Citation
The news-leader

Material Information

Title:
The news-leader
Uniform Title:
News-leader (Fernandina Beach, Fla.)
Portion of title:
News leader
Place of Publication:
Fernandina Beach, FL
Publisher:
Fernandina Beach News-Leader, Foy R. Maloy Jr. - Publisher
Creation Date:
January 4, 2005
Publication Date:
Frequency:
Weekly
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Fernandina Beach (Fla.) ( lcsh )
Newspapers -- Nassau County (Fla.) ( lcsh )
Genre:
newspaper ( sobekcm )
newspaper ( marcgt )
Spatial Coverage:
United States -- Florida -- Nassau -- Fernandina Beach
Coordinates:
30.669906 x -81.461028

Notes

Additional Physical Form:
Also available on microfilm from the University of Florida.
Dates or Sequential Designation:
Vol. 124, no. 9 (Feb. 27, 1980)-

Record Information

Source Institution:
University of Florida
Rights Management:
Copyright The News Leader. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
000366799 ( ALEPH )
04377055 ( OCLC )
ACA5658 ( NOTIS )
sn 78002171 ( LCCN )
0163-4011 ( ISSN )

Related Items

Preceded by:
Fernandina Beach news-leader

UFDC Membership

Aggregations:
Florida Digital Newspaper Library

Downloads

This item is only available as the following downloads:


