 11n0iIne39944.0 9415.0 lio9412.0 11024.0 chanceand chance chlincechlinceInd chanceutud Indutud9552.0 took toottooc9184.0 U10192.0 9580.0 wan wnowao11216.0 busy 11152.0 busylotting bus bus10Ulng lotting 10Ulng9743.0 cm emortoftfirat9908.0 10344.0 plaaso ploasoplanso10852.0 the9735.0 waggling wnsrnzlngwasgasimiglittbotimooky skywhistling whllltlingwhistlinga whllltlingIl8952.0 10028.0 Ilsort9020.0 9432.0 air 9348.0 lr Ir9792.0 the10316.0 slipped sllpPodsiIppo110768.0 11388.0 11300.0 timeplatform 9156.0 plat Corm 9464.0 9848.0 reached reachad10080.0 thestop 1ItopatopstopThero 1ItopThero atopThere 10351.0 Thero There10395.0 9340.0 pontlorous ponderous9492.0 10324.0 10387.0 womnn10252.0 bound tobo toho 10516.0 10ho10176.0 thehalted IInJtod11268.0 Mmhimfor Mmtor tor10715.0 Ii9356.0 mamentmomentIt mamentIt10848.0 10883.0 waRwasfata1 atllfati1Tho111010880.0 11140.0 10875.0 mans mnn10980.0 manshand mnnhand foil folloH11044.0 9584.0 hlohie10256.0 shoull1ornnd10820.0 timethoyoung thoYOlnr timeyoung 11192.0 YOlnr9444.0 mllnvolco 10lcoYolcoshouted sholtooshotuted10264.0 Wowl WawlWowIWowlIn WawlInWowIin11420.0 11339.0 11368.0 earTheshout aboutnndend10560.0 surprise lIurprlsosurprisegave lIurprlsoglWsurprisegar11527.0 gave glWgar9836.0 Impetus Impotus9772.0 10420.0 thntcarried cnrrledhimto 11660.0 the9400.0 oljowalk oIJolnllnIlowailc9976.0 11692.0 nregardless rogardiessregardlessof rogardiessof11695.0 rO ardless ardlessor 11816.0 11828.0 or9164.0 11119416.0 9624.0 bls11852.0 11855.0 full rul111831.0 speed 81oodsixcodbohogalloped bolallollol1 11983.0 galloped lallollol112020.0 across ncrODSacrons10060.0 the10340.0 lawns lan8Rudend10712.0 crocus croCU11012.0 crocushodd croCUhed crocusbaths 11440.0 baths hoddhedat9240.0 10088.0 Ian Square SquuoWithout Withoutbreaking Withoutbroaldnc Withoutbroaking5hla 12303.0 12308.0 breaking broaldncbroaking5hla hll12316.0 stride 8tll l0 10388.0 hurdled hlllll1edimuedled11228.0 overa overnnline linoIIno12484.0 atbenches honchosnsits12479.0 bo10744.0 11080.0 landed Innlloll10992.0 landedon Innllollon12631.0 12664.0 9180.0 12636.0 the9472.0 12640.0 walk nn9768.0 overready ovoNcadyovorremniy10004.0 policeman pollcomon10760.0 policemanfell pollcomontellpolicemantoll-652.0 fell telltoll12796.0 ltb imisclub chilJclimbclubWhon chilJWhbn climblVhbn 9092.0 12964.0 12968.0 Whon WhbnlVhbnthe9468.0 12971.0 cnrwont wont 12995.0 10748.0 again galn10656.0 11096.0 withthg withnit withthQ nit thgthQIndignant InlIgnantlnIlgnnntponderous polldorouspotidorouiebOobeborating bOorotlog berating 13288.0 rating rotlog13291.0 9344.0 cOIlluctorcomniuctorthe13296.0 l1usl 13323.0 youngmln 11112.0 youngnina 13451.0 13475.0 mlnnina13480.0 oawhitssorely sorolybattered chargo chargodisappear chArgol1BapPollr chargodIsappear 13611.0 disappear l1BapPollr13616.0 13619.0 timo13644.0 grasp 13624.0 oC10588.0 thelaw 11128.0 lawwhereupon lawwhoroupon lawwimeroupon 13776.0 whereupon whorouponwimeroupon13779.0 time13784.0 seeker scokorseokeralter nIter10948.0 Innocent Innocentdiversion Innocentdlcrelon innocentdiversion 13936.0 diversion dlcrelonsmiled smlletemilemiRII10276.0 reflected roOlctadrofictoa13972.0 hothoamtuomont thoanll130ment hoenmlt3emont 14096.0 14111.0 amtuomont anll130mentenmlt3emont9788.0 14103.0 14100.0 behllrorfive flvofivo10752.0 coats11072.0 contsIn coatsIn14252.0 14263.0 NewYorkltuI1 Yorl-780.0 9856.0 14260.0 Moll f1111Dnd14268.0 ISxpross 1xprossISxprossReading 14271.0 1xprossReading xpross xprossRcadlng Reading RcadlngGroups GroupeGroupsIsnt Groupesnt Groupsisnt 14808.0 14824.0 snt9720.0 14819.0 llttlo JIlllohlttie14816.0 attention nttentloll10032.0 14811.0 paid 11320.0 14832.0 yOl114835.0 youyoung yOl1aunc 14971.0 15012.0 aunc14984.0 readers rOOllers14987.0 limo14979.0 order la10868.0 11164.0 whlcbwhichyou 15136.0 15183.0 9032.0 15147.0 101111roaui9644.0 books bouls15156.0 u15144.0 15152.0 difficult dlftlcultlImcuit11428.0 toluobtain luobtnln toobtain 15296.0 15312.0 obtain obtnln15299.0 lists or9972.0 15308.0 lIooleR9900.0 15335.0 15304.0 arranged nrrnnged11288.0 thaithateach thaieach 15456.0 15479.0 15476.0 helps In9684.0 time15464.0 understanding 15471.0 11220.0 tanding anltanti15460.0 andappreciation anltIIJlllrCcl1 11540.0 antipprcciatIon 8944.0 15616.0 15636.0 IIJlllrCcl1 appreciation pprcciatIonot15623.0 the9960.0 following tollowlng15647.0 11416.0 inlimo 15783.0 15799.0 limoreading 9152.0 15804.0 orUt15791.0 Scott 9996.0 10672.0 roruxauiplo 011111110uxamjiouxamjioouIdnt uxauiplowouldnt 011111110ouldnl 15948.0 15959.0 wouldnt ouldnlouIdnt9592.0 15964.0 be15951.0 wlso vIso9912.0 15956.0 take tnlioloothemor themorthOBO themorthose 15972.0 orthoso 16100.0 16127.0 those thosothOBO16148.0 prefer profor1I1 preferIn16116.0 theordor16111.0 11236.0 tholrtholrtime theirlimo theIrLImo 16268.0 16287.0 time16284.0 First Klrstlrlr 16304.0 comes comol16279.0 Count COllt16271.0 Robert UobortHobortorciofParis 11552.0 orParIs ciParis 16431.0 16447.0 Paris timen16444.0 TlloIlotrothcd IJolrothcl111h3otro1hed16436.0 Noxt NextNoxtTho NextThe 9016.0 16596.0 16611.0 The16608.0 Talisman TallslIIllnIvanhoo Ivanhoelion Ihonthen11068.0 IhonCntlo thenCastle lionCastlo 16751.0 16771.0 Castle CastloCntlo9508.0 16779.0 Dangerous 16768.0 Thmo16760.0 Fair Inlr10788.0 Maid Mnltl11144.0 Mnltlof MaidotMaIdf16920.0 ot9028.0 16936.0 1crth 1erthlcnth16928.0 Quentin QuontlnQuontla10508.0 16923.0 Durwnrd DurwardnndonllnndAnno onllnno andAnne 17104.0 Anne Annonno otClolrostoln 17088.0 Oolrostelnoll floirostolmiailorot10892.0 whlcb10828.0 arooroaroc orot17251.0 9000.0 17264.0 t17256.0 times timebefore heorothediscovery I1I 17280.0 covory orat11156.0 Amor Amorlea AmorIcolJ Amorcc 17416.0 lea IcolJ cc 9312.0 17424.0 17419.0 byCciiumnbus Columbus ColumlJus17411.0 nO 10612.0 I1ng thcmthorn11424.0 ititholr timIheir itiIhIhtI 17571.0 tholr IheirtI olr 9036.0 ono17576.0 Imasa10600.0 17579.0 bettor 1I0UorhotterIdea ototIro oftro ofro 17731.0 Iro tro17780.0 ro early enlylimesllamasond17736.0 appreciates apprecll1teloacheachtho oachtile eachho 17888.0 thohomora nioromore9640.0 because bccauRo17903.0 atthosothollobeforo10772.0 11448.0 itIfIDU Ifou itfrOU IDU frOUou 18100.0 ore 1110arc18071.0 9880.0 beginning 18068.0 18063.0 torond 10724.0 rood roadScotHcotScotttiy ScottI Hcotztiy 18263.0 bldng9040.0 thorn themchronologically cllronologlcally18220.0 111ixiximle Inthis 111thIs 18380.0 imle18420.0 wayIram vayFrom9560.0 18391.0 Prom 10188.0 Doolts DoolesIloohca18388.0 onllanti11004.0 Heading HeadlnHeadingIn headingUHeadlnIn 18535.0 18567.0 the18551.0 SeptollllJorst 8U10104.0 NicholasWhy 18899.0 18912.0 She 8heBuSEnjoyed 18904.0 ItI ItIi 19088.0 Ii 119099.0 llko 1110111cc19132.0 go 9736.0 church announced nnnouncollannouncedLottlo nnnouncollIottlo announcedaottie 19256.0 Lottlo Iottloaottie9484.0 aged agodDgodflvo 19287.0 vo becllusobecauso10816.0 sIng nlngnlngDlco IIln IIlnDice sIngIco 8940.0 19444.0 Dice DlcoIco hymns 19431.0 nboul9728.0 10248.0 19428.0 flowers Cowers19423.0 an1cn4Insocln InsoclllInsoctulInsoclnpud InsoclllDlld Insoctulmid 19580.0 19604.0 pud Dlld19596.0 timings9664.0 19599.0 oat 19588.0 onll10120.0 19583.0 the19612.0 thotbothorghtgbwn tborlghlg timgimlgOwn 19756.0 rlghlg 19759.0 rghtgbwn gimlgOwn19788.0 9636.0 19748.0 talks tnlktalksllJolt 10476.0 birds blrdbirebirdsWhy blrdWhy bireWimy WimyDottle DotlloDottiesnldhormother motimerIdont IIont 20068.0 20084.0 dont Iontthink thlnlrhero tborotimoro20103.0 oro20092.0 20099.0 20071.0 alJoutaboutInsects alJoutInsccts aboutnsccta 20231.0 Insects Inscctsnsccta20244.0 IInd20236.0 eatoatThero eatThere 20391.0 20399.0 There20396.0 Insisted Inlltod9936.0 Dottlo DottieLaUiinday LaU IatlLaltIatlEunlIay 11560.0 Laltumnday 20555.0 20563.0 iinday EunlIayumndayWdwesang slln Iiboautyhymn aboiit aboLltaboataboiitBringing aboLltDrJnglng aboatIlrlnglng 20723.0 Bringing DrJnglngIlrlnglng9884.0 tbothoCheese ChocteChoele20728.0 20744.0 20760.0 tadl1ediiytodaytvo tadl1Q ediiyvu 11472.0 8968.0 20915.0 tvo vu9064.0 Q Bans20912.0 anobegan begon10260.0 JlIslnsItm Inm Itin 21075.0 tm nmtin9148.0 anaoneflea fiell10928.0 whon yhensyimon21067.0 Wdwa11276.0 woeiot Wdgot waoL 21200.0 21211.0 got eiotoL 9256.0 21208.0 time21231.0 10072.0 10540.0 talked talleodtallied10436.0 nboul21239.0 Iialiawlc 21235.0 Iibawl amawic 21368.0 21371.0 bawl liawlcmawic21376.0 nnd21379.0 pigeons pigeons1plgoonspigeons1Subsequent plgoonsSubaoqllcnt pigeonsSubsequent 21531.0 Subsequent SubaoqllcntInquiry Inqlliryrevealed rOQlllel1rovaiodtimefact CActfactI CActtbat factbat 21699.0 21695.0 tbatbattimo21691.0 text toxtIIAdimadtWhyhalt lIalt21719.0 yn ynbetween ynietwcen 0lJetwccn 21860.0 lJetwccnietwcen21863.0 opinions ulIlnlonsSovtcmbcr ctplnions7SoitemberulIlnlonsSovtcmbcr1IPplncott -1548.0 ctplnions7Soitemberipplncotls 21851.0 -700.0 SeptemberMpplncotts 22015.0 Mpplncotts 1IPplncottipplncotlsMpplncottsNo 1IPplncottNo22340.0 140Hone Horl11HorseType TypeNotwithstanding TypeNotwlthstnnlllng 11104.0 Notwithstanding NotwlthstnnlllngImportanco Importancerf rrefrfliorso rrborlolJrecdlng efmorse borlolJrecdlng morse liorso-940.0 breeding 22728.0 01Industry Iumdustrytlmithlcountry tbl1 tbl1countr tlmiountry country countrountrythero22872.0 tlmo22891.0 die dltdltllnctly dietlnctly dieIncily llnctly tlnctlyIncilyAmerkanhomo hQrllOhorsetype 11000.0 The23051.0 rae raoraefig raoItig ra raIJg 23168.0 23192.0 fig ItigIJg23184.0 thoroughbred tharoughbredfa fsf5English nc1Iahng1Ish10920.0 timeheavy heavyrafthorso heavytraCthorao heavyrafthmorso 23336.0 rafthorso traCthoraorafthmorsoIsFrench FrencbtliotTloHackney is11364.0 iiEnglish 11456.0 IInglllll isngllsb Inglllllngllsbnndond23511.0 trotting horeohbreo10792.0 18asbred asmued 18blcd bred blcdmued23683.0 IIIprcscnt9440.0 10092.0 rack rOlidear aorleraorrlco lervlco earrico rlcovlco23863.0 typo Lypontanimalpc 11040.0 nnlmalanimalvpo nnlmallrPlI 24023.0 lrPlI 24031.0 vpo pc 23999.0 canaotba10056.0 24004.0 hoestablished ostabllsh01ostabilaholestablishedLntll ostabllsh01until ostabilaholmntiiLntllmntiireproduces reproducelIIlIolrreuonreasonillo 11524.0 reasonLb illo 110Lb certainty certnlntyFrom ccrtaintyProrn-596.0 From John JohaJoheQllmor OllmorGilmerQllmorSpeeds OllmorFopecd Gilmerpeeds 24484.0 Speeds FopecdpeedsHorso Horaohlorso10708.0 America IDIDSeptember InSeptember Inoptembcr optembcr24647.0 CenturyFITpeynrnnentiy Century CenturyFITSneraanenlly CenturyFITapermaoeatly 25003.0 FITSneraanenlly FITapermaoeatlyFITpeynrnnentiycored curedersdKo10412.0 fill fits25023.0 25019.0 neounorousnervousnot norouslossneouMlIfter 25131.0 MlIfter loss25136.0 flrftt nrtlflrst25127.0 days 25147.0 uleotDr Kline HllneIClinos11212.0 Great OreatGreatKerroltatorerliltrlalboUloiuxltrenlliefroQ OreatHerrol1lorerUlrlal GreatlervehtIorerS21r1ai 25239.0 Herrol1lorerUlrlal lervehtIorerS21r1aiKerroltatorerliltrlalboUloiuxltrenlliefroQ KerroltatorerliltrlalboUloiuxltrenlliefroQIiltII -2560.0 25244.0 boltloAlI1l boitloand-1264.0 Irlllllltfroo IrlllllltfrooDrIIIl tresiI lsjitroo lsjitrooLrhiIf 25355.0 25372.0 IiltII DrIIIlLrhiIf25375.0 Ktl 25363.0 KtIULtd Kauix 25396.0 Ltd 25367.0 031 O3tArch 25359.0 Arcb8tlhUIa HtrhlUIfl HtrhlUIflThere -792.0 10716.0 SI Phila Pa PaThere Thtrenearly nurl 25579.0 030000 OJOooo25603.0 dress drwdressmakers dressnAens 25624.0 25659.0 25711.0 makers JnAliennAensIbe25700.0 VnltedVatted25695.0 Kingdom DgdomKingdomMr KingdomfraWiniiowe 25935.0 25947.0 Windows fraWiniioweWll1IIlo Soothing SoolhlagSootbingiJyruptor Byrop 8yrupchildren ebUdrenchildrenteething ebUdrenIlotblDIrofen childreneotblng 26075.0 IlotblDIrofen 26080.0 teething eotblng-904.0 9892.0 poftenthe tfla tbe26091.0 gntni gullaredder reduetlreduarsInflamm InCmmainaimmaInflammHonftllajr InCmmatlODatlar inaimmatoualiays 26179.0 Honftllajr tlODatlartoualiayspatncarea ralDeurespalncnrte26191.0 26187.0 wind llIel colla colltlooHe10876.0 28e 23025cIiabottleVirtue 26384.0 26399.0 Virtue 26431.0 nay tnaymay26395.0 26403.0 its litown 26423.0 reAr 26387.0 reward cwarcl1bat but26419.0 IOmescumscomepeople IOmePfople scumscople 26515.0 26528.0 people Pfoplecoplemike26555.0 9716.0 26523.0 trademark tndemark26520.0 ItItUooey II110ufrefundtd IIiloecy Uooey iloecy26751.0 110ufrefundtd refunded 10272.0 lortachpicks pac1rlcpackegciofPOTKAW ofIunASl ciPvruu 26871.0 26887.0 POTKAW IunASlPvruu26883.0 FADELESS lADLEUYADZntUIres Dita10756.0 uosatlifso unextisfasuosatlifsotory 26908.0 111114 unextisfasioiy lIra 27023.0 tory ioiytoryThe ioiyThe 9420.0 arerageIITtrlgOmln10268.0 27212.0 27204.0 talk bIb10952.0 boutnotbeing notbelDg noteing 27343.0 belDgeingappreciated apIrttllttdis27335.0 really reali 27331.0 chomp cbampchumpchump3dootbeUrPtsoa 23dootbeUrPtsoa -1168.0 1IotbeU 27607.0 rUoj 1110Cur CorCU Coamap CoDUapConuinapCoDUapI ConuinapUcahuininaitaroughs Coamapllcnhuan 27679.0 llcnhuan lJoJlhLuU1Ul Ucahuininaitaroughs -900.0 inalfuo 9948.0 rrO ajh as1IIS 154coldsIo ootdiZouootdiZouI13oyszTgnilyiIpringi1a4YIb JOIN JOINylioiM 27823.0 ylioiM I13oyszTgnilyiIpringi1a4YIb 27827.0 Dotll -1880.0 Trinity TrinJlr27807.0 nprianInd 27812.0 JlprfDp beL Fab libU 12P 12PA ItJJWA ItJJI 28048.0 28071.0 womln28027.0 28040.0 chen eivengvenhysterics Lyitericsbrlterla28051.0 gen ceogsaceofrl1l1 gsarsIiy 28067.0 28108.0 erally frl1l1rsIiy8928.0 baa hathissberbel28192.0 111111weyxmlns:ns6 ID20 25991 2736 11600 2324 ns6:type 12376.0 13088.0 Srafceo 8rakeoSnakea13004.0 SrafceoOut 13556.0 13092.0 8rakeoOu SnakeaOut 13552.0 11856.0 Out Ou 12084.0 12168.0 or12024.0 tbo12296.0 onohundred Jlllndrcimmtndred12900.0 13612.0 13840.0 sixty fllxtjstxt13764.0 fllxtjodd 14259.0 stxtOtiti 14232.0 11716.0 Otitispecies speclensptclol111904.0 ot12820.0 oorpents aerpentscorpents13376.0 13704.0 AmcrlcaAmeric13600.0 Americanorth Amcrlcanorth Americnorth 11720.0 north ot12064.0 12392.0 Mexico 13340.0 nbollt13800.0 13692.0 twentynro twentyarotwcnt 14244.0 twcntare 14152.0 nroaro11980.0 venomous vonomolsvonomous11928.0 the12616.0 12980.0 others othorotimora12936.0 13436.0 oro13696.0 amharmless 14048.0 14104.0 aa nsam14212.0 aaharmless 14240.0 nsharmlesB harmless harmlesB12364.0 III12304.0 12560.0 GOso12495.0 12744.0 12688.0 kittens 1lttenll13083.0 13684.0 rpd13584.0 rpdmoy 13908.0 13968.0 mny mnn behandled handlell11872.0 wllb12448.0 12868.0 Impunity ImjlInttrkuntty12792.0 13608.0 13432.0 Lul Iast13760.0 13884.0 13952.0 yeas yaaryeasI 14028.0 onr 3424.0 cauGht cnufiht11780.0 12372.0 wllh12300.0 12988.0 bare baro12916.0 hands hnnl1B13272.0 13788.0 novoral IItworlllseveral13712.0 Inrgolargeblacksnakca blackanakea12056.0 12908.0 12552.0 nnkl3 12464.0 13008.0 13140.0 number numornllm 13620.0 13504.0 OT 13408.0 13680.0 3616.0 3639.0 13860.0 garter l1rlergavtei13740.0 gartersnakos 14236.0 gavteisnalcos l1rler8nalos snakos 8nalossnalcos12288.0 throo 12172.0 12708.0 milk mtlk12628.0 13056.0 tmnkos lDIlkc3snakcb13604.0 13500.0 13900.0 grer grersnakes 14215.0 13904.0 gn Itr14068.0 cn 14092.0 cnsnakes cnsnakos snakes snakos12164.0 crass ernSBsnakoi snnkMsnakos12896.0 13576.0 13427.0 vsolrr vsolrrsnakes Olrr Olrrsnakes 14248.0 otsnakes 12251.0 12160.0 12660.0 several leveralsevern13283.0 othcrll13124.0 13812.0 nManti13688.0 14115.0 al nlalthough 14220.0 nlthough 11704.0 4236.0 12244.0 Eomo somosonoot12883.0 thcmbit 13548.0 rot13460.0 13848.0 the13724.0 14120.0 ctci14040.0 offocts ctCocts cifeds 14332.0 feds foctsCocts12112.0 jroro 12016.0 ero roro12432.0 loss conscquonco conecqubuco13000.0 conQequ 13992.0 thntoe 13996.0 thnnthnithnnnil 14272.0 thniem 11688.0 oe nilem11920.0 11832.0 brnmblo IJromblobramimbloscratches IcrlltchclIgoratchesscratchesAn IcrlltchclIAngoratchesAn4703.0 Irritable Irrltabloirritablo12700.0 serpent sllrpent12632.0 13180.0 13564.0 aperfect perfectlpofcctiperfectharmless 14203.0 perfectlhnrmless 14159.0 pofcctiharmless 14200.0 hnrmlessono12284.0 12752.0 12956.0 thmo13327.0 4876.0 atorwatoronnle Dnnlcannitconnlewhich Dnnlcw annitcwmIch wmIch5083.0 12076.0 11892.0 lch 11792.0 12144.0 12444.0 usually uoul111unually1J0be13183.0 ollnd13544.0 13792.0 Ot13732.0 13984.0 noai notrnoa13932.0 noaitho 14280.0 notrUI noathe thoUI 11900.0 11984.0 wntor12480.0 perhaps 13080.0 swimming amon amoni13756.0 amontho nmong 14184.0 nmongtho amonithe the11988.0 stems Atemsorof12692.0 pickerel plckcrolweeds wocdnwe 14008.0 14144.0 Irpursuit iipursuIt Inii14224.0 Inpursuit 14264.0 pursuit 5539.0 affrogs fro33troa12395.0 12839.0 13240.0 possibly pOBsllJly13127.0 13880.0 colled collol1colictcolledup collol1up14256.0 colictup 11908.0 11844.0 12128.0 12388.0 bank bnnk12332.0 12876.0 5691.0 snnUo snaloancilco13168.0 bile bllobitebileand 14228.0 blloInd biteand 11684.0 5851.0 Ind11992.0 hlto blto11916.0 hard hlird12240.0 12716.0 bullt 12932.0 13260.0 onomousvonomoumvenomousin onomousInvonomoumifl11680.0 ifltho11808.0 12136.0 10ast12072.0 12624.0 U12784.0 docs doosdoes12724.0 13132.0 1I0t13072.0 13404.0 13592.0 13656.0 eggs 13508.0 bulbutbrings butbllngs bulbrings 6184.0 brings bllngs12212.0 6180.0 forth ortb12096.0 12528.0 12928.0 YOllngalive allvonllvo13316.0 Last 1lIstLasi13748.0 LastSeptember 1lIstSoptember LasiSeptember Soptember12472.0 112608.0 caught cnughtcmumglmtn13292.0 flnofinospecimen speelmon13527.0 specimennnd speelmontlnllspecimenAndnndtlnllcarrlelllion12440.0 homeDotwoon 1J0twoonlietwoonnoon noan13871.0 noonnnd noanInl noonand nndtour11876.0 12320.0 oclock oclacloclocic12852.0 she12776.0 hnd13068.0 13440.0 nineteen nlnoteen13364.0 14080.0 lltlittic littie tic tlotieones anel11848.0 12404.0 They Thtywore wcro12739.0 Irrltablo irritableyoungsters youngalors 6991.0 sters alors12104.0 trom12000.0 thotllo12408.0 start stllrt13248.0 nUll nndanSI13120.0 13580.0 almallt13476.0 musoon 14012.0 14112.0 muassoon aslIoon 7143.0 lIoon12080.0 ns12312.0 thoyworoWlfO12595.0 13100.0 born barn13488.0 13388.0 13771.0 wouldcoll wouldcotl wouldcoli coll cotlcolinndnnll7303.0 leap 10ap12228.0 ot12872.0 C1y12788.0 hond13448.0 tholrtixelu13856.0 theirllttlo tholrIItUo tixelulittle llttloIItUo12068.0 jaws wldo wide12368.0 12816.0 open oponopenAll 13116.0 oponAll All 12012.0 enlees12880.0 live 11012808.0 13400.0 nnlmnl onltnalanimnitaolltootll13832.0 foodtho taolltho tootllthe thelarger Innlr11896.0 12468.0 ouos OliOSoumos12380.0 12864.0 reollcod12772.0 13220.0 small 13371.0 Slno 13808.0 mainmala mammRmmammals mRmmals mals malablrdefrog12456.0 anllreptiles roptllesroptiios13276.0 14015.0 nnelanul13876.0 andtho nneltho anulito itosmaller smnllor12488.0 13256.0 InsoctsInsoct13920.0 Thoy Thoyswallow 8280.0 swallow theirprey proyJlroy12612.0 wholo wholetimebones boncbonoxbonesof bonoxofboncat 11656.0 attheir11796.0 8435.0 heads imoatis12208.0 12780.0 bolng being12680.0 13244.0 loosely looulylooely13380.0 14036.0 puttogether puttogother togotherthnt12676.0 thoyqan 9nn12960.0 stretch strotchtheirmouths theirtholrmouths tholrmouth 11652.0 mouths mouthnnenormous onorlnOus12540.0 13308.0 extent oXlontoxment13824.0 13715.0 IIIlVohavehavosoon IIIlVo1Ioon havesoon 8912.0 8959.0 1Ioonn8916.0 snako sllkoaqako12416.0 twentyseven twrntYlIoventwentysovonInches 13768.0 Incheslong 100 swnl1QwswnhlQ9119.0 ft12860.0 fully ful1y13268.0 fledged Ot1ed13156.0 9103.0 ollngyoungcatbird youngcaIbird ollnglatblrttJ catbird caIbirdlatblrttJ 9255.0 12348.0 12544.0 11H12400.0 IJaynoa Dllyn03Iraynos13392.0 13632.0 Womens WomonWomons13512.0 WomensHomo WomonHomo WomonsIlomo 14128.0 Homo Ilomo12100.0 Companion COlllpnnlonCompanionHow COlllpnnlonHow12824.0 How 8heKnew Know13016.0 KnewTwo 13452.0 KnewTIVollttlf KnowTwo 11788.0 TIVollttlf iitti9girls slrlsginswero worovero13216.0 9895.0 playing 1laylngrroltfroiltfrontof rroltofroiltof11644.0 10099.0 11772.0 11840.0 11976.0 city dwelling dVolllngdweiling12220.0 10091.0 a13232.0 13424.0 strange strangotrnnso13360.0 IIIlnmmmixmanxvont IIIlnwont mmmixwent xvontwent12048.0 11968.0 byThat byThai byTimmit 11860.0 That ThaiTimmitn5man12188.0 Ii12548.0 12828.0 anundertaker uUllortnlorsaidono saIdono saidone onethelItUohitt1ginsgirlsHow 13096.0 girlsuJlow gins110w uJlow110w12436.0 know knowt13496.0 asked IIslol1noicodborlionhercompanion borcompanion lioncompanion companionOh companionOhm11864.0 011Ohmbocauso because11035.0 thenUllnun13324.0 13727.0 13664.0 14064.0 un onundertook onclertook 14303.0 Illrtool 14315.0 dertook llrtoolclertookgrandmother 12492.0 1576.0 srandmolhcrBe1telll grandmotimorBeptomn-852.0 13484.0 grandmotimorBeptomnher -1576.0 14208.0 Septem 11239.0 ber herLlpplncotts 1lpplncottsLlppincottaLlpplncottsSufficient -796.0 11948.0 LlppincottaSufficient 11375.0 ISufficient 14324.0 Sufficient 13104.0 Cause caus13012.0 CauseMary causMnrrDlll CauseMaryflimt 13412.0 11836.0 MnrrDlll MaryflimtMary -724.0 Dut 12620.0 11847.0 whYlto 11871.0 13536.0 thlnlt thlnlthmlnlctheyrO theyAro 12007.0 Aro 12060.0 cortpln corlllncortpin11972.0 fall talltai12756.0 13028.0 lovo lov07iovo13200.0 lovoAnn lov07AnnIn iovoAnnIn Ann AnnIn timofirsl13172.0 12167.0 place llaceiiacetllolrtlmolrpnpatents pnlents palofts 12327.0 tents lentslofts12340.0 lisle hntohlito12500.0 12336.0 cactinndansihiittthothin13948.0 thosecond till6ccond thinsecond second 6ccondneither nollbor12092.0 1msbos13720.0 12523.0 penny 110nnyimonnypennyIn 110nnyInimonnyinthmo11768.0 world worldOctahor wonldOctobor13744.0 SelSotSetColombia SelColombIa SotColombIa 12728.0 13047.0 Colombia 1msluciacirculation clrculntloncircuintlomi050000 M3OOOO3OOO13588.0 13215.0 000 otpaper Ilnllerirnimor13228.0 money 1II0neymmommey13032.0 trom13396.0 wlllchticarlyIlenrlyticarlyall Ilenrlynilnearlynil 13372.0 allvalno alllovalueIIIIISbaadeparted delIlI1IOtlThoTllo13375.0 llIllerpesterpapermoney pestermoney llIllermouey 13551.0 moueycapita cOIlItcaptinlk1i Jo11Oi12996.0 nndonl1lt 13736.0 ii13896.0 takes tnkestnkctakesover tnkesocr tnkcover 13716.0 ocr1OOof12600.0 tilo12516.0 stuff sturt13456.0 pay 10113695.0 hotel imotulhotelbill imotulbill bill 11940.0 torcue otio0110dnrtinydayThero dnrThero tinyThmeroisnothtmmg Thmeroisnothtmmg 12248.0 II12920.0 Him llkomo13300.0 14116.0 n13227.0 14088.0 Vet wotwet13368.0 blanket blnnkotblanketto blnnkotto14255.0 11868.0 distinguish illatimiguishitlnsul 12648.0 thotllo12912.0 lire fire12848.0 otenthusiasm enthuslnsmemitimuslautimenthusiasmThero enthuslnsmThoroemitimuslautimThere14084.0 14531.0 14552.0 TheroThoro14544.0 la14564.0 more12264.0 14539.0 Oatarrli CatllrrhOstarrim14536.0 tn tl1In13188.0 13468.0 motion soatloa14559.0 13700.0 loJ1 13636.0 cithobothocountry limocountry bocountry 14651.0 14672.0 14691.0 12280.0 12460.0 14664.0 1111cii14659.0 othordlAoasotput othorcliliouesothoriisoases13471.0 togotliortogothertogotliornnd togothertn11togetheranul14192.0 14795.0 tn11anulmdii12140.0 lt 12256.0 thotlloloit IIthimttow rewlaw14803.0 yoimww years13520.0 13312.0 AI supposedtj lIpposo1stippointisupposedtjbolnourablo 14780.0 ta tabo taho 14895.0 bolnourablo tnourllbloinourabieholoorlornirroutiniiay 14932.0 groat roat 13148.0 maa leMSyetredoatora lloolorttiostondoatorapronounce lloolortpronounced tiostonpronounced 15015.0 pronounced pronounce12532.0 15052.0 12639.0 15023.0 local aloMItooxi12939.0 dlseiuo dlloModissaxo15020.0 prescribed presoribedprescribedlocal presoribedlocal lroarlllel lroarlllelloonl 14196.0 loonlrornelllOllInll anti12983.0 oOllsl 13648.0 13420.0 uUy 15139.0 fAlilnICtailingtoeuro toouro 15220.0 euro ouro15275.0 boat12232.0 10011 treatmentpronounced trosImemtpropouncetitrOlltmont -1324.0 15283.0 propounoel 15264.0 14076.0 hiIalacurable 14180.0 hieurnble Iacurable 15372.0 curable eurnbleScience Bolomo8elonoo12684.0 hitsIU1111lroen proven iroenCnUrh CAIArrhstarlm14000.0 13959.0 15403.0 a14136.0 ncoiulltutlonaldlfloivie 14164.0 nOOlllliltulionalllilloM8 aconetitulionsi 15492.0 coiulltutlonaldlfloivie OOlllliltulionalllilloM8conetitulionsi StiLt15500.0 Ancllheroforo 13208.0 15503.0 therefore 15495.0 romilroi roiinlroiromilroiconstitutional roiinlroieonstitutIonai 15536.0 ulrOl ulrOltonUtutional constitutional tonUtutionaleonstitutIonaiIr15631.0 treatment tmont Altnouthalts HMls111111Ownrrlt OisrrkOwnrrltOuro Oisrrkthin Mrlt MrltOuro 15744.0 15764.0 Ouro thinmnnutnotnrod mllllUfMhllllmnnutaeturott15752.0 