Full Text

PAGE 1

rfnt rfn b rffntbtrrbrrrffrrf A string of violent encounters among Fernandina Beach middle and senior high students both on and off campus left many fearing for their safety.April 28, 1993 rfnntbn rn rntntntrrr 2017 Nassau County Delinquent Real Estate TaxesHonorable John M. Drew, Tax Collector WEDNESDAY, MAY 2, 9, 16, 2018 Supplement to the News-Leader In accordance with Florida Statute 197.402, the list of unpaid properties is advertised three times. Accounts listed within this publication were unpaid as of April 19, 2018. Please note that some of the listed properties have subsequently been paid. Florida law requires the delinquent list to be organized by account number, not by alphabetical order. ntn fnntr Where to go when you need to know Coastal Georgia Wellness Center and Family Medicine Age Healthier and Live Happier CERTIFIED PRACTITIONER Dr. Susan L. Fricke, MSN, FNP, BC2400-C St. Marys Road | St. Marys, Ga. 31558 Monday Thursday 9 am 5 pm | Friday 9 am 2 pm912-576-7546susanfrickewellnessandfamilymedicine.com** NOW ACCEPTING NEW PATIENTS ** JULIA ROBERTS/NEWS-LEADERA man tosses a computer in a dumpster on Saturday, April 28, at the annual city of Fernandina Beach Recycling Event. Fernandina Beachs Fleet and Facilities Maintenance Director Jeremiah Glisson said the citys 11th annual recycling event, held April 28, was the most successful ever. He estimated that 1,100 vehicles disposed of approximately 40 cubic yards of electronics, two tons of tires, and 100 cubic yards of hazardous materials and that 10 tons of paper were shredded and recycled. In addition to receiving recyclable items, the event also collected food for Barnabas Center, the local nonprofit that helps families in crisis. Glisson said 2,000 pounds of non-perishable food was collected. Nassau County Sheriff Bill Leeper asked the Nassau County School Board at its April 26 meeting whether it will pay for more law enforcement officers in the schools, and got a positive if cautious response from Nassau County Schools Superintendent Dr. Kathy Burns, who pointed to money provided to Nassau County by the legislature. Adding more school safety personnel was mandated by legislation passed in the wake of the February mass school shooting in Parkland, Fla. Leeper told Burns that he was looking for guidance on hiring officers to be trained as school resource officers. He said the Nassau County Sheriffs Office budget does not have any funds to pay for those officers. I dont know if you have discussed it yet and come to some conclusion, Leeper said. We need to know, because the money we would need is not in our budget. We cant move forward until it is. We cant hire somebody if we dont have the money. We are just trying to get some kind of direction of which way you want to go. Burns said that it is the districts plan to move forward with school resource officers. We have to have a district safety specialist, so we are working to get that in place as well, Burns said at the April 26 meeting. We know the county doesnt have the money to fund those additional officers. Were working with our budget as well, figuring out how we are going to do this. Burns said the district currently has seven SROs, one in each middle and high school. She said county schools need at least nine additional officers. Asked how the district will fund those additional officers, Burns said, We received $500,000 safe schools funding in this years legislative budget. Burns said she attended a meeting with other superintendents, and that the superintendents agreed that some of the language in the new law is confusing, and gave one example of that. We are asking for some clarification on part of the language on that bill, Burns said. It says every educational facility. That doesnt only mean schools in Nassau County, so were looking at trying to get some of those things cleared up and narrowed down. Leeper said that SROs require special training that goes beyond traditional training for deputies. If we hired them today, they would not be ready by next school year because it takes at least 16 weeks to train them, the sheriff said. If they are not ready, we would have to supplement that with overtime dollars, which is an additional expense. They would be certified deputies, like we have now. We have five we provide for the high schools and the middle schools. If we had to provide them into the elementary schools, we have to have additional personnel. Fernandina Beach Police Chief James Hurley said his department currently supplies schools in the city with two officers, one at Fernandina Beach High and one at Fernandina Beach Middle School. The School Board funds 75 percent of those salaries. Hurley said his department is asking the city to fund two additional officers for Emma Love Hardee Elementary School and Southside Elementary School because of the legislative mandate. In other business, the School Board: Recognized the Fernandina Beach High School girls basketball team, which won district and regional championships and made it to the final four in the state playoffs; and Honored Yulee High School student Jaya Riley, who was recently awarded a $10,000 Horatio Alger Scholarship.ttt Leeper Burns U.S. District Judge Marcia Morales Howard sentenced Vincent J. Jones Jr., 47, of Fernandina Beach, to eight years and four months in federal prison on Monday for distributing cocaine. Jones pleaded guilty on Jan. 23, according to a news release from the U.S. Attorneys Office for the Middle District of Florida. According to court documents, Jones sold cocaine to a confidential informant on three separate occasions in 2017. When law enforcement officers witnessed him driving and attempted to arrest him pursuant to a warrant, he refused to pull over. The officers witnessed him throw a bag of crack cocaine out of the window before he eventually stopped his car. At the time of this incident, Jones had 10 prior felony drug convictions. According to Jones plea agreement, a confidential informant (CI) recorded Jones on Sept. 21 and Oct. 6, and the recordings show the defendant with the drugs and purchase money in hand. On the September 21 recording, the CI and defendant can be heard discussing the price of cocaine and the need to be careful because, in the defendants view, some of the people that the CI was dealing with were shady. On the October 6 recording, the CI and the defendant joked about which of them was more wellknown by the police. The case was investigated by the Nassau County Sheriffs Office and the FBI. It was prosecuted by Assistant United States Attorney Michael J. Coolican.rf nttb fThe Surfs Up Caf will be ready in time for a big day on Friday, the start of 55th annual Isle of Eight Flags Shrimp Festival. The first completed part of the major renovation to the popular Surf Restaurant & Bar, the caf at 3199 S. Fletcher Ave. will hold a re-opening celebration on Friday, according to general manager Joey Ledet, and will be open from 7 a.m. to 10 p.m. daily thereafter to serve visitors and locals. The caf will serve breakfast 7:3011 a.m. in about three weeks, Ledet said, but on Friday it will start offering a menu of organic coffee, healthy smoothies and smoothie bowls, milkshakes, and sandwiches and salads to go, as well as 20 flavors of Leopolds ice cream from Savannah, Ga. Leopolds has made a special flavor ice cream for Surfs Up called Wipe Out, Ledet said. The Surf closed in January for the renovations, which included turning the inside part of the restaurant into an ice cream parlor motif, doubling the size of the former outside dining and bar area, and making everything more family-oriented. The totally renovated and enlarged outside dining and bar deck area most of which now will be covered for the convenience of the lunch, dinner and late-night crowd is expected to open in late May or early June, according to Ledet. Tom Swinson, president of ArcRite Construction, 5174 First Coast Highway, is the general contractor for the renovation project. The caf has seating indoors for 66 at tables that were all handmade, including a special surfboard table that was handcrafted by Clint Hobby of Hobbys Painting out of Brunswick. There is also a small game arcade area with a few popular machines. Ledet said that, ever since Thomas and Patti Flannery took over ownership of the restaurant in November of 2016, There have been plans for tnnntttSURF Continued on 3A JOHN SCHAFFNER/FOR THE NEWS-LEADERThe first part of the major renovation to the popular Surf Restaurant & Bar, the Surfs Up Caf at 3199 S. Fletcher Ave. will hold its re-opening celebration on Friday, according to general manager Joey Ledet. NL 6 col. Wed 05.02.indd 1 5/1/18 4:17 PM