13112.0 1C VP13064.0 13264.0 Obenoy OhenoyChenoy40013956.0 CoToledoOhio 00rollllo CoToioOhto 15875.0 ToledoOhio ToioOhto15880.0 rollllo OhIo IIIisthe12564.0 12836.0 onl oonatiIu11ousleonUtulloQalouro eonUtulloQalouroon 15888.0 cure auroauroon cureon 15943.0 16024.0 themfkot timemikOLvkot 12452.0 15991.0 tnkon15983.0 Internally IntornAlly15967.0 13752.0 15980.0 dosts 11001tioses13888.0 dostsfromlOdronstontoupoonfui 11001Irom tiosesfrom fromlOdronstontoupoonfui Irom-1692.0 IOIrop lOdropstOI 16143.0 Mpoonful aipoonfui16103.0 Itaotsdirect UllatllIroalItaotsdirectly UllatllIroalIy16108.0 hitch direst direstly 16152.0 16224.0 16239.0 ly Iy16236.0 thothe11964.0 mood hloodblood12192.0 16228.0 nndt1l1muoou 16252.0 mucous 16231.0 surfnoen lIurfll3011surtaoo14056.0 thethocyntom thoyteDl thesystem 16368.0 system cyntomyteDl16355.0 1hoyofTor olToroilerotisbunllrelhunthreildollars olhull14044.0 14071.0 fornny forany 16459.0 16507.0 nny11111CMO osso16464.0 fnllscuro16467.0 Bend Send8endcirculars oiroulllucirculatecircularsnnd oiroullluMilcirculateand16583.0 16604.0 Mil nndand16591.0 testimonials testimoniAlteatlnioniaisAddroAddros13416.0 Jt 13627.0 16588.0 Caesar GIUXIIJlliurGIUXIICo CaesarCoJlliurCo 16719.0 16727.0 Toledo 1010110O0Hold OHolet 16724.0 0IiOii 11784.0 16839.0 Hold HoletIiOii12036.0 Druggist OruKitlstt7Ju 7Junails 75 7675lInll 76hails 16952.0 nails lInllhailsyamlly JAIliIlllII PatnilyllilsIllls aroRro13136.0 thathoboslhostboatTho boslTho hostTim 17151.0 17172.0 Tim12180.0 17159.0 Investment Invcetmqntpleasure plo 17188.0 luro yachts yachtsin 17316.0 17335.0 11924.0 Amerlcl1IIlJout500J000 GOOvMOOOOOOO17324.0 andthe 17468.0 17495.0 the17492.0 annual annll111cQst17520.0 ot17484.0 their12952.0 maintenance lIIa1ntonancoinaintonancomaintenanceIs lIIa1ntonancoIsinaintonancoIs17636.0 17663.0 17647.0 0000000 fOCOOOOOOCOO00017675.0 a17667.0 10lUon13060.0 Whoa13540.0 naDtiam aatnua 11696.0 17796.0 17832.0 Dtiam atnua17851.0 lIln 17819.0 yacht yacM12668.0 17815.0 II17807.0 chartered chllrterod17799.0 theprlco13804.0 priceusually prlcoululIlI priceusuaily 17956.0 17979.0 usuailyululIlI 17984.0 1O12328.0 17967.0 month 12748.0 18000.0 11erimcryncht17959.0 tonIn 18252.0 Saxony 18239.0 therotimoro18228.0 13596.0 Industrialschool Industrial Industrial8chool 8chool18412.0 18435.0 18423.0 ovaryovor 11011 uan14G11Inhabitants InhtlbltantlinimabitantsInhabitantsPoorly InhtlbltantlPOor inimabitantsI Poorly PoorlyFor -1396.0 18944.0 POor lJCI 19707.0 19723.0 CI 12052.0 porPer19751.0 yearrurel luffered19719.0 lericrterribly lerrlbly icrribly ribly rlbly12236.0 19871.0 19859.0 dyspepjU dyslepslldyspepsisgreatdepression greatdcprcllloo greatdepressIon5 20008.0 depression dcprcllloodepressIon520027.0 wUliwaYI 13568.0 feeling fcellngfeelingpoorly fcellngpoorly 20155.0 poorly 20147.0 thcn20136.0 IrledAyers AyerlSsrsa SiralSersaSsrsaparllla Siralpnlllt Sersapanilia 20267.0 parllla pnllltpaniliaweek wcek13560.0 20291.0 WIIIanew Inew 20403.0 20416.0 nJohn msnJohnMcDonald McDontldMcDonaldPhiladelphia 13352.0 McDontldPhlladelphl McDonaldPhIladelphia -648.0 20568.0 Phlladelphl12760.0 PaDont PaI Par 11600.0 20787.0 20931.0 20959.0 20951.0 Dont 12704.0 20948.0 forget 20935.0 ItsAyers 14052.0 ItsAye Aye -740.0 21227.0 12536.0 tt Sflyrsaparllla SnrsapnrJllaSarsRparIlISflyrsaparlllathat SnrsapnrJllaiSarsRparIlIthat-1000.0 21404.0 11620.0 21395.0 21387.0 makcstrongand 21635.0 hopeful hoperul13571.0 21640.0 waste wasteyour 14059.0 21835.0 13852.0 13780.0 bytrying bytryJng 22055.0 tryJng22128.0 22067.0 kind kindUse 22283.0 22315.0 Use 22307.0 22299.0 oldl 12904.0 22295.0 tested triedand 14020.0 22303.0 trl dand 22519.0 22571.0 AycrsSarsapa SnrsapnSarsppaSarsapaflHiMlli SnrsapnI Sarspparum22763.0 rum rHln22847.0 flHiMlli flHiMllil si 13020.0 ihttl 22820.0 AlllnlllI Amh4gitsAlllnlllIAk 14032.0 Amh4gitsAikyootdo5tcrwbs 23116.0 23139.0 Ak 23131.0 Aikyootdo5tcrwbs JMlr 23135.0 23127.0 wild wt 23124.0 23119.0 Itilnkihlnkl13224.0 olit ItItspstIia 23239.0 12088.0 avarllia spstIia23219.0 IIll1nolIabollHhlara IIll1nolIabollHhlaraol -1344.0 23227.0 knows knowiiii 23247.0 23215.0 lltwuith lltwuithoU abuial CMI 119 5t5 23299.0 23328.0 oU 014family ftnllyalflll m4lrlnt melllttom141laYellow bll IIlIadrk ku advki ark arkInsures IIwe 23415.0 23428.0 mI23420.0 lallI lallIJ IMli51 23431.0 wIU12008.0 12524.0 12556.0 0ATIS VII 0111 1cwsflUIHORTHSOUTH 23480.0 usia usiafiiRThStITh 11748.0 23876.0 HORTHSOUTH fiiRThStIThE1STESTV E1STEST AS1ISV1AS1ISV1iV 24275.0 iV 24300.0 WI wiht 24279.0 riM riNriMtoYmllg Iy I175fl toYmllg 24655.0 1111iJ 24848.0 111iJ 175fl24875.0 JlAlO JlAlOWAiEr ASlLP WAiEr 25111.0 ItH ItHIL 25271.0 SlLP IL CLTh1N4 THINQ THINQrftUWMrB rftUWMrB VYWMLlirftUWMrBfc VYWMLliflu-1052.0 25587.0 fc flu25600.0 Ict Ict1i 25595.0 rdtritl lafe4 uf ufutt 25631.0 13928.0 25723.0 utt 25967.0 fw 12844.0 25963.0 jq 25983.0 25959.0 rtodCin rtodCintM 26103.0 tM cr dowr 12948.0 ia1fedI4dMt 26115.0 26107.0 tit 6 26087.0 toft k TfftIS T926203.0 vdets17gJtatkIrU231G vdets17gJtatkIrU231GI -1340.0 IttI -1336.0 mt kuWII4 JGH Of OfJ 14188.0 26311.0 26327.0 TNII TttrJtle9eteg4tfmz fIH -1244.0 26339.0 26319.0 26323.0 1lr 1lrbfQIqAJI 12032.0 12120.0 iI bfQIqAJI 26455.0 26452.0 13252.0 ttlCl ttlClan 11932.0 26623.0 26627.0 aIVIIl LMQr2 NIU 13164.0 C4JenOlJW1l1A ieslsiuIUC4JenOlJW1l1AAU ieslsiuIUviLJL 26631.0 26711.0 AU 26635.0 em 26695.0 viLJL CJMM C41rJt4TMJ CRf CRfInsurelllilnsf Insures InuresInsurelllilnsf InsurelllilnsfIlUausns -1388.0 against againfagainfBiliousness againstliii 27303.0 27307.0 Biliousness IlUausnsBiliousnessHas IlUausnsHns-1024.0 liii -1020.0 27348.0 ousnsss ousnsssIfas 27559.0 Has HnsIfasregulating reguI4t1nregulatingrebellious reguI4t1nrebellious rebellious 27715.0 livers liverformore formorc 27975.0 27896.0 morc58 581I rearsyearstoe rearsaDe1I 1Iiztix1t 28059.0 toe aDeu4 titAt iztix1t 28147.0 28135.0 28203.0 AI28211.0 28187.0 Jn drvU11 dnitis28215.0 28219.0 28200.0 wftllxmlns:ns7 ID22 1360 6288 14376 2132 ns7:type 14392.0 cOn 14396.0 OOM1VLOBOREMCIIOLSON 14896.0 OOM1VLOBOREMCIIOLSONRccommcndsPcrunaOt1ior -3664.0 15016.0 lY -3044.0 15440.0 DORBYNf 15208.0 16880.0 16816.0 SON 17336.0 18304.0 FO 18919.0 18831.0 14376.0 RccommcndsPcrunaOt1ior 14380.0 RccommcndsPcruna RccommcndsPcrunn-3820.0 Other Ot11cr17255.0 18284.0 Prominent ProminentMen ProminentMon-1400.0 Men Mon16852.0 Tpstify TQstifyTcstify16743.0 20595.0 17775.0 xmlns:ns8 ID23 19644 14356 3563 ns8:type 14492.0 3563.0 Commodore CommlloroCommptiore15260.0 Somfrvlllo mervl11eSmervIhio15200.0 15940.0 Nlfholwn NlrhollNieholsan16452.0 16511.0 3571.0 0116780.0 thc16728.0 thetnltfd 16967.0 the1ntltel thclnlted 14384.0 3715.0 tnltfd 1ntltellnlted14852.0 fctntos14788.0 6t 15060.0 ttlS 14968.0 15284.0 Navy I4atv15608.0 15716.0 15523.0 aS15820.0 letter leltrr15952.0 16396.0 16332.0 16448.0 16664.0 16736.0 1837 15371837U 1837It1537it U14532.0 Street Blrrel14476.0 14972.0 14876.0 15452.0 WashIngton 15320.0 Wa 15600.0 lilngton IIhlnl1ton15660.0 16260.0 16264.0 016308.0 16360.0 16536.0 16655.0 wyi uyalsyswyiInuc 16940.0 16711.0 sysInmim 16896.0 14503.0 11111 14603.0 Inuc InmimiVriittft Irutsa14944.0 IHI1505 15876.0 16067.0 bcess16484.0 16392.0 andnoio 16752.0 16584.0 lid 141141stoma 14388.0 stoma noiotlDIO14712.0 iiicil musetitIee 15068.0 bi 14964.0 bll80 15404.0 15268.0 ao so15132.0 IIIIIIHItutafll0oJ 16072.0 emfrlescla 16216.0 emfrlesclafluid 16292.0 16367.0 rtatutii 16388.0 rtatutiicatarrh 16720.0 nclll 16628.0 fluid 14420.0 14656.0 net 14459.0 14696.0 arqtma1ustcsxiceaga 14724.0 1rlJ -1292.0 14935.0 14912.0 15024.0 4407.0 15003.0 15120.0 flllntlCC8 15935.0 16052.0 surD stare16404.0 cllrolo 16372.0 cllrolocntl1lrh 16876.0 otsreor otsreorCiirji 14403.0 catarrh cntl1lrhCiirji15008.0 IhalIhe I15172.0 15435.0 4559.0 IUIaum15379.0 15732.0 convlnttul copiviemi16564.0 15796.0 illoitrallvc ItItCIttaltUc 16884.0 oitrallvc CIttaltUc14996.0 14820.0 tVI 14728.0 15040.0 fjiialMe qilelilge14976.0 15072.0 15591.0 15276.0 15447.0 15604.0 15664.0 15708.0 15628.0 aiiiIssiheatltal 15976.0 aiiiIssiheatltaliuiIj -1172.0 15808.0 IU -1072.0 16020.0 115928.0 16244.0 hfttttnl 1111111116104.0 4711.0 16820.0 16335.0 hfttttnlf 16276.0 16848.0 Iflfll 14424.0 iuiIj 14584.0 flfll 14796.0 14668.0 14856.0 rrcoiiimotd rrrllulinelidtCCImuItfleiIl15723.0 II15640.0 15891.0 rt nfl tiU4863.0 16300.0 16400.0 4855.0 jursosu jursosuiIJJCitiig 16916.0 16455.0 ir 16723.0 oni 16644.0 oniiioi 14412.0 tllll1CI1I0 iIJJCitiig14500.0 iioi liio 14840.0 15160.0 fruiiIrel 15496.0 iu lint15368.0 15835.0 OIlIllJI 16211.0 onnipla 16316.0 onniplaS 16460.0 jila 16492.0 16552.0 5015.0 16532.0 lIf 16623.0 lIfS 16688.0 514616.0 14700.0 14752.0 00111011 diolson14828.0 00111011Unltcd diolsonUnited olsuii olsuiiUnited UnltcdSlalMStl1tllMlnlstir Mimiistr15512.0 lIl1lst 16064.0 tu15988.0 16232.0 UuaUniula UuatfnlalBuuatennxia16188.0 UuaUniulal uuatennxiaEnlorses 16235.0 UuatfnlalBlnoscs lnoscs Enlorses15760.0 rnun 15816.0 rnunDr 16311.0 14528.0 14791.0 WO 14940.0 Godfrey 15528.0 15216.0 iltrcy rrr Hunter l1unlert16172.0 S16476.0 5775.0 Minister MtniterMlnhtrrMtnitern 14408.0 5916.0 14488.0 14576.0 UivMcm 14520.0 tJnUemalnj Uimttomalnt15035.0 15228.0 5927.0 exniemb exmembertxnmcnmber15904.0 16000.0 01ci16156.0 Coinrc Clll1rrCoarre16692.0 fton fronfronieumtucky 16908.0 16740.0 ron 16911.0 Kentucky ieumtucky14516.0 Olltllel 14988.0 14884.0 15116.0 15164.0 15324.0 15484.0 lotterhotter15391.0 15900.0 torn liotnhomViliinitonj Vtsiington16164.0 IIIIIon 16964.0 Ii14456.0 C14647.0 wrliMi wrmkiu14688.0 wrliMiI wrmkiuI15244.0 14608.0 14732.0 autsum14652.0 Cull 15347.0 natlefici ntlnellstifict15923.0 thAL16240.0 16167.0 Ollr 16579.0 Ierunn 1HunnPerunaIerunnit 1HunntlPerunaIs16972.0 6412.0 tlIs14568.0 nilancllknflou el11ClllOIIIIciIkniotia14708.0 15908.0 caltlrrhcatarri16748.0 16808.0 6448.0 16796.0 1and 16932.0 1GlIlt 1anti 14400.0 GlIltantinlnl mf mn frlcpiw Irlelfrfcpd16023.0 ImvehobrtllLtCeVI16296.0 16696.0 IxnvbentIxnvHtcd 16948.0 lienI1lcll bentIlted 16888.0 Htcd I1lcllIltedill14864.0 uso11015316.0 WUtJIllnttr 15700.0 15800.0 16432.0 Ujfltmntcr Wunter 16528.0 16636.0 16592.0 1Member UIIIclllbrr 16828.0 UMember Member Iclllbrr15044.0 orCoiiKtvs ClIIIfnj4migresFront lFonl16096.0 Vlrfjlnin YJrlTlnlaVlrfjlninVilles YJrlTlnlaWdlCs Irginm IrginmYuttti 15444.0 Villes WdlCsYutttiVillesHon YutttilIon Hon 11011lIon14956.0 15064.0 nHDrown flrownMnrtlnvlllc MllrtlnJ1IcJamtinv11lcVA VtIVsexox16699.0 criMcmhcr exInemJcr oxmncmmmbcr iMcmhcr InemJcrmncmmmbcrorConereu Olllreu ouigress15679.0 15767.0 Fifth Filth15860.0 1fth 16084.0 District DItiiet16079.0 Wth Oth16632.0 WthConRroM 16988.0 OthCOIIJtltM 0th 0thCongres ConRroM COIIJtltMCongreswrites vrltfwrHu writesI 15056.0 vrltfI rI 15852.0 14744.0 cheerfully rhccrtullycliterfuliyIIYOendqraement ondQrsCnen15932.0 endqrll nen 16420.0 toyour toour 16992.0 7811.0 Imum lctunllatuumx15252.0 AS 1115168.0 a15612.0 ciro ellroctrolor16128.0 Mtllrrhctarrh16823.0 7819.0 ItsItcuieliciml ItnItll16980.0 Itnuencliclil Itllbrncl1clt uencliclil brncl1cltItcuielicimlrtiult rUIIIresultshmvo1Ioel0 Jicexso7979.0 icenx fimhlydUll dfiudeumdfiuonstrAtcd 16943.0 dUllonntrlltcl deumOfltrfttcd 8063.0 onstrAtcd onntrlltclOfltrfttcd15047.0 tint thstthatHautb 110imsehViifritlftl cjitiitlal15788.0 hri1 16288.0 ritlnl nil16764.0 allpcrnoni nilleNon all1ereons pcrnoni 1ereonsnuffning eulTrllngsutfemingtrainfro1ItbntlftJrltA fro1ItbntlftJrltAIon -1060.0 15984.0 tbatifdlscaqa tbatudiseaostbatifdlscaqalion tbatudiseaossianleNon Ionsian14747.0 nIt14836.0 UrolTiirowpDrownThe 15508.0 UrolTTho iirowpThe Tho14888.0 14960.0 15103.0 won WIIwawhonmen ofpromnenc otpromlnenceoironInonce16028.0 ofpromnenchrtitateil -880.0 otpromlnenceht8i1nt oironInoncehesitated hesitated hrtitateilht8i1ntcl 15279.0 Illvlgjv15632.0 tlitlr8587.0 Uitlinonlak tuthallqlaltestimsonials15916.0 16867.0 toproiinletnry 16872.0 toproprietary toproJlrlclllr 8676.0 proprietary proJlrlclllrproiinletnry15124.0 meiliclnet IIIclladnlmedicinestor15691.0 publication pibUcattnnIlublc tlonl IhlirtniAini 16667.0 hllrellllllnl Attic IhlihllAtticremains 8836.0 rtniAini rellllllnlremainstrite tniotnlotoder15184.0 todaot 15840.0 8856.0 moot IOIItmoatproprietarymedicine Ilropr proprietarymeiheinee 16679.0 etarT etarT1IIttllcintl 1IIttllcintlmeiheinee15179.0 nllttIntiVrunn lcnlnnlcrunalifts hnllhas15912.0 8967.0 oceotno bCCJIIIObecome16855.0 BO soBOjiutly 16976.0 sojustly Cl ClJutly justly jiutlyJutlyfamous fmnoturtimOUIilaIInmehti mtiltnmetaRrCsoknown knofI16140.0 tn110sonomany 110mlln somany mlln 1IC01IoIOiliO14632.0 15288.0 15504.0 htlth15756.0 Iow16479.0 itatiqn ItaUqnatetiqasitatiqnthat ItaUqnthllL atetiqastImtt thllLtImtt11014636.0 9355.0 onohesitates heiltatehuftntutollCI 15979.0 tee ace15920.0 16472.0 9347.0 name ntlnoinprint 16860.0 inpnmumt print pnmumt14684.0 14556.0 9483.0 14736.0 rClomme1rllllgletunl rClomme1rllllgletunlrho 14740.0 recommending -1332.0 Porun letusPorunThe letusihio 16004.0 rhoihiohighest hlllhtaLimigimestIu15823.0 16223.0 nation nallolnatloix16123.0 16716.0 hohavegiven hoIIhfn havegiveum 14364.0 9719.0 given IIhfngiveumPerunn llorunnlauna14680.0 IIa15176.0 IItrolllCstrosig9727.0 endonement efldsement15748.0 ertd 16560.0 16092.0 nement MenrrpretentlnK Mentt1 Menrcpr rrpretentlnK 9879.0 tt1 15112.0 rcpr lentll1lr senllng15203.0 allclnwci o111uuonscaalldnci 16144.0 stations itatioiuatlonlarc16708.0 arec arctClusll areequally 9971.0 equally iuallytClusll14844.0 repreientrtl rfll1ttntrdltlreefltttlrepreientrtlYour 15535.0 rfll1ttntrdYour ltlreefltttlYour Your Liver LiverIs -1080.0 16843.0 acting nctlngvcIlBowels BoweJsBowelsregular BoweJsreguJnr 14359.0 reguJnrDigestion 16135.0 Ifnot 16540.0 11155.0 remember remcm1er11111.0 Aycrs Ayers16523.0 PutsPillsThe PutsTho Thoyouhnvo hove have16060.0 11315.0 16132.0 knownntl knownntlroUl -840.0 16772.0 14356.0 roUl Jj 14880.0 14903.0 11551.0 e11616.0 tWont 15556.0 15720.0 11608.0 16267.0 11603.0 Lo 15832.0 11596.0 I1JI4 I1JI4Want 1Want 14440.0 11839.0 Want Wont11907.0 moustache rnousincliemoustaclicorbeardi -848.0 moustaclicorbeardia -1612.0 beard beardn 14428.0 a12059.0 lieautlftil IJcnuUfulhemtutiftmlbroWnOrt1cImbMCI brovn-1280.0 tIelbJ4c116684.0 UIOUseBUCKINGHAMS UIOBUCKINGHAMS Usol UsolBUOKINQUAMS BUCKINGHAMS BUOKINQUAMSDYE DYETinu DYETnTDYj 14496.0 12555.0 12596.0 TnT MI 14676.0 cIM 15356.0 12591.0 01111 Tinu nut miH 16340.0 1nOllt 16567.0 Ci 16788.0 II16672.0 uThe 16892.0 12767.0 12867.0 Tlte14768.0 Watkins 15648.0 12859.0 BoyHay 15635.0 Boy DoyHay Pe PeTHE Press PressTHE 13147.0 THE MARVEL JARvsOF OP15491.0 TilE15740.0 COUNTRY COUNTRYTwo COUNTRYufCOUNTRYTvoufJ ufp 14588.0 14524.0 5TI TITvo14404.0 110111 14628.0 14920.0 14772.0 14452.0 14431.0 yt 14439.0 ran ianOp 15140.0 14415.0 tJlMltAto uparaterM U15784.0 1110 15828.0 14423.0 tie15960.0 olhceil olhc ohorolhlwer miiied miiiede eil 14600.0 unit an114548.0 sn 14847.0 14515.0 IxiUUioorop 15568.0 IIl1lorop Limo ilaht riHnt14512.0 15776.0 14507.0 10tltliin Inc nUl14504.0 nIe flldIIItltn 16899.0 14523.0 ns nsthnrOst 17008.0 tliin tltnthnrOst rOil rotthilt at14643.0 15091.0 hnnllnir hlullnlf15000.0 hanimnxUvblg tnr trr15884.0 biff bhthtrM IlffAAPrcseIt16200.0 ilue 16440.0 iIo UIIDI UIIDIor lotorollinrllilnit lots lotsoCtiier 17011.0 14711.0 14719.0 orollinrllilnit 14743.0 15247.0 14735.0 oCtiier nth Ihll tltiis 15376.0 IU11and15668.0 cot toltecostouilyHJO 11111I1L1Writin Writ VrIIeVrIIeII tll tllU 14860.0 II14848.0 St14720.0 OutS onfflOUttltortlrouJar14827.0 NOI 77 f1V77E f1E VC 15004.0 CLOWC LOWnLOWIXQOCOAtiantllGeorolll AtiantllGeorollltrOOOD -1084.0 Oeorcjla QeorIaOeorcjlaAOKNT8 QeorIaaooD trOOOD 15167.0 aooD 15344.0 AOKNT8 AOiNT8VANTi WANTIWANT1P WANT1PSOFT 16416.0 16348.0 P1Q P1QSOFT 16767.0 aSOPT SOFT SOPTSILKY SILIVHAIR IIAIRflAIRHAIR001IIM 16904.0 IIAIRc 17371.0 001IIM 00111817387.0 15432.0 17348.0 WIIIW WiRNVUJtN17351.0 yOU VOU17340.0 tWMCarpcnlers tWM 111116555.0 1111Cnrpcnlers 11Cirpcniers 16384.0 Carpcnlers CnrpcnlersCirpcniers17523.0 OX 17515.0 MARROW MARROVPOMADE P03UOBOMADHPOMADEHull P03UOBuullliOMADHCIWAIII 17804.0 uullli CIWAIIIOf15472.0 tWltArIIl txiItAvmosaHull 17976.0 14859.0 IlAn1 14891.0 15100.0 tbtAIP holInhI 16220.0 IhhIrV IhhIrVfuIis lnf 17924.0 1111111 18076.0 An1 wi IIOf 15032.0 15352.0 18047.0 KIII 15672.0 18035.0 18040.0 16320.0 18032.0 tallll1lI 16704.0 tmll tmlla 18116.0 18163.0 fuIis allll1lI uit 18176.0 15291.0 au 18128.0 nUrUMidflir alidrutfIOO 18144.0 OP 100OPinlrol 18119.0 JlQUO flQtirriany anan 18280.0 18275.0 inlrol itsurolmortosto 14812.0 itsurolmortostoPRICE 18268.0 15328.0 OAtOL OAtOLPRICE 18372.0 PRICE 29 2025CENTS CENTSAt 18587.0 jour your18564.0 drn druIII drunialil 18572.0 lull maillullco mailAdd anAdd 18755.0 CAIUIUNIUR CAIUihNiLhI18708.0 Ct16120.0 coLouisville COIoul L LThe 18860.0 Louisville Ioul vltto 18852.0 KyTll Ky 16864.0 KyTlio 19295.0 TlioTll OrontOroRtKnit nlUnlWcit 15520.0 mstmi Anrt AnrtACROSS WogtLtfle WogtLtfleACROSS liltt lilttMI 19392.0 ACROSS ACROSStlioentlro Slates Bintetlioentlro tlioentlroBinte entirn orirvan 15235.0 irvantim 19571.0 19712.0 lLflilU X ASlates 16088.0 lijm ItlO 21383.0 tlO TIIOII 21399.0 TIiOUCl AnSWXC 15572.0 AIUIUIIj1TIOI AIUIUIIj1TIOIhlllu8horilit 16676.0 qv jlTIoSp jlTIoSpThlrtyth iom iomThirtyfile 21471.0 21496.0 Thirtyfile Thlrtyth21480.0 rollei inik21488.0 hlllu8horilit 15360.0 15396.0 Shortest BhoriraiItmttc llnulIImte16248.0 Blireripott 8I1rlpoMlirupotlIGlafiiilii IGlIa latsiiss 21572.0 lIa fiiilii tsiissWrite WrlleYriIe21591.0 torew IIn16044.0 T uuran elsarueuuranH elsarueIfriss rissH 21680.0 21711.0 If21708.0 JITUItNrll0 TUIINIIIITUliNlIQen15420.0 1ais islAft AllAgiDall P51111 llaaT TnIJI 16732.0 Tn liiiliiiDropsy iai iaiCURED 21952.0 Rr 21955.0 Dropsy DropsyUemovU -1188.0 IJI -1184.0 16548.0 22379.0 Hcllsf Hcllsfawilllu CURED CUREDOlvei Quick QuickHcllsf CUREDRr 22104.0 Olvei OlveiQuick 22123.0 Irl 16799.0 UemovU 15772.0 awilllu wIllugln Iu6tose 6tosedaysi lotara daysi 22736.0 ara eff lIlell tfIcIsII15879.0 JUfTIaat pEfpisiiehttfn 16599.0 nl 22668.0 eur eurntn cute curocuroIlln cuteS 22799.0 22771.0 Illn 22775.0 1113510 15656.0 15596.0 ntn todl 22767.0 dayiTrial 16076.0 22755.0 TrIAlllellllll TIalIreiitnsbl16423.0 22759.0 TrIAlllellllllsltllfnIotlllnJua TIalIreiitnsblglwmi trealwtut trealwtutWi sltllfnIotlllnJua glwmi -1216.0 fr Zlothlnca bt behirer Curdhirerto Curdwtie 22964.0 22972.0 22983.0 Wi Wrlle wtieHe OrDrOrHKi Cystss22979.0 16576.0 16620.0 lens 16272.0 cmSpiel on8plChllI 23035.0 23147.0 23084.0 Spiel 14703.0 23075.0 8plChllI SpscIuIit15564.0 15588.0 illlll Dot DOlUos0AIHMtlil Attests AllutlItsxmlns:ns9 ID29 19352 3640 17092 3892 ns9:type 20576.0 20607.0 17752.0 9f 17828.0 19456.0 MM 17824.0 MMifwII 18916.0 ifwII ifwIIrcrJ -1464.0 19016.0 18636.0 rcrJ 18987.0 sIt 20636.0 17216.0 If17396.0 YOIl17328.0 17684.0 to17608.0 17896.0 9111.0 18092.0 derive crhe18036.0 18599.0 prompt 18528.0 promp 19092.0 nndnad18963.0 nndfactory 19304.0 19383.0 stta sttafactory 19644.0 19507.0 tItllctory factory tllctory17628.0 results reaultll17528.0 front18019.0 rant 18392.0 18496.0 tliotho18775.0 DM UIOne18684.0 19048.0 or18956.0 Perunai lerunaiPcrunut19168.0 Perunaiwrlto lerunairlto 19716.0 PcrunutvrIto 17136.0 9339.0 wrlto vrIto17496.0 17420.0 17699.0 nce 18048.0 17968.0 Pr HrIrllnrtoian Hnrllnanlianinuan19172.0 Blrlna RII givi19536.0 iA DIaaifull 19704.0 afall 19616.0 DICuI CuIfall17199.0 tntement IItttollltnetatoment17999.0 or17943.0 18240.0 18431.0 18487.0 9499.0 eoiicr8larid nndIIld19072.0 lio 19019.0 19124.0 mu19216.0 wUwll19460.0 19488.0 19548.0 boi bohoboiIlleaird boJiltlliCtlto hoiisaeii 9572.0 Illeaird iisaeiiJiltlliCtlto 17640.0 17755.0 17848.0 givtiItlve18175.0 18080.0 hit his18643.0 18736.0 valuable vAluabcvaitmabe19312.0 advice adviosadvicegrAilr 19680.0 Idvl Idvlgrn 19556.0 adviosgratis 17092.0 gratis gratisAtitlresa 17431.0 Lie LieAdelre grAilr grn 17211.0 Adelre Atitlresa17272.0 17592.0 17764.0 DrHarlman I1nrhnnnIfmtrtmnan17919.0 18668.0 Irenlilent lrr8hfnLIrciitlen19280.0 or19224.0 19451.0 fha7ho19400.0 ThoHartman 7hohitmitman fhallArtntnn Hartman llArtntnnhitmitmanSanitarium Sanltnrluin811 Drl 17912.0 17975.0 tnrluin 17955.0 9955.0 Culimibin CulumblllColiunbus18352.0 19144.0 19036.0 0MALSBY 19231.0 17167.0 10212.0 MALSBY MALSBVCo5oulbrorJjIiSAllfluln3a COA 17311.0 10623.0 417460.0 117428.0 17596.0 5oulbrorJjIiSAllfluln3a 17511.0 5oulbrorJjIiSAllfluln3aPortnblo -1944.0 19539.0 Souib 17836.0 lhFotsllb 18016.0 lorsyib 18512.0 18568.0 18828.0 Annulo AlinuisAlinuisiLk 03Ut 17887.0 10843.0 iLk iLkPortoblo -1748.0 19636.0 18492.0 11763.0 1t -1144.0 18656.0 Ut 18604.0 Ut1t 18887.0 trortnblOllll 1724.0 17611.0 Portnblo Portoblo12075.0 rortnblOllll still ntul18628.0 StatIonary BlntlonnryBntlunt1BlntlonnryEngines 19336.0 Bntlunt1Engines StatIonaryI3ngines 17252.0 Engines I3ngines12243.0 BoilersSLw 18428.0 Boilers -948.0 19595.0 BoilersSmv 19600.0 BoilersSnv Smv SnvSLwMills MillsAND 19184.0 20551.0 IAND 17143.0 12884.0 AND ALL 17476.0 17672.0 tL 17868.0 17928.0 KINDS 18424.0 18800.0 MACHINERY IACIlNERYMACHINERYCompW IACIlNERYCMAChINERYQomple120703.0 4IttifxD74 20732.0 13108.0 CompW Qomple117643.0 mpll 17575.0 18043.0 lint fin 18187.0 18296.0 13095.0 ttrrltt carrfrlcarlt 18728.0 18768.0 fri18924.0 ilockorIUMBDIATX 18875.0 Iock 18984.0 ilockor lockfor19207.0 19228.0 13087.0 lor 17728.0 IUMBDIATX IttifxD74-872.0 MIEDl 17787.0 18416.0 13247.0 TX 18436.0 iMpmtnt iMpnirnliMpmtntWrlto 19151.0 iMpnirnlgist hpmft gistltachtnsty 17376.0 13391.0 lowiul rrlollu4 18440.0 Ftlos 19040.0 18843.0 IIId 18812.0 19084.0 Dccl 19087.0 19363.0 Tem 19163.0 TemWrlto 19668.0 Term TermWrite Wrlto Write17852.0 UIits17768.0 18124.0 13595.0 tor13587.0 cnfnlocuc forcntnloguocnntoue 19139.0 priccipriceetc priceote 19624.0 priccietc ote17531.0 bofaro17360.0 18052.0 buying buyingiSAW bulns bulnsSAW buyingai SAW iSAW18012.0 MILLS MILLSrlth 18804.0 18368.0 14179.0 Llsour 18328.0 18848.0 rayed roYl118995.0 f8awMlJU f8awMlJUwith 19575.0 ld 14187.0 19156.0 19284.0 Ulrcul 19236.0 Ulrculf8awMlJU 19331.0 19468.0 19416.0 14316.0 rail 19544.0 railI 1m 1mroYl1 rlthnhliii17564.0 lIeges HeneVHeire17524.0 17960.0 Umvenal UnlY Vn On18224.0 erullAI 18108.0 erssl 18756.0 18299.0 14567.0 18463.0 18384.0 18531.0 Jnu 18631.0 14572.0 18763.0 Hi lit18696.0 riml lrAnis18880.0 19107.0 19148.0 Re 19044.0 Rfolln RfollnllhlulahnUI neolilinIl neolilinIlrat 19732.0 19360.0 lilln lillnr 17267.0 rat rminiill 17436.0 17504.0 Smiptillahentis Itl 17952.0 14648.0 niu8itWirk 8M SniWmkull 18460.0 18536.0 yuIrI4l 19063.0 18796.0 14667.0 oust oniltIi Um 19300.0 19372.0 llfftUeallfftrooVKlnX UearolKlni liesroohKln 17276.0 rooVKlnX roohKln17448.0 llhlulahnUI VUIII Vsrtlla 18319.0 18031.0 rUM 18287.0 iestl 18468.0 18592.0 il l114748.0 Uoiki tflIkI19080.0 ire Iro19316.0 nni imumsinniwiled IIU IIUI imumsiiemteit wiled iemteitrolKlni c1 17680.0 17792.0 17831.0 ACCIIHAOV 17904.0 14879.0 ccun ov nuiriiciTV sUiricITT19131.0 bviADii OVIA1IuIbviADiiirriNOiAiiiorgrinATiov 19572.0 OVIA1IuItYTAl4D 19200.0 UUbl irriNOiAiiiorgrinATiov 14992.0 tYTAl4D -1508.0 18780.0 XAU Acun40T 17992.0 18028.0 orcrInATirl MIIrltITt 14955.0 rli 19204.0 19112.0 Ie 19239.0 fnrfol fnrfoldr 19395.0 14939.0 liiig lul dr ITAI irlpll 17648.0 15099.0 17987.0 olrenur orou1lsr17884.0 18363.0 orQllnnWf 18143.0 18499.0 ManwafitiWbjr 18248.0 Mnlll -920.0 1nttittitii 18968.0 tlrrc1 19068.0 rut Jhfl 19480.0 JhflSAIKMIltONOnKSMnl 1M the1M8JAION theAl drurlllh eepu15175.0 8JAION SAIKMIltONOnKSMnl 15180.0 Al -1520.0 18856.0 17464.0 17720.0 WORl5SVinIuiuiIilfitflNO 17931.0 WORl5SVinIuiuiIilfitflNOhtpuisTumbulcnnro -1544.0 Sil mN 19483.0 15280.0 SCKSS7 SCKSS7lUpaiuTnbulcaaro 15524.0 lUpaiuTnbulcaaro htpuisTumbulcnnrolUpaiuTnbulcaaroIhu htpuisTumbulcnnroHue18675.0 blllcllr blllcllrIIQ Hue IhuIIQ 18724.0 bust leatbClt 18980.0 dyspepsia dllopeIBdyspepsitxdyspepsiamcillcliio dllopeIBIctlllno dyspepsitxsVA 17364.0 sVA 18387.0 mcillcliio inethicimmoIctlllno 18960.0 001evermnde nfldemndeA IIOltO IIOltOA 20539.0 15899.0 20676.0 4b 20707.0 16003.0 18399.0 18272.0 18504.0 hUl1rcd millionsmillionof 16043.0 millionsof 19348.0 16040.0 olof 16192.0 tlmefl16203.0 11el 18948.0 hmflvo18975.0 19356.0 beensold been80hl beenBout 19760.0 80hlBoutin18663.0 JI 18895.0 19004.0 16347.0 theUtmltcdUnitedStates 19319.0 Ull UtmltcdStatIc dStlltel StlltelStatIc18936.0 16512.0 18816.0 16535.0 16543.0 19244.0 tlngla IURloalmiglo19268.0 tlnglayenr almigloycnr IURlon yenr ycnrfivcry pvr1flycry18619.0 19351.0 Illnoss hlInhiIllnossfrom 16675.0 Inlalaln hlInhierising 16871.0 alaln erising Cram18099.0 16895.0 a18004.0 18256.0 disordered 16863.0 111aorl 18928.0 disord rel1 rctlMonmch aioumnciiItOlleh 19551.0 Isj Iellofd 19672.0 isrelieved 17164.0 17031.0 relieved ellofd17599.0 17039.0 17060.0 orcc17012.0 tytbt 18760.0 tliHr tlmdr17028.0 uioUleHocommon 17015.0 0COllon 17160.0 17219.0 common COllon 17996.0 17183.0 18192.0 17180.0 Ilnt 18452.0 18543.0 diseases dionses17191.0 nel originate origlnumleoriginatefrom orhIHo orhIHotroln origlnumletrain 17152.0 17356.0 trolntrain17467.0 stomach Itollcb 17327.0 flthny 18840.0 18560.0 111n 18900.0 18743.0 18972.0 bsattIy 19100.0 safely sally19007.0 19563.0 17332.0 19500.0 assorted 19568.0 Ilorted 19700.0 17463.0 17508.0 sorted lortedtherolucre17540.0 Iixuq18260.0 17471.0 condition commdutlotmOlltoll oCill19495.0 IIIhenllh 19739.0 illhuiaitii 19772.0 17620.0 17652.0 henllh huiaitiiIInlh 17548.0 17660.0 thttIumt17631.0 vIlI17639.0 buhibencIltciT beimcfttcilLeleJtcl orcured orcllrcd 17132.0 cllrcd17572.0 tho17724.0 17855.0 occasional occn 10lnl 18343.0 utro misc17783.0 1leot Illuam 1UnmmuIlluamTabulcs 1UnmmuTabuies Tabulcs TabuiesTnbulc LbyalclfiUB Lbyiicinue17708.0 lh 18563.0 lcllu liumow18819.0 17971.0 19095.0 17940.0 timemuandapcnk 1ul apcnk Illenl510111018111.0 highly otthomthuonm19136.0 drugtlitruggistidruggistssell itruggistisell sell thoumTliorhofivecent flvcccsitIvocelt pacUrtBO paclilgo19648.0 isIBenough Ieloulh iseumougim 17140.0 eumougim18283.0 1101 tor17808.0 18459.0 18451.0 onorduumnnyorlnary occasion oCcutsIoteccnlol fQc nndnndthe 19763.0 nnltho 19768.0 andtile eloulh thotile17404.0 18579.0 Family VnmilyFamiy 17864.0 Uottlo llottlo18316.0 olxty1IIItceutCfntl cohtnln cohtainscohtnlna cohtainsacottnlli cottnllia 17148.0 18744.0 lioufotioltl oti4ChioId17220.0 18731.0 supmtIUl1111 Cora year ycn18752.0 Ono OneOnogenerally On OnIccfBlr OnegcnoatIy gcnoatIyIccfBlr 17155.0 uilqutcfl wlututuiIqutcuilqutcflW wlutuW tuiIqutcw louCelol 17872.0 18896.0 elves18312.0 18888.0 relictrelct 18879.0 within witbimawllhltnt wllhltntwlutu 19663.0 twentyuilqutcfl twentytuiIqutc 19311.0 L5 18180.0 DOUCLAS DQUCLASDQUCLASYou -1560.0 19615.0 32 19620.0 19623.0 SHOES SHOESYou -1036.0 19412.0 WYOI YOI clnsavosa 18075.0 18131.0 19835.0 819840.0 19827.0 IU14fly yearly ytarlbywearing 19463.0 b1bywesrlnj b1warJsW 19940.0 wearing wesrlnjTi19963.0 LDouslu3OO 18072.0 Douglas 18612.0 390 i35O18580.0 19951.0 orhhoC 19619.0 19024.0 19992.0 19075.0 19272.0 etocs hossetocsThey hossT1ICI T1ICIwarJsW 20107.0 equal cIIU4120112.0 thosothosoUmt thOo thOotln 20604.0 Ilint 20632.0 Umttln hnto iuusYc20247.0 17687.0 17816.0 horn18155.0 20255.0 eltIg costlag tIng 20364.0 lag IngIg20388.0 joim 17343.0 101 17655.0 frouuifrolt 3W 3Wto 100to 20419.0 20495.0 17367.0 20475.0 fiHVO 17668.0 17443.0 20483.0 dVO 20479.0 Tub Th6Thbim1mUIOIIM im11101mM UIOIIM 11101mM20635.0 OII 17516.0 salerI18292.0 18340.0 ItDoiifflai 20639.0 20559.0 tJ tJUQulln 18740.0 tioumglas Doiifflai ioumglasUQulln shoes aliooahoo 20739.0 prove itruro17936.0 provetliolrsnporlorltyovor tliolrsnporlorltyovorall18360.0 Irvet Irvetholr 18419.0 itrurotiiolriiip 20844.0 tliolrsnporlorltyovor 20847.0 tiiolriiip 17208.0 holr lp 17440.0 rlorlly riorilyovct riorilyovctBoi oVer oVeral 20967.0 17296.0 othormakesBolil Jako 21072.0 21083.0 Bolil SoUBoi21087.0 retail rell shn iiine21079.0 shnijenlers iiinei1ciiens ttiook 20644.0 21203.0 ijenlers c1eleri1ciiensevprywhere evItrywbersevprywherefxKik roJ 21323.0 fxKik tiook21328.0 21336.0 17480.0 eVII 17716.0 21363.0 nntno nimmo18096.0 andprice anti21355.0 1111price Aprice ftloltm ftloltmTli bottomThll 1Thu 17243.0 21575.0 Thll ThuTli Pduilii DOsalsiPdul HIM 18208.0 Cor CortnaColl Coolt1 CorDM1011 tnaColl DM1011olt1 protii pro 17964.0 Ihirt thirethle isItCorona IIu 19192.0 3usis 17176.0 21787.0 usis Iu 17499.0 21808.0 10UII IJoului 21792.0 hon shoehonOtOI acT acToresI 19128.0 Corona OtOI oresI 21884.0 hII21892.0 Ike hUlint hiahPuthllhtt hllhttmall hiahPutgnu Ijr 21984.0 22020.0 jr 21999.0 gnu 17287.0 17355.0 17408.0 22003.0 IaLeIhrinuuis 17568.0 IaLeIhrinuuisp 21995.0 jh 17760.0 18148.0 21991.0 mall mtilmallfl IMtliBkjJ1iar 22031.0 19368.0 lif faill ICWIVVI 17616.0 ltrt 17916.0 22099.0 ilt iHfl aiiofHMblX VfMJVKiiKl VfMJVKiiKlOar 19736.0 22183.0 Oar 22172.0 44 f422188.0 Ollt 17711.0 22180.0 ttit frf 18204.0 22199.0 iaim fe 18616.0 ISCWc 18607.0 22164.0 tgiiallti rrl u1anfricr u1anfricrithoe tan 22196.0 nUt nUtHlo 19560.0 19375.0 rttte rttteNhott 22272.0 Nhott ithoeHlo 17555.0 bf mqwall Sri tftUqitu Ia suits riliafrl 19000.0 Illnnlnlfrt lIlusiraIIdIllnnlnlfrtCalalti 22275.0 1lrl 1lrlIt lIlusiraIIdCaialg Calalti Caialg17232.0 ftIrI ITUOIUMH IIOVCJIA14IOtUfAt 18824.0 18892.0 ilrofitcn lirarkIcuIrorUcn 19380.0 Sisal SisalGive luGive utho 17260.0 22516.0 22579.0 Give 22576.0 tho22595.0 22603.0 22568.0 thliihrpap 22592.0 19407.0 whento wJn wJnwrItng 17108.0 22731.0 wrItng 22739.0 idVertlicr adVerradvertllrJAt393 advertllrJAt393I advertllrJAt393t-1380.0 adVerrItal5irdwIIh5 At393 Ital5irdwIIh5 irish -1088.0 rJ ie 23027.0 ThM 23067.0 unemplen 18907.0 SiY Eya rirish 23055.0 xmlns:ns10 ID35 5056 6576 14612 23247 ns10:type 14872.0 Ifoursfora YOlIAffI23439.0 YOIWl -1744.0 16616.0 YOlIAffI15fiT 17084.0 Cearfeatf ClearHeaCearfeatfBEST -2240.0 19324.0 17087.0 ClearHeaBRONOSBTZER -2236.0 20780.0 23283.0 23903.0 23928.0 15fiT 15fiTD -3708.0 BRONOSBTZER -2684.0 24256.0 fO 24355.0 orDBVRYWERE 15224.0 orDBVRYWEREc orDBVRYWEREBEST-2376.0 16035.0 24387.0 -2036.0 VJSRV71JER VJSRV71JERESTFOTNE -1432.0 16572.0 24903.0 24916.0 BEST 24908.0 ESTFOTNE 24911.0 FOR 17124.0 TE17064.0 BOWELS IOWELIROWELSBOWELSIDANBY IOWELIQUARAUTGED ROWELSt ROWELSMNY20556.0 25803.0 IDANBY MNY18324.0 15340.0 26295.0 16755.0 CTI1ANTO 16784.0 26247.0 16544.0 26583.0 21047.0 26615.0 20651.0 jOUARAuTUaD 21188.0 27259.0 QUARAUTGED OUARAuTUaD27267.0 CURE cug10U1 16204.0 27275.0 ubisppndICitIbiiiOUflhiS 27243.0 k4btathi rlt bd bdbld aslined lcUI bloulff 27280.0 27375.0 lined bldcitatomlchbteute etUllpn bowel -944.0 17624.0 foul mOi lb budach hiudacheIndcntlI1 indtestt pimple 18951.0 pimplepimni mile 27479.0 pln pimni liter 27475.0 Oe nuae saun 15644.0 Iivr 27495.0 toUIf 15944.0 rouai 14 Oltc 27487.0 sallow 16660.0 27531.0 mi9W bwollol mmiu skin kln17036.0 wuw 27483.0 ad sad 27471.0 dulnrl diuIni 27467.0 Whr 27527.0 27523.0 HI bwl 27459.0 boweil wsi 18943.0 27451.0 dOn 4Qn19116.0 TptUonklUiirorp mOo mOoflla matigUlarly 19524.0 tigUlarly flla yotz olaro itch IllkContplUo Con Itipiftori 27587.0 ptUonklUiirorp kills 17184.0 17284.0 peoplesterti opta bn aU IiiUoth 18140.0 r4li 18448.0 27551.0 c1UkICthcr diiesIItcltttuCT -956.0 18704.0 aMt 18940.0 togethertt sterti 14716.0 tlna chronic ebfonic15408.0 tllmtat slim lmal sod indnolODf loot long16428.0 27711.0 vetri talTrrlne uIfrrInCoullnc matter msttermate wb 18152.0 whitKill Ifslied tmt19307.0 takln tkOitaklnCA8CARET8 Uklll tkOiyou 27787.0 CA8CARET8 CACARET5todCAICARBT8 27791.0 toayoay forl yen 27763.0 wflf 27795.0 wl ren 27815.0 nvr nv16840.0 ct wIl27783.0 iodaie ea wllunt 18748.0 ett etV 27775.0 jouf joour 27771.0 ouC bovnl bovnlright Iril 5004.0 27891.0 Tik Tak27915.0 27883.0 15779.0 Ju 27911.0 27899.0 stirS aUrtltn Ccicartti ClurtUCsscrstitAdar tLdsltAdarmoniy nder 27907.0 ncc 17980.0 absolute Wlute cu usraetd usraetdmenu rmnt aoadeij 27871.0 cum 19475.0 4892.0 ril 28023.0 moniy mon menurtfoadeij rutuadedrtfoadeijbooklet rdldId oadeij 27991.0 27983.0 ThoJnulu jttnuln wih tablttitamptd tbIetstamped17308.0 27987.0 CCC CC tlever tCer18112.0 28011.0 eer aold114 18443.0 tnClal bulk bulkbooklet eaAddr lmpl 19424.0 27972.0 28103.0 booklet bklt frr Irre28087.0 Addr Addrau Addtii28095.0 iuBte Uaul UteimM 28116.0 28091.0 lliHtRtm fomldy Rmv ablumpd dyCompaayCbM 28099.0 va pun1lJL1Ir 17784.0 Cb 28111.0 gaef eM KowYotk Mow VokVok9UJIIji1 28079.0 28223.0 9UJIIji1 28207.0 lIE JaITmJ 1ILVJ1I xmlns:ns11 ID38 2080 10648 10056 28423 ns11:type 28423.0 19607.0 19924.0 29175.0 STo 29492.0 29571.0 29603.0 curd cureQUr9r 9r qrInoney ioney Yr 29547.0 rcfvnc1 29779.0 byyourm9rchanto -1968.0 merchant rchant 14296.0 15412.0 nQttry flQttryIQt 29535.0 trY1 29511.0 prlo 1rIcQQ OOQQA OOi18516.0 29759.0 UA 29875.0 29895.0 29923.0 29927.0 29883.0 30003.0 30063.0 IIJ 20075.0 30079.0 I5J 20095.0 30187.0 i30275.0 30299.0 5J 30307.0 30419.0 30431.0 30459.0 30467.0


xml version 1.0 encoding UTF-8
alto xmlns http:schema.ccs-gmbh.comALTO Description MeasurementUnit inch1200sourceImageInformation fileName \\exanet02.iarchives.com\newspaper\root\projects\production\newspaper\UofFL\NDNP\Box2\BN01987\ocr\0096b.tifOCRProcessing ID ID0 ocrProcessingStep processingStepSettings useAbbyy4:0
dictionaryFlag.D:American-English
ImgPrep Component Count High Estimate:17651
useCaere:0
Abbyy6OCREngine Character Error Ratio:0.1259
splitwords:0
ScansoftOCREngine Character Count:20721
conjoinWords:1
enableLog:1
dictionaryOn:1
IrisOCREngine Character Count:22552
Abbyy6OCREngine Character Count:23444
Abbyy6OCREngine STAT BLOCK:STATBLOCK_Abbyy6OCREngine;23444;2952;44.3362;94.89
language:en
ScansoftOCREngine Predicted Accuracy:66.27%
page-reoriented:UP
loadfromfile:true
suppressPunctuation:false
multipleEngineWeight:0
suggestionCount:0
Node Count:7082
ScansoftOCREngine Character Error Ratio:0.4018
spawned:1
IrisOCREngine Character Error Ratio:0
IrisOCREngine STAT BLOCK:STATBLOCK_IrisOCREngine;22552;0;0;0
cachePath:/jobq/caches/newpah_legacy
monkeyTimeout:1800
Predicted Word Accuracy:94.89%
lexicondirectory:\jobq\caches\lex\wintertree\
text-orientation:UP
IrisOCREngine Predicted Accuracy:0%
verboseOutput:false
trimwords:1
Abbyy6OCREngine Predicted Accuracy:94.89%
ImgPrep Component Range:13914,17651
version:Newpah v2.36 Luxmortis
ScansoftOCREngine STAT BLOCK:STATBLOCK_ScansoftOCREngine;20721;8325;0.729743;66.2745
noPunctuation:1
ImgPrep Component Count Low Estimate:13914
DictionaryFlagsUsed:D
configFile:/jobq/caches/newpah_legacy/config/newpah_acwi_x.xml
processingSoftware softwareCreator iArchivessoftwareName NewpahsoftwareVersion v2.36Styles TextStyle ID3 FONTSIZE 10.0 ID5 37.0 ID6 15.0 ID7 14.0 ID8 12.0 ID9 11.0 ID15 9.0 ID17 8.0 ID24 28.0 ID29 5.0 ID41 16.0 ID45 21.0 ID46 40.0 ID47 48.0 ID48 44.0 ID49 13.0 ID50 23.0 ID51 30.0 ID52 18.0 ID53 17.0 ID54 29.0 ID56 24.0 ID57 19.0 ID58 34.0 ID59 4.0 ID60 25.0 ID62 64.0 ID66 60.0 ID67 51.0 ID68 22.0 ID70 43.0 Layout Page ID1 HEIGHT 30676 WIDTH 21036 PHYSICAL_IMG_NR 1 PRINTED_IMG_NR [1] PROCESSING PrintSpace 30144.0 20736.0 HPOS 188.0 VPOS 312.0 PC 0.9489 TextBlock xmlns:ns1 http:www.w3.org1999xlink ID2 4372 20212 712 312 ns1:type simple language en TextLine 72.0 20.0 20512.0 String CONTENT I WC 0.8095238 56.0 32.0 4184.0 1340.0 STYLEREFS t 1752.0 1468.0 r 0.96825397 20900.0 1500.0 j 10384.0 1564.0 S 500.0 176.0 20744.0 1660.0 304.0 1856.0 372.0 20864.0 SP 20799.0 1r ALTERNATIVE 1f-56.0 20919.0 1I 1i 156.0 5880.0 776.0 2000.0 36.0 2036.0 l 80.0 1192.0 2040.0 10 380.0 812.0 120.0 6112.0 f 4884.0 1228.0 92.0 6608.0 432.0 6176.0 528.0 20056.0 768.0 1996.0 384.0 320.0 18 ie112.0 1352.0 2148.0 P 264.0 1088.0 168.0 2776.0 2116.0 1424.0 128.0 2936.0 J 96.0 2840.0 144.0 3088.0 2172.0 i 2992.0 if -96.0 3184.0 88.0 4304.0 2164.0 > 1120.0 4428.0 2200.0 4384.0 52.0 5692.0 2244.0 1244.0 4448.0 1h -20.0 5712.0 19792.0 2440.0 b 14080.0 20620.0 2368.0 796.0 19824.0 356.0 20728.0 2168.0 76.0 20651.0 880.0 2507.0 h 1336.0 17716.0 736.0 2580.0 2864.0 0 1024.0 3684.0 d 248.0 1180.0 3695.0 Y 1136.0 1448.0 2832.0 4 192.0 1256.0 1536.0 3708.0 1480.0 1580.0 3160.0 -16.0 1596.0 1012.0 896.0 3020.0 2628.0 T 1416.0 1604.0 744.0 1308.0 4036.0 2940.0 HE 3916.0 1072.0 3504.0 6252.0 2683.0 QAINE 908.0 5344.0 2288.0 7876.0 lrwIoI -1880.0 9756.0 232.0 1176.0 10540.0 2595.0 WFiI 376.0 10164.0 748.0 2760.0 10816.0 3024.0 TILTE -900.0 11716.0 1104.0 3052.0 14424.0 2812.0 STAR 0.95238096 848.0 13576.0 14872.0 3588.0 -2604.0 17476.0 136.0 14900.0 3568.0 -4.0 14904.0 68.0 15004.0 3732.0 14948.0 18415.0 3580.0 3360.0 15056.0 tJ -36.0 18451.0 212.0 3616.0 3476.0 3832.0 1224.0 iDvorj1D 104.0 3688.0 3836.0 -1012.0 4700.0 856.0 3848.0 3844.0 VUto 3768.0 288.0 4896.0 3876.0 to 4704.0 556.0 5340.0 3880.0 TIXE 5184.0 392.0 5504.0 3884.0 -392.0 5896.0 148.0 952.0 6140.0 3896.0 MonAL VtOIALI244.0 196.0 6600.0 7256.0 3915.0 1312.0 BUSLNJeSS ThUgflss616.0 8704.0 3948.0 AND 8568.0 1456.0 9464.0 POLITIOAL EoLITIox49320.0 132.0 11068.0 3968.0 INTERESTS ITERSTS10920.0 328.0 12728.0 3980.0 OF 160.0 12568.0 648.0 13208.0 3988.0 OITY 152.0 13056.0 428.0 13212.0 3984.0 CIT -644.0 13856.0 14064.0 4020.0 OOUNTY 512.0 Ooty -1120.0 15184.0 1640.0 15320.0 4068.0 16111.0 4072.0 STATE STTE15968.0 STTEIU -848.0 16960.0 404.0 18192.0 712.0 4140.0 808.0 4248.0 VOLUME 1688.0 4256.0 1520.0 7600.0 5840.0 1760.0 272.0 8144.0 4272.0 VII 480.0 7664.0 84.0 12540.0 4236.0 IU 4148.0 8392.0 18220.0 IL 5596.0 12624.0 18807.0 520.0 18287.0 268.0 18960.0 728.0 4416.0 4528.0 7704.0 4672.0 6932.0 772.0 140.0 800.0 8932.0 lLORIIA 1144.0 7788.0 504.0 9032.0 LnIUI -700.0 9732.0 9536.0 4424.0 0.0 9616.0 A 9608.0 568.0 9976.0 lIUDA tDA7240.0 9736.0 632.0 11040.0 4432.0 EPlnM 496.0 10544.0 11704.0 Dr 11672.0 11952.0 R 11864.0 12240.0 4480.0 25 184.0 12056.0 12344.0 4487.0 c -64.0 12408.0 108.0 236.0 12664.0 ioo 260.0 12404.0 12736.0 9J -164.0 12900.0 224.0 416.0 18888.0 4456.0 Inn 5904.0 12984.0 19543.0 4612.0 Al 19304.0 xmlns:ns2 ID4 7224 2680 588 4707 ns2:type 492.0 2056.0 732.0 4707.0 460.0 1084.0 SHERIFF sHERIP444.0 816.0 1968.0 4756.0 PULLS 1816.0 PULLSBIG 0.82539684 -816.0 2784.0 1972.0 4760.0 -812.0 436.0 1976.0 2788.0 1032.0 1288.0 5279.0 424.0 BIG 420.0 464.0 5292.0 JOE 1712.0 2548.0 696.0 6048.0 Found 216.0 664.0 1264.0 6056.0 Whiskey 1160.0 2028.0 6084.0 and 100.0 1928.0 2408.0 Empty Eiuply2296.0 164.0 2996.0 6104.0 Bot Dot2908.0 Bottles -248.0 3244.0 Botties Dotties 1652.0 1140.0 6344.0 ties tles1512.0 6356.0 in fn1404.0 1772.0 6352.0 Fryers 1872.0 6404.0 ryers -428.0 2300.0 6376.0 Store StoreJOE -384.0 2792.0 6379.0 StoreJOEDLI 2592.0 644.0 6896.0 684.0 JOEDLI -316.0 964.0 300.0 1080.0 6916.0 DID -252.0 1332.0 172.0 1472.0 6920.0 NOT 1380.0 6928.0 WANT VANT1800.0 752.0 2484.0 6943.0 TOCOME 2384.0 TOCOMEBut -752.0 3236.0 TO 448.0 6951.0 COME 2696.0 COMEBut -448.0 COMEjut 2640.0 628.0 7388.0 336.0 But jut292.0 672.0 7468.0 -292.0 564.0 1056.0 7471.0 Sheriff Shariff660.0 1756.0 7484.0 Brought 1620.0 Br -660.0 2416.0 368.0 2048.0 7492.0 ught 1940.0 2512.0 7496.0 Man Mnl1Mini284.0 2984.0 7508.0 alidandWhiskey -284.0 3268.0 7500.0 ni 276.0 7504.0 alidWhiskey -136.0 3120.0 3188.0 -72.0 3260.0 dWhiskey -80.0 2080.0 932.0 7720.0 180.0 7735.0 Together 1300.0 TogetherJoes -736.0 2448.0 TogetherJoesExplanation -1300.0 3012.0 TogetherJoesLXp1zinntIon 2620.0 7756.0 Joes JoesExplanation 968.0 7980.0 Explanation LXp1zinntIonExplanationSheriff LXp1zinntIon8berI-968.0 2460.0 784.0 8252.0 8berI1252.0 8260.0 L r41208.0 1452.0 8263.0 W 1680.0 8268.0 Fennell Fennel1592.0 124.0 2248.0 8271.0 Is 2412.0 8276.0 saM said2344.0 116.0 2728.0 8296.0 2656.0 2916.0 8288.0 be 2844.0 3104.0 8328.0 an all3060.0 anehtliuslastlc -140.0 alleltthuslalltfc anethusast1 2616.0 636.0 8428.0 ehtliuslastlc eltthuslalltfcethusast11440.0 8452.0 cat 1388.0 1708.0 8444.0 hunter hUllter2220.0 8456.0 2136.0 2536.0 2452.0 2584.0 8460.0 2716.0 he be2636.0 2952.0 8464.0 findsnyof 2860.0 296.0 2956.0 8468.0 finds -296.0 3252.0 findsany 2560.0 8604.0 8640.0 any 704.0 8607.0 nyof 868.0 912.0 of -128.0 1040.0 200.0 1128.0 8612.0 the 324.0 1372.0 blind bUud1328.0 1744.0 8623.0 variety 1696.0 2224.0 8632.0 0C2180.0 344.0 tigers tIgcr2348.0 352.0 prowl prawlprawling -352.0 3192.0 prowling prowllug 2568.0 8772.0 ing lug8788.0 around e1louI111atupt840.0 1420.0 8796.0 where whee1316.0 1876.0 8804.0 1796.0 hunts huuts2524.0 8816.0 cnU cnls2432.0 8852.0 cns1 -232.0 2756.0 348.0 2848.0 coons 2796.0 coonsand -348.0 3196.0 8856.0 2612.0 620.0 8952.0 8964.0 340.0 900.0 other Uterther852.0 544.0 8972.0 varmluU vanulullvarmIuts1240.0 2108.0 8984.0 lie1924.0 516.0 2352.0 9003.0 captures aphlrescapUires2256.0 2920.0 9000.0 them 2868.0 themnllve -312.0 3232.0 thema1lve themalive 9132.0 alive nllvea1lve400.0 9135.0 brings 920.0 308.0 1556.0 9148.0 thetntbem1960.0 9168.0 1864.0 9176.0 town 228.0 2532.0 9164.0 aull2856.0 places plncesptcesplacesthem -380.0 plncesthem 9204.0 ptcesthem -376.0 9308.0 984.0 9348.0 on 944.0 1188.0 9316.0 exhibition exhlbltkti1920.0 9327.0 In 1836.0 316.0 2088.0 9368.0 some soUlesonic9344.0 2404.0 2672.0 9340.0 9360.0 court courtroom -320.0 courtrooms courtroofl1 1092.0 9480.0 9500.0 room roomsroofl11052.0 1000.0 9492.0 tuo tbotho9495.0 city cityWell cityWelt cityVeIl 2468.0 764.0 9660.0 Well WeltVeIl9663.0 tliQiherldgot 1060.0 till the1988.0 396.0 1364.0 9668.0 sheriff eberia1788.0 9692.0 got 9679.0 hunting huutlng2556.0 9684.0 his 2676.0 hlsltnd -180.0 hlsltndlat -504.0 9696.0 head ipadheadlait 2988.0 ipadlint -244.0 612.0 9832.0 9836.0 lat laitlint532.0 Tufcsday TutsdIYTutsday1504.0 9880.0 so 1412.0 1728.0 9847.0 1632.0 388.0 1952.0 9860.0 armed amlooaruied2396.0 himself hlmsetr2340.0 9868.0 with withhis -276.0 2624.0 10000.0 10012.0 badge 1280.0 10015.0 10020.0 office 1408.0 1912.0 10028.0 1824.0 2212.0 10048.0 went 2564.0 10072.0 up 2516.0 2768.0 10040.0 2720.0 that tbat2880.0 thatruck tbatri thatisk 608.0 10188.0 ruck isk10196.0 ri -304.0 832.0 k 1028.0 10224.0 o 0204.0 10191.0 1100.0 1584.0 10199.0 woods 2124.0 10207.0 known kllowlI2668.0 10251.0 as 8S2552.0 2912.0 10216.0 111gb HighHighSprings -308.0 3220.0 111gbSprlllgs 111gbSprlngsb 2576.0 604.0 10348.0 Springs SprlllgsSprlngsb10364.0 aud1476.0 10356.0 before beCore10380.0 1860.0 2152.0 10383.0 had hnd2060.0 10388.0 espied espledn2380.0 2888.0 10427.0 a -68.0 3000.0 10404.0 cator 3180.0 10408.0 10576.0 or 452.0 824.0 bagged 10580.0 1276.0 1532.0 10584.0 coon cool110551.0 lie1820.0 2204.0 10559.0 accidentally accldeutallyacddentalfy2112.0 accidentallytumbled accldeutallytellabled 600.0 10719.0 580.0 tumbled tellabledituinbied10756.0 0111436.0 1384.0 1716.0 10724.0 den ICU1672.0 2044.0 10732.0 which 1944.0 10771.0 10727.0 little hUIr1itth252.0 2968.0 10748.0 bird blrtlbirdtold blrtltold 10892.0 told him bin10932.0 was VI9yas548.0 1560.0 10903.0 occupied occl1pled10911.0 by 10952.0 one 2360.0 10924.0 10928.0 those thosevarmints -328.0 3216.0 thosevannlnls thosevssrznlnta 2504.0 700.0 560.0 varmints vannlnlsvssrznlnta1392.0 11079.0 1260.0 1612.0 11071.0 bUnll1808.0 440.0 2272.0 11100.0 2192.0 varlet -440.0 2712.0 2800.0 aull3080.0 11136.0 3028.0 asthe -124.0 3204.0 11140.0 2604.0 11244.0 208.0 892.0 11252.0 place 1272.0 11255.0 cmitcd emlledemited1740.0 11296.0 11260.0 bug 1812.0 juice 280.0 2684.0 11276.0 odor 11280.0 tIIe2964.0 thesheriff -196.0 3208.0 th thberla 3136.0 tIIeahiff 588.0 11420.0 412.0 berlaahiff708.0 11552.0 raud -88.0 488.0 11423.0 decided dectded688.0 11428.0 decldellbe -488.0 1528.0 11431.0 -148.0 11439.0 would 468.0 11444.0 explore 2144.0 11456.0 2648.0 11460.0 denand -216.0 3152.0 dens densand -268.0 2608.0 596.0 11604.0 11607.0 aud948.0 lie360.0 1216.0 found Counll1096.0 11615.0 tbe1576.0 11624.0 following fol1owlllg11628.0 list tlst11640.0 2972.0 ofthings 11780.0 things xmlns:ns3 ID10 3316 2696 552 11984 ns3:type 1868.0 11984.0 364.0 11992.0 barrel narrel11995.0 0112000.0 oneHalf 220.0 12003.0 -516.0 2196.0 HsIt 2492.0 pint ptn408.0 bottles LoUles2736.0 12008.0 bottlesof -408.0 3200.0 LoUlesof 12011.0 12119.0 12135.0 524.0 whiskey widakeytwothirds twothlrdstwothkds2068.0 12152.0 2020.0 12143.0 ora ofa-120.0 2188.0 2228.0 12192.0 12156.0 bnrrel12160.0 -40.0 2976.0 12196.0 olleonepint -220.0 12200.0 ollepint 12311.0 940.0 12316.0 ofwhlsk -132.0 1552.0 1648.0 12319.0 -360.0 2008.0 12368.0 y 2160.0 12332.0 four C -260.0 2304.0 12336.0 barrels ba -420.0 cls 2744.0 3072.0 12339.0 ofempty 12492.0 12500.0 empty 988.0 rind IIlId1676.0 iid -156.0 1832.0 1880.0 12504.0 malt 2208.0 12508.0 bottlea2704.0 12515.0 Bllll12548.0 2928.0 oneJ 12552.0 onet oneii 572.0 12660.0 tii 12671.0 M 1iIryer lrier1rjer864.0 IryerFryer -356.0 1320.0 lrierFryer 1rjer1xyer 720.0 12839.0 12847.0 Fryer 1xyerdisclaimed 652.0 12864.0 ownership oWllerehlllowneralilii2752.0 12867.0 12875.0 theliquors theIIqnors 12872.0 -192.0 2664.0 584.0 13007.0 liquors IIqnors1068.0 13020.0 1016.0 1348.0 13028.0 t01l11296.0 1644.0 tbesherla 1840.0 1888.0 13032.0 2280.0 2328.0 13043.0 they 2644.0 13084.0 were 2600.0 13048.0 -288.0 2932.0 2980.0 13051.0 left leftthere -204.0 13199.0 there 13204.0 Ballard DallardDallarll1948.0 13216.0 who 1852.0 2236.0 resided reslltedreSlledlu13219.0 High IIlgh2828.0 IIlghSprings highSprings 13375.0 13384.0 several Itveral1064.0 13416.0 years 1544.0 13428.0 ago 2336.0 13395.0 nnd2176.0 2960.0 13403.0 has teashassince 3164.0 teaselnce 3048.0 13439.0 -116.0 assince 13556.0 since elncedied thIt13564.0 but 13595.0 1804.0 thc13568.0 heTIfrSheiIT2572.0 dout dontdou4t13584.0 2892.0 believe 3132.0 behave 3140.0 13648.0 13719.0 13736.0 lieve have13724.0 Inplttlng 13732.0 pitting ptttlng-468.0 13744.0 off 011476.0 13740.0 olisuch -168.0 such -280.0 ucb 13747.0 doings 13788.0 13791.0 run rlln2824.0 running -208.0 3124.0 rllnnlng 13824.0 13908.0 ning nlng332.0 13912.0 740.0 bUl1dtlgeni -332.0 1720.0 13956.0 1916.0 13960.0 2032.0 13920.0 dead 1980.0 2372.0 13964.0 man 2320.0 13931.0 manald 2632.0 2732.0 13967.0 193176.0 13972.0 19the 3056.0 14079.0 14092.0 half balfirnif1152.0 14088.0 plutbottle14140.0 2464.0 nicely IIIcel -372.0 2836.0 2944.0 14115.0 anti audawjaudfreshly -240.0 antiIresll -228.0 3172.0 awjfreshly 14268.0 freshly Iresll 1004.0 labeled 1636.0 14275.0 Johu John1508.0 14283.0 Kazauzas Iazauzas1936.0 2708.0 14288.0 Valdos Valdosta ValdosU-416.0 14436.0 14464.0 ta U780.0 14451.0 Ga Go680.0 14448.0 wbere956.0 Iryer1ryer14456.0 2364.0 been beeu2292.0 2700.0 14459.0 busi blslbis12816.0 business 3112.0 blsln bis1ness 3128.0 14532.0 14635.0 14663.0 ness 14668.0 n 828.0 716.0 1112.0 1148.0 -200.0 1400.0 marks 14671.0 1784.0 14640.0 ontbe 2072.0 -188.0 2260.0 2356.0 14643.0 heads beadsheadsshowed -344.0 beadsahofedth 2820.0 headsahoyed -340.0 552.0 14808.0 showed ahoyedahofedth 1020.0 1076.0 14816.0 1204.0 1284.0 tthey-44.0 14811.0 shipped 3036.0 14836.0 tothe 14984.0 14987.0 fligli1324.0 14992.0 1212.0 1932.0 14995.0 pharmacy 15000.0 FrcrsrryersFryersbusiness 15003.0 Frcrsbnslness rryersbusineash -444.0 2596.0 15152.0 bnslnessbusineash1248.0 15171.0 theofficer thefflcr15176.0 -632.0 1492.0 Qffic 15215.0 472.0 deeMeddetliled2388.0 2740.0 hc2692.0 15179.0 xmlns:ns4 ID11 4984 2996 188 15323 ns4:type 15323.0 tind-52.0 676.0 15344.0 unelth 916.0 15347.0 1220.0 right rlght1172.0 1588.0 tiger iu luin15352.0 2096.0 2488.0 15360.0 rght 15355.0 -212.0 3100.0 denati denI 15492.0 15559.0 15512.0 ati 15523.0 aththat -160.0 1124.0 15528.0 liebring 2140.0 15531.0 whole 2332.0 push 1illl2772.0 pushto 1illlt3148.0 15567.0 2900.0 15556.0 2904.0 15536.0 ht 15647.0 15712.0 15707.0 724.0 15672.0 Gallesv Gainesville Galiesv1IIe-452.0 -152.0 1428.0 together togetherMr -528.0 2004.0 15680.0 toget 15743.0 rMr 692.0 15880.0 Mr 972.0 Flier Fycr1sycr884.0 didnt dtthit15895.0 want 1764.0 15919.0 come cOUle2376.0 2872.0 15883.0 wltbwiththe wltbthe 16035.0 16056.0 16051.0 aheriClaaicl sheriffaald-404.0 1200.0 256.0 said -256.0 16043.0 hed hell16095.0 conic COIIIC2496.0 16064.0 down dOlon16068.0 Wethenext Wenext 16227.0 16240.0 next 876.0 day 16232.0 daybut 16235.0 1780.0 herlffher1uI1704.0 wanted 2852.0 16276.0 com coucompany 3092.0 companyand coupalsy 3108.0 16307.0 16408.0 16436.0 palsy pany16411.0 panyand 484.0 insisted insiitedInsltted16416.0 2012.0 16423.0 