PAGE 2

Barbara Ann (Sharkey) Tomes Bohannon passed away gently of natural causes at her home surrounded by friends and loved ones on Wednesday, April 25, 2018. She was known by all to be a most kind and generous person, and many of her childrens friends became her adopted sons and daughters. Barbara conquered the adversities in her life with courage, strength, and integrity. Barbara was born in Brooklyn, N.Y. on August 3, 1932. She was adopted by Henry and Florence Sharkey of Manhasset, Long Island, N.Y., where Barbara lived until she graduated from Manhasset High School. She attended Lynchburg College for two years before marrying William (Bill) Lee Tomes, after which the two of them moved to Manhasset. After Bill secured a job working in Jacksonville, Fla. (and Barbara having two boys, Billy and Mark), they moved there, where a third son, Dallas, was born. Bill passed away not long after, and Barbara and the boys moved to Fernandina Beach, Fla., where Barbara raised her boys and loved work ing at the original glass-walled teepee Welcome Center at the Fernandina Harbor Marina, where she handed out orange juice to locals and visitors alike. Barbara later married Stanley Bohannon of Fernandina Beach, and the family moved to Orlando, Fla., and, later, Merritt Island, Fla., where Stan worked as a crane operator assembling the Saturn V rockets and worked every Apollo mission. Barbara worked for a private contractor at Cape Canaveral as a secretary. Another son, Michael Bohannon, was born in Orlando but died one year later of pneumonia. A daughter, Patricia Bohannon, was born in Orlando that next year. A few years later, Barbara moved the four chil dren back to Fernandina Beach. She raised her children and worked as an administrative assistant in the Fernandina Beach city government in various departments, including the city managers office and in public works. After the boys graduated from high school, Barbara and her daughter, Patricia, moved to Manhasset for three years to assist her mother, Florence Sharkey, in her move down to Florida. They returned to Fernandina Beach, where Barbara worked as a teacher of developmentally disabled adults. To stay close, Barbaras mother moved to Jacksonville, where she lived alone until the age of 100 before eventually moving to Quality Health Care in Fernandina Beach, where she passed away at the age of 106. At that time, Barbara was the office manager in her daughters interior design firm for eight years, from which she retired in 2004. Barbara spent her retirement years enjoying being with family and friends, traveling, and caring for her dogs. She especially enjoyed having her daughter move back in to care for her in the years before her passing. They loved watching NASCAR together, a firm tradition every weekend there was a race, without fail. Barbaras favorite drivers were Mark Martin, then Carl Edwards, and finally Joey Logano, who won the Talladega race on Sunday, April 29, 2018, perhaps in Barbaras honor. Patricia considered it an honor and a blessing to get such quality time with her best friend and Mom and will treasure these years forever. The family is so grate ful for Patricia Bohannon for her excellent care of Mom, allowing her to leave her aching and tired body so peacefully at home as she wished. Barbara is preceded in death by her parents; her two husbands; three of her sons, Michael, Billy, and Dallas; and one grandson, Caley Tomes. Surviving are her two children, Mark Tomes and Patricia Bohannon; six grandchildren; eight great-grandchildren; and her faithful four-legged companion, Smoke. A funeral service and Celebration of Life recep tion will be held at 11 a.m. Saturday, June 23, 2018 at St. Peters Episcopal Church in Fernandina Beach, where all family, friends, and neighbors are invited to share together our love for Barbara. In lieu of flowers, the family asks that you make a donation to one of Barbaras favorite charities, the Nassau Humane Society.rMarie Cashel Grant passed away peacefully on April 28, 2018 at Community Hospice & Palliative Cares Warner Center for Caring in Fernandina Beach, Fla. Born on September 24, 1922, she lived a full and eventful life and will be missed by all who knew her. Her surviving family includes four children, eight grandchildren and six great-grandchildren. A memorial service at the Amelia Plantation Chapel will be held at a later date.fnrtbbDwight O. Kamback Jr., 74, of Fernandina Beach, Fla., passed away Wednesday, April 25, 2018 in Jacksonville, Fla. Born in Colorado Springs, Colo., he was a son of the late Dwight O. and Miriam Fullbright Kamback. Growing up in Muncie, Ind., among other activi ties he was a Boy Scout and achieved the rank of Eagle Scout. He held degrees from Ball State University, Purdue University and the University of Northern Colorado and spent his entire work ing career teaching biology and chemistry at the college level. He married the former Linda Miller in Pennsylvania in 1978. He was a devoted and loving husband, father, brother, son and uncle. He dearly loved attending all of his childrens activities. In addition to his childrens varied activities, he loved the outdoors. He was a member of First United Methodist Church in Lake City, Fla., where, among other ministries, he was a member of the choir. After retirement, he and Linda moved to their beloved Fernandina Beach. He is survived by his wife, Linda Kamback; a daughter, Katherine; two sons, Peter and Charles; a sister, Jeanne of Ohio; and a brother, Joe of Indiana; as well as nieces, nephews and other extended family members. There are no immediate services planned. He will be laid to rest at Bosque Bello Cemetery later in the early summer. Those desiring may make dona tions to Alzheimers Association, 4237 Salisbury Road, No. 406, Jacksonville, FL 32216, or the Nassau County Council on Aging, 1367 S. 18th St., Fernandina Beach, FL 32034, in his memory. Please share your memories and condolences at www.oxleyheard.com.rfrMrs. Beverly Ann Wood Norton of Fernandina Beach, Fla. went to be with God on