1964.0 1ryer 1rcrLryershould sholllllshouldaccompany -400.0 sholllllaccompany 16568.0 16620.0 accompany -712.0 16587.0 hlulhilni1768.0 16628.0 1600.0 16604.0 1900.0 16596.0 I1ryer1ryec16631.0 came camealong 3144.0 16763.0 16768.0 along 928.0 888.0 Feuuell Penuell16772.0 Fenn -484.0 1748.0 1664.0 Uand 1792.0 aud2100.0 16775.0 aud nudciudaudnotwithslhudiug nudnotwithathulling ciudnotwlthstbndiag 16939.0 notwithslhudiug notwithathullingnotwlthstbndiag16951.0 their late 16948.0 arrival Ilrrhdlarriv4l2232.0 lii16956.0 thcthecity thccity 17115.0 17120.0 17124.0 night 17127.0 prisoner prisogerpriso9er17143.0 2316.0 17164.0 Duke Dukeand -324.0 17296.0 Laugley Langleytwo Lang1etwo-520.0 17316.0 two 1692.0 17308.0 saloon 17340.0 men lIIenhere hereto heret2876.0 heretgo heretogo 3016.0 17319.0 tp tpgo 17464.0 17503.0 go 17511.0 bls872.0 1156.0 17479.0 bond 1108.0 1524.0 760.0 morning tltllllornlng-176.0 1700.0 17484.0 rather rallier2284.0 than thl1l1thanput thl1l1put 1724.0 17660.0 17663.0 put 792.0 17687.0 992.0 17671.0 at 1168.0 Hotel 1116.0 de 1776.0 Fcnuetlrune1IFeuuellWednesday FcnuetlWednesday rune1IWednesday 668.0 17831.0 Wednesday 536.0 17836.0 1II0rning1396.0 17844.0 1984.0 waived wllved17867.0 exam examination 3076.0 examInatlon examinatlon 17896.0 17992.0 18004.0 Inatlon ination18012.0 18056.0 gav gave1236.0 18015.0 1572.0 18020.0 2084.0 18048.0 sum SUUlaunt17999.0 pf pC8500 8500Cor 500 500for oo oofor 18180.0 for Cor18188.0 bisappearauce -184.0 18227.0 appearance -716.0 18207.0 18199.0 18191.0 circuit clrcllit2240.0 2808.0 eourt18204.0 courtwhich eourtwWcb 18364.0 wWcb960.0 18372.0 will 18408.0 convene couvene18380.0 18383.0 Oct 18375.0 6th 6t 2724.0 2896.0 18367.0 audalldaudthen 3116.0 alldthen andthen 18483.0 18540.0 then 18559.0 1196.0 18587.0 01118551.0 way 18548.0 rejoicing rejolclugback tJackbackto tJackto508.0 18716.0 18732.0 I1lghIigb1048.0 18724.0 SpringsThe SpringsTh 18727.0 2480.0 18900.0 The Th 18903.0 editor dltor1344.0 18908.0 1304.0 1516.0 18911.0 Star Smracceptetl -264.0 2076.0 2120.0 accepted -532.0 2652.0 18939.0 allIIIhiinvitation IIIvrtatloll hivIt4tiolt -108.0 19071.0 vitation vrtatlollvIt4tiolt19095.0 19115.0 19084.0 2268.0 19079.0 jail audanll2476.0 see seethe 19252.0 19260.0 stock 19263.0 oCLlInd2128.0 thereAll thereAU 19428.0 All AU19431.0 19436.0 19439.0 1628.0 captured is 19444.0 held 2324.0 thereand 19607.0 it 904.0 19612.0 begins 860.0 1360.0 19632.0 19623.0 make niake1484.0 19620.0 tbe19615.0 2456.0 have hae2400.0 quite quitea 19791.0 saloonlike aaloonlike19827.0 appearallce2264.0 19799.0 bllt2104.0 19796.0 few fewprisoners 3096.0 fewprl80n 19959.0 576.0 prisoners prl80n -576.0 20011.0 1292.0 19975.0 1488.0 jallalll 19972.0 ami 924.0 anithch1quors 2064.0 19979.0 -656.0 20000.0 never neerneverget 20003.0 neerget 20151.0 20155.0 get togetberxmlns:ns5 ID12 2212 2676 448 20512 ns5:type 1540.0 THE THEI1376.0 20515.0 CITY FATHERS PATHeRsFAT1IRR51736.0 FATHERSRevenue -724.0 PATHeRsRev FAT1IRR5Revcrwc 20779.0 Revenue RevcrwcRev -584.0 20820.0 1tC 20795.0 Ordinance OrdlaancC20800.0 Passed 980.0 20787.0 passedTrasII -464.0 passedTrasIIWagon -980.0 3084.0 Trash TrAhTrashWagon -388.0 TrAhWazonput 936.0 20971.0 Wagon 820.0 Wazonput -496.0 1432.0 20979.0 Put 1844.0 20987.0 540.0 20976.0 Mauling HaulingMaulingThe HaulingThe-540.0 20983.0 tl ullng 21144.0 21152.0 City Council Counell21167.0 met tactMonday 1044.0 Mondayeelllllg Mondayeelllllgald -1044.0 21147.0 eyenlng eycningeyenlngand eycningand21323.0 ald21331.0 completed 1444.0 21335.0 21372.0 passage passageoC passageof-476.0 21359.0 revenue revenueordinance -480.0 21496.0 ordinance 21511.0 whlcb1616.0 1568.0 21548.0 now 21555.0 2252.0 21515.0 law 21519.0 It 2472.0 21504.0 Im 1m2764.0 Imposes 1mposes 2924.0 21540.0 tfl -104.0 tflposes -100.0 3044.0 21571.0 21680.0 21708.0 poses 844.0 21716.0 21683.0 license 21731.0 21700.0 almost 21724.0 every kind klnlloCofoccupation 21775.0 Ioccupation 456.0 21863.0 occupation 21876.0 21871.0 ndis 21867.0 considered 1w21900.0 21895.0 avery 3064.0 averysweepl 21988.0 22063.0 very 22039.0 verysweepl -272.0 sweeping 22083.0 tg 22055.0 Very 1656.0 22047.0 Cew22076.0 occupa occupations occupatlons 22071.0 3032.0 22104.0 22208.0 tions tlons22215.0 imaginable ituaglnable22259.0 are ore22263.0 22236.0 exempt 2132.0 22219.0 from CrolllfromJiccnse CrolllUCC1Jsc fromllceqse 22384.0 Jiccnse UCC1Jscllceqse22412.0 tax tar22404.0 1132.0 22407.0 1460.0 22415.0 taxes must nlwt22391.0 paid paidby 3068.0 paidb 22563.0 22575.0 QcLQct22580.0 1st tstxmlns:ns6 ID13 7488 2712 352 22751 ns6:type 22751.0 Alderman 41demtan4Idernau22759.0 Pedrick 22764.0 called 22756.0 attention attentlollattentiolitoth 22919.0 22927.0 fact lqct22940.0 tIat22976.0 many nzanycomplaints coUlplalnts22967.0 2392.0 bc2780.0 being 3008.0 bcing belrlg 22992.0 23091.0 lrlg23111.0 made ntadenade23116.0 oCotthe -144.0 1268.0 1548.0 23119.0 neglected condition 23099.0 ofthe 23275.0 23292.0 streets Itroetsstroets640.0 23287.0 witb23295.0 reference 23308.0 2052.0 theaccnmu theaccuinu23300.0 theaccnmulatlon 3004.0 theaccuinulatlon 23315.0 accumu accumulation 23344.0 23451.0 latlon lation23468.0 23460.0 ortrasb ortrasls23471.0 trash anti23455.0 Councilto 23627.0 23639.0 Instruct histruot23647.0 23667.0 persons persous2420.0 drove droethetnuh thetrash 23815.0 23820.0 tnuh23851.0 wagons oniOnS23839.0 23836.0 23828.0 work 23823.0 Other al aldermen alderinen 23879.0 23979.0 dermen derinen24004.0 agreed agreedwltb -424.0 1368.0 24007.0 Ir 23999.0 2660.0 23991.0 2520.0 24027.0 nnresolution aresolution 24167.0 resolution 1164.0 24183.0 covering 24172.0 tile24175.0 ground grOufll24203.0 waspassed -224.0 24351.0 passed passedIt 24524.0 24527.0 24568.0 24532.0 notorious notorlow24539.0 factthat hasbeen 24692.0 756.0 24715.0 too much mnch24711.0 negligence neJtlgence1356.0 24708.0 2508.0 24703.0 this 24739.0 par partlcularllne partlcularUne particularhine 24863.0 tlcularllne tlcularUneticularhine24895.0 24887.0 Councils Counells2428.0 24884.0 action luIniuthe luthe Inthe -112.0 25047.0 25071.0 matter 25067.0 25088.0 meet 1884.0 25060.0 hearty heartyapproval 25243.0 approval 25247.0 25275.0 25255.0 ofour 25291.0 our 1992.0 citizens citizeuscitizensCompliments citizensColnpllme citizeusCompliments 25627.0 25643.0 Compliments Colnpllme25660.0 1848.0 thoihe25647.0 Press PrcuPressOf PrcuOf2500.0 Pr 25671.0 ss ssOf 25847.0 Of 25888.0 25855.0 minister mlnleter25863.0 25871.0 gospel goapel2312.0 25867.0 25852.0 well weUwellknown weUknown 26012.0 26031.0 hi26039.0 26043.0 26047.0 Tampa Tanlpa26028.0 Tribune 2436.0 Tribuneof 26191.0 26204.0 Sept 26215.0 23d 23dsald 23dsaldRev -512.0 26219.0 saidRev 2444.0 26375.0 26395.0 26399.0 NCorrpreached rrpreache126424.0 26387.0 able 2804.0 26419.0 ier fericriermon fermon icrwon 26563.0 26575.0 mon wonEl EI26571.0 Bethel BeUlelChurch Chnrch26579.0 last 26567.0 2688.0 Inlie 26727.0 lie26768.0 course co 26751.0 oCMs26760.0 remarks be26743.0 26739.0 tbethepress tbepress 26915.0 26931.0 press 26951.0 high compliment 26927.0 26923.0 knows knowkflOW2528.0 knowswhereof -396.0 knowwhereoC kflOWwhereof -336.0 27079.0 whereof whereoC27099.0 27112.0 speaks hehlmsel27095.0 1327127.0 apractical aPractical 27263.0 practical 27319.0 newspaper newpaper27323.0 JI1Bn624.0 27267.0 connected connectedwith -624.0 -616.0 27431.0 27439.0 tbe27451.0 Uaptlst JaptlstlJapUltpnJ1Isbed -472.0 27464.0 published -612.0 2092.0 tbls2308.0 27443.0 citylie -236.0 cityIe 27611.0 lie Ie27627.0 stated ltatedatafj27640.0 27675.0 newipapers Dewpapersiewspapers27671.0 27679.0 w re pext next27623.0 inImportance Ini inIniportauceto 27780.0 Importance Iniportauceto-876.0 27816.0 portaucc 27827.0 27824.0 27819.0 27795.0 pretenting preycntlngpreeuting2216.0 pretentingevil preycntlngevilpreeutingcyil-672.0 27967.0 evil cyil27983.0 28011.0 27987.0 28000.0 when 28003.0 28031.0 papers 1828.0 vied 27975.0 witheach 28147.0 each 28163.0 28207.0 28176.0 28212.0 doing 28151.0 inTarnpa InTn1pa InTnpa 28311.0 Tarnpa Tn1paTnpa28335.0 il128339.0 publishing publlhing28383.0 names DamesweU2424.0 28363.0 asPlaces asplaces 28487.0 Places 28511.0 28523.0 shook ahooksboo28531.0 996.0 28520.0 thestrongholdll stronghold strongholdswick wlckwickedness wlckedness 28667.0 edness 28723.0 28704.0 tIIey28740.0 28707.0 shaken ahaken28691.0 2276.0 28699.0 todty today 28836.0 dty28859.0 HU llia28863.0 28872.0 interesting interestlns28883.0 services senices28867.0 2748.0 becontinued becontInu 29031.0 continued contInu29051.0 thitweek 29059.0 week wetk29048.0 He IteEtc29056.0 2016.0 29092.0 pleasant pleasantpeaker pleasantspeaker pleasantIpeer 29207.0 speaker peakerIpeer29232.0 aadarid29263.0 29215.0 logical togtcsl29268.0 reasoner reuoner29211.0 hispowerful hisPOmat hispowerfal 29391.0 powerful POmatpowerfal29403.0 appeals appea1aappsaha1464.0 29419.0 bare havehayc29447.0 29408.0 telling effect 29427.0 upon upI 29555.0 29579.0 hia29571.0 bearers hear 30167.0 xmlns:ns7 ID14 3700 2640 3384 4692 ns7:type 4056.0 4692.0 3972.0 4844.0 TUeTHU4348.0 4852.0 TWO 4280.0 4752.0 4864.0 GLASSES OLASSaSOLASSLISGLASSESWine -696.0 5448.0 OLASSaSWine OLASSLISViiie 3440.0 5108.0 Wine Viiie3840.0 5128.0 3796.0 4172.0 Water 4080.0 5132.0 -432.0 4604.0 4408.0 5152.0 ter 4320.0 4676.0 5144.0 Each SaChi5048.0 Tells 5004.0 5468.0 5156.0 What Vhat5384.0 5920.0 5164.0 5844.0 IHas 5956.0 ItIIns 6024.0 Ittins 4372.0 5312.0 Has IInstins4696.0 5323.0 Done 4620.0 DoneThere 5036.0 2544.0 3416.0 5496.0 There 3812.0 5540.0 arc3780.0 4052.0 5528.0 4008.0 glosses Jlnsscglasses4276.0 4828.0 filled 4740.0 5188.0 5560.0 5380.0 5552.0 tbe5308.0 5676.0 brim brllll5580.0 3420.0 5644.0 On 3644.0 5684.0 3760.0 5648.0 rich mans nlnllSiimtts4000.0 4472.0 5675.0 table 4420.0 4860.0 5680.0 rim 4768.0 5700.0 5068.0 5300.0 5688.0 5252.0 5780.0 One 5824.0 3660.0 5804.0 ruddy ruddv3936.0 4400.0 5812.0 allliand4356.0 5820.0 red 4624.0 4916.0 5860.0 5084.0 5828.0 blood 3412.0 5928.0 And AlldAnti3712.0 5960.0 Olle3672.0 5975.0 3944.0 4156.0 5948.0 clear 4108.0 c1 4340.0 5988.0 ar 4260.0 4508.0 4512.0 aithe 4632.0 4664.0 4856.0 4904.0 5972.0 crystal 5376.0 flood floodSaid 5668.0 floodSa 3408.0 6168.0 Said 6172.0 Sa 3676.0 3564.0 111 3548.0 6180.0 4104.0 6192.0 glass glas3992.0 6200.0 4404.0 4744.0 6208.0 wine 4636.0 5148.0 6228.0 5032.0 tbe5268.0 pale paler6260.0 p1 5992.0 5864.0 6268.0 er 3808.0 6316.0 brother brotherLet 6320.0 brotherTct brotherLetus 3500.0 6456.0 Let TctLetus 3700.0 3736.0 6492.0 us 3872.0 6467.0 tell lell6476.0 4100.0 6484.0 tales 4724.0 4680.0 oftlie 4888.0 6496.0 5076.0 6516.0 past p1st5488.0 6520.0 5396.0 6511.0 eacleacb5608.0 eaclother 5976.0 eacbothcr 5944.0 eachother othcrotherI othcrI4136.0 6744.0 6772.0 can con3456.0 3868.0 6752.0 teU6756.0 6760.0 banquet bllllqUtl4308.0 5028.0 6780.0 nnd4908.0 6788.0 revel 5256.0 5756.0 6828.0 am 5660.0 ammirth 5936.0 6796.0 andantiIIIlrlh 6884.0 mirth IIIlrlhmirthAnd IIIlrlhA mirthAflhl 7024.0 Aflhl7028.0 3656.0 1111 3480.0 3952.0 7039.0 proudest lroflilest3904.0 4536.0 7048.0 RlIlIanti4492.0 7060.0 grandest JlindestgflhtilCSt5472.0 7072.0 souls sOllls7112.0 5776.0 oearth 5888.0 onearth 3804.0 7176.0 earth earthFell 4116.0 earthphi 3404.0 7303.0 Fell phi3692.0 under nl1er4096.0 7344.0 my UlJiiiy4060.0 4352.0 7328.0 touch tOllch4296.0 4732.0 7368.0 4684.0 7336.0 though thought7352.0 struck ehllck5332.0 5816.0 5768.0 7452.0 blight b1lghtblightWhere b1lghtWhereblighthiere3392.0 7588.0 Where 3536.0 7592.0 hiere 3800.0 7628.0 3932.0 7632.0 4204.0 7596.0 king 4588.0 7603.0 4544.0 7647.0 4764.0 4812.0 7620.0 ruled nlllnileti7624.0 1115228.0 might mlgbtuitght5444.0 mightFrom 5912.0 mlgbtIrolll uitghtVroui 7831.0 From IrolllVroui3776.0 7840.0 tho3720.0 4024.0 7844.0 healls4412.0 7852.0 4648.0 7856.0 kings 4540.0 7872.0 Ive 4988.0 7888.0 torn 5764.0 7884.0 thecrown 8012.0 8016.0 crown crownFrom 4152.0 crownFront 4176.0 8020.0 3384.0 8108.0 JroutFront3784.0 8124.0 3728.0 8128.0 height helghhheighit3976.0 4616.0 8136.0 oC4524.0 8139.0 fame 4876.0 8175.0 1I1IIe 5124.0 5220.0 8152.0 hve5548.0 8156.0 hurlemen 5452.0 hurlet1men hurled hurlehurlet1hurledmcii 5872.0 8204.0 < 3764.0 mcii4076.0 dowlI4028.0 xmlns:ns8 ID16 3532 2616 3304 8408 ns8:type 3484.0 8408.0 3824.0 blasted blAted3772.0 Ulanyninny4252.0 all4656.0 4900.0 8420.0 honored bonored5436.0 name l1allle5400.0 3368.0 8535.0 8544.0 llaeIliavetaken virtue 4112.0 4580.0 8563.0 given 4804.0 givenihallle 5192.0 5244.0 8576.0 shame 5632.0 8680.0 8684.0 8692.0 tempted templed4364.0 8703.0 youth 4312.0 4440.0 OUlh 4720.0 4772.0 8708.0 wllb5088.0 8747.0 5044.0 5204.0 8732.0 sip elp8752.0 5616.0 8728.0 taste 5532.0 2540.0 3352.0 8820.0 That 8827.0 3648.0 3960.0 nmilcnll1lle3908.0 8840.0 hi 4288.0 lila 4568.0 future Cutllre4520.0 4984.0 8884.0 4940.0 barren lJurenbanen5556.0 8876.0 waste waate5500.0 3364.0 8959.0 Far lnrVar3632.0 8980.0 greater reater -364.0 4120.0 8967.0 thau9011.0 4396.0 4564.0 4516.0 9016.0 aliisin8996.0 5080.0 IOr -48.0 5172.0 3356.0 9104.0 9107.0 Or 3560.0 3516.0 9143.0 allarmy arlllY9120.0 beneath 9128.0 4932.0 5224.0 sky 5180.0 skyI ak akI 5368.0 skyIII 3348.0 III 3488.0 3544.0 9384.0 ve 3624.0 9352.0 malIcinnile4212.0 4548.0 9399.0 nrni IIrnlirni4504.0 4848.0 nf 4788.0 4920.0 4964.0 5008.0 9376.0 tbe9371.0 driver tlrlver5208.0 fall 3340.0 9487.0 tiiitAlUlleut 3604.0 sent 3940.0 4180.0 9512.0 tram train4132.0 CroCl4484.0 4572.0 minthe 4808.0 ltbe5056.0 5104.0 iron imn5408.0 9524.0 rail raU5352.0 9619.0 9627.0 3448.0 bl1ve3788.0 9632.0 IIImletitade4160.0 9640.0 good 9644.0 ebl shi4464.0 4576.0 ui 4688.0 4880.0 to9688.0 5072.0 9656.0 5492.0 5412.0 5696.0 9700.0 sea sca5604.0 3344.0 9759.0 9764.0 Anti9767.0 tbe3892.0 shrieks sbrleks4388.0 9776.0 4344.0 9784.0 lie9803.0 06t 1ost4796.0 9828.0 -172.0 5064.0 5200.0 vcrc5576.0 9824.0 sweet weet3744.0 9920.0 3912.0 9940.0 me JlemeFor meltor 9943.0 JleFor 10152.0 For ltor3612.0 10155.0 ald4224.0 10163.0 behold Lebold10172.0 how bow4640.0 5060.0 great 4996.0 5456.0 10220.0 you 5536.0 ou 10284.0 Fame failleFanie10308.0 strength strengtbatreiigtb3704.0 4460.0 10312.0 wealth wealtbealth5000.0 10320.0 genius Renlus10328.0 beforeyou 5916.0 beforeou 10440.0 10468.0 3964.0 4012.0 lallfailfallfor lallI10r failIor 4208.0 3328.0 I10rIor3584.0 10612.0 your 3552.0 Ollr mlgbt10587.0 anllami10631.0 power 10639.0 5016.0 10644.0 over 10616.0 all 5612.0 3332.0 10716.0 ilo 10IIo3608.0 ho 3520.0 3856.0 brothcr4776.0 10740.0 laughed laughell5316.0 10752.0 5264.0 wlnr Wlllwin5516.0 10851.0 Can Canyou 3640.0 10895.0 10864.0 boast 4468.0 10876.0 4380.0 10880.0 tleds ds 4968.0 s 10900.0 Rreatasmine asmlue 5892.0 10999.0 mine mluemineSaid mlueSalll 3308.0 Salll11247.0 tbe11268.0 water waler11263.0 4244.0 4872.0 11272.0 4972.0 11307.0 call4924.0 5280.0 11291.0 not 5176.0 11288.0 5480.0 3312.0 11379.0 OC3512.0 3468.0 3628.0 11387.0 3576.0 11395.0 dethroned 11448.0 4592.0 11452.0 4948.0 11416.0 murdered muroeredhost hostllf 11532.0 Uif Bittllf 3528.0 3572.0 11536.0 11563.0 cnn11540.0 4188.0 11580.0 t11547.0 heart 4832.0 11588.0 once 11560.0 sad SIld5116.0 sadily SIldy fly ily3400.0 11703.0 3524.0 11700.0 niy3472.0 lit 3716.0 11684.0 crJstal4228.0 drops 11692.0 madc4992.0 11695.0 light lIghtalld hightand5288.0 5568.0 glad 3304.0 11808.0 OC OfIf 3460.0 11811.0 thirst tllirsttblrst11827.0 Ivp3852.0 4232.0 11832.0 micnrliwl auenehednutnhiI11868.0 4820.0 11835.0 nr 11844.0 5140.0 11840.0 limu IImU11884.0 11855.0 Pun 5744.0 v xmlns:ns9 ID18 3484 2644 3264 11956 ns9:type 11956.0 laved laetllavedOt laetlOt4032.0 12091.0 Ot hands baudshallds3452.0 12108.0 4392.0 12112.0 cooled 12116.0 Rnd12127.0 5628.0 12132.0 5512.0 IveIve Ivevetli Iveaavet1 3696.0 aavet1 aavet1Ive 3828.0 vetli 12376.0 leaped 3540.0 12388.0 through turojghthroJgh4608.0 12391.0 tbe4912.0 valley 4800.0 5440.0 12407.0 dashed 12520.0 4084.0 12528.0 12531.0 mountain lIIoIl11all1niountain12647.0 Flowed loed1lowed3816.0 12652.0 12663.0 river rIetand dvciand-300.0 12680.0 4956.0 12684.0 played plaetl5356.0 12691.0 5564.0 12751.0 12800.0 fountain Counmlnfountainlcpt CounmlnIept fountainlept 5900.0 3296.0 12932.0 12963.0 3372.0 lcpt Ieptlept3652.0 12935.0 3600.0 12944.0 Ihe12948.0 sunshine UlIshllle12960.0 dropped droppell12968.0 Cromfronifromthe 5856.0 fronithe 3924.0 3284.0 Anll13232.0 everywhere 13235.0 gladdened gladdelled5020.0 13243.0 4980.0 5248.0 landscape lalllhcapelaudbcape5212.0 landscapeand lalllhcapeantilaudbcapeand-608.0 3680.0 13372.0 anti3956.0 eye eyeI 13608.0 13612.0 hl1vf3324.0 13652.0 3668.0 13615.0 eased 3664.0 13620.0 4044.0 hot 13623.0 forehead 4584.0 4748.0 13664.0 ore 13628.0 4928.0 5324.0 13636.0 5544.0 fever leverfeverand 5852.0 leveranti 13755.0 anti13760.0 pain 3900.0 painI 4200.0 13876.0 13892.0 havti havtliavl1adcUiacie13903.0 4336.0 parched parchetl4868.0 13916.0 meadows meallowlumeadows4816.0 5520.0 grow 5428.0 14032.0 fertile ferille14040.0 4040.0 14048.0 grain graiiigrainI graiiiI14132.0 14176.0 3376.0 14203.0 3636.0 14180.0 14184.0 otthepowerinl14220.0 14224.0 14192.0 owerlli 14195.0 wheel wbeel14200.0 themill 5836.0 theIII thestill 14316.0 mill stillmillThat 14348.0 stillThat -76.0 3864.0 IIIThat 14492.0 groun 4048.0 14484.0 out flower Ildwer4596.0 14508.0 wer 14475.0 turned turlletl5624.0 atmy atIII atlily 14604.0 14627.0 lilyvillwillcan 4128.0 willI villI 3276.0 14739.0 3380.0 14764.0 enncnn3320.0 14744.0 tea tclrtel 3888.0 oC3792.0 14748.0 manhood lUaubood14751.0 debased debnscd4628.0 14759.0 14792.0 OU 5640.0 14876.0 14888.0 lifted IIfte114915.0 4292.0 14891.0 anll14896.0 crowucd trowncllcrowucl14932.0 anew alewatewanewcheer 3272.0 15020.0 15015.0 cheer 15023.0 15028.0 help 4368.0 15039.0 strengthen 5260.0 5160.0 5484.0 15075.0 atn 5572.0 aid aidgladden 5760.0 aldi aldigladdell 5808.0 15155.0 15160.0 gladden gladdellglathlen15168.0 tllehenrt 4476.0 15207.0 UlI1I1wan5120.0 aftdanl5460.0 maid lIIaldtimid5348.0 maidtet 3264.0 15300.0 15311.0 tet set15303.0 3820.0 15308.0 chMti chMIIcbkln15316.0 cantlve capteeantivefree ree xmlns:ns10 ID19 4780 2608 3204 15551 ns10:type 15551.0 AtulII 3756.0 15592.0 arcletter hetterbetterCurfurknowing 15572.0 -524.0 15595.0 4708.0 no wing 15600.0 inc IIlemeincfliete 15603.0 IIleThe meTliee 15696.0 fliete Tliee15732.0 e 3492.0 arc15699.0 4088.0 15704.0 heyluld4716.0 eacb15716.0 5304.0 otherThe otherfhe 15831.0 15836.0 fhegloss glass3496.0 15844.0 15839.0 vine4644.0 its 4600.0 paler 5216.0 15851.0 brotberbrotherAs brotberAs3240.0 15980.0 As ther15996.0 sit smt3996.0 logether4552.0 15983.0 16004.0 15988.0 thebrlui thebrluiOn -544.0 15991.0 brimOn 16108.0 16120.0 Olin 3424.0 16152.0 111311Smimamis16123.0 16128.0 rimm16139.0 4836.0 16131.0 rllIInutrimVIOLATUI rllIIVIOLA 16164.0 nutIOLAI2fl 5276.0 16491.0 16499.0 VIOLATUI IOLAI2flVIOLA -692.0 16508.0 TJj 4092.0 16519.0 JAA1E JMBIAMI3LAW LAWIwt 16524.0 LA LAWTwi 16516.0 -84.0 vTWd 16788.0 Iwt TWdTwi3620.0 Prominent PronilnentYnurig -708.0 4328.0 16791.0 Young Ylung4824.0 16804.0 Dentists Oentlstsflentiats16799.0 Are Arc5476.0 ArePined 5788.0 AreFln11 16796.0 ArcFlimod 16964.0 Pined Fln11Flimod16967.0 ror16972.0 Killing 16980.0 Quail QuailWednesday QuailWedllesday QuailVeduesday 17176.0 WedllesdayVeduesday17179.0 4728.0 17187.0 Fcnncll icnnellLCItIICII17192.0 arrested 5196.0 arrestedOrs arrestedDrsarrestedDra17352.0 17360.0 Ors DrsDraG 03748.0 U3928.0 17355.0 Tlsjn 1lsnTfsnawl4264.0 17371.0 11L4952.0 17368.0 Jarvis Jarviaarvls 5404.0 17388.0 5664.0 oC5620.0 ofGainesvilles oCGainesvilles 17528.0 Gainesvilles 17552.0 uipst mpst4016.0 17539.0 popular 17575.0 young 17544.0 5420.0 denisU 5728.0 dentlsts dentists 17684.0 17699.0 isU tlststists17704.0 17692.0 huntlanhuntiag17712.0 alltlkilling 17715.0 quail qnnll5012.0 17720.0 vi violation violatloll 17784.0 3228.0 17883.0 olation olatloll17891.0 tbe17924.0 game gaUie4488.0 lawThe law1he lawlime 18059.0 1helime18100.0 Joung4168.0 lIIen18108.0 18075.0 caught caugh5232.0 18083.0 18072.0 III5584.0 theact 18080.0 3224.0 18235.0 18259.0 act hy3740.0 18243.0 Ibe18240.0 4500.0 hhnselfalldwhile whileboth 5772.0 18248.0 18388.0 18416.0 both 18455.0 ire 3860.0 18395.0 highly higbly18424.0 respected 18419.0 anllantiandirofesslouul anllprolesslonal antiprofessional 2588.0 18592.0 professional irofesslouulprolesslonal18631.0 mail18600.0 tblstheheriff 18644.0 isheriff 18768.0 heriffdisliked 18787.0 cause 4300.0 18779.0 Ibem18776.0 trouble 5096.0 5636.0 18812.0 5588.0 ornconvenieiice orIncollvenlence orincoiiveiiietice nconvenieiice Incollvenlenceincoiiveiiietice4164.0 18955.0 18952.0 beellviolated violatedaud violatedand 3212.0 19123.0 aud3556.0 19128.0 shieriflcould 19131.0 do nothing notblngbutmake 19307.0 tbe19315.0 arrests Hlld4240.0 19335.0 4556.0 thetmi19319.0 19332.0 ap apear appear 19480.0 19516.0 pear 3256.0 19519.0 ear 3288.0 3532.0 3752.0 trial trialThe 3336.0 19651.0 19659.0 offenders offellders19695.0 arraigned arralgnetl19664.0 5284.0 beforeustice beforeustlce beforeJustice 19832.0 Justice ustice ustlce19840.0 Coltuan ColmanCohuan19843.0 yesterday estenlayandeach 5752.0 20019.0 20052.0 fined 120047.0 5 Rlld20036.0 costs 5052.0 4960.0 20023.0 theypaid 20187.0 20195.0 promptly xmlns:ns11 ID20 2444 2572 3172 20371 ns11:type 20371.0 We 20407.0 20404.0 sorry 4216.0 20375.0 sonic20388.0 most moatmostprominent 5740.0 moatprominent 20544.0 20547.0 prominent cltlzells4444.0 persist peralstviolat vlolatviolatng vlolatIng violatlug 20723.0 20727.0 lug Ing20764.0 ng 3444.0 20732.0 tbe20759.0 gatelaws lawa4004.0 amvs 5100.0 frequently freqnentlyfrequentlycalled freqnentlycalled 20899.0 20903.0 4196.0 IIIlii20911.0 btar20916.0 tar dang daugdangers danger8daugera20960.0 21084.0 21119.0 ers er8eratbl1t21111.0 surround surroulII -548.0 21108.0 onr5112.0 21087.0 sportsmen sportan1en5024.0 sportsmenriends 5736.0 sportan1enCrlends sportsmenfrleuds 21247.0 21260.0 riends Crlendsfrleuds21255.0 add andarni21251.0 cautioned 4660.0 against agAlnet5508.0 vio vioatlngthc violating yb ybhating 21427.0 21436.0 hating latingatlngthc 3596.0 21439.0 timela821431.0 alldintbls5524.0 21460.0 5432.0 ournotives 21463.0 ourlIIotlves ourmotives 21603.0 21612.0 motives notiveslIIotlves21615.0 21643.0 pure we 21607.0 done 5592.0 Itor 5732.0 ItCor itfor -92.0 21779.0 21799.0 Cor21835.0 3396.0 21791.0 21788.0 information oCtitepubhic public believ bellevbehfeybelievng bellevIng behfeylug 21959.0 21972.0 Ing22011.0 21967.0 21983.0 3724.0 21964.0 tbetimeduty dntynewspapers lewapaperstoicep tokeep 22131.0 22156.0 keep icep22151.0 tbe22143.0 people 4192.0 posted 22171.0 01122140.0 4780.0 22148.0 matters mattersOnce 22311.0 22335.0 Once 22360.0 22316.0 22343.0 5040.0 al1l1andeveral 5716.0 al1l1seeral andseveral 22487.0 22503.0 everalseeral22500.0 times 22495.0 recently hae22523.0 atentlon attentloll attenhloil 22663.0 22676.0 entlon tentlolltenhloil22692.0 22668.0 importance 4144.0 obeying obeylllgxmlns:ns12 ID21 4352 2604 3120 22855 ns12:type 22855.0 22863.0 hem tbemthenitbemGelltlemen theniGentlemneil hemGentlemen 3300.0 23015.0 23036.0 Gentlemen GelltlemenGentlemneil23028.0 You 4452.0 23059.0 call23031.0 1I0t4652.0 justly 23020.0 blame Llameblamehe 5720.0 Llamethe blamethe 23191.0 23215.0 heofficers 23207.0 Cor23199.0 enforcing enCorclllg23204.0 5272.0 23231.0 23196.0 isheir 5724.0 Istheir 3168.0 23375.0 23391.0 heir23424.0 sworn 23383.0 23396.0 4284.0 23380.0 4496.0 4784.0 23416.0 23388.0 23407.0 yourlutyas 23411.0 yourdutyas 23551.0 23572.0 dutyas lutyas23564.0 23559.0 4532.0 23556.0 obey lawIt 3292.0 23719.0 23759.0 23743.0 23751.0 592.0 23735.0 worthless wortbless23727.0 loafers 10aCeriaroundtown 23724.0 aroundthwn 23908.0 23944.0 thwn23923.0 23955.0 likely 4840.0 23919.0 violate 5464.0 thegame 5708.0 3156.0 24079.0 24139.0 24103.0 24095.0 bnt24092.0 24087.0 violators 24115.0 5388.0 often oCten5296.0 oftennen oCtenmen oftenmen 24252.0 24319.0 nen24279.0 24271.0 24275.0 stoop etoopcommit commitwhat 24255.0 commitwbat 24436.0 24463.0 what wbat24459.0 Ibey656.0 24447.0 tonsldered24480.0 crime 24439.0 theylo 5704.0 theydo 24607.0 24643.0 lo 24664.0 seem 24623.0 toconsidera consider -596.0 24656.0 