Saturday, April 28, 2018 after a brief illness. Beverly was the eldest of three children born to Ralph and Mary Evelyn Wood. She was born June 21, 1940 in Jesup, Ga. She grew up in Fernandina Beach, where she graduated from Fernandina Beach High School, Class of 1957. She continued her education at Stetson University and St. Lukes Hospital School of Nursing and graduated with a degree in nursing. Beverly worked as a registered nurse in Jacksonville for many years at St Lukes and Wolfson Childrens hospitals, all the while continuing her education. She earned a bachelors degree in nursing and a masters degree in allied health from the University of North Florida. Beverly was a long-time parishioner, lector and member of the Altar Guild of St. Peters Episcopal Church in Fernandina Beach. In addition to her parents, she was preceded in death by her husband of 55 years, Jerry Norton. Beverly is survived by her sister, Gail Crim; her brother, Ralph Chip Wood and his wife, Margaret Ann; and by her four sons, Richard Norton and his wife, Tammy, Greg Norton and his wife, Sheila, Randy Norton and his wife, Valerie, and Jeff Norton and his wife, Megan. Also surviving her are six grandchildren, Elizabeth, Shawn, Sarah, Kyle, Maia, and Marissa, as well as three great-grandchildren, Natasha, Robin, and Victoria. She leaves behind four nephews as well, Jerry Sapp II, David Imbs, Curtis Lentjes, and Jeremy Wood, and one beloved niece, Dana Whitekus. Beverly Ann will be missed by her family, friends, her church family, and her bridge club. A memorial service will be held at 10:30 a.m. Wednesday, May 2, 2018 at St. Peters Episcopal Church in Fernandina Beach with the Reverend Stephen Mazingo officiating. A reception will follow the service in the churchs Burns Hall. Beverly will be laid to rest in St. Peters Cemetery. In lieu of flowers, memorial contributions can be made in her name to the Youth Program at St. Peters Episcopal Church, 801 Atlantic Blvd., Fernandina Beach, FL 32034. Please share your memories and condolences at www.oxleyheard.com.rfrbRobert E. Bob Powell, 79, of Fernandina Beach, Fla., passed away at Community Hospice & Palliative Cares Warner Center for Caring in Fernandina Beach, Fla. on Thursday, April 26, 2018, surrounded by his family. He was born in Monticello, Ga. on October 3, 1938 and attended Middle Georgia College and Oglethorpe University. On June 12, 1960, he married Billy Jean Browning of Hazlehurst, Ga. Bobs long and distinguished career in agribusiness, notably with Central Soya Company, Super Sweet Feeds, Poultry Health Services, and Ivesco, moved him and his family all over the South and Midwest, where they made many lifelong friends. Bob loved the beach, and his lifelong dream was realized during the last 21 years by living in Fernandina Beach on the ocean. He also loved to cruise and travel with family and friends and visited six of the seven continents. He selflessly volunteered for his church and numerous organi zations throughout his life. Bob loved to tell his grandchildren, Leave more than you take. Bob was a warm, happy, joking, and loving person to all who knew him. Bob was preceded in death by his parents, Emmett and Emmie Louise Powell, as well as his only daughter, Christa Powell Walley. He is survived by his wife, Billy Browning Powell; son, Robert (Alice) Powell Jr.; son-inlaw, James (Kathy) Walley; grandchildren, Gary Walley, Matthew Walley, Brittney (Dexter) Powell Freeman, and Robert Powell III; and three greatgrandchildren. Equally important to him were his many friends who touched his life and became like family. A memorial service will be held at 11:30 a.m. Friday, May 4, 2018 at the Memorial United Methodist Church in Fernandina Beach. The family requests donations may be made in his memory to Memorial UMC or the Barnabas Center. Please share your memories and condolences at www.oxleyheard .com.rfrrbHilton Curtis Wilder Sr., 71, of Fernandina Beach, Fla., passed away at his home Saturday, April 28, 2018 after a lengthy illness. A Fernandina Beach native, he lived his entire life here. He was a son of the late Arren O. Wilder and Agnes Cook Wilder. Growing up in a large family, he learned to fish and mechan ic. His skill as a fisherman was well known. He loved to fish and is remembered as a Great Fisherman. He was an expert mechanic and could fix anything with a motor, whether it was a car, a truck, a lawn mower or a boat. Over the course of a 53-year marriage with his wife, NethaDean King Wilder, the couple would raise a daughter and two sons and see their fam ily grow to include four grandchildren and four great-grandchildren with a fifth great-grandchild expected soon. Mere words cannot describe how much he loved his family and how much he was loved by them. Curtis quick wit and sense of humor insured there was never a dull moment. His family lovingly recalled you never knew what to expect from him. Because of his sense of humor and his ability to shoot the bull with the best of them, he always had a surprise waiting that was guaranteed to provide laughter and entertainment. In addition to his father, he was predeceased by two brothers, Little Arren Wilder and Delton Albert Wilder. Curtis is survived by his wife, NethaDean; a daughter, Sandee Dean Wilder, and two sons, Hilton Curtis (Kimberly) Wilder Jr. and Waylon Clayton Wilder, all of Fernandina Beach; his moth er, Agnes Wilder of Fernandina Beach; two sisters, Shirley (Bill) Rutherford of Morganton, N.C. and Ann (Hal) Parker of Fernandina Beach; four grand children, Jenna Johnson, Wesley Wilder, Isaac Irvin and Preston Wilder; and four great-grandchildren, Jadyn Young, Alyssa Smith, Ella Smith and Arya Smith; as well as several nieces, nephews, cousins and other extended family members and friends. His family received friends at Oxley Heard Funeral Directors from 5 to 7 p.m. Tuesday, May 1, 2018. Funeral services will be held at 11 a.m. Wednesday, May 2, 2018 in the Burgess Chapel of Oxley-Heard Funeral Directors. His longtime friend, Gerald McKendree, will officiate. He will be laid to rest at Wilder Cemetery. Please share your memories and condolences and www.oxleyheard.com.rfLawrence Brown, 68, of Fernandina Beach, Fla., passed away Sunday, April 29, 2018. Arrangements to be announced.rfJames Murphy, 90, of Fernandina Beach, Fla., passed away Tuesday May 1, 2018 at Community Hospice & Palliative Cares Warner Center for Caring in Fernandina Beach, Fla. Arrangements to be announcedrf NEWS DEADLINES Community News: Wednesday, Noon Letters to the editor: Monday, 5 p.m., Wednesday, 5 p.m. Church Notes: Tuesday, 5 p.m. People and Places: Wednesday, 3 p.m. AD DEADLINES . .................. WEDNESDAY EDITION . ........ FRIDAY EDITION Classified Ads: .................. Monday, 5:00 p.m.* . ................ Wednesday, 5:00 p.m. Classified Display: ............ Friday, 3 p.m. . ......................... Tuesday, 5 p.m. Legal Notices: . ................... Friday, noon . ........................... N/A Retail Advertising: . ............ Friday, 3 p.m. . ......................... Tuesday, 3 p.m. Monday holidays the Classified deadline will be Friday at 5 p.m. MAIL SUBSCRIPTION RATES In Nassau County: $41.99 Out of Nassau County: $71.99rr r bnrftbrb rnrnThe News-Leader is published every Wednesday and Friday by The Fernandina Beach News-Leader, 511 Ash Street, P.O. Box 16766, Fernandina Beach, FL 32034. Periodicals postage paid at Fernandina Beach, Fla. (USPS 189-900) ISSN# 0163-4011. Reproductions of the contents of this publication in whole or in part without written permission from the publisher are prohibited. POSTMASTER: Send address changes to: News-Leader, P.O. Box 16766, Fernandina Beach, FL 32035. The News-Leader may only be sold by persons or businesses authorized by the publisher or circulation director. NOTICE TO ADVERTISERS: The News-Leader assumes no financial responsibility for typographi cal errors in advertising. When notified promptly, the part of the advertisement in which the typographical error appears will be reprinted. All advertising is subject to the approval of the publisher. The News-Leader reserves the right to correctly classify, edit or delete any objectionable wording or reject the advertisement in its entirety at any time prior to scheduled publication if it is determined that the advertisement or any part thereof is contrary to the general standard of advertising acceptance. B&B Monuments Donna Byrd (904) 277-2742 474418 S.R. 200 State Licensed Monument Cleaning, Raising, Engraving and Bronze Renishing 904-261-8783 MEMORIALS rffntbfftfThe Fernandina Beach Branch Library will observe the fol lowing operating hours during the Shrimp Festival: Thursday, May 3, 10 a.m. to 6 p.m. Friday, May 4, closed Saturday, May 5, closed The library branches in Bryceville, Callahan, Hilliard and Yulee will observe their regular operating hours. For more infor tbffbfnbbfnNoted author Bren McClain will be at Story and Song Bookstore Bistro doing readings and signings of her debut novel, One Good Mama Bone, on Friday, May 4 at 3 p.m. Set in early 1950s rural South Carolina, the story chronicles band and her best friend and neighbor, is thrust into her care. nation of the hard reality of rural Southern poverty. She creates, out of the time and place of the story, a character as authentic have a true artist like Bren McClain come share her passion with Ave, Fernandina Beach. Phone (904) 601-2118. Because of the large number of arts booths and sponsors, there will be a major change in the time for closing the area. Beginning at 1 p.m. Friday, May 4, Centre Street from Eighth Street to Front Street will be closed to all traffic except Shrimp Festival participants. Also closed will be the northern and southern por tions of Second, Third, Fourth, Fifth, Sixth, and Seventh streets between Alachua Street and Ash Street. All vehicles must be removed from the Festival area by 2 p.m. From 2 to 6 p.m., Shrimp Festival participants will be setting up their areas for Saturday and All vehicles and trailers must be removed by 6 p.m. Friday, May 4. With the anticipation of large crowds for the opening night of the Festival, the safety of pedestrians is of utmost importance so only pedestrian traffic will be allowed on Centre Street after 6 p.m. Friday. Thursday, May 3, 6 to 8 p.m. The parade will begin at 6 p.m. South Eighth Street will be closed from Ash Street to Centre Street to allow the parade to cross at these locations. Heavy traffic is expected on South Eighth Street and South 14th Street two hours before the parade and one hour after the parade is over. Sounds on Centre starts after the parade. Centre Street will be closed from Second Street to Front Street until approximately 10 p.m. Friday, May 4, 1 p.m. Centre Street as well as the side streets one block north and south of Centre Street will be closed for Shrimp Festival vendor setup. North and South Eighth Street as well as Atlantic Avenue (A1A) eastbound will remain open. The traffic on South Eighth Street and Atlantic Avenue will remain heavy through the afternoon and evenuntil until about 10 p.m. Saturday, May 5, 9 a.m. to 8 p.m. The S.R. 200/A1A corridor could become extremely heavy at times due to the construction. North Eighth Street at Centre Street will be closed to thru traf fic that morning and throughout the day. Heavy pedestrian traffic will be crossing many of the roadways on South Eighth Street and Atlantic Avenue. Sunday, May 6, 10 a.m. to 6 p.m. The S.R. 200/A1A corridor could become extremely heavy at times. North Eighth Street at Centre Street will be closed to thru traffic that morning and throughout the day. Heavy pedestrian traffic will be crossing many of the road ways on South Eighth Street and Atlantic Avenue until after 6 p.m. Official closing time of the Festival is 5 p.m. North Eighth Street usually opens back up at 6 or 7 p.m. Sunday.bbMany downtown Fernandina Beach businesses will hold sidewalk sales on Thursday and Friday this year. For infor mation on the sales, visit the Fernandina Beach Main Street page on Facebook. tffbbf NL 6 col. Wed 05.02.indd 2 5/1/18 4:44 PM