4736.0 Iolatlon5320.0 24612.0 ortheame 24783.0 24855.0 ame 24815.0 Jaw lawlal 24847.0 24835.0 wrong 24796.0 itsvrong Itnons Itscrong 24967.0 25027.0 vrong nonscrong24991.0 24983.0 careful carefal24972.0 dont lets leta5416.0 haveany havean 25148.0 itIt ItIt 25155.0 25211.0 25203.0 more aloresnore3280.0 25159.0 about 25580.0 25599.0 25588.0 Was VA 4376.0 25616.0 Dandy DandyMr 25583.0 25783.0 25827.0 25819.0 F 25815.0 Ramsey Ranisey25836.0 25787.0 promlnentdUzen -628.0 promlnentdUzenoC -1052.0 citizen citizenof 25959.0 26003.0 oC25991.0 Wacahoota Wacaboota26015.0 4436.0 25976.0 25963.0 Wednes VednesVednesday 26020.0 -12.0 5652.0 26135.0 26171.0 26152.0 speaking oC26147.0 John Stocktons StocktonsShell -652.0 26303.0 26355.0 Shell 26339.0 Pond 26336.0 speech 26331.0 he26320.0 salll26315.0 5336.0 heard heardthat 26307.0 26483.0 26540.0 26523.0 26519.0 26515.0 26491.0 dandy 26496.0 tellyou 5672.0 26680.0 26747.0 26707.0 26735.0 26695.0 26691.0 26683.0 vast ast 5360.0 num numer number numher 26839.0 26895.0 her ber26936.0 26883.0 26879.0 26871.0 26864.0 henrd26859.0 4936.0 26848.0 Stock Stockon Stockton 27055.0 27083.0 ton 27103.0 3316.0 27063.0 27059.0 xmlns:ns13 ID22 1944 3200 27723 ns13:type 27723.0 ptUMfit ptUMfitiii -780.0 27891.0 28075.0 iii iiia 28171.0 28371.0 2184.0 28583.0 28619.0 28587.0 28591.0 tr 28595.0 5364.0 Iq -28.0 28655.0 q gllr1IH4r1II gllr1IH4r1IIRnyc1se -1636.0 29439.0 Rnyc1se xmlns:ns14 ID23 3372 6076 4872 ns14:type 6156.0 SAlOONISTS SAIOONISTSMEET MEETTHEIR -732.0 THEIR 7264.0 WATERLOO 7124.0 WATERLOOJudge -1472.0 8736.0 6076.0 Judge 6596.0 Wills ViIIs7052.0 6188.0 Denies 6988.0 6184.0 Attorney Attorncy7536.0 8360.0 U8272.0 E C8500.0 CDavis 8664.0 EDavis Davis 6832.0 6464.0 Prayer Praycr6692.0 7432.0 7340.0 7716.0 6472.0 Injunction 7636.0 InjunctionDAVIS -764.0 8480.0 6096.0 6964.0 7020.0 DAVIS 6708.0 TALKED TALKELTAI 7404.0 7031.0 mn 7004.0 7540.0 7036.0 7996.0 TALleRTALKEDBut 7044.0 D 8748.0 IBut -8.0 8756.0 6080.0 7576.0 6512.0 7580.0 Produced 7376.0 No 7708.0 Argument ArgumcntArgumentThrasher 8524.0 ArgumcntThrasher ArgumentThrzmslicr 6276.0 7820.0 Thrasher Thrzmslicr7220.0 7836.0 Produc7040.0 7964.0 8164.0 Law LuwLawand 8504.0 Luwand 1896.0 6396.0 8080.0 Judgo Judge6688.0 7320.0 Did 7248.0 7656.0 8087.0 Balance Ilalnncc7584.0 nnl -636.0 8292.0 8036.0 nce 7912.0 xmlns:ns15 ID25 3512 2720 5988 8336 ns15:type 8336.0 8351.0 saloonisls saloonlstssaloonfata6424.0 7132.0 8356.0 7088.0 8359.0 Alnchim AlnchuaAlachna7260.0 7908.0 coutityJiave couiityhavccoutityJiaveagain 8672.0 8400.0 coul 8368.0 couiityhavcgaiim 8216.0 trhlc -456.0 trhlcfaRaln 8519.0 again faRalngaiim6444.0 6388.0 6728.0 8532.0 6676.0 7080.0 8540.0 Waterloo Walcrloo7816.0 8548.0 7660.0 7992.0 tile Jliethe7952.0 8248.0 8579.0 case cllse8200.0 ofSam 8668.0 ofSail 8700.0 Sam SailLeonard Leonlltd6308.0 6944.0 vs 6888.0 7016.0 7068.0 7168.0 8716.0 Hoard DotlDoartl7612.0 8720.0 7828.0 8724.0 County 7736.0 Coin Coiti8284.0 Coinmlssionerp Coini 8608.0 CoiniIIIlsslollerp Coitimnissloners 8871.0 mlssionerp IIIlsslollerpmnissloners6844.0 8900.0 etc elc6696.0 7204.0 8892.0 nndllnelT7428.0 7732.0 7564.0 7784.0 V 7868.0 7988.0 8896.0 IlellllctllUl 7864.0 IlellllctllUlsheriff -668.0 8656.0 Fennel lcnnell-664.0 8536.0 8936.0 amassheriff 8940.0 amsheriff 6040.0 9047.0 6528.0 9060.0 6432.0 9063.0 Alachua AIRchuaAlachna6652.0 7348.0 9088.0 county 7252.0 count 7776.0 9072.0 Florida IllorldRI5lorkla7700.0 9052.0 bill 8352.0 billor 8652.0 billfor 9220.0 6092.0 9260.0 6224.0 6272.0 injunction 6976.0 9239.0 restraining restrQllIllIg9252.0 7668.0 9244.0 7920.0 sherlfTallll -412.0 8376.0 sherlfTallllall 8660.0 8424.0 9256.0 ammttandall ammttall 6036.0 9396.0 6240.0 9404.0 oth 6576.0 6524.0 9443.0 6440.0 6620.0 9412.0 9420.0 frolllfrontattempting ntleUlptluJ8300.0 9440.0 9459.0 CII8416.0 enwee 8596.0 CIIforte enfotce 8592.0 6044.0 9572.0 forte fotce6068.0 wee 6340.0 6448.0 9583.0 6748.0 9588.0 local 6644.0 9591.0 option prohibition prohibit7524.0 9600.0 1011 8432.0 8324.0 lawnow 8648.0 lawIIOW law110w 9748.0 9780.0 IIOW110wIII6296.0 6560.0 force Corce6460.0 6864.0 9772.0 tiletime7280.0 7760.0 7832.0 7672.0 JI 8212.0 7984.0 9816.0 1ge 8264.0 WII18Willswho 8588.0 WII18wllo 8584.0 8412.0 ilts iltswho 9924.0 wllo6348.0 9964.0 6288.0 6660.0 9935.0 holding holdlug6568.0 7236.0 9960.0 cOLlrtcotirt7144.0 9948.0 111iii9952.0 Ilrouson tfronsolltirouson8404.0 8344.0 thisweek tillweek 6032.0 10103.0 10108.0 denied 6332.0 dell 6668.0 led 6648.0 10119.0 Attorncj AtiorneJAttorne7528.0 10116.0 1avisavls 7968.0 10132.0 motion ruollelnmnotinnCorfortemporary 8636.0 Cortemporar 10276.0 10292.0 temporary temporar6716.0 IlIjllnctlon7460.0 10336.0 7360.0 7684.0 10300.0 witt7972.0 10304.0 8160.0 10339.0 seen scell8112.0 8476.0 byhe bythe 6016.0 10452.0 hefollowingIn -588.0 6848.0 6012.0 10628.0 6204.0 Circuit 6148.0 ClrcnltCourt CircuitCourt6632.0 Court 10647.0 7644.0 10656.0 COllllty8192.0 Ulghth 1ihtthm8100.0 UlghthJudicial UI 1ihtthmJudicial 8320.0 10660.0 hth hthJu 6136.0 10807.0 Judicial 10812.0 Ju 6372.0 lclal 6656.0 7108.0 10820.0 10828.0 IllorldlVioridrm7824.0 10840.0 7724.0 10836.0 Chancery Chancer ChancerSaUl -508.0 6544.0 10991.0 SaUlSatit6868.0 6808.0 Leonardvs LeonardsLeonard1103rtl 11203.0 vsHoard 11208.0 6004.0 11335.0 1103rtl6408.0 11340.0 6360.0 11372.0 6540.0 7084.0 11343.0 Commission COlllmleslonComimniision7032.0 Commissioners COlllmleslonersComimniisionera-748.0 7848.0 11516.0 era11524.0 elc6164.0 anti6436.0 11527.0 6800.0 6952.0 7100.0 6908.0 7156.0 7244.0 7400.0 11519.0 IcnnehlFcnncllas Icnnehlasennell 7440.0 11712.0 bhcrifftsherlfl6116.0 6628.0 11687.0 oC6584.0 AlachullMachun7384.0 11708.0 7312.0 xmlns:ns16 ID26 3652 2708 5920 11863 ns16:type 11863.0 IborjclaTime 12036.0 Time12039.0 above bove6816.0 12080.0 6768.0 7200.0 12055.0 coming coullngcoining7152.0 7696.0 12083.0 oil 011on12072.0 8060.0 12064.0 8008.0 12068.0 heardhis heardthis 5980.0 12212.0 his12215.0 tiny6532.0 12251.0 6488.0 12220.0 6840.0 12231.0 fur teniporarytenH 7948.0 12275.0 7944.0 12280.0 8196.0 ry 12244.0 IIIinunction 8528.0 IIIjunction inI 12308.0 12380.0 junction junctionThe 6508.0 unction 6020.0 unctionThe 6100.0 12567.0 12603.0 same sallie6812.0 12608.0 wiuwns6712.0 12583.0 argued runcd12588.0 7556.0 12596.0 Robert RltJert7808.0 8440.0 12600.0 K8340.0 Kavs 8624.0 12732.0 12779.0 avs 6416.0 12740.0 solicitor Cor6924.0 12764.0 complainant cotiilaiiiaimt12792.0 cOlI -776.0 8028.0 lalllallt 12772.0 12776.0 5968.0 12916.0 12924.0 B12927.0 6052.0 6324.0 Thrabhcr ThrahherThirabhcrBotlcllor6900.0 12940.0 dcfewlnnlH deremlRllheIeenhlanldcfewlnnlHIpou -680.0 deremlRllheUpou 7892.0 IeenhlanlUpon -640.0 5964.0 13092.0 Upon IpouUpou13095.0 considering conslderlllK6292.0 7136.0 13108.0 tile13144.0 annie smnulinllu7740.0 7692.0 7880.0 13116.0 8048.0 13120.0 ordered 7976.0 ordereddjudged 8520.0 13155.0 orderedadjudged 8180.0 13128.0 ercd ercdadjudged 13263.0 adjudged djudged6592.0 13276.0 anti6872.0 13271.0 decreed deereed6820.0 13287.0 thut thllttbt7744.0 13292.0 tho8032.0 13328.0 8nlllemaine13300.0 8348.0 beenicd 8572.0 bedenied 8436.0 13432.0 13436.0 enicddeniedDoue deniedDone enicdDone Doueaud6740.0 7276.0 7224.0 7456.0 13631.0 Uronsoii Jhonsollh3ronoii7396.0 h3ronoiithi 8076.0 Floridahis tlliathi 6232.0 13796.0 23t12l13799.0 oC6664.0 13807.0 September 13815.0 1103 10031103J 1003T7712.0 1232.0 13991.0 13996.0 7308.0 7212.0 WHW WnrSnrs14004.0 jutige7916.0 JudgeThe jutigeThe 8084.0 nu 14035.0 8224.0 cThe 14151.0 6412.0 14156.0 10100niits maloonlatsIsts 14164.0 7424.0 14159.0 Alacliual AlllclllHl1Alaclnia1onntycountyirough 8508.0 Ollllt Olllltthrough onntythrough 5940.0 14324.0 irough14327.0 theltattorney attorneJattorimey7544.0 14352.0 14343.0 tlQvebeen 8172.0 tlQvehaye8560.0 haveceninakluj hayebcenmakiug 14495.0 ceninakluj bcenmakiug14503.0 -820.0 makill 6216.0 14547.0 6972.0 14511.0 desperate despclatedesperatc6880.0 14519.0 effort eiTortelTort14536.0 8184.0 defeat dete1tleteAt8140.0 14524.0 defeatje dete1tthe 8228.0 leteAtthe 5932.0 14676.0 14715.0 je 6236.0 14679.0 14684.0 7096.0 14692.0 7000.0 14731.0 ever eer14700.0 Inceiucetltetheounty 8556.0 tltecounly thecounty 14860.0 14863.0 ountycounlyva56364.0 voted 6684.0 7184.0 dry 11714871.0 TheIr TUclr7772.0 elr 7680.0 nUorneyfittortleyAttorneyIKS nUorney1I1el8552.0 1I1el limi415059.0 IKS 6144.0 shown sholYlI6640.0 15036.0 hlmstlC6588.0 7164.0 15052.0 7380.0 15044.0 bo7284.0 7608.0 15083.0 a7728.0 hard harel8116.0 worker workernd -436.0 workerolld workerand 15199.0 olldnd 15204.0 leech leecblikchal1gclon keclilikebangeroulike -924.0 7512.0 6876.0 15212.0 haitgeron 6824.0 15223.0 null alldauthhelll15235.0 therennv therebeen 15251.0 15380.0 beeu15419.0 nnvIIny15383.0 6480.0 6804.0 mi ml7008.0 15388.0 lid hlaliii6948.0 7232.0 15396.0 side tlitehlaoC7752.0 ffin tflCtfmc15440.0 nue 8304.0 15411.0 tlon 8236.0 8580.0 xmlns:ns17 ID27 3480 5872 15559 ns17:type 6088.0 belfqybell 7216.0 7092.0 hevoilld 7364.0 7416.0 15580.0 mtoitld7796.0 15575.0 15619.0 15584.0 foittmtlfoundnd foittmtlati1 8384.0 ati115735.0 produced llroducedprolUCetl6912.0 buthehll btttlItig7292.0 15740.0 7640.0 15748.0 without 15760.0 IIIwlawnd IIIwand lawand 15900.0 15908.0 15911.0 III6368.0 6312.0 6612.0 absence absellce6564.0 15903.0 ot15955.0 allYargument nrJnClentargtiiiieit15963.0 011onits 011his onhis 5908.0 16079.0 its16084.0 oC16087.0 liequestion tiuestiomi6852.0 fJuestlonhe 7472.0 16100.0 be7812.0 16103.0 only olllyotiiyonlytalk olllytalk otiiytalk 16260.0 talk 6248.0 16263.0 6604.0 taut tallitatll6504.0 16271.0 Ills Hisablkytcnn ahltltycallablhltycau8132.0 16299.0 8052.0 16284.0 8332.0 beuestioudd 8516.0 befJueslloll beqticstbottl 16428.0 uestioudd qticstbottlfJueslloll 6500.0 dl 6420.0 16439.0 lor br6616.0 6720.0 16472.0 6904.0 wlthollt16452.0 ability abllilIIlwon abllilIIlwonclerClI1 -1032.0 8472.0 7940.0 16455.0 ittid16496.0 won 8168.0 wonerful wonlerful 16607.0 erful clerClI1lerful6328.0 16612.0 tenacity tenaclly16656.0 11016623.0 lawyer 7076.0 couM7548.0 7928.0 withoutsyllable 8512.0 withoutsyllilble withouta 16783.0 16819.0 syllable syllilble6548.0 lav16827.0 shadow shallowshiatlow7160.0 7676.0 justice 8364.0 16848.0 onils onlila ilslila6124.0 16959.0 17003.0 Morry iorryworr -368.0 6860.0 16975.0 6776.0 7064.0 ewof 7324.0 tbe7792.0 16995.0 temperance temiserancetemperanceeopcaml -720.0 tenl temiseranceImeople 17019.0 lerallce lerallcejleople 17135.0 jleople Imeopleeopcaml abdkeei17151.0 tbe7116.0 spirits spirit17195.0 7960.0 8176.0 menu inewilIIeGeIinewiceepthem lIIeGeIkeep menukeep 17311.0 ceepthem theimihopeful bopefuljhopeCIIIor 7196.0 17324.0 17327.0 saloollsalootpeopleas peoples17492.0 17523.0 17520.0 IonS IOIIKlong6380.0 6336.0 17495.0 lie6704.0 hasCol 17580.0 6028.0 Col Cot17676.0 116384.0 6428.0 ATJeraeher 17668.0 -580.0 7300.0 17696.0 pttorney Attorney8044.0 8312.0 thecfcndants thedcfendants thedefendants 5884.0 17839.0 defendants cfcndantsdcfendants17863.0 6956.0 17860.0 IIronsoulironson7128.0 7780.0 arumed17855.0 IVltilwithle 8496.0 IVltilthe withtime time18051.0 le 6128.0 justlcc7272.0 18028.0 atid7604.0 18031.0 therefore 18039.0 hRllhindhadut hRllbut hindbut ut 6132.0 IIttltalking 6984.0 18212.0 7148.0 7104.0 hut7304.0 7688.0 gained cery8104.0 everyont cerypolnl everypoltit 18359.0 polnl poltit5924.0 ont antI and6732.0 vltl 18411.0 feeling feetlu mingled IIIll1gledmingledleasure 8484.0 IIIll1gledpleasure mIngledpleasure 5876.0 18543.0 pleasure leasure 6392.0 anllamil6764.0 pity saw tbefrail Crall18567.0 craft ofIs ofbls ofhis 18711.0 bls18740.0 opponents 18763.0 18743.0 6968.0 pieces agaillstogahist7652.0 timetherockbound 8488.0 therockbountl timerockbound 18895.0 rockbound rockbountlshores xmlns:ns18 ID28 3672 2660 5832 19076 ns18:type 6000.0 19076.0 nloon6244.0 6736.0 19112.0 Ulenmcii7316.0 looking lookhmg7900.0 19092.0 blue 7800.0 8256.0 nnllandre nnllare andare 19283.0 19280.0 doubtless Ceellngfeehliig19255.0 bilious Llllous19268.0 19271.0 oftern ofthemhaving ofthembaying 19423.0 themhaving thembaying19459.0 tern -796.0 having become tired IItlnt1oCfool foulfoolshness foolIshneuhaa foullsiinesshas 19596.0 Ishneuhaa lsiinesshas19604.0 shness -840.0 6536.0 6304.0 packed Pfloketlpcketl19643.0 7572.0 19627.0 8148.0 Jack Jacksonville Jacksonvllle 19684.0 19775.0 sonvllle sonville19780.0 Vliere19783.0 tbe19788.0 others 7748.0 Ill 1118280.0 19811.0 IIOtnotret IIOtyet notyet 19956.0 19967.0 yet ret 19964.0 tisis6680.0 7012.0 scribe ecrihe6960.0 7488.0 IC8208.0 20008.0 con COliconnue COlitlnue continue 20127.0 tlnue tinue20163.0 6284.0 luintime6836.0 20132.0 liquor 6724.0 bwlneS20143.0 20148.0 willmve wIllhave willhave 20308.0 20339.0 mve 20324.0 20344.0 frolllfroni6572.0 20311.0 Alacimua20327.0 20319.0 Cor8088.0 20363.0 Ramjority RlIIajority amajority 20476.0 majority mjoritylIIajority20479.0 20520.0 20484.0 20500.0 voters oten6892.0 7448.0 20487.0 nnd Cllldand20495.0 8072.0 20503.0 Honor 1I0borHonorudge 1I0borJudge HonorJudge 20655.0 udge20663.0 20660.0 f20668.0 tbe7464.0 Eighth ttighthUigbtis7412.0 20671.0 udlclat7904.0 JudicialCircuit udlclatCircuit 20828.0 20831.0 20836.0 Ilorldallorida20875.0 says eas20839.0 Machun7896.0 20883.0 R20847.0 dryounty dryCounty 5848.0 21012.0 ountyCountyTEnPERANCE CountyTE3tIPI3RANCI3 21023.0 ountyTEflPERANCE 6152.0 TEflPERANCE TEnPERANCETE3tIPI3RANCI321447.0 AT STARK STAUKSTAUKreadier STARKPreacher 21452.0 sTA K KPreacher 21719.0 Preacher readierFailed Palled6452.0 toUct Get Od7372.0 21727.0 TlttroTherQ8244.0 21735.0 UrirDrSlbley irSibley 21859.0 Sibley Slbley21903.0 Spoke SpokeRev 21907.0 22115.0 22120.0 6300.0 6212.0 6580.0 Wells VehIs7140.0 ackllOnvllle22159.0 22164.0 toiave 8448.0 tohave 5832.0 22275.0 22291.0 22324.0 iave 22288.0 addressed atldressetIaIdresse122299.0 peopt peopleoC22303.0 Starke Starkc22307.0 laitlutlaitonday lutMonday lastMonday 22467.0 onday6940.0 22472.0 bulbuh22508.0 RItaim22479.0 accident nceldent7392.0 22492.0 22519.0 arlrr1if artlullt ar1n1 22640.0 rlrr1if rtlulltr1n122655.0 + 22643.0 traIn frnltlfrnlt6636.0 22679.0 ml nn22684.0 6784.0 22648.0 ItlnIii rrvirt rnut22651.0 tnnfT rntllnrdIi-32.0 IttiriAfitnrnqxmlns:ns19 ID30 4388 2652 5772 22816 ns19:type 22816.0 sible ble 6108.0 6160.0 Corhllli6672.0 22835.0 22827.0 reach 22860.0 reads 22824.0 appointment nppoilltulelltappointmentut nppoilltulelltButappointmenthut-800.0 hut23011.0 22995.0 fortune Cortune23000.0 Voulll23003.0 bave8232.0 PrDrV DrW Prv 23147.0 23176.0 6064.0 23179.0 Slbley SlbleJSIbley23168.0 tbls23212.0 Willpresent presentnd presentand 23347.0 23352.0 Cor23367.0 tClIperancetemmiperancetemperanceMch tClIperancespMch temmiperanceapsech 23523.0 spMch apsechMch 23531.0 lIe He23528.0 answered anawew 7520.0 call callanll amid8064.0 23535.0 spoko spokoor spo1 spo1for 23567.0 po pofor 23699.0 23704.0 23740.0 three tbre23711.0 quarters 23707.0 hour His IlisIIIHiseech Ilisspeech IIIspeech 23916.0 6220.0 eech 23911.0 23883.0 6996.0 anc1highlypredated hIghlyappreclatell highlyappreciated 24051.0 predated appreclatellappreciated24055.0 large lar audience audienceDr -552.0 24227.0 24243.0 6196.0 24231.0 SlbleyIlIln 24263.0 old soldier 24235.0 iiitem tern8056.0 ternperance 8380.0 24299.0 24403.0 24444.0 perance 6280.0 24407.0 fought Cought24411.0 24419.0 Gen GCIICciiGeneal GCIINeal CciiNeal 24579.0 24587.0 Neal eal 24591.0 Dow 24583.0 orPortland Maine Mnlne8092.0 24620.0 sonic soUle7936.0 sonicwentyfiveor soUletwentyfive sonictwentyfive 24759.0 24763.0 twentyfive wentyfiveor24799.0 thirty 7240.0 yurs8068.0 whenaine whenMaine 5800.0 24931.0 24935.0 aine 24939.0 secured secnre -460.0 constitutional colIttlltionalcotmititutionalprohibitory IJrohlbltoryprohibitoryaw IJrohlbltorylawprohibItorylaw5796.0 25119.0 aw 6008.0 awThe25283.0 25295.0 25287.0 orofThic beard25299.0 Doc DoeDocor 25303.0 Doctor Doetor 5792.0 25459.0 25487.0 tor 25507.0 25471.0 speak 25467.0 6792.0 25503.0 oueevening heCoreourocal ourlocal 8188.0 25635.0 ocal6120.0 25639.0 election 7444.0 bliohi 01117804.0 25655.0 temper tempernee25859.0 ance neeblade Lladethc25831.0 true 7420.0 25823.0 Damascus ring rlllg8040.0 ringoil 8396.0 rlllgto ringto25999.0 ItThe oilThe26179.0 saylietruly tmly26188.0 tohake toebake toshake 26343.0 26351.0 hake ebakeshake26347.0 hand 26380.0 Lawyer 6856.0 Gornto Corntowhitewhilet whiteatwhileat26527.0 He26556.0 181Goruto7568.0 7956.0 26559.0 unpur ullpurunpurlasable ullpurchasable unpurchasable 26699.0 26703.0 chasable lasableL1wler26732.0 whom sa ananloon 26867.0 loon 0011 788.0 influences Influenccslaarid nndRndcountycannot 27051.0 cannot buy xmlns:ns20 ID31 2868 2620 5760 27475 ns20:type 27475.0 6980.0 27479.0 Sheriffo SheriffToSherIfflo27655.0 27667.0 To lo27699.0 27663.0 Voters 27692.0 Alacimnaounty ountJountyI ountJI27799.0 27807.0 hereby 5952.0 announce annOUblCeinaOuze27803.0 myself mysei27839.0 candidate candidateor candIdateCor27939.0 Cor 27943.0 ofceSberlaSberhlTsubject 27956.0 27948.0 thection theactiOtl theaction ctionactiOtloC28080.0 28095.0 28083.0 Democratic DemocrnUcprimtry prltlllltyprimary28215.0 28223.0 elected promise promleIpromnise28231.0 discharge dlachar 28259.0 28227.0 theuties theduties 28352.0 duties uties28359.0 oUicetile28396.0 nrrbest 28367.0 1Jestofm1 1Jestofm1ability beatof 8004.0 myjility 28399.0 myability 28491.0 28503.0 jility28499.0 solicit soUcitsupport aUIJpDrt7408.0 28507.0 or28539.0 aUalloters 8372.0 aUvotersat allvoterS 28639.0 28660.0 voterS oters28652.0 votersat polls pollsRespectfully poltRepectullypollsItespectuhlypolt 804.0 6556.0 28771.0 Respectfully RepectullyItespectuhly28919.0 28924.0 UACUCar10sd HAGUS UACU2ACUHAGUSCarload 2ACUCarload 29335.0 Carload Car10sd29343.0 29339.0 buggies buWefbggie1jI2g jaU JI1 7436.0 Arrived urled29379.0 onsale onsate 29488.0 sale sate29496.0 Thomas stables tabIeJ6700.0 7120.0 30280.0 xmlns:ns21 ID32 8756 4876 ns21:type 9336.0 KNIOHTLAFONTISEBAlarrlage KNIOt1TLAFONTISDellarrlageKNIOHTLAFONTISEB KNIOt1TLAFONTISDeKNIUUTLAFOMTISUU-1616.0 10956.0 KNIUUTLAFOMTISUUMarriage -1612.0 Marriage Alarrlagellarrlage9544.0 019472.0 9676.0 9888.0 Popular PoplJlar10496.0 5191.0 10424.0 11004.0 Couple 10936.0 Couplein 11476.0 OalnesvlUcOmtlnesyilfeGainesvilleA OalnesvlUcAOmtlnesyilfeA10600.0 beautiful benutiCul9076.0 9848.0 home imotmie9724.0 10280.0 5579.0 wedding welllllllg10912.0 occurred tCcurredoccurredat tCcurredat11464.0 8836.0 9008.0 Ilia 8956.0 Ihohome iiioiiomc9248.0 oC9808.0 thctime9760.0 10060.0 5755.0 brides btltlabtidaa10532.0 parents 10484.0 11052.0 IIIin11000.0 11224.0 thlthmt11168.0 5763.0 tillcity 11392.0 thlclt thmtcity clt 9160.0 vdiiemilayllIellllaJ 9872.0 9968.0 afternoon aftruoou9852.0 afl -600.0 10568.0 10212.0 ncoou 10620.0 210948.0 oclock ocloclc10896.0 oclockThe 11396.0 oclockTIme 8768.0 TlceTIme8784.0 contracting colllmcthlK9208.0 parties lI 10444.0 10100.0 10176.0 rtle 10128.0 weJCllr10780.0 11116.0 11016.0 11348.0 36247.0 8832.0 Knight 8780.0 9324.0 9276.0 9496.0 6264.0 Vnlt1osta9456.0 10136.0 Oa10248.0 -60.0 10448.0 6283.0 aud011110784.0 Mks 1IsMis10680.0 11120.0 Lucy Liley11060.0 9056.0 LaFontlsee lAIolltseeLaIontlsee8948.0 9844.0 10064.0 tliist1ls9972.0 10368.0 eltJ10800.0 11ev10608.0 11144.0 11228.0 1IYllch 11188.0 11316.0 8828.0 Lynch IYllch9272.0 9476.0 6624.0 St 3t 9704.0 Patricks ltrlckaPttrlckaCatholic Catbollc10272.0 10992.0 6643.0 church churchofficiated 11424.0 churchoffielnted churchoflhclntetl officiated offielntedoflhclntetlnndIInll9740.0 olllyoimly10056.0 tue10024.0 family 10252.0 Cnwll 10700.0 6811.0 alld11032.0 R10976.0 11156.0 6855.0 eryfelnlll1late 9080.0 intimate friends frlemls10140.0 10088.0 10432.0 presentThe 9288.0 groom 9788.0 9980.0 Ra10148.0 opulnr10052.0 7192.0 10636.0 11172.0 lIIantitanmanwho 11436.0 lIIanwho titanwho 8812.0 hilslisa9468.0 9372.0 la hLIlL9752.0 10076.0 7332.0 9996.0 10360.0 employ clllploy7339.0 7347.0 STlollln9 11220.0 11328.0 3Tuonms Tlollln9Thotims9444.0 during 9876.0 10260.0 10604.0 year yrar10516.0 10972.0 7515.0 alltl10884.0 ho11200.0 hehas hobas 11292.0 bas9068.0 modi niad9020.0 1I1R11lruany 9400.0 9452.0 9812.0 9864.0 CrlendshereThe herefhe herellie fhelliebride Urltle9200.0 9564.0 9768.0 9716.0 10044.0 beautllul7867.0 nndRnd10596.0 10980.0 accom accontaccomplished accomplihell accontphlshied 11384.0 8800.0 plished plihellphlshied8024.0 daughter dauchtcrdaurlcltroC9884.0 8043.0 10096.0 nndIIlId10376.0 10736.0 Mrs 11072.0 8051.0 11160.0 11264.0 N 11124.0 xmlns:ns22 ID33 3452 2700 8708 8192 ns22:type LaFontisee Llll1ontilecLii1ontIseecllfnndntlis 10480.0 10632.0 10988.0 oC11212.0 tbetimethemost 11408.0 tbeIIIpst 11216.0 timemost 8792.0 IIIpstdeservedly tlraeredlydeervcdly9084.0 8388.0 poIJular9800.0 OIllIJt10872.0 ladies ladlesIndies8395.0 inOnlnesvllle InOAllltsitle 11324.0 8439.0 mm 11312.0 mmaiiiesvflle Onlnesvllle OAllltsitleaiiiesvflleOnlnesvllleImmediately 9484.0 OAllltsitleIn1J aiiiesvflleInThiediately 8920.0 Immediately InThiediatelyIn1J -788.0 9708.0 eelately after nfter8739.0 time10104.0 10512.0 8744.0 marriage lIIarriagetimarriage10416.0 11164.0 8760.0 lUrMrnnd 11344.0 lUranll Mrand 8887.0 nndanll9096.0 8908.0 8904.0 Knlgbt10032.0 lehlett9936.0 8915.0 via 10240.0 10412.0 Ia 8923.0 Atlantic AtlanticCoast 11388.0 AtlanticCost 10888.0 -500.0 Coast Cost9212.0 Ilue 1Iue1iuc9112.0 9596.0 railroad rRilronl19091.0 10460.0 Atlauta Atlanta011011short ashort 11380.0 aalmOtt short almOtt9140.0 bridal Lrldnl9548.0 toner tOilertottertonerThey tOilerThey totterritey 9424.0 They ritey9428.0 wilt9228.0 lIIake9556.0 Qcaly pcaly10036.0 peal 9448.0 futurofuturehoufe futurohonie futurehoute houfe honiehoute9196.0 9612.0 mid nnd1111119100.0 Klliltht9712.0 10316.0 engage ellgAge10640.0 11111184.0 inbusiness 11368.0 111Lls1ne4s Inbtislnc4s Lls1ne4sbtislnc4s9268.0 thereThe 8880.0 9956.0 9224.0 Stil9624.0 olherotber9904.0 friend Irleutafriends10296.0 9979.0 extends extellltaextend10792.0 extendscougrntulotlons extellltacOllgratll extendcougratulotions cougrntulotlons cougratulotionscOllgratll tlolls 9332.0 allllatiti9992.0 10180.0 st 10120.0 10147.0 wishes wIehewishesDr wisheslr10776.0 wIeheDr 8868.0 10564.0 lr10572.0 9028.0 119568.0 SllJleySIbley10016.0 rualle511510Rii10352.0 proeaslonpmfesaioual10504.0 professionalvfsit pmfesaioualvIt-744.0 lIv vfsit vIt10768.0 8988.0 1t 9040.0 10744.0 10735.0 Waldo WRlllo9664.0 cstcrdoyclltertlliyyesterdayhave 9744.0 cstcrdoyHave clltertlliyIe 10955.0 Have 8976.0 Ie 9184.0 YOllr10960.0 clothing clothhll9520.0 cleaned clcalled10124.0 10983.0 10684.0 10996.0 Owen 11087.0 Lloyds UodsIloyds11096.0 Dye Iyc9192.0 Works 9516.0 11115.0 July 3u 11008.0 14 tf tfMr tfilr 11308.0 1Mr 8844.0 11299.0 11304.0 ilrnudaud11320.0 lIraMraJames JalllesJautes10228.0 Skinner 11364.0 IIIinthe 11332.0 IIIthe Intime 11467.0 time8960.0 11488.0 9240.0 11480.0 9116.0 9900.0 Croutrout 10200.0 11500.0 Archer xmlns:ns23 ID34 3872 2692 8640 11692 ns23:type 11723.0 car load 9528.0 9728.0 11720.0 wAgonjwngon10236.0 just 10192.0 10528.0 received recelvecl10476.0 alllland11044.0 nndon allllon andOIL 11860.0 OILaRle8860.0 9356.0 TlIolIIBThtomimas9304.0 atabfes11848.0 stablesCol atabfesCol stablesColC ColC 9136.0 12047.0 12052.0 12044.0 1hollll9lhonias12060.0 10324.0 returned 10908.0 12075.0 10856.0 11204.0 aprofessional 1proCessl 8696.0 proCessl nRt 9488.0 12223.0 visit 12236.0 Tallahassee TAUahassceTallahasseeI TAUahassceI12432.0 8888.0 12435.0 Robertson RotJerlson9896.0 12440.0 haslleell 12443.0 beau01110436.0 10772.0 12456.0 time11064.0 12451.0 sIck sjck10968.0 sjck1st sIck1I8t sicklist 1st1I8tCorforseveral 9144.0 12611.0 ernl 9620.0 days tlay10008.0 12619.0 9908.0 10264.0 01112632.0 10556.0 12636.0 mend 11I1lelmendFour 11I1lelllollr 12668.0 menu1ou 8824.0 12812.0 Four llollr12823.0 1ou 12852.0 rooms roOtUmoiuq12836.0 rent remitNext 10708.0 12856.0 10624.0 Drown l1roWIIBrown10824.0 8688.0 12955.0 House Honscllotise9172.0 North NorlllNorti9720.0 12976.0 9532.0 12971.0 9804.0 10092.0 11196.0 13004.0 1110668.0 atMrs 11Mrs 13168.0 13172.0 Nancy lallcy13175.0 aticy Shaker hlkerStinker13188.0 10080.0 13191.0 Tll1IpaTmummpa11092.0 tuetheguest tueguest 8676.0 13340.0 13351.0 guest 9044.0 9004.0 9216.0 irleutlllamid aud9648.0 13392.0 lld 9984.0 rclaUycs rclaisrela1 e8 10268.0 13364.0 III10760.0 lie13367.0 cityMiss 11240.0 cltMls8 13548.0 Miss Mls8Trixie Trixic9092.0 Reeves dffAlachuu 4tAlachuadt -728.0 10400.0 13579.0 Alachu4 11084.0 haahaaheell 13700.0 heell13763.0 011oti13771.0 R9312.0 vlblt IhltvibItMm llrllMum13752.0 IIhiMcDonald McDlllnltlMcDmnnhlMcDonaldthUcIty McDlllnltlthlll McDmnnhljhiiis13900.0 thlll jhiiisthUcIty thUcItyHQII 9180.0 cltvcltvlIQn cityIlati HQII lIQnIlati14123.0 19264.0 14120.0 O9460.0 14128.0 UnuneyK RnllucyItammisey10232.0 14148.0 ount 10664.0 commis colllllllacomittlscommissioner 11236.0 colllllllasloller comittlssloiter 14236.0 sioner slollersloiterfrontWacahoolajlwns Wacahoot4rns14296.0 Wacahootd -1016.0 10456.0 Vnl 10560.0 14312.0 in14304.0 time10676.0 14319.0 cityyesterday cI 14360.0 1tstcn1ay 14431.0 14467.0 tstcn1ayyesterdayC 14544.0 fr frC 14596.0 ICo 14619.0 CoMcLcod McleodZtlcLeodwIf 9672.0 14687.0 wlf9 10068.0 tjii dft14707.0 g children lUtlrenchiilrcuwero10868.0 werein 11284.0 weroilltbe werelii 14839.0 14847.0 liiilltbe 14855.0 9024.0 14852.0 lty yeilercjay etcmlnyeatertay10004.0 fromitCronttbell bOllleimonie11056.0 atRochell6 atI atPoche1t Rochell6 Poche1tRochell6D Poche1tIiochell ochellD 15243.0 Ii8968.0 Ft Lm8864.0 15295.0 9152.0 McCall 15259.0 Jr 1r9592.0 9944.0 15256.0 Falrbmkt Ii1lrLlIke1Irbmiiks10144.0 15272.0 naval IIftvaltiaval10832.0 navalstores IIftvalatortl tiavalatomes 15424.0 stores atortlatomes15435.0 abut omrtal1 9408.0 15460.0 m wasma15463.0 bllslneas15432.0 visitor 10852.0 15455.0 11028.0 xmlns:ns24 ID35 3444 2668 8588 15584 ns24:type 8644.0 Tuesday ruedayTuesdayCar fnelida 15611.0 1Cnr 1Car 15795.0 15804.0 Car Cnrloud londlondoC 9300.0 15807.0 firstclass IIrstclass10156.0 15820.0 Kentucky KentllckyIentucky10860.0 horses 10788.0 horsesnnd 11256.0 horsesRlIII horsesnimil 15939.0 RlIIInimil15947.0 mules stitilemInlll 9388.0 15944.0 Just lust15952.0 arrived rrlvectiftrived15960.0 anllanti01110500.0 10848.0 salo11088.0 8628.0 16071.0 ThonmnsIInblclstablesJ IInblclM38912.0 Iryer9796.0 Sanl16312.0 leollRrllLeonaril16351.0 16320.0 III11024.0 IIIthc thc16464.0 16467.0 WellllesllayVeduesday16480.0 Crom9892.0 16483.0 tbelrthick10692.0 16488.0 bionic hbuiohbnle11132.0 nt at11036.0 ntHigh ntIIlgh atIligit 16640.0 IIlghIligit16643.0 SpringeSpringSpringsMrs SpringeIIrsSpringMrs 16860.0 IIrs16868.0 316863.0 Williams Wllllnm16871.0 allllami16876.0 cblldrcllchittiren10548.0 childrenhave chittirenhave 8616.0 h3ve17032.0 returncd9576.0 Cromfront17080.0 17047.0 extended extendcIl10804.0 17052.0 17055.0 inSouth InSouth 17203.0 South 9036.0 17208.0 Carolina CarolinaJ CarolinaC17415.0 17423.0 3Newberry Newbcrry9928.0 17443.0 contractor 9856.0 contr ctor 17440.0 busibustbustIteM Ine1 11180.0 17596.0 17619.0 ne1IteM17627.0 lIIallitmaimIIIrh11gb17599.0 17648.0 Will17611.0 17764.0 17772.0 WednesdayMrs 9628.0 17979.0 fUDorscy DorleyDorsey17987.0 ofGainesvlllcofCalnesville17995.0 10764.0 10964.0 11012.0 18152.0 18168.0 18155.0 8924.0 relatives 18160.0 111Springfield SprlngllcldTlmes SprltmgflcldTluieaSprlngllcldTlmesUnion SprltmgflcldTluieaUtmioti-1256.0 Times TimesUnion 8600.0 18320.0 Union Utmioti18331.0 kept tcpt18339.0 ept 9432.0 22 2tC222Sheriff 2tSherla C2Sheriff 18535.0 Sherla9292.0 SVIellnelIennell9580.0 18556.0 lIIadoniade18595.0 10648.0 brief bricibrletbricibusiness 11192.0 brlethuslness briefbusiness 18708.0 huslnesstrip 9540.0 southern outhern18747.0 part 10392.0 18735.0 10704.0 18892.0 uesdnyxmlns:ns25 ID36 3612 8544 19095 ns25:type 19107.0 18916.0 19104.0 ItH9108.0 Cultism GninnGUhUlthowideawake wIlleawakewldeawaketownof townofAlactmua 19275.0 AlacbUIIofAlactmuau9604.0 19288.0 toGainesville 19447.0 19456.0 WedllelltlayWednesdayPresiding WedllelltlayPresh1lllg Presiding Presh1lllg19671.0 FKlcr Iklcr19676.0 ker Cole Colc19679.0 ortime10720.0 Gaines Galne11148.0 Galnevltle Gainesyule 19747.0 yule villevltleDistrict Dltrlct8848.0 19847.0 preached 19863.0 19855.0 10160.0 10552.0 19860.0 Methodist Metbat1letMetlio4lstMethodistchurch Metbat1letchurch Metlio4lstchurch WeduesdftySVcduesdaysilghtnightMr night1I1rsilghtMr20223.0 20231.0 1I1r9048.0 nndRnd9392.0 20239.0 20236.0 Marcus Kndel nndelUndel20248.0 leftWednesday leftWeduesday 10984.0 20399.0 Weduesday20440.0 New 20412.0 Vork York20415.0 and10204.0 20419.0 20427.0 beabsent bealJsent 20575.0 absent alJsent20616.0 n20580.0 9436.0 20595.0 twoMaxey 20600.0 twoltlaxey 20792.0 Maxey ltlaxey9236.0 Bennett DennettlIennetthils20803.0 returued20823.0 hlaliiihishome 20807.0 hlabOble liiihome 8564.0 20963.0 bObleiii9156.0 20968.0 Tampe TampcTaumpe9064.0 alter10084.0 21015.0 ahort10672.0 20999.0 torelatives torelatles 21131.0 relatles21139.0 alldCrleud11Ifriemidsthll10340.0 10288.0 cityThe cItyflll citytIme 21356.0 fllltImelargest alldanti21364.0 bet21383.0 assortment assortmelltnssortnment10712.0 21375.0 liar hareliarnew hareilefi liartica new ilefitica21527.0 brought brouKbtOalneavlUenowoffered nowofTcretl 21636.0 offered ofTcretlIOle21656.0 21647.0 21651.0 ItTbollllllThommiasstablestablesMisses 11128.0 stablelssea 21840.0 Misses lssea21843.0 Nettie Nettle21851.0 tihaker hakerbhmakerTnUlpaTaimipaandAgnes andAgnc 21991.0 22027.0 Agnes AgncZctroucr Zetrouct8928.0 Rocbelie RocIielfRochel 10396.0 arc22032.0 visiting vleltltlg10592.0 visitingfriends vleltltlgCrlelldl 22195.0 Crlelldl22200.0 R1l1amid22203.0 relatlveaiii9820.0 22211.0 timelor22252.0 Cew10904.0 fewdays CewltaJ fewtiny 22379.0 ltaJtinyltaJI 22583.0 22591.0 22588.0 Prehi reh 22604.0 meats lIIeatsimmcaterocerles rocerlecrocerlesxmlns:ns26 ID37 7480 8468 22728 ns26:type 22728.0 22731.0 Call CaUsend scntl8776.0 JIIemmmcyoucorders yiuorders22767.0 utor -572.0 10168.0 22772.0 10256.0 22739.0 phone piiomme22747.0 forwhat 22871.0 wbat22904.0 22891.0 waut22875.0 322879.0 Harrold lIarrold9916.0 22888.0 Phone 1I1ouelbone1I1oueNo lboneNo 23007.0 25Sheriff 8944.0 23039.0 5SherlfT SherlfT23220.0 JcnneUFennehl23223.0 10112.0 23264.0 23227.0 official officlaloflidalvlaltvisitlo vlalttovisitto11152.0 23403.0 loJIIgb8808.0 Igh SprlngaSpringTueadaybroughtback broughthack hack8872.0 23575.0 Joe 9188.0 Iryerlryerand9988.0 23608.0 IOmesonicLlIlld23587.0 tiger1IIUor tigerliquor tIgerliquor 1IIUorliquorIf 1IIUorItliquorIt23960.0 If23983.0 JOIl101223963.0 nnutAut money IIlonCTIte 23967.0 hUT10508.0 23975.0 hOHlObuild ftulldnbulhl24128.0 ahouse liunnihOIlHCJ9416.0 24136.0 ur24131.0 pay 111124107.0 otlIiis24120.0 mortgage mortgsgemortgageor mortgsgeurJIIurlr 24143.0 24268.0 ur oracontract cClntractJor9364.0 br 24239.0 profitable pruUtalJlepruiltahie24247.0 lurc 24195.0 IurestmneriC IurestmneriCace ureatinont ureatinonttee -684.0 trnon trnonItCIJ 10944.0 gtl 24379.0 tee ItCIJaceMOJCM MOJerloyeraMOJCMJHO MOJerJno 24384.0 loyeraJmmo JHO JnoJmmoOLaFuntlscc IAIuntlleeLaFuntisec9840.0 24595.0 TimesUnlouTiwesUiilouTimesUnioncame TimesUnloucaneeTiwesUiilouclInic24788.0 caneeclInic24791.0 Wtnelday24780.0 24775.0 attend mar ularularrlage 24811.0 riage rlage24943.0 orleislilasister slater9584.0 24947.0 Lulu IuluLimlu24959.0 24951.0 lmIrIILJ IIKnight 25111.0 25115.0 IKnightGlddings KnightGlddlnga KnightGlduiing 25319.0 Glddings GlddlngaGlduiingHair lIalr25331.0 Grower does doe10488.0 25335.0 workor 25456.0 25500.0 8740.0 Sale 39792.0 25475.0 HGiddiugs olddlngsGiddingsonluecaine10524.0 onluevitIa caineyUle 25536.0 yUle villevitIa25607.0 smut9124.0 25611.0 Postofficc lostofficcIostouficc25619.0 Drug 25632.0 btore btorcbtore1IIgb btore1IIgbSprings 11108.0 25743.0 25748.0 Fhu FhuThe FI FIThe PThe 25955.0 amity25968.0 Asseesor AueeaorColton Col60nColson25971.0 10940.0 reo reomovec1 removed 26035.0 8492.0 26131.0 moved movec18992.0 rom romn26139.0 Trenton 26155.0 tblaaudamid10728.0 andthus audtbus amidthus 26311.0 thus tbusanother 9328.0 desirable 9912.0 addition adllition26323.0 Gainesvllle Gainesyules 11048.0 26487.0 villes vllleyulespopulation populationMrs 9560.0 Palmer 26711.0 01GllneGllnevilla 26771.0 villa villeyulewllohislisabeea26887.0 Chicago 26892.0 severatseveralmonths 11104.0 severatmonth months monthmedical 27076.0 treatment uLaexpect expected expectoti27223.0 ed oti27227.0 bonlchonme8620.0 27247.0 tomorrow tomorrowCotton -604.0 Cotton faIi9232.0 27447.0 bualnepick pickIng picking 27619.0 Ing 27651.0 upimoaey 1I10aeymoacyfaplcatifal pleatJfalpicalifal27635.0 thefarmers thelarmer thefarEers 27791.0 farmers larmerfarEersuti9552.0 delinquent c1eUnrJuentsubscribers ubscrlber10244.0 subscribersshould ubscrlbershould -648.0 27971.0 remember tbeeditorWe 28179.0 28191.0 28187.0 provided 28220.0 proY 28183.0 28199.0 atockwiththings withthlnga 10808.0 28319.0 28323.0 thlngaespecially especi 28327.0 llr 9652.0 suitable aultablelorbirthday birthdayginJ 28463.0 28467.0 gifts ginJgift28476.0 See gifUgUtt28471.0 belore28484.0 purchasing purchulnzpurchasingelsewhere purchulnzelsewhere 28603.0 elsewhere 28608.0 U 147428616.0 Smith SaJithSmithRer SaJithRef SmithRet 28779.0 28792.0 Ref RerRet28787.0 B DHolley I10Ueyhfofley28799.0 JacUonrilleJacksonvilleyesterday -792.0 JacUonrilleycterda 28951.0 28955.0 ycterdaexpecting expcctJng28971.0 28979.0 jneet ieetttt 28975.0 10332.0 nol HolhIolnolleyntt hIolIcy 29035.0 29119.0 29131.0 Icy ley29123.0 leyntt md29136.0 c1Iltdren29139.0 29180.0 29147.0 visviIUnr viaIting 29303.0 iting IUnr29307.0 hiCentuckyXcntucky29312.0 TlttjrTIler29320.0 did drd29331.0 t10tsiot29356.0 COfJILcomebut 29359.0 COfJILbut 29483.0 29515.0 exed29519.0 exp -556.0 ted 29491.0 koi29499.0 IdardayJ 30115.0 xmlns:ns27 ID38 3228 2724 11520 4936 ns27:type 11736.0 P11932.0 O011836.0 12136.0 Rowland RowlalldRIIIlnmnt12696.0 13096.0 13024.0 nII13272.0 13563.0 13472.0 13Howell Jlowel1Howellnnd 14244.0 Jlowel1Rntl 13792.0 Howellanti 5092.0 nndRntlhrother11812.0 Lute Iute12820.0 12724.0 13268.0 13808.0 among alllollgniiiomigamongthe alllollgtbo niiiomigthe tbo11880.0 prolllillentItromnitment11784.0 Lllsillessbusitiess12536.0 13251.0 visitors 13160.0 13816.0 13716.0 14031.0 tho13932.0 thotit 5447.0 tit 11820.0 5455.0 yestcnln11728.0 froum12468.0 12572.0 5499.0 12816.0 Ncwberry NewberrNewberryNcwberryFOR Newberryyou13500.0 NewberrItOll FOR ItOllyou12092.0 SALIt SAIHsi4ii12024.0 12484.0 heAutifulbeatmtifil12768.0 13456.0 soda 6011a13380.0 13840.0 fount foullt11568.0 5799.0 IlIlIerCcctorller 11688.0 11748.0 perfect 12564.0 12228.0 order 12180.0 allllnint5851.0 ery12896.0 13355.0 cheap chcnl13264.0 13944.0 Any ollewishing visldtig12416.0 it12580.0 bargain bnrgilin13152.0 13052.0 13667.0 COlliecottie11856.0 Stnrffice 12532.0 allelsec12720.0 6107.0 COUIlt13288.0 13676.0 tfMlsfca tf1lIses tftt1scs 11696.0 Mlsfca 1lIsestt1scsARnes12656.0 Mosaic J1tsslclksste12544.0 13088.0 milt nudand13040.0 13376.0 Lillian IIlIlRuLilltmui13324.0 Sllgh lIghlig1t13800.0 Sllghwill 14179.0 13940.0 lIghwill lig1ttvihl 11556.0 tvihlleave ICAVCIlwenOOutSelllClIIl1crSepteumber13th 12thit1m13284.0 Cor13600.0 5113884.0 StAugustine 14116.0 6503.0 51Augustille 5Augustine 14072.0 11548.0 Augustine Augustille12320.0 12184.0 12796.0 tltuy12700.0 thl 13072.0 13180.0 wl1vihI13511.0 aUell13412.0 14012.0 StJosephs 14135.0 St05elill 11544.0 6819.0 Josephs 11612.0 05elill 12076.0 12016.0 11968.0 Academy AcmlelllYMiami Miatmil12704.0 13296.0 IRIIII 13008.0 News NewsThe 13692.0 NewsTime 11676.0 TimeInrgest11928.0 allliaitul12912.0 helt12788.0 asimoittitent13164.0 14060.0 oC12104.0 tIIultStunIcs11940.0 12640.0 7180.0 harness harnOIs12472.0 13312.0 bugRles13112.0 altandwagons altwngolls 7295.0 wngollseer12328.0 Cor13148.0 anle13076.0 in13552.0 cltJ7476.0 tow11644.0 11996.0 7479.0 Oilsnluanlu12144.0 12488.0 tholllasriioiitaa12604.0 13248.0 alllblcastablesFred 13672.0 alllblcaI1ml1tng stablesVrcti 11680.0 7655.0 Fred VrctiI1ml1tng King 12352.0 12460.0 thr12584.0 12756.0 Ii 12996.0 firm IIrlll12824.0 13604.0 Johnson OhUSOIIJolmusoim13520.0 JohnsonKing JolmusoimKing OhUSOIIIollIg 7823.0 IollIgCo Macon llnconMacoit12232.0 12892.0 Gn GRGa13060.0 nrrlv 13504.0 13756.0 iu13976.0 time13875.0 14168.0 timecity 11520.0 7999.0 WedllesdayVeduesday11764.0 greet Rreet12716.0 rcct 13132.0 oMCrlends13332.0 13927.0 Rllelamul13836.0 xmlns:ns28 ID39 3192 11448 8175 ns28:type ortlerorders11900.0 12360.0 front12708.0 Our 13000.0 lJlIslllcss12928.0 titetimenOld 13828.0 8240.0 men0Idue8papers titetiOki 11652.0 Old Oki0Idue8papers 11876.0 12648.0 slIlIa 13236.0 13044.0 wrapping wrapplllg13508.0 11504.0 purposes PUtpeSpurl 11768.0 8571.0 11804.0 15 IScbS ctsctlt12268.0 ithundred IlIIndrellItitittireti13424.0 13336.0 35 2S2513872.0 torCorforets 14044.0 cts cisetsat11980.0 TliK TIII12260.0 12312.0 STAHSAl12216.0 12688.0 officer officerV officerHofficerlH11732.0 11828.0 12012.0 Cobb 11916.0 12424.0 12480.0 oplllnrioputar12620.0 13224.0 13320.0 agent oC13860.0 theSeaboard theScabonnl Seaboard ScabonnlAir MrLine 11110Iinerniltoad rnlhoidrailtondntthis 13184.0 at13684.0 13448.0 titlepoint poilltpoimitpointImsreturned poillthnsreturnell poimithmasieturned 11492.0 Imsreturned hnsreturnellhmasieturned12356.0 frolllfront12276.0 nCew13140.0 weeks 13596.0 vacation vacationspent vacatIonsjmeut Rcnll 9311.0 13984.0 14008.0 11 14000.0 1181Jent 11484.0 spent 81Jentsjmeut11904.0 12096.0 9415.0 Alabama AlnbnlllaAinbanmanud RIIIInmul12980.0 points POlIthspointsMayor 13844.0 POlIthsMayor 13496.0 13532.0 olnts olntsMaor 11620.0 Mayor Maor12124.0 12204.0 12296.0 HIt1holllasVhtotiaaretltllellWedlleVetlnes14052.0 Wedlleday Vetlnestiny 9723.0 11472.0 tiny11760.0 9795.0 lronlltroutentllckywhlrelie13196.0 13540.0 bought bollght13444.0 nncar 14096.0 aCRr aCar 9971.0 CRrlondlonll0111976.0 fine filloflue12140.0 9987.0 hol1ios12420.0 nllllaimut13240.0 ttuilos IIIUlosittulca13136.0 13704.0 whichare whichnre14075.0 11468.0 nre11668.0 12020.0 Oil12172.0 12672.0 12908.0 stahlesIII13544.0 thla13823.0 10184.0 13776.0 cityRev cityllc cityRey 10367.0 Reyllc 11852.0 11772.0 12040.0 12264.0 10375.0 S12120.0 12476.0 Carpenter CnrJellter10372.0 13104.0 13492.0 esletlay13404.0 CorPernnmllnn tternAlllllllalcrimnndiun12512.0 vhierc12412.0 lie13192.0 hmlhiatttJcen13420.0 reoelucltctl remucsted 14056.0 quested elucltctlmucsted11988.0 12148.0 nllliaunt12304.0 12676.0 deliver elellvertelllllerallCeteumperaucetemperancelecture telllllerallCelecture teumperaucelecture lecture 11964.0 11896.0 IIIRht12848.0 Ihat10916.0 13656.0 Nassau NallNauatiNassaucounty 14083.0 NallCOlIlIl Nauaticounty 11076.0 COlIlIl 11792.0 wh 12348.0 12396.0 11112.0 H na12516.0 wet 12464.0 12784.0 nndantietry13400.0 elcctlullciectiuim13992.0 13888.0 11948.0 he12088.0 heldsolicit xmlns:ns29 ID40 4132 2848 11372 ns29:type 11576.0 11483.0 women Olllellvotmtemimmml12284.0 alulmost 11475.0 mitost12920.0 12972.0 lII mnll miarc nrcRrOcharmed chnrlllettclmartited13476.0 charmedwith chnrlllettwith clmartitedwith 11440.0 R11888.0 11596.0 hniulsomo hRlIllsolUolianilsoimierillgVo12904.0 13440.0 11648.0 tanCAIm13352.0 show howshowyou howYOIl YOIlrings rllIRsclilga11747.0 12248.0 suit 8111tstilt12208.0 11744.0 tastes tnste11752.0 front from11756.0 sllllllesimmiple13560.0 simpleones simmipleonesslllllleoncs 11432.0 11871.0 11899.0 ones oncsCorbabies hatJles11944.0 thoso linactho u 12880.0 eetietwilli13280.0 11936.0 gems gClllsgenisgemsbeautiful gClllsbeRutiful genisbeautiful beRutifulenough ellollg1lcnouglmdelight IlolIghtuielighit1113516.0 duchess dllcbcSlllflchCSliIJ1111636.0 11816.0 SmllhSumithi11724.0 SmithAlmost SumithiAlmost IAlmost 13624.0 11564.0 Almost cver 12448.0 train tmln12372.0 12383.0 thnttllnt12844.0 hRS 1mstinsentered enteredOnlnesvllle 12399.0 elite enteredGainesville 13864.0 reel reelOainesvllle OainesvllleGainesville12164.0 12539.0 durhlRluring12556.0 timCew13176.0 12559.0 claystiny13459.0 13852.0 haehasbrought haebrollght Its Itsbrought 12707.0 brollght12715.0 students IItudcllhlstulentsCor12860.0 Knst HlstItnatSemi Sellli13640.0 Seminary SellliIInry 14016.0 12803.0 12891.0 nary IInry11892.0 wtekholhIsotItschools IIehoolll12911.0 wilttJe13804.0 bedown tJedowlI 11404.0 dowlI11740.0 13059.0 busltieiu LlIslneslibtsiiiemi13080.0 ntulnlliltholie13812.0 13087.0 willbe 14036.0 willLe 14172.0 Ibe 13227.0 Leell 11824.0 studenlstuuleiitstudentsWants studenlWAnts stuuleiitWants Wants 12100.0 13480.0 13455.0 Hotao 836.0 tiocqTJie 13468.0 raqIhe 12868.0 13463.0 Cable CnbleCnlJlePiano 1JnnoPin 14028.0 13880.0 Company Coitspany13587.0 12004.0 lllllnll wants WRI1tewatits11912.0 12628.0 trade touletNdO13644.0 IIa12952.0 13100.0 piano plnllo13896.0 13848.0 ororgan 13659.0 ororgRn 14124.0 dorgan 13727.0 organ orgRn11796.0 lorfar12028.0 13768.0 IIa12496.0 IJI1g12436.0 buggy 12884.0 horse I10r1o 13680.0 13820.0 14024.0 tther 13859.0 ther titer13879.0 particulars vrtictilar911656.0 -676.0 rtlelltlrs 13895.0 CnllII1413536.0 Rccdcr Heederltcculerlocnl11788.0 manager mallngrtittmimagr12444.0 407 12752.0 14027.0 West WeltWct13156.0 Street SIreet14055.0 14152.0 14143.0 GabmeavihleFla lIAim uSepfim rScptbltSeptthiuSepfimMrs 13832.0 i13316.0 rScptbltrs tSeptthi1rs11608.0 14363.0 trs 1rs11872.0 Roynl HonlRoyni14371.0 Cook 12804.0 14376.0 wlmo12644.0 14412.0 WIIS13484.0 14392.0 rccelltlyrecentlyadjudged rccelltlymlJndAetl recentlyadjttulgttl mlJndAetladjttulgttl14539.0 Insane 11191111eIsiammunudalld1ms 1mm12964.0 13012.0 eillce12828.0 14560.0 14552.0 bcellstR1 stay staj14704.0 1111itmhlMrMosc 14712.0 lilt12176.0 14720.0 Moso MoseUdelftteins UdclstcillsICtielatcitis13407.0 hOIlllmoni13303.0 14775.0 n13748.0 ntllrllell 13979.0 14800.0 14783.0 14880.0 tllrllell14883.0 YCltenlllyestertiny11800.0 hmerhiijbnndH IwsbRlllthiitbnmitlhOIIChotite13572.0 homeand 14920.0 hOIICnllel hotiteami 11376.0 nllelami15047.0 Iehoped llopeditoped11924.0 thntthl1tsite15119.0 ie 13452.0 15127.0 soon sooit15096.0 beclothed beclothecllh 15124.0 15220.0 clothed clothecllhiiimind mlullinitidmindIf mlullJfinitidIfJf15476.0 vourottr15448.0 Imlr hltlrllisir11960.0 12452.0 hccdniliu hecdllIlbcediiltii12400.0 thin ililnthihit15479.0 try trv13728.0 nM rollbt 13952.0 xmlns:ns30 ID42 3356 2792 11316 15592 ns30:type pgs Uii UimlrUe1ti 15628.0 -568.0 nriaJekd 12288.0 lel 15639.0 JIAJt9rQWCr 12808.0 15636.0 pir 15616.0 RnQrQv 13068.0 grower 15631.0 Jor Po 13948.0 15655.0 11360.0 15675.0 safe sarun1erre fJ 15719.0 11rhr8 Rhft tIIi15727.0 ofiMfoKp nfiMIIlItnhululIlmgfoalllcullleoalllcullleallllt -688.0 Gainesvilleamiut 15856.0 amiutallllt tlie flle15888.0 PostoQlco JostoQostoflicccc 12592.0 JJtitu UrllK1rug13064.0 toru 13524.0 lljuli lIhchIIJghSpring SprlnSpringsSpringMr SpringsMv 16032.0 16048.0 12692.0 tMr 16208.0 16211.0 Mvn16216.0 HCrlbtuof Cribbs Crhbba16224.0 Hawthorn llnwtliornhimmwtborii16244.0 whpli 16247.0 whq wlmqI10clJte1 13904.0 16359.0 16372.0 located 10clJte1locuteul16400.0 12032.0 Lctnioii rcIIIIGnLeimnon16431.0 WI1812876.0 a12832.0 littslncss hllslneuiitsiness16420.0 visitorto visitortotL visitortoti totL toti11508.0 11632.0 cltJWectlltsllayWeditesilayalltIatiul16592.0 onleredorderedThe orderedTheStar 13988.0 TheStnr TheBtRr 11356.0 16731.0 StnrBtRr16747.0 sellt16752.0 1016744.0 lilt leIemistilyfalllll 16760.0 ntHawthorn nthlawthorii-808.0 I1awttaotllIr I1awttaotllIrCtlLbnnyft -964.0 MrAirCrlbbs MrCrIbbs 11352.0 16907.0 CtlLbnnyft Crlbbs CrIbbs-704.0 tays saym16920.0 lie16915.0 liken likeslike16928.0 12840.0 orhii16936.0 inilly Alllllyfatuity13764.0 toImvu 16912.0 17083.0 Imvu17088.0 gooclpnpcrspnpers17104.0 rend readreaulrendJ readCnll 17288.0 17303.0 5317300.0 Cnll CalllACrosse UCrosse1aCrosseItAnderson MsclcraoiiAndersonHigh AIIIIcr Msclcraoiihigh 17363.0 ol olII1gh 17467.0 II1gh17472.0 SprlllgsSu1tigs12300.0 I12364.0 17487.0 Ahrmna AbrnlllllAbraitis12612.0 17500.0 jnck Jackson ackSOIl13688.0 ackSOIlvlllei onvllle 13924.0 17567.0 17643.0 vllle vllleiville17655.0 12128.0 Ilnuknlglil I1auklllltalIIaukiilii12956.0 Arclleri17679.0 WWells VVeIls 17823.0 VeIls17828.0 AluchllaAlachiunallliawl12340.0 17847.0 17852.0 JlfDnvldion nvldeoll1avidaomiDnvldionHigh 1avidaomi111gb 13360.0 nvldeoll111gb 11336.0 17984.0 HighSprlnseSprIngs18043.0 weraverc12616.0 alliollgainotigthotimetransac trallsacIrmumsactransactors trallsactors Irmumsactots 18092.0 18183.0 tors tots11600.0 18175.0 buslncssbualitces12324.0 liilie12744.0 18196.0 cUycilyTncudny riledayucsdayTncudnyWe riledayWeucsdaye 11664.0 rcptUr repnlrrepnjr18391.0 umbrellas iimhrellnnumhrella12084.0 18403.0 hI In12748.0 tilelie13220.0 immostskill ellI18515.0 fll fil18520.0 CIlIIIRlIler manner ninuner12168.0 18527.0 12272.0 better 13036.0 Ilave13660.0 tucltuchtucltwork suchwork uchwork 18667.0 18672.0 12392.0 18683.0 ellecll1l1y12560.0 18719.0 13016.0 eclally whetawhellit 18691.0 cOMlacoalscostsno cOMlanocoalsno18799.0 18831.0 18840.0 moroimiorethnti thmthatiInferior 18815.0 lifer York18835.0 Wo18823.0 nlso Rlsdaladxmlns:ns31 ID43 3660 2836 11272 18967 ns31:type 18967.0 18975.0 carry 18983.0 nice 12576.0 parasols tmratolsIlnraolallllmindumbrel IIl11hreltmnibrcl19043.0 las 11528.0 reasonable reasouablereasomialileprices prrcesI13388.0 SUllthSmimithiSmithThose SUllthThose SmimithiThose 19291.0 Those 19343.0 12188.0 aroulld12428.0 allliamiulborrow borrolVborrowcopies borrolVcopies 19464.0 copies 19472.0 11920.0 todaystodaya19488.0 SInr19495.0 19527.0 BeOarc19491.0 whats wllatluin13712.0 iuit init 19483.0 tIt 14108.0 19640.0 nreRro19648.0 requested rcqucsledrcqulemtcl12384.0 19667.0 ntthieoflice 19708.0 orsce oraceorscethe 19711.0 oracelie 19819.0 11512.0 e1I1or19835.0 l1ullailtisubscribe uhscrlbe13256.0 19884.0 13244.0 scrlbe forIt forit 19987.0 20031.0 IUOUimmatishollll1muon huh 1I0timotbe20016.0 Iwrrnwlng horrowlllKborrowing20067.0 nnthing athlug athing 20160.0 thing thlug20176.0 thntlint20184.0 woull120199.0 cost coatltiiithlmlcu lesithoutitanonecent 11300.0 20360.0 cent 20380.0 104 20352.0 20355.0 ThusBInr20368.0 13344.0 Jl IrSetSeeGuldens SetGlcldells SeeGiddena 20556.0 Guldens GlcldellsGiddena20559.0 Unparalleled Unparallcled20583.0 20688.0 lallll 20699.0 nil20704.0 thnt tllltthat20743.0 laUleminute20712.0 Implies lnsplfcaItnlJllcs U20756.0 cures rtircscureadandruff dallllnladatidrulT20859.0 stop atopsstops20851.0 falling aIIlIg12712.0 hair linErhn 20891.0 nnd20867.0 produces IlroducevroJticcsproducesnew vroJticcshew-564.0 IlroducelIeIV 21007.0 lIeIVhew12292.0 21020.0 aumum20996.0 excellent excellelltIInlr21004.0 dresser dresseror 11400.0 enle21136.0 ti tJDGlddlnjs OIlldhlJahlddliqsUrllghtoro titoraftorahtoroGainesville 21155.0 titoraoalneevlllc ftoracaiticvtllernid 21235.0 oalneevlllccaiticvtllernid 21263.0 nllel21268.0 liePostoffice lostolncelostoflcc21287.0 DrujDruSf13588.0 21284.0 21271.0 tIIIgh 21392.0 IIIghhUgh21400.0 SpringSpringMra 11412.0 21587.0 MraMr21620.0 French lrtllchlreticii21623.0 thftthintfaithful althCul13632.0 tell1terntell1perance ternpcrance 21695.0 21807.0 pcranceworller21796.0 VlIotins hns12936.0 lived IIve121819.0 litatWind WillclWitidWindtor WillclrorWitidsot13868.0 sot torrorevcrnllllolltlJl inonthi21975.0 rctlltllcllrcttirieclyeslerday22003.0 tomake tolIIake tomimake 22123.0 lIIakemimakeGalllellltIeGaineavtlloItemhomo hOllloliozmioagaillMrsFrench 22167.0 MrsIrench MrsIrencli IrenchIrencliwae22347.0 12048.0 au earnest 13488.0 22332.0 11113708.0 timethetciDbcrahcc thetemper timeternncrahcc 22475.0 tciDbcrahcc ternncrahccbce fight Iflitfluhtlinttermlnata terllllllatlClterimimmakd22511.0 22555.0 xmlns:ns32 ID44 7784 11188 22659 ns32:type 22659.0 grand gralldvictory Cor22671.0 tellllerancotoIllepeopleof 22723.0 toIlleof 22831.0 AiaciiumiAlach UI1 COli ty 22852.0 111111atulOIlIlesvllluGniiesvilhGainesvilleshe OIlIlesvllluheGniiesvilhuscshe uscyll1willmore 23044.0 Iliore23023.0 thallfill 011tbetime23072.0 nuyanyone nuyolle ollemay lIIaysnayleRvebecause becalletho13580.0 townwent townwellt townwaist 23359.0 welltwaist23831.0 end BndYoitf23887.0 Lundinl Lund LbUnd23903.0 toJewel torlIIt 13368.0 torizi rlIIt rizirlIItJewel riziJewel 11232.0 24483.0 Jewel 24495.0 Laundry LanllryLaundryJ LanllryJ-1408.0 25228.0 25236.0 25239.0 Runklc RunkicProprietor ProprlctorProprlctorGAINESVILLE -1092.0 ProprietorGAINESVILLE -1080.0 13592.0 