PAGE 3

although a few items may be added if requested by frequent diners. He said there is still time to work out those details before the second phase of The Surf opens hopefully no later than early June. The same kitchen will service both the breakfast menu for the caf and switch over for the lunch and dinner menus for the restaurant and bar at 11 a.m. Parking for the caf and the remodeled dining and bar deck will still be available along South Fletcher Avenue, beside the caf, along an alley south of the caf, and in a large area behind the motel, which is part of the property. *In order to receive the bonus amount, CD must be funded with funds from a nancial institution other than VyStar Credit Union. Bonus will be credited on the next business day after CD is opened and funded. Early withdrawal penalty applies and bonus amount will be deducted from CD if closed prior to maturity date. Fee incurred could reduce earnings. Limited-time offer. All new accounts are subject to approval. Programs, services, rates, terms and conditions are subject to change at any time without notice. VyStar Credit Union. Move your money to VyStar and get a bonus when you open a CD*. 12 Months 18 Months 36 Months 30 Months 24 Months 48 Months 60 Months $10 $15 $20 $30 $100 $150$5,000 $9,999.99 $10,000 $24,999.99 $25,000 $49,999.99 $50,000 $99,999.99 $100,000+$30 $25 $60 $50 $300 $250 $20$40 $200 $40$80 $400 $50$100 $500 $50 $75 $150 $125 $100 $200 $250 $200 $300 $600 $500 $400 $800 $1,000 Bonus Tablerfrfn rrtbb rbtn br rtb rrbb bbbtbb tbrb bbbrrbr b vystar r VYS 2557 Refinance Your CD Ads(5.25x10.5).v2.MECH.indd 1 4/9/18 11:33 AM 86058 St. Peter Blvd., Dr. Elizabeth Atkinson & Dr. William BauerAmelia Ear, Nose & Throat has moved from Fernandina Beach to its new location at: 904-321-1417 Adult and Pediatric Care Sinus Disorders Allergy Treatment Sinus Surgery Balloon Sinus Dilation Deviated Septum Ear Infections Tinnitus Snoring 277-3942CFC 1426558 FL CFC 057478GA MPR 006661474390 E. S.R. 200 Fernandina Beach, FL 32034 DEERTRACKS WELCOME to our SHRIMP FESTIVAL! Our daughter-in-law Andrea (Dustin) is a Tilliakos and knows the history as her family from Greece built Shrimp Boats. While you are here visit our Welcome Center and Shrimping Museum 235 S. Front Street in Fernandina. Have fun, drive safe. Come by the coffee is on. Dylan McCormick Memorial Scholarship still taking applications Enjoy the festival and let your ONE CALL PLUMBING COMPANY handle your plumbing. Showroom, counter sales, 24/7 emergency service, repair, re-pipe, remodel or new construction for residential, commercial or industrial needs. Call, come by or email daveturnerplumbing@comcast.net. Like us on Facebook! Coming soon a new exciting addition to our neighborhood! Support you local businesses. Stop by for a visit. DEERWALK Momentum achieved earlier this year by the Board of County Commissioners Affordable Housing Advisory Committee has been impeded by the slow approval process of a needs assessment study to be funded jointly by the county and the city of Fernandina Beach. In January the committee recommended that the Shimberg Center for Housing Studies at the University of Florida conduct a housing needs assessment at a cost of $17,500. Early expectations were for the study to be completed by June. In her initial meeting with the committee on April 18, Adrienne Burke, the countys new policy planner in the Planning and Economic Opportunity Department, advised, The first step is to implement an interlocal agreement between the city and county. There was a delay getting that done, but we are now moving forward. The draft agreement has been reviewed by the county attorney and is currently being reviewed by the city attorney and (was) scheduled to be on the agenda for the city on May 1 and the county on May 16. Hopefully, the study will be completed over the summer. She projected results of the study could be available by August. While the AHAC had already proceeded looking into resources for implementation of housing strategies pending results of the needs assessment study, including a recent presentation and proposal from The Florida Housing Coalition, they were advised neither the city nor the county would be ready to look at strategies for solving housing issues until results of the assessment study were available. After the meeting, Taco Pope, director of the Planning and Economic Opportunity Department, told the NewsLeader delays in getting the study approved were related to the complexities of having two governmental bodies and two sets of attorneys involved in the process as well as sorting out the Shimberg contract from the Florida Housing Coalition proposal. The latter will be reviewed later as a separate issue. Burke suggested several activities the committee could pursue in the interim including the establishment of a county housing website to educate the community about housing issues and to establish a forum for community dialogue. Committee members Justin Taylor, who is also a Nassau County commissioner, and Betsie Huben agreed there is still a lot of misinformation out there about what affordable housing means and whether its really an issue locally. Much of the public does not realize that the county has an issue. They perceive that what this group is trying to do is put up governmental subsidized housing out there, said Pope. Committee members reiterated their ideal solution is to find creative ways to blend affordable units inconspicuously throughout the community. Pope shared his departments recently published 2018 Nassau County growth trends report that supports earlier data about the median household income in the county as $59,196 with average single family homes selling for $333,022 and condos selling at $413,022. Affordable housing efforts are focused at bringing housing prices more in line with incomes as computed by 50, 60 or 80 percent of the countys median household income. The full report is available at the countys website. Burke recruited members for a subcommittee to look into the use of accessory dwellings such as guest houses, mother-in-law suites and garage apartments for affordable housing rental options. Currently, this option is prohibited by county ordinance and allowed only for non-renting family members and guests by the city. Member Greg Matovina pointed out that one local developer is already looking at building homes with carriage suites that rfntbt PAMELA BUSHNELL/NEW-LEADERAdrienne Burke has replaced Kristina Brown as policy planner in the countys Planning and Economic Opportunity Department. Burke was most recently the executive director with the Riverside Avondale Historic Preservation Society and previously the Community Development director for the city of Fernandina Beach. Brown left to take a position as Community Development director in High Springs, Fla. could provide additional affordable housing options if regulations were more amenable. A subcommittee was also formed to research incentives being used in other cities and counties for developers to create affordable housing. Kreger advised that a group of local citizens called the Affordable Housing Citizen Coalition spearheaded by Medaro Monzon and Al Pertuz using a model similar to Habitat Nassau is looking at forming a nonprofit to build affordable housing at 60 percent of median income. The group is making a presentation to the Fernandina Beach City Commission on June 5. The next meeting of the AHAC is scheduled for 4 p.m. May 16 at the commission chambers of the James S. Page Governmental Complex in Yulee. Members of AHAC who have been appointed to two-year terms are Lora Britt, Schools Superintendent Kathy Burns, Jenna Emmons, Betsie Huben, Fernandina Beach Vice Mayor Len Kreger, Barbara McDuffie, Greg Mantovina, Laureen Pagel, Mary Pitcher, Lisa Rozier and Nassau County Commissioner Justin Taylor, who serves as chairman.rf changing the place to be more family-oriented and less of a bar atmosphere. As part of those changes, both the caf and dining deck will be designated as no smoking areas, Ledet said, but there is expected to be a designated smoking area somewhere on the property. Ledet told the News-Leader the old 4,000-square-foot dining deck, which was demolished in January, is in the final stages of being replaced by a new 8,000-square-foot deck that will have a total of about 340 seats, including 35 at the new, 32-foot-long bar. The deck will also have a covered stage for live performers. We are not changing the menu, Ledet said in reference to the Surf Restaurant & Bar, Continued from 1A The totally renovated and enlarged outside dining and bar deck area at the Surf most of which will be covered for the convenience of the lunch, dinner and late-night crowd is expected to open in late May or early June.JOHN SCHAFFNER FOR THE NEWS-LEADER NL 6 col. Wed 05.02.indd 3 5/1/18 4:22 PM