25559.0 GAINESVILLE 13124.0 PLA FLAPLABRING 25924.0 BRING Gcll Us UsYour 1892.0 Your Chickens ClilckcnnEggs KKfiliggs26499.0 KKfiVegetables 13784.0 liggsi1cgetnhlcs 13780.0 Eggsege1aii1cs 26607.0 26667.0 Vegetables i1cgetnhlcsege1aii1cs26675.0 nndnnllIiitactallkinds allkind 26831.0 kinds kind26851.0 Country CotmimiryPro IroProduce Iroritice 27015.0 duce riticeduceWE duceWEPAY riticeWE 27203.0 WE 27208.0 WEPAY -920.0 WEPAYIIf -1972.0 PAY -852.0 PAYHighest Highest IIf 27684.0 hest Prices PricellorCount CounCouuiCounttry Couuitry 27847.0 27868.0 27855.0 lroduce27851.0 alldaflISell 27887.0 ns asnsCheap asCheap aCheap 28023.0 28036.0 Cheap 28067.0 aa tlIml28027.0 Cheapest CheapestCALL CheapestCALLON CALL CALLON -992.0 CALLONUs -1816.0 ON ONUs 28683.0 whcn28715.0 yotiYOI112524.0 waut28687.0 SllpIc Sin SllSttiSinpic Sttiplc 28847.0 pic plc28855.0 alldFancy FallcyVaticyGroceries GroeerIGroceriesGAINESVILLE Gr erf erfJ6rGfvc 28903.0 sg6rGkcu9n 29019.0 J6rGfvc g6rGkcu9n UII 29075.0 29027.0 Trial TrialOAINESVILLE 13260.0 TrialOAINL3SVILLE 29224.0 OAINESVILLEOAINL3SVILLE29227.0 GROCERY aiocwv29243.0 CO COGainesville Coaalnuvlllefla coOalnesviile Oalnesviileaalnuvlllefla 29444.0 Flat Flati 30295.0 xmlns:ns33 ID55 4544 6596 14264 4924 ns33:type 15264.0 15620.0 AA 15312.0 15752.0 16207.0 17895.0 4a 16856.0 18295.0 EottE 18112.0 14328.0 We1iave We1iaveIn -1744.0 15583.0 5372.0 HaveIn 16504.0 19567.0 19584.0 19660.0 Iff titt tt 14428.0 15703.0 Stock115604.0 5939.0 16356.0 16916.0 16820.0 17364.0 constantly 17228.0 cOllst -1124.0 18488.0 18035.0 nt1y 17904.0 18580.0 receiv receivtng 19231.0 6019.0 reedy 19239.0 6071.0 15612.0 tng6195.0 uptodate ptodateUptolate15976.0 17556.0 Shoes 16368.0 18303.0 fotfox18748.0 Men 18620.0 IfI 14308.0 6400.0 15608.0 6415.0 Women WmeuWnnen14416.0 16600.0 17072.0 6459.0 Children 18136.0 17980.0 18464.0 poptdpopftiai18336.0 popularprices -860.0 19324.0 popftiaiprices 19208.0 19564.0 19368.0 20624.0 19680.0 20843.0 20664.0 Ipnces pnces16336.0 16236.0 16824.0 16724.0 17096.0 17504.0 17419.0 17991.0 makes 17908.0 makesWe 17996.0 makesVe Ve15504.0 callParticular 16168.0 15508.0 callParticula callParLicular 16212.0 19540.0 16163.0 4360.0 Particular ParticulaParLicular16548.0 16404.0 17488.0 18095.0 Ladies LadiesBroel 14280.0 15560.0 JBrockport CCBroqkpore15695.0 Broel -1108.0 16288.0 7875.0 16272.0 16376.0 port 16311.0 17000.0 17452.0 Mens 17372.0 ens An18596.0 Amer Arner18532.0 America Arnerica 18599.0 19216.0 4560.0 14264.0 15544.0 ica 14384.0 15864.0 15843.0 16080.0 8120.0 andWalk adWa1k15972.0 -1244.0 uWalk 16475.0 17416.0 Over 18144.0 grades 17928.0 gradesJ 18147.0 gradesJD 15999.0 JD 16204.0 16456.0 16740.0 Matheson 16743.0 MathesonpiioB Mathesonhoa-1884.0 14655.0 piioB 14784.0 hOB hoa15136.0 bnd15040.0 Urn 15520.0 Leiitljei LBbbfiB15372.0 15524.0 Lcte 16132.0 16388.0 toe toife16392.0 9019.0 bO 16648.0 16552.0 17952.0 Jaine Eaine16727.0 18032.0 bin8 18355.0 18511.0 liIl8f 18360.0 18576.0 ille i11e18864.0 Fie FInFIH19520.0 19600.0 19636.0 xmlns:ns34 ID61 1504 5300 14304 9992 ns34:type 15728.0 19559.0 15816.0 10323.0 14400.0 14395.0 10331.0 14595.0 14907.0 15008.0 15208.0 10344.0 15192.0 15516.0 15304.0 15824.0 15799.0 15924.0 16340.0 16440.0 16652.0 17268.0 17263.0 18068.0 18376.0 18472.0 18680.0 18984.0 19499.0 19083.0 sTHE 19603.0 14447.0 TFIE2884.0 16704.0 STARJSTARI19587.0 xmlns:ns35 ID63 3732 5196 14364 11720 ns35:type 15539.0 a14912.0 THIS nIISTIuS15664.0 PAPER 16880.0 puMishcd16816.0 18008.0 17920.0 18280.0 18703.0 inter 18612.0 interest 19212.0 14408.0 est cst14796.0 15128.0 15011.0 15552.0 Moral 15456.0 16352.0 Business 16176.0 17432.0 17956.0 Political 17816.0 18948.0 18856.0 Interests 19200.0 14404.0 terests 15219.0 15084.0 12759.0 18752.0 andFlorida andElorida Elorida15356.0 12992.0 12999.0 15736.0 16140.0 16044.0 16608.0 13015.0 financial interests inteiests17540.0 18684.0 18588.0 19004.0 itseditor 19272.0 19008.0 19420.0 14380.0 15092.0 15568.0 proprietor proprietorTHOSE 16675.0 13304.0 proprietor1HOS1 -1104.0 19416.0 16672.0 THOSE HOSE1HOS113639.0 -892.0 15868.0 WHO WIfOseemed seented16527.0 17444.0 13703.0 17384.0 think 17640.0 18347.0 13696.0 18979.0 18924.0 19012.0 westarted 19412.0 14364.0 started 15180.0 luore15080.0 15796.0 15724.0 16344.0 16264.0 13980.0 16795.0 17752.0 18116.0 18692.0 lHE18607.0 THESIAR 14019.0 SIARSl 15076.0 14696.0 14228.0 AR 14652.0 15167.0 14252.0 appeared 14255.0 16544.0 14260.0 16444.0 16987.0 journalistic journalistk18276.0 18796.0 18700.0 19408.0 15148.0 purpose 16024.0 14607.0 15292.0 15547.0 14612.0 pOS 15920.0 16116.0 14555.0 shining shinng17292.0 17224.0 17800.0 14583.0 18352.0 18428.0 14616.0 temperj-756.0 19184.0 14660.0 per 14928.0 campaign 14832.0 carn -1020.0 palgn 15328.0 wecwie976.0 mistaken 111stakellnistaken16571.0 111stakelllHE -908.0 17632.0 nistakenTHE 14576.0 15140.0 15156.0 15188.0 lHE15196.0 15687.0 S1 16540.0 AR1s 15284.0 16984.0 17463.0 Prnpr 17315.0 PEOPLES Thiwwrigmner nauernaner18436.0 19395.0 19195.0 xmlns:ns36 ID64 6576 5244 14268 15479 ns36:type 15484.0 14732.0 15400.0 advocate 15227.0 su 16968.0 16844.0 16708.0 17099.0 15515.0 candidates candid 17931.0 tes 17796.0 18311.0 18316.0 forofflce 18615.0 forofflceas -932.0 19247.0 18696.0 15543.0 officeas 19387.0 14340.0 15784.0 14543.0 15068.0 15787.0 14967.0 15776.0 conscientiously lSClel1t1ouslycpnscientiously15823.0 believes eheves17428.0 18492.0 18828.0 thepeoples 15872.0 19135.0 15916.0 epeople 5168.0 14335.0 16076.0 peoples people15104.0 16156.0 15791.0 15708.0 15812.0 frtendswh fricndswhen17068.0 16188.0 principle prtnclple18459.0 experi expertexpertenee 19152.0 experidice 19140.0 16219.0 19148.0 16384.0 dice enceenee14824.0 15564.0 arc17400.0 cOl1sideredand -1128.0 18528.0 andwhile 15071.0 16680.0 friendly 16711.0 suggestions 15932.0 17436.0 17900.0 always 16739.0 wel 18628.0 welcoined 19143.0 19403.0 14332.0 coined 16988.0 thcpolicy 15452.0 poli 16200.0 16275.0 17011.0 15940.0 16564.0 IIE 17988.0 17027.0 Wllvill17916.0 18467.0 17036.0 betrolled conk17112.0 control1ec1 19228.0 conktrollecl 4316.0 14320.0 17264.0 trolled trol1ec1trollecl15115.0 17283.0 nly15019.0 15692.0 15596.0 16036.0 16379.0 16280.0 17012.0 17531.0 propnetorpropnetorYou 18636.0 18476.0 17728.0 17787.0 17819.0 15271.0 Need 16448.0 ItYou 16460.0 16764.0 19356.0 19360.0 14952.0 18460.0 18471.0 18479.0 TUETH1316800.0 17960.0 18496.0 STARIF -1152.0 18507.0 iIF 19455.0 IF YOU favor farorfayor15780.0 19180.0 ideas idcaspolitical ideaspolitical17827.0 political -888.0 andotherwise 19136.0 andotherwiseyou 19340.0 19139.0 19379.0 otherwise 1684.0 otharwlseyou otherwiseyou15296.0 19400.0 ivUl16808.0 enjoy cnjoy17583.0 reading 18623.0 rHE18407.0 THESTAR 19204.0 19451.0 14272.0 15088.0 14996.0 19700.0 19703.0 17336.0 19723.0 17240.0 18524.0 19739.0 whichis whichi19192.0 14724.0 greatest 16512.0 16415.0 conducted 18300.0 20028.0 20039.0 Flor 19100.0 20267.0 ida 20280.0 jf20283.0 differ 20300.0 20396.0 18584.0 pout politpo1it18495.0 19096.0 poutical 20292.0 20567.0 ical 20644.0 15016.0 15840.0 20608.0 17380.0 18232.0 20627.0 read rend18820.0 20639.0 thepaper 18836.0 20880.0 20935.0 paper 20943.0 15244.0 15744.0 20952.0 15668.0 16228.0 20955.0 16136.0 16691.0 20895.0 know 17276.0 18064.0 20927.0 hit 18272.0 20932.0 himand 19176.0 19316.0 aand 21172.0 21175.0 15260.0 21207.0 21180.0 16124.0 21183.0 21196.0 oft16535.0 offSEND 21191.0 19320.0 21232.0 21488.0 SEND 21491.0 US 21499.0 ONE 15936.0 16720.0 DOLLAR 17864.0 18420.0 21551.0 receive receivefor -760.0 19179.0 21783.0 twelve 15416.0 21955.0 xmlns:ns37 ID65 2088 5420 13992 22184 ns37:type 22184.0 mTIE16119.0 STARD -2480.0 18976.0 23139.0 1316072.0 GODWIN QODWIN17260.0 Editor BdltorEditorGainesville fGainesville 23856.0 14104.0 14239.0 14100.0 23688.0 7 17968.0 FJori 17972.0 FIork1a17975.0 FIork1as -1068.0 19044.0 18944.0 23663.0 19039.0 23427.0 24084.0 14196.0 14300.0 14291.0 14496.0 14603.0 14803.0 15112.0 15216.0 15412.0 15720.0 24099.0 16020.0 16012.0 16304.0 16616.0 16828.0 16932.0 17140.0 17236.0 17843.0 17644.0 24123.0 17939.0 18256.0 18568.0 24147.0 18880.0 xmlns:ns38 ID69 5396 6592 13927 25060 ns38:type 14551.0 25063.0 THOMAS 14556.0 TIIOASSTABLES -1748.0 TIIOASSTABLESw TIIOASSTABLESIs-4228.0 18784.0 25079.0 STABLES -1984.0 STABLESv STABLESIS16223.0 25984.0 26072.0 26403.0 IS TUE14476.0 PLACE PLACETO PLACETOGIiT-1112.0 15048.0 26763.0 26799.0 26804.0 TOGIiT 26807.0 CUT GtrrCUTFI1UE 15632.0 19091.0 26779.0 17091.0 IFJIJE 19156.0 19899.0 26787.0 iFIJVE -24.0 19923.0 26999.0 27091.0 FI1UE FIJVEFJIJE14600.0 TE TEM 15268.0 MAT 15427.0 15236.0 27695.0 27739.0 1EA 19308.0 EA 14592.0 ONABLE p 15576.0 16096.0 28007.0 16184.0 20464.0 28671.0 29115.0 28875.0 28968.0 16735.0 28719.0 16748.0 17304.0 28696.0 TIIOIMSTIIOIMSA -1420.0 TIIOIMS1ivi11e -2036.0 29083.0 19312.0 29247.0 29043.0 19512.0 1j 28931.0 tO tOtf 19944.0 iJ 20156.0 20063.0 20448.0 20175.0 20456.0 29007.0 29423.0 Caln 29431.0 1ivi11e 16088.0 1ivi11eI -2256.0 17788.0 29435.0 ilV111e -1272.0 Jrl1a 20460.0 19020.0 ji jI 29683.0 29719.0 29708.0 iI 16308.0 29903.0 29987.0 11ii1 19223.0 30111.0 ii1 30347.0 19803.0 30287.0 d



PAGE 1

obO-DOOODaOSEABOARDFAGANGainesvilleDepartmentIDSCOMEATSpleaseDUTTONKindsFreshRwysoilsHijjhBfftGAINESVILLEjxJNETryCottonyoupriceBCorrespondenceGulfInlandTwlcBAWBBApplicationCongressmantobeottoqpaidQAINf5VILLfWednesdaysGainesvilleAMIEStffvliollowcljeekcdcanJacksonville-Cityacknowledged-thatcorporation-moneysoGainesvilleCoT-imeall1t13it4StfttVestlbu1tedQuantitiesCongressionalCo-ngressmenworkingmensnmemiTamiipacaptionVMrsubsisting-uponPHONEwere-flockingtointerruptedlyCongressionalTitlpTonnyoverwhelmingrrakeCItusapGalncsvlllewardApalachlcolajaccomplishedirregularitiesCOinvestigationinsignificantWarehouseJacksonvilleIn-vestigationJacksonvillelesssincerelyJacksonvilleJacksonvillesubsciptlonsympathy-wasCongressmanrepresentedofwecorporationscorporationsLYPW-JASTMtemporarilymagistratesRepublicansJacksonvillePhiladelphiaprobability1TW1CRAWULKdispossessedCortin-C0Il1P1111IasplendidWashingtonJacksonvilleimmagiuaryWashingtonreconstructionATAMIIArPMrepresentedrepresentedABSTRACTfollowingAgriculturalLegislaturerepresentedoldfashionedpropositiondepartmentconvincinglIavanaleleIsup-portingDepartmentallowing-himmagistratehumiliatingCARTOONS-TooMedlinPresidenttaxpayersRepublicansympathizeobligationsproportionElconsiderationchargesproportionSap-tILT4csenter-tainmentJack-sonvilleJack-sonvilleflagshouldproportionLharvestingappreci-atedthispaperpohicetuidCOMPANYMetropoliscountrymanI1repentancechaingangAdvancesantiStocktonexceptionsJacksonvilleacknowledgedacknowledgedAlACHUAWash-ingtonTuesday-wasUniversityjQafnesvJIIethrough-outsomethingSUCCESSFULpireevenGraduallymanagementgovernmentcontroversyMACDONELLIusMo-nopolistconsultingHarlrldgepossibilityRETURNEDelectedbutacknowledgedoftiiecitypro-portionMetropolisAugustinecontestingfArPernandimiaapsolutelyabsolutelysomethingconsiderableproducingrassessment-forsomethingGainesvillelamiasufferingscompelledcompelledpermanentincreasingem-ploymentChattanoogaspeakingunfortuniitesettlement-ofreformationremember-edappertainingsympathyJacksonvilleManagerHartridgeinefficient-inSPLENDIDsubsistencewftLL1invariablysupport-ingmateriallytaxpayersadvertisementsGainesvilleWahlntonINCURlORATIQNIVsupport-ingSparkmanacknowledgedappertcnanccsoFftHarmonynoniusesslblqIndicationsINTBRVIKWBDAssessmentraising-theIMCompanycontributedioopSs5asolicitedWashingtonwaterworksAlitotpeaceablegamblingAttorneyyesterdaysentiment-ItdischargeundesirablestockholdersSVashingtoiiattorney-forprincipalsoberandmajorityprosperouspeddlingde-lightfulItSVlttJlSufferingsiveRpardonedpresentedappearedfoundlingGentlemenpointingexpectedMondaysV4aGLpcommittedsomewhere158p258acorporationmajoritycorporationchargingvaluationr-iconstitutedproperty-incommittedFlewellea-MacahootadnrsJrmbelongedunderstoodmajorityreceptioncompanysmajorityCongressnewspaperscarefullyHereditamentslaboringreceptioncertainlyopponentcandidatescorporationSaturdayprovidedapplicationforJen-ningsaccusingcapturedparticularlyCompanyviolationspinliiliig-millStocktonsJacksouvllleliis-tcrlcsCarnegieninetynineJacksonvillecorporationanythingannuallyrequiredaspiringparticularlyconventionassessmentrepresentImowingdrainageArMonUcelloJacksonvillepackageshunger-ofJacksonvilleproductsconditionsrepealedgovernmentcorporationregardedpresent-edacceptedsubsidizedFlorida-ThehostilitysuccessfulexoutlawsucceededcontendedRailwayJacksonvillesubscribeconsiderationAnVHRTiswostarvingpleasurelaboringEffectivesubsidizedsweepingFlemingJacksonvilleexplainassessmentINCORPORATIONar-raignedrepentedSaturdayCOUNTYpronouncedSeptembersubsidizedsocialistSavannahimproveoperatorsSonthtlde-HkkmtnpropertyArPensacolaopeninganythingsucceededwhiskeyProprietorExcellencyotherwisefortyeightrevisingEGOCGChristianscorporationcountrysretali-ationhereditamentsESTABLISHEDJacksonvilleJacksonvilleSaturdayAttorneypropertySavannahproducecontinuesstealingrememberPersonallycharge-IthelplessWADH-IiriCTKScalculated8oo8oapro-tectionmentionedassessmentpropertyvaluationJackson510p720a94o325pexclusivepertenauccscandidate1000000CLIPPINGScopies-ofSprings1000000HXCIJPTIONSspirited3DiilvaluationhumbugSaturdayquartersassessmentindebtednessSOUTHERNcausingsecondclassassessmentpropertyThursdaysthoughteddontORLEANSSeptemberassessmentE8TABLI8HBDlawyerspoorcrapPersonallyslecreraPersonallyCHRISTOPHERlookingLargo5flceptvagrants1000000wheneversaloonlstsCOLSONassessmentappointedpayingConnectionsLibraryBarringassessmentMctropoElrkwood-ClraltGovernorStocktonabolishedbelongingpeople-toTiteschapcontinuesin-creasedincreasedTogetherreadingGiddingsreduc-tionsaidtimepre-cludedmanufacturecomingoppos-ingMondayafternoonsub-jectsstation-forrequireGRAHAMfurnitureTownshipbelongingre-memberRichmondBclltlayV-TTilMcompanyScheduleeagernesscomingindi-catedoperatorGainesvilleStocktonOQCcccoeincreasesassociateconsumedTampastockholdersexposurepopularDemandSecretarydescribedTallahasseeCom-missionSunday101906-5IIGStocktonMadisonStocktonStocktonnecessaryac-companySundayElectrichopingoipiofcpgettingrailroadendeavoresteemedH1903-MHDIINTampaGainesvilleTampalawyersRIchmondcriticismattorneyassociateTampaTampaFryersJenningsUainesvllleStocktonGiddingsconsideroperationagainstdependSTRIKESpresentspeechcommissionPortsmouthstatementTampataxationhusbandOAINKSVIUHtaxationincidentschurchesuniqueleavingasylumcriminalpartieseditorialDuringArFairfaxcompanyjustifyTampagettingdrawingeditorialAUchuaofficialsquotedVIccIresldmod-eratecommissionwithoutthoughleadingplainlyGainesvilleCon-gressleadingStocktonMissourisub-scribersmembersonefifthprovedElectricGainesvillecortxjrallonTribuneforegoingincreas-esinferriortaxationBclltuontbrougtspeechstatementprop-ertycrackersFloridaproposedpaying51903hIlastingJanuaryGainesvillemademachineassess-mentspeedyJUXDCUTORSappliedweatherGODWINcouldntgreatlyStocktonmouthsduringGainesvillechildrenchildrenTribunecon-fessedweightx-Plaintiffscrackersbetweenelec-tionsproposedchargeTribuneSecretaryZAUzCKAWEOKDsocialistoptionpoint-tohundredGainesvillehoweverMachineNEARERMissouriAlnclumchildrenauthorityGainesvilleSultansbaggageduring288000knockedprincipalpeoplehighertaxationDIVISIONcryingincreasechildrenPublishedinnocentMATIIUSOVproposedsayingliclterspeechtroublesprofitshardlycountryWIUlfordDistrictBowdensayingplantedfought288000utter-ancesTogetherpeoplepartedstatementStocktontryingSenatoralwaysaskinggivingMessedproposedtigerheaviestStarplacedcontained288000sellingprintingsewerageRichmondpeopletryingchildrenCrescentdBTTINUsouthwestFmiteitfamilySmallSpringsliquorweeks-orspeechthingspermitquestionbeginscampoccurencesWildwoodPostofficeMiddletonessentialSTRIKEaffirmeddrawingliquorJasperpubliccountyassessedcountycountyteamsterpertainsbodilyBrunswickarousedbelievesvictorydefenseMiddletonhungerfamiliespo-sition1ccrueltyschoolsaccusedabsenceelectionanotherAttorneyPoliticscountyfarmerspropertycountybecauseelectricconductedJaspersub-scribedfurnishedinsertiondawnedDunagautransactedproposedlongerwringTuesdayconductedMayorCongressbeingpimTnondlTillegalpassedelectionJunction134ManagerFloridachangedsingularpublic050000bordersfAXEStwentysleepersseverallyOenUleplacedMiddletonNovem-bermem-bersanotherappearsTheenforcefamilyofferscoeeeDOmillionTigerbeingPuntaFennellfamilyMyerscouncilmeetingNegroagainstmightworriesresidencescouncil1rcsldentFirmcontainedreader-itoutputnightsschoolsAlongfac-torylengthExecutorStetsonsunkencartoonspolicewantedmightBollardex-pensesmonthshandedFloridaThousandThousandEnteredliabilityJamesmightletterseveralChicagoFloridabeingdressedGowaufeatureThousandManagerRaleighprotectpropertysixteenpostalAttentIonPullmancarefulinvitedFloridaSecondcontestseemednightFloridaMondaycitizenColumbiaagainFFBNNKMviolatedesiredGowahfriendsI5SagaingrandBannermana-gersfurtherWauneeTwentymonthsSocialsvoice-ofmadeseveralthereinarrivedwithinexecution288000schemeconvenesJudicialpropertySpringsincomeGovernorexecutioncontainedpoliceprettymarketFloridasincereUnitedBal-lardsoutheastseemedchecksSeaboard7gDirectorsJamesPowerscouncilSher-iffchild-renLamarbeiiigclothesJanuaryknownbeingbur-densingu-larBartowexpiresgoingspendbeinggoingendureCOMPANV-IPalmettoMlcanopyitnotSpringsgettinTampaTreasurerpanscartoonthingFryerpanysExpressexpiresheart-InwhichGowanfurtherchanceseveralSenatedisplayEffectappearattentionbehindbelieveJamesDARRShighestjumpbeinghiddenlivedSeaboardPullmansuingpres-entSTATIONSdescribedshouldExecutorreallyreallybeingSultanseveralpepperwithintamingCountyDenmarkMonthscranksskeardcrimesagainThereJamesagaingiventheatershouldshouldknownRecordPalmettoSteamersaccountQuincyTRUTHamongwithinTreasurerAdditionclassesagainBannerStatesSouthernoffensetodaySp-ArshouldpoorerloadedstrikesFridayagaindoubtsshouldUnitedexpiresamountworthpromptgeneralalmosthighestscantyopposewhichcartoonValuedLaCrosseturnedtwelveshouldHundredPRESSquiteofficialsentedcrimestenementsshouldamountpMac1ua1000000businesssteeperBaldwinWhenRTIOr3promptinvestorUnioncartoonmembersGordaCountymoralstamedcapitaldeceasedshelterfairlygruntThereDirectorsTimesHarris11600ManateewouldquoteartistsamongpersonJulyshould96-0ssPullmaneapa-radesgHighMilesrtestamentknobswhichproper-tymatchFrankAlaclmawouldstrikeTimesenablealongbusinessbusinessbusinessWhat31879monthwhichThereAugustNotaryAugustReadersTampaleadergrownhundredSarasotadailyweedssubjecteditorTheyThereofficesvaluesGordacirclesotherswouldManateepurposesmediateNolanhealthwhichNotaryNotarybTATEroundweedsfriendstrikeplacewheatGordaTablepapersaUItLevyMonthsAUataCSarasotapricedAlachuafoundpublicwouldwhichwhichThereTHEStatesattendbeforewouldAlachuastolenbarrelbetweenwouldwouldworthwirepriceacknowOrlandoCharteradvancewhichfrienddollarSoodwouldAugustsaloonothersothersstrikeplantAlachuaelectionlargedenyOrleansCountybetweenPow-ersFloridastrikebetterNORTHmuchscrapsundarLint16000wouldFrankcountyAlnchuunderbettermatter281003streetsbeforeknobspartyCountygoodchoplightJohnwhichraisedpaperstrainstrainmasterherebyWhenVerypaidstrikenaturemoneypa-persstrikeentirewrongMorldabusinessCamdengreatgreatgoodmastergoodBarrs1RilesgoodeditorOnlyHighleavesStatesmoneyguestaccountunderstrivetakensignedwomanAlachuamoneyCountyterrorsGeneralstoryOctobertigerbetterdollarraisedexceptIURNKVhnndskeepAlachuabetweengoodwouldwhitewhitewhileThecrimeLettersGeneralOctoberstopsOrleansCitycountyextentwordsAlnchuauniongreatdollarPuntaStreetclerksunlessaboutfoundgrownwhitehopegoodgoodsonvlllerevenuegreatbetweensituatedFloridawouldunderdoubtbreadweakheadsaboutsignedstrikewhenwhileBoyspackWnsnirtBoysducedwarm-orFloridawordscasuallooterselectionstagestrikefoundsignedwhilepublicparcelhighJohnOcalaresultFloridaexcusesgirlsshares-Evaluestreetsfcif-ciweekotherownersfightboyssufferoutcryRangeeverythosecountySheriffknownkingti190-3siuiwhileknowchainAfterseamyPuntacarefulThenLargecoaches1100rInunderNewsknowaboutmuchcouldwhengoodtheyJougpiececot-tonworryWESTthiephelpstoodMOnuumi-nbranchSectionFloridaGrowerpointscalledpaperhaveCityNewsheardNewsNewsTicketSpacerOcalahorsebusyas-oUowsorganTampaotherCharterBarraPAIDapplyFloridaFloridacouldwhencouldixStatecouldparcelwomanstoodconnectsFloridaCharterworkMobiletheyin-comeRilesWynndaysAtiantaonlywinkWyiiiiIJANINOgiventheygoodwomanSlmontonhomemakeFromvotedknowshellef-fectlumberjurynegrovaluecouldcountyCOtSONraisegoingconsistwomenmakepricesBarrsdaysnegrotheirTUshareThetheydaysWaldoweakBlindpaperthereWynnAgenteligiUariywoman1144themcountyArcherThatBarrsthreeedgedtherelllpaperpaperknowstandordermakemakeeffortwantsPatmitvoterscertainservicelaborAgentamounttheythreeonlygivenCircuitSheriffFlor-idagreatBarrsmanytermsnegrobrcveretheretoPRANK3muchChartercoachesViewwhatdirecgamedontwhenthosegangStateReadtheySeptthereinCircuitTUtherevllletheylievescentchildwhymuchtakenraiseFloridacottonofficersbeingextraknewlaborstreetthesetherewhyworksincebeenfreecreatedFloridawhoDollarsDollarsMedlinshootBarrsRATES-IBarrsblindplaycityBarrsyearsblindamountwhatthemtradetheirtionsJunebdltorcharterfollowswordcertaintheftmanytheyposesfleetotherPress1000000Drug2lbiddermadetheir536pThosofficethereweekmanyBarrswhatharmDARKSrLlIonWhomillsgoingAprilLiverepreArthurNoticePublicCitypickthereLargeLargeOtherswalkhavelittlelittleFalrficUthesefromknownPublicrMarchofficers3oastormthereSeptHoufromtherecrueluponoftenthreeThathandseedsbeinglittleknown1000000yearsThiseveryafterhaveannualtheirjustYorkfromfromwomanlyingthereuponthemMaconyear-auntilhaveNEWBarrslyingeveryWVNNVOVIBGainesraisemillslittlelittlehavedeadAlbiontheirhavegoneuponhandPolkwhatIIwetwithlongThetaxesyearsCommeanscouldbeenexistviewhavetheirCOlllNpanypityhavetruthpayfromknownfromtiredwithpiecepiecewhocitycityTakenPublicUndersorrowtermswithwithcitylocaltheirthemwhatCorncoffinsUnderidealComknownreniemtaxesstoleshares-ihave136pTakenuponTimeHereJackdoorwithwhatwho-ptheirwithwith80saTWOunderNowhead1200-MMRASTANDwhatArPMplacesharesMarchpartwithwolflawslivedThisbeforeviewbeforevestedcourthaveissuedgangpaysdoorhavebeentimebeforejustfoldmatterthishavecitywhichtimelawsthenfromthanVicebeforeWASmeansmeanssuchbeentheirhavedeadbeforefrombeenstealdeadcityOOOOjobTakenMarchhavetheirCorncitybeentimeAndbeforetimeeachwithwithcoursenearerstaytearswhocityleviedstoretwccptownthauwhichbeenfeelsfromYtMreasonhasDrugcantcitystormbeforevirtueNewdarkTheBoardUtebeforerollsbeenthenwiththanwithfalseHighGibbsvirtuecityhavewhotowitpeepmustiIwifepastfoodbeerslowfoodmustissuedJnoundermustupper945anatureunlesssharesOneeoSilverThenextTheport12thftthatfinalfoodthanLevyfromcomebydryBoardwentThreemoreleastdaycitymansTheSMurThethenwhohimhousethanwithreadtliqtRUTStimeThebustLevylegalamifrontseepuuthodoesaddswillCitythanTheaboveTheableTheThehoursFortthatwhomWITHfallsair1whomustCentsreactdrysaysTP1IthanjestMATHverywhoandabovecentsintowellthatwellthatTimeIUIH8suchSouthdulythisbeerTheblueheldthatThethatcrapDallytermshamesyearneverdoes310-1MgRiverpaidtowitthatciorderTheHavedrythatthatThehowTheOakTheheldStarlikewentcosts-LblockRockyhouseyearDHyandSALeachmustthatwillthatHerStale1903YouThethatseedthatTheButTheThewhoideahow840-SNthatthisCentsPlanthostabove900PTUGThedryThesaysThethatthatthatthatsaidsaidliesthatbestthatthatthatStoreAND7WpStarkaopCourttheyandboxKeyverybigeyesRilesyorksideintoPinesmannerinletThewillgetthatthatthatloonwillpaidCitysendthatJuqICmanner830-R38forceaseSIDexcesDillystockwheninghadandandtoldalsothatsaidthatwillsidesaidthatsaidthatwiltdueantisomeandwillwillnevercausehoursmummervalueitorState21stthatTilEIrnthatHinthimandwillhimHimhimandandlikelinewillthatbesttiltsyearthatCityLakerentThethatLeeanddialtoldmejandwill741129thJoeTheotherstockveryfavorsayssaysneceswayDadeRilesthatsayshadandthathimrealhadthisfactlastandthishimthatwailpassJoeeveryshareotherworkthisandtoldhadandStateevilcasemaymoreFifthjustandhimhadfindIoIoaalsothisthreeYorkotherthisKeyforthmeanandfewlikesarysentbutexistweretiesshallsaleyearsStateStateStatelionwilltypeandandbanandandandthisfactforththatwillAutsomethepaymidwillandMaeentruetriedsentStatefirstthatuponitselfTuesHairlastandhad27thRileswithhadandandandhadlawlastbadthisrlzeilthatandtactsentcomesomeifJ-IfkWestshallfromtheremayshallhaveshallandpaysupand34thhimshallandBudandhadButandandlaw17thcartandbutsomefewcourtdayidleSALBeachbutbutbutweremoresentshallshalluntilyoumorewereshallFirsDallyfewandandWebadandandwithandandthegetandhadandtherethefewforthactsfewshallhavetriedsamegetfewStateStateandrategetofsomesameandandandMailStateandandandhadfedandfreeJoblessandandhasbadsameTARanddayaskbutsellbutLivehavemydayBywerejKwandandandandyetitellpayIlirdrealandafterPointanyandhasfreelasthaswithhascostactstruehadthethe1LAThis10000shallbutyouyetjobteethetheypurhaveyearyouthethedayNotandandandwonWecarthasderhastheleftcitytownwereevencourtbuthergetthetheNewweretheshallsuedeachhavedoorsendtheandWeyetthethecellshebutwisewisedaytimeNewNewhasthebutthethebutthethethethegettheforbutthethethethedayoOOthetheoldAllthetheseentwoago1904roomIrvineonesmidandhasyetsheThePortcashdentlandandlastthethedietlifedaythethethetimetheNewherthethethethetimeitssuchbeenshallbeeneachfallthedidAndwantfeltyouthethethethethenamesevenSAUltheJayTheheldvilletermhothumshatthethetimetimethethethethethethethethethethebuttimethetheNewsaveibyBaUulifementhethethetheandaSpa8pbythehetheatedstatthenotlandthethehastimetheyethis36pmanovereverALTeacheachthethethethethethethethethethethethethetimethedaythethethethesaymayfour915outlandbycostoldthethehisbythethegetcashtimeonceoverSRAtthesuchforthethethethethethethothethelifethetimethethethethethethethethehistIleberthethetheearneversaidthemetsoldnotoutthenotagosaidtitleownnotnottOaDmanhishisaSpthethethethethetheSopbtarthethebythethebythethethethethetheat-1Wmanwas26pTenthethethedidthehisfor903saidwanthedidhisfor56pthatnowseenwhoPasshis=sixtweentimethetheCIAhisMrthethethethethetheonesownIbyseenoutnotseensaidThe11MhisbybyTheMrthethethethehistheandnotoutoutsaidandnotand1903TheI8ptheconmyMythe148hishisseesyearforhisthehisnamethetheandoutwassaidsatebestwasforhiswillamidandever1903ThewellsaidFor745ThenotnotnotwastheforforOneThewhohalfmanHeownNalgoandPUbleMylineforefirstforthatwellthatIcyJ7thatnotnotnndtooandInnowformaniAwaswasforhishishisMr4SPtheHewasforbybyHpby-JnotEdforforforthisandand100fortheTheloth1903well1903notoutnotoutandnotandantiwaswasandcut40PthathisforforforHemencarmidSopandandandfortaxnotfirstwillGenhis463saw1810forforroomthisthisfornotnotAUnot4oportnowNo0LakeDoMrforoffSixwasoffSEATnotandandwillwaswasMelarsaridandmindthisandsituandandlov36alistandandthinthisandwillandoSPandnotandandforDrwasLakewaswaswassameto-meforfix5thnotandantiandand5thPenandandandnotforenellTenandsale3op57Pandandandwaswasandand55P45P55PforforforPJIforandyouforcamecamenotanyanditnotwasandandnullpayLotSSPsameantiandandandforforonce53PanyandNosnotandSSPLotSSPwasforforDrFlacameupandandandandlastsellospandandandandandsalelOpof4Ponedu-wasTImupwas1120outanyandoopsaleandandallSSP3PzipljourourtheSyouourusescanActDoVIIo3pfullrcsl20palltheMPlOpcanwaslettheISPOfnilrunandandestsopupAND1110one44acanyouFla4ipvia45aouritsupthehetwoalldoitsall30toneallIllstellogp2jaithethe053the17PdoaretheWlOpcanbeoneone5-t504the39athethethehehebeallonecanthethethetheFinthethetheheU-uS4aEthew45a40abeCObebythethethethe2jabebytheforbehehehebeeeAllheheheheourechenuuheuphewilloopthearethesoathetheViathethethetimethe3a13athethethebeofthebebeofbeofLvofbetheledbebeallhebus45anmeofseeare840StiSforareareheitsbeoutnessthetheallforfortheVIathethethejja42aareareseethe15a24pAllofbyofbei8a2S8areusesambyoop725640arcparthe35aofbeits10hebeofofthearcohhebeof3saareareheforTCTbeforthetheViaCCfor50arci3suearefnnarethethessausesbeofofIVbeofbebeofofofDUllEdforLvhebeberforofofbe28seefor901for34081379forthe25aforofoffororNoforofofinofinoEof400SCOofbeofofofofbyofofUs24areofinofbeInof90arcareareInm-onmvsire34005810inofinofi708410915ofofofofofofofofbyofofininofofofVILv561Mbeof758T703aregI80forwe745renme8036C3743ofiniuofinofiuofofofofofofofofinofviaininininofofIn765lot843ga815LvorLvofLv444Ifofofofofinininme80inMofStinIfIfofinunbyAr8S373nobyNoCoweisalie2oaoninofofsetinininofinkiofIfsiiniuinVIArArinifoftoininintoapEmeonetoiaaVa813mllaltlotArofof46orintoofinofinofininininoftoiniuInArArtoiftoArArsetonset43A4itsIIIallwereon20aatNArArinanattototoWtoofolIfArtotoin57onallAtAttoistotoistoeaoanoononaoanoooaAtifArisItMArtototooftotototoinontobebetoAruntobebeisistoArisbeonbeheooaheArItcanntnoanonontototototototototoantoOKIttoattototoattotoattobeistiisArnoIsisisifisbeisisWAronnoononmeonononisattoofnoIntoattototototototototoheof34oltoattotoofIt04ismeisisbebebeliuArisisisatofofofisOKrWisisifIsaniisonitusoranclttoofofastotototoofofoftotoasammerofof66Ltotoattotoofillofsbofofof66Isnotoisisisisisisus66isIsifRitlorofanititofofofCmofInanifatofinaremecarofofofofofofofofoftoattoofofof2718S5anso50oreraIsitlIritoritasisofofinin4asofinofItInofofth52toorofofofof31WLvJofasassoNome50isororasLvisitititDaititJ25inofofofofofinofitititNoofInofofofof25ofto35itJCininonof34CISasnsBIonasoritasofinIfat23or31itsa2537itsaitJArit1itatitin25asMMtnnt25toasaton7EatESXTItoanMIattoatisPtoIattotoatArJatssLuirArreitoMD15to10lAtoonitBontoJtoatatNisIfnn4Jto15Uon12onononon1012onIINatMVnJelE10it01H31214orOD9101012RDRD20itoris20jii1010DDRDorJ2oRDGtoorC7IvDxADD9ID10AAAUAL12uXiIJLnor5aoras112la10asDDIsIAasAAorizIIAasiiasasS11itasAt3basiicIIIIJl9tnbISMaII45AfIIiiII10JasifIIpi9aa63a5Trh4teLaa119IaP695p83PpiO73aaasa48naaaaaaf94479T3348AO353Aaanaa473339a7868457a5aaaoPtaaaaaaaaJaaaa67=3445756638aaanaaaa77a75aap69a75aaaaI1sSJIaiPl7ft2Iotap7IISa428JIITnntIf21aP4ln2102IIfI=tta8iIt>IIt1it>LII>Li1ijJI1II1SSiijilsiIIiIIISIrlind



PAGE 1

QAINESTARSTARTILTESTAR-DTHESTABLESTHETHOMASHETLaundrydu-ceWEPAYTHOMASSAlOONISTSCALLONU-sWATERLOOJ-udgeWe1iaveMatheson1ivi11e-IBRINGSTARI-FSHERIFFgllr1IH4r1IIR-nyc1seconscientiouslyGainesvilleJewelptUM-fitiiiPLACE-TOPULLSjournalisticONABLEsuggestionsTHEIRNeedTHEMEETconstantlyNeedproprietorFloridaproprietorcampaignpublishedWFiIprincipleKNIOHTLAFONTISEBGainesvilleDOLLARPEOPLESTEMcandidatesProprietorappearedtemper-ancefriendlyconsideredParticularconductedJDYouuptodatepoliticalUsYoushiningreadingTHOSEpeoplespopularCountycampaigninterestsExplanationS-heriffmistakenGAINESVILLEWeotherwisecomingTogetherJoespolit-icalcallJrl1aii1BusinessadvocateaalnuvlllefladuringfinancialgreatestINTERESTSAlachuaalwaysPOLITIOALChildrenaud-notwithslhudiugattentionPAPERJOEPoliticalexperibelievesabilityAmer-icapurposeWomenBIGLeiitljeiGODWINThUgflsspolicyiDvorj1DpricesFloridaFI1UEfriendsStockmonthsIfIOOUNTYTHEGAINESVILLEmonthsWgradesseemedSTARshouldTALKED-ButenjoySTARIurestmneriC-acereceiveSTARuWalkmattersg6rGkcu9nSENDInjunctionLadiesstartedtrolledTHIScougrntulotlonsSTARWhiskeyImportanceAttorneyeditorwhichCorrpreachedVtOIALIcoutityJiaveComplimentsWHOVegetablesTHEcoinedTEflPERANCEthemhavingwheremakesdffAlachuuWednesday-MrseditorRunklcEditorShoesTHEUnparalleledJainetwelveRTHEONEreceivGROCERYeditoronlyWhiskeyknoweditorImsreturnedYOUpopulation-MrsappointmentpiioBMoralArgumenttiocqTJieonlysweepingthinkTHERespectfullyMensJacksonvillewhileieImmediatelyTALKEDterestspapert-OtfdiffertwentyfiveaccidentallyGainesvilleWednesdayfavorBroelEAprofessionalGainesvilleideasmorningpretentingstrongholdsWednesdayUimlrUe1tiwhenwhenofficeVOLUMEWednesdayconsideringIlnuknlglilpredatedshortcomplainantTimesUnionSpringfieldJacksonvilleWednesdayFryersWednesdayWednesdayntHawthornlsiinesshascontractinginterpublishingimaginabledeservedlyprohibitionlLORIIASTATEinterestingWednesdayattemptingothernconvenieiiceLundpurchasingrestrainingJackson-villeconstitutionalCheapestcomplimentcommis-sionerablkytcnnfollowing-InprofessionalcomplaintsThrasherprohibitorylawTheOverinjunctionBroughtdelinquentyoucorderspowerfulWednesdaytemperancetemperancenegligenceEmptySeptemberuestiouddCommissionYouGainesvilleinjunctionwrappingPrayerHighestsuchCountryGroceriesprominentprofessionalprominentIwrrnwlngProducedMenehtliuslastlcskyownershipGainesvilleheadProducedcompletedEPlnMWednesdayimportanceKentuckyprofitabletemperancetogether-MradjudgedSeptembertemperancewithwideawakeMOJCM-JHOdisclaimedJack-sonvilleyesterdayChickensPostofficeWednesdayreadargumenttemporaryexpectingItKentuckywillFlorcandidat-eortlcularllneyesterdayfrequentlyespeciallyNcwberryeverywhereinfluencesportparticularsinglandscapeItThehaitgeronWednes-dayTallahasseePostoQlcoNewberryprominentyeilercjayliIl8fyesterdayFATHERSCarpenterpublishedaccom-plishedthanLaFontiseeespeciallyLaFuntlsccyesterdayAugustinepromiseyesterdaysubscribersaccumu-lationfourpharmacySpringsCompanyChanceryGainesvillesstrengthenAlacliualGainesvilleInnUdelftteinsGainesvillespeakingyesterdayMethodistsaloonlikeAcademyprisonersGLASSESWacahootdUnuneyKfollowingpublishedadjudgedPresidingwereprowl-ingbestarraignedneglectedgladdenedrequestedGainesvilleoccupa-tionsRocbeliewick-ednessdischargeAldermannewspapersyesterdayWANTdesperateWednes-dayhimhowplcatifalLaFontlseeGainesvillenewipapersdcfewlnnlHhiijbnndHinformationGaines-villePernnmllnnrockboundnewspapersOrdinanceOnlnesvllleCIlIIIRlIlerexpectedtemporaryenforcinguSepfimMarriagebrother-LetGainesvilledaybutthatwhiskeyProminentappearanceproducedtemper-ancesportsmenrejoicingyesterdayGiddiugsnewspaperconsideredtwothirdsmarriageBalancethatprisoneryesterdayaudience-DrWacahootaclothedKentuckytDA7continuedhimappearanceDemocraticoccupiedtogetherwillIborjcla-TimemlssionerpexhibitionFancyaccompanyGaines-villedaughterLaugleyrecentlytem-peranceTufcsdaycapturedopponentsjunctionGainesvilleandDAVISGlddingscoveringrespectedbusinesshuntingbestBot-tlesexam-inationweddingandProduceordinanceTuesdaymorningCouple-inproducesRobertsonpopularacceptedresolutionAlachuaquestionconnectedmajorityTncudnydefendantsMcDonaldpreachedandtermlnataknowingGaines-villeFalrbmktFoundyouAttorncjclothingwillandconsideredSheriffSpringsandassortmentCoun-trydethronedJosephsStocktonsanddroppedAttorneym-maiiiesvfllereferenceandin-vitationreasonableJudgomountainwhiskeyChicagoyoupleasantGentlemenGentlemenpracticalRevenueDenieseveninglookingafternoonrclaUycsumbrellasandmorningrememberHawthornmingledSpringsbusinessfriendsAndersonpittingMondaypleasureelsewhereprimtrysaloonislshniulsomoandyouCheapmoreandandOITYANDgrandestassortmentandandattorneyhopefulandholdingpromptlyUaptlstPopularPatrickspeople-ofsubscribeTribune-ofelsewhereshippedandbelieveespiedshowedaddressedweltenacitybuggiesUSbanquetSpringsinotoriouscontractorvio-latingSpringsSpringsbroughtCouncil-tovisitingworthlessproudestthroughfreshlyMondayeyenlngpopularMaulingLctnioiiexpect-edDnvldionJOEhuntingTuesdaybroughtmurderedtoechildrenlittslncssSemi-naryexploremnerwishingSpringsRochell6temptedthroughWhiskeyliquorsSpringsPostofficcstrengthCouncilspttorneyquartersSpringspopularSpringsSprIngsKnightchildrenImplieslogicalcautionedvarmintsbeautifulapprovalANDJohnsonLeonard-vsThrabhcrCOMEappealsthereforeWilliamsextendedvacationPreacherMrMoscbuggiesconditionbeautifulSeaboarddutyasSpringsTuesdayagocourt-roomsobeyingTarnpakillingjutAllfirstclassansweredInstructdandruffsouthernthelaughedrecentlyyouDamascusWaterlooThrashercomingpowerfulValdostaKnightTampapnothingattentionbargainWagonofficiatedThrashererocerlescharmedDavisparchedpopularLloydsexcellentGuldenspeoptCountyagainsttogetherlACrossethesyllabledoubtlessviolationhundredcomingwhereofgrounddelightquestedattentionbeautifulcapturesCarloadadditionmanhoodpurposes25-SherifftheArcherfeelingagainstTampatumbledUronsoiiministerSTARKandgladdenpassed-ItcrowucdvarmluUmeadowssuitabledesirablethetalkingEggsTampaboughtbusinessstudentsJudicialpeople-asdiceKazauzasKnightAlabamahighlyenoughthebaggedoffendersISspeakerfoxthetheFryersvarietyheretoLawyertreatmentbeautifulSlbleysunshinehonoredJiccnseluringJudicialthestudentsKnighttomorrowbusinessbusltieiubusinesstodayinillyreturnedVIIPortlandCatholicreturneddermeneverCountyheightCountyduringbroughtthejusticeforeheadAlachuaRowlandThomasThomassolicitorsolicitorMcLcodrelativesreturnedZctroucrcontractCoiniandliquorsjusticeviolatorspersonsFcnncllemployTIXEthehavingandAlnchimrelativesoccurredTampeexemptreceivedbusinesschildrenhccdniliuorderedhighlyWillsidasimpleTampamyselfperfecttemperrun-ningpackedSibleyCountythebrotherintimatereturnedHolleyfountainLeonardbusinessbusinessThomasAlachuathefamilyYoungAsseesorthoughThomasgroundlocatedPricesfeelingvarietypartiesDentistsaccidentFennellsupportSkinnertellingAtlantichitbyliquorslargestNancyAlachuaAlachuaLeonardCarolinabusinessrelativesforabsenceRamseyagreedspeaksbearersduchessbringsspeechAlachuaAlachuadoingsfoughtfallingDorscyThomasinsistedwithoutwithoutIspeechreturnedbeginsparentscopiesconsidervis-itingpostedsurroundCountyWantsJusticechasablebusinesstheEighthPedricklargestrailroadparasolsgospelAlachuaStoreabilitymistilylawyerSpokelawyerherebycopiescountycountyStock-tonremarksIlrousonYoungconkspMchspeecharounddecidedelectionelectionre-turnedgospelfamilynicelyThomasSlbleyValdos-taBennettpeopleoptiondecreedThomascountytheKillingspiritsUlghthcountyextendsbecausepeopleFeuuellrniltoadfaithfulleapedgainedresidedAlachuawantedpresentPedricksuitablepeopleCounciloptionorderedvisitorsChurchtheFIncaughtarguedshallowAhrmnaGrowerdislikedHarroldanotherTuonmspersistTrentonpresentvi-olationStinkerglossesarrestedFennelldeeMedpointscom-panycountyofferedcountyoffcrystalhimselfliquorshimselfvictoryHowellpublicFloridabeneathviolatedmedicalfarmerstittdebasedwantedumbrelDandyAgnesre-movedFryerFeuuellcommitSibleyshrieksthingsthingsforforworkerkindsknownhimselfJudgehopedgeniusserviceslectureplayedwithoutphonebrotherfortuneitsliquormicnrliwlbusi-nesscountyMaxeybuildenteredannounceIm-posesliquorgreaterborrowwhplijleopleUronsoiicleanedDistrictcitizenstihakerfriendsFennelorderedharnessMayorpiecesendIFrenchFcnncllcitizensSheriffHAGUSmightlabeledmotivesdandyFennellLillianworkerabilityplacescitizensAtlautamotiondelivermakillarrivedFlowedvalleyFloridaarrivedjusticecheapAlmostdresserANDMarcusmonthsschoolspassageperancelicenseWaterfriendstheycon-tinuefriendsIryerjustlyrlIItFrenchFryerArrivedbecomeRccdcrden-tistsruddywagonshimselftigerscountyNOTLynchcountycrystalVIOLAheartythingseveralMiamiGrowerstablesshouldPassedPalmertransacemptyTherestablesvisitoraroundFloridanightvblightColtuanbottlesoclockstreetsJudgeQcalyTrialBallardsecuredfriendsJamesFlorida1ryerengagebadgemightYour1-itigersfriendswhichbeingpianoPlacesAgnesCircuitaroundNassauMcCallnightcmitcddashedcitizensPLAbottleswaivedstablesFloridaspokocantlveArcherReevesallalongseveralshakenworkerwhatsCribbsJudgeRoynlbeforeGorntoBethelquite-aHowellTheymonthstroublemotionelectedchurchfriendsGainesamongwhenspeakbrothershouldWaldovisitorialongKingFlierWHWchurchhunterknownblastedSheriffsoldierHighpointourkingsTheythirtypricesbiliousbusi-nessshouldtroubleofficersJAA1EsheriffsheriffFryerdoinglikelydefeatentlonCircuitbridesKingJJtituGorntobringfoundColtonwisheshorsesseveralamongFryerdropsMissesTrixieearnestestdoingbarrelsWhereSheriffofficerstjiiwagonsgrandmattersriendsstablesSllghcountynightgivenagainitsDrugundershownbottlesbeholdSheriffseveralofficialcanoneHalfInarrivalRobertstablespapersplacevisitordeniedKndelseveralstablestodayagainiInalmostyoungCrlbbsnightNettiesolicitThosesheriffsheriffHighWherehuntsHighJarvisright1MaconHighofferedMaineTimesFryersheriffloafersFailedmatterturnedStarkeactionhurledbarrencarefulii111gbhighiringsnightMlsfcaagentCultismareUpondeniedbabiesspentPianosolicitviolateStarkeHighMosaic111gbpalerarmedattendofficerInsaneHighplacebeforetiredbottlesmoneyreasonercannotdrivereditorknownrightlargejuicesheriffColCElljulicircuitsaloonothersSALIthorsesap-pearabsentwhereSmithwherevirtuestatedyouthsheriffpain-Ipapersattendbe-ingsky-IIIaremoaeybeeditorTrashbeforeeditorWhatactionfutureUnionwherebridalWindHighshoresDrownDIDCotton8500whichsheriffsheriffDoctorotherdidntLawMainecitizenwherefounddangtrulyfuturefwealthsaloonPhonehelpany-onetigerhighVotersare7horsesbarrelmuleswouldshookCircuitunpurMiniwhichwantconvenegroomDrugHighfromtigerDrugsheriffwherekingwherebeforeflowerbetterTheresaloonordersTWOhomearmedshamebemaderightkeepgoodCITYmarkscalledwouldNorthStreetkeepscriberevenuecooledmanystrucksheriffnum-beryoungDavisstooparrestsdownofofwhichhavefertileHoardundereditorSmithJohuwouldQuailtigerofVeryrightbeforewouldtinyofweeksWinecalledladlesgoodvfsitFrontDavishomesaloonwoodswhombelievabovecalleddaysyoungHouseratherPressmendCableLucygoodWellsinwouldhandsguestbarreldutiesttuilosfoundmanyountyNorthFamehomoknowsHonorpushpalerriageyoungquailtheygoodwhichonlymuchTheIrhomeWillsDavistunIcswouldwlf9staybionicblindStorewewholeSouthvilleskingFKlcrhouseaboutCourtrghtmanyPinedblamethirstbridehoufewrongOtherblindinintheyLAWwheelwhilemakehomeJohncalledDoc-torofStoreSeptblinddownmadegreatandHotelHoardlightheadsotherviolatcrimeheardglossshakewhenpinttheydutyobeytheywhilekeptin110-3JpintstoresgreatleavepowerhomeletteraboutmirthheardvotedhomeotherWellstheregreetwomendutyJohntakengladJulySellgoodguestpaidheardhomeheadsheardchMtierfulstockordercheerTlsjnvoterSwanttheyCourtleechkingtheyCitymaketakenorganlivedwhenlavedeffortwhenothersinceareblindmadeMorryblindofficeDonereachTHEliftedstopsdowndowncoulddrovepextkeepeveryhomesIckeffectaavet1couldCoastthosedownweekEachFromshortwmaderingTHEtrashpaidpickmindbloodblademadesisterNewsmakeworktinyaboutfountshowhavecourseTellsotherlongonlysincetherefountofficethreeheadfromalivegladsee-thePondcityOwenofficesinceNextlittleSstocktouchdownmodiwithhaveyearsdoutboasttheirrlrr1ifhavelikesfromeveryvrongroomssa-loonOFeasedcitycoulddontWillsnavalcarrycitythemmadefactCobbatheyPrehithereworkleaveringailievetAnyfromamieverytheirthickhtoroothertimesforceofficeDukethosopityjaUcitybondtrashwithaatheytheytheyamostyearshomeof-hiswantsLuluNextcitytoaliveriverafterVorkwentcityvotersthemfevermineShelltheirweekarmyHaveSTARmademakegamegameandheartwaterDonetastesDyecityfromsuchThatweekclearboastacityfrontfromfrontbondfilledWashandaftertheretaxesarmygameFourand-retheyandbeencityshorttradeawlnrandbeenEottEthenbuyhavethemtherepressruledoftendayfrombackMissLutetimidfromhavetheirdonecitytheretottercitypichedhavewithWestCookdrymeatswithbeenwithwithDidthemtcitycityhaveWeltfamefinedfortelittlefromtraintripsorrygamecourtacitytheyyoucitythanbeentroutruckyouthatwastebrimbriefbeenskillothergamewithisaearththemfloodHairfactfromlocaltowhatfor-ItwithLinethanhereSinpastbeencitythemuponworkwithMisswithsodasweethavehavesoulsbtoredeadbeenwinewithhaveHairispaletablehavecostsfindsThatlcptcourtcityjneetcityfilledonaandInnbuymanspasttheirsoulsdonetownwhatbothandcitykindhardfrombeenIluebeentheirhavehavemaltfromwineforbarrelvisitcityvisitmayTOparttablehemweeknamesvisitwhothembeenthanodorSamColeNewdoesbugfromFredtowntowerehavtiwineuipstlocalthntiofatcityStarThatcraftyourmostwentcitybugpaidtoeachMkstitanwithwentOncemosteachrevelhavefromlocalsiblegrowhavebeenfightcityIwthavehoursuchvied9JpasttoKnstwhoveryrendcityNealsendontownbeenhavewithmustjailhalfdiedthanHQIIcityvisitwhohereSalemeetskyjailjailSaidwantcrowntobrimdrytalesbackhavehaveDowyourtowndaypoltthatRevloudifwhowithThewithnlsowentProantigavandthatmostSaidbeenwithwhowithhavehavecitytastebesttownthefourwithwhothatwhovlblt13thloadhairtohaveeachTheworkcitywenthavebeenHUverycitycoonsCOsuchyourmostheldsaidthatthatnextStarSaUlOneloadwhoStartoldswornableleftbothStarThetramheretalespureingdrycomecuresbeenverynameyearpintthisForfrailliarbirdthatThewellthutsideTheStarTheThethattraIn8saMtheAndSamStarJortaysandmiltwillwillheldthusanewmoreInglawsdrylawsIcyhimwillsaidtinswellsideRevthlllhimwhobestmorehowwhoCnllwhoableironwhoantiForandnndbluenndevilmansnevercomeeachthatPutThewhothatandtoldthisOnesalesaleMrsMrsArewillsafethethatQfficthatThatsidebestthntAntiAndlawssaysStarlikeJustthistitlesonicandthislawssaysfewcostsnamewellAndMmandrichsaidandsaleandwillandhimthisletstalksentthatwhohosttrialwhoTheThethatThefirmthinthatputRetJoesaleandAndFhuandcauseForIteasasTheTImeorandandandCanwillnullandaridsaleandaudhimTheTheImlrIveYouandthisandandmansowelldencomesaidandwillgetthelugsssayswilllastbillanniesameclInicFellTheMrssaleNoAndMrsherandandandthiswillnndthisantiwillwillandthisandnndnndwillandfactTheTheantIandaudsuithadthisandandwillstillthatTheandantiOldandsitefewcausemenuwantlugandGenthemetandTheandandandandhindandnndandrentandIveAndMrsandhadandandhadandandandthisandamidandthisantihadamiandForleftthatMrsStarandconicmorolastsentlimuandthisandthisandmidCallnextandandantiTheMrsandandsalesonicsonicandIveTJjandandthisyouaudandandandandhisandfoolhutnudcnUthisIvetornthatantithelawcentbestabutcoonlawfewtliesnoredidandtautandrrvirtandandandanyandandnndgetandGetMrsandlawthisaidnolcauseanyaridcallrindandaudaudwillandandandwaytrueandletsgotleftwereineye-IandandandandandandwilltheIveyouthisFarflueAirsheandandfewandandantiandandnndyounndandvastRevRevandOctantiandfew4a23dweretileAThasssthethecameweressforwerewereIveMrstoldandlawandwillmilllintlateandandandwillandandandagohadgotthethethethetalkfewtheMrsantiandhadandcallmenhaslisadenWeSeeonesmarIststheherwereseemwerehadtwoyouThethisandIllsfdenlastHissametwocostsomefreeTheantiwilllawhashemontherim1mssomeliewerewereyouanythetheIllsnottinshistheColbuthaslawCartitanyetfewtherimtimethetheupbuttheWebuthastheherthesstorstwolastforandforthe23dWetuoonceweremetlawweresoontnnfTnowSeelawlawthelisathethethethethethefallhotthethethemythethethethethetheAirthe1stOurForlawtheontlistwereyou1111tealawhasthelefthasthebutthenownicetemhissstheyouhasthebutthe407thethethethetinsthomanseenthetilltheAllthethethefallthethetimetheMrthethetimelistthetheoldthetimeforssssss25agoUifWeWehishisthethethethethethethebutthethethethethetheoldthethethethethemythetheWethebutthethebutthehasthethethetheevereverwereEnowthetheoldthewetCallHesipbcego104thetherimtlonbutbutthehasthefornowthethethetimebutthethetheaoverthetheIliaforthethesadtimethethethethenowtheallOctpirhisaiditslediJnMrimtherailtheevermenmenmenmenthethethetellbutnotthethethethethethethethethethebyviaforMrthethethethethemyATthetheforthetheredthethethetellthethetellthetimethewanmenhishislilahisforfurOrsparthetheFlathewerethethetheffinthetheourGathethethethetilefortheMrMrtheforcasenowforilotheMrMrAllformanbybythenewlawfornotnotbybyinItthetoothehisforNooffforthethethethetellthethethethethethethewasforthethesumhisliltforhistheIbytaxbybyoneforfor6ththehisMrflyforforlilaforthemannowmenDrthetheMrtheforfornotnotlilaforhisforthenowtwo22onetilltheonewastelltimeMrfurlorbybytheismennewGabynotfurforthetheforDrthefortheMrtlIeMrofffrnotup-InottanMrwasforforMretcwasupwaswasforlidwasupoutnrnionelieOnGnfillcatbywaswaswasareOfforforforforElwasheourMrwaswaswasmourtetcanshietcCoofwonDrL-JgodecatwashewasbyuponewasonepfbeOnnilwascanDrwaswasonecnnourctsToourofhecbSLonehehearearegoOfupcanallallourPunallwasofitrycarDrDrourlanrhehehehehoAscanitsallsawdoourheupdogoonewasgoDrgoWiioneJrteofheheWheupheupdoseehogogotetJgoofofbeactofbeWhebeOrbebehebeareseehehebeheofWsitmeIarciofofseeofofofofofbeheinsotofUbeStWanyofbeJlcanareOtallnueWmihe14doarecarareincarearcoftillofofofofofofofofInWKbeWWbeWbeWammeamidbeVVnlinofofofofFtofofofofofofofareofWofofofofRofbeofbeofbedeInbetohetoWersareInofofofofofofofofofofoftoiuaaofofStofofofofofofofofdsofofofofofinatInofofofAAofofInnfinofinofWIai-fst-ItofofofofiuofIninofininStIfInoftoinMofofofofinInintphiofofofofofofofItof15toierIniuin35iuJIarefseaareoilInofIKSweofCareMinInhIEtoinofofinininofofofofHWoftoofofofofofofofofntininInininIIIinInininWMoforInofinofInofaretonsersonweweinanurofofinoftointoIIItoattoatininininin+of+toinattototoisItofInononsonisonIstoininIIinItattoweattotototoatMtontatatatntinininIIIonK+tototoatonon+toonanonnoattotoSifItss++anissonweanatatInoilananonanF11totoiutototoattoattoattototoIftoattooftototoKtototototototototontattotoIstoenisItIsJt++toattotoisorononsLsononHonan25totoatattotototoAittotototototoIftotototoattoonanistoattotoonisGItonanonan+++ansisisSnoasitIsItIItoto+ItTNG+Utototo+toGisA++IsItistfis++totoalisIsItIstfIsis+s+isYitLofanLororIIKattoIITA+asorto0sjisItItDRonanisEisA++++s++++itisifIsitisusorLLVasitis+orAIsn+orCsoas+sis+isisIiLitLLasasfJasItatItCCIsoasororititCLCaslititasasvsIIJassoasasIGSdAPnjCCC1Idml+VKiasasPIasmitasasasasJAisCitAASDPIIBreSJJtonIIJJJItAlJyJIItoJJJJDftiJJPjItJaf1IIsaaJd>antInFaaannnIIIaIjnoaaaaaoaIaIIafTaaaaaaaaaaaaanan4IIaJaaaaaanHaaaaaaIaaa4arlaIteIILI>uaih>ILjiiIfJIq44