PAGE 4

rBeing a licensed mental health counselor in private practice suits Anne Cleary. I love what I do, she told the News-Leader in a recent interview. I get to help others live more fulfilling lives. Such has not always been the case. Her first career after receiving a bachelors degree from Villanova University was in marketing. Although the field afforded her an opportunity to use her people skills, she longed for deeper connections. She sought work to nourish her soul. Originally from upstate New York, Cleary had relocated to Jacksonville by the time she decided to pursue a masters degree in mental health counsel ing at the University of North Florida, bringing considerable life experience to her new studies. According to counselorlicense.com, Mental health counselors help people who have normal cognitive processes cope with difficult life events, for example, physical illness, death of loved ones, and relationship problems or divorce. Others help people manage serious mental ill nesses like bipolar disorder . All states license mental health counselors. In Florida, licens ing falls under the Board of Clinical Social Work, Marriage & Family Therapy, and Mental Health Counseling. Florida law requires a masters degree from an accredited mental health counseling pro gram, two years of post-masters supervision under a LMHC or equivalent, and passage of a national clinical mental health counseling exam. After graduation from the University of North Florida in 2009, Cleary worked at the Womens Center of Jacksonville with victims of sexual assault and abuse until starting her own gen eral practice in 2014. Cleary recently transferred her private psychotherapy prac tice to Fernandina Beach, where she works with clients who are adjusting to all kinds of life transi tions. Special interests are cou ples dealing with infertility and new mothers or mothers-to-be coping with depression. Another area of interest is post-traumatic stress disorder. In January, Cleary gave a pre sentation to a local group of the Veterans Association of America on PTSD. I think its important that victims (of PTSD) recognize theyre not broken, said Cleary, adding that many of the problems PTSD victims, especially veter ans, encounter have to do with societys lack of understanding of what they experienced. She points out that Israeli soldiers have negligible incidence of PTSD because every citizen is required to serve for at least a year in the military, giving the community a better understand ing of what soldiers experience. She empathizes with veterans that the authorization process with the Veterans Administration to get them into counseling can be a frustrating process, but she has had some success helping them through that process. Cleary has also gained insights into military life from her hus bands 20 years of service in the Air National Guard. Cleary lives here with her husband and two children, ages 3 and 1. For more information, visit anneclearycounseling.com or call (904) 599-8320.rffntbfDataUSA says the average age in Fernandina Beach is 53.3 years. The 50-plus age group is a vibrant, engaged, and involved demographic transforming the way we think about older adults and how older adults think of themselves. Resolving to make healthier choices, to keep moving, and to stay well for as long as possible is part of it, and there is a new place helping the over-50 set do just that: Amelia Fit, located at 1401 Julia St., Suite 211, on Amelia Islands south end. Owner Kim Kelly-Speranza is a former advertising professional from Atlanta, Ga., and like many transplants she first vacationed here, visiting her parents often. She began hosting exercise classes at the Property Owners Club on the Amelia Island Plantation and later added Osprey Village to her tour. Kelly-Speranza says she found her purpose when she became a caregiver to an elderly neighbor. Her experiences showed her better ways to care for older individuals. Now she is dedicated to serving the 50-plus demographic and has the degree to prove it, recently graduating from college at the age of 53 with a bachelors degree in advanced allied health. Amelia Fit opened on Jan. 15 and already has amassed a loyal following. The studio offers Jazzercise Lo, a low-impact, highintensity full-body workout, that reduces stress on joints. Kelly-Speranza is also offering Centered on Yoga, with classes that began in February. Hal Mather, a loyal client said, I have lived on the island since 1995. I have been Jazzercising with Kim for about two and a half years first on the Plantation and now at Kims new studio. I am over 82 and credit Kim with helping to keep me young and fit. The programs are attuned for older folks, nothing that a reasonably fit person couldnt do. In April, Amelia Fit joined the SilverSneakers movement. SilverSneakers is a free fitness program provided by dozens of insurance plans. One-in-five people 65 and older is eligible, according to the Medicare website at medicare.com/coverage/silversneakers. SilverSneakers is an exercise program specifically designed for older adults with the goal of keeping you engaged and interested through fun and social activities. Enjoyable fitness activities may encourage older adults to stay healthier in the long run, the website explains. Kelly-Speranza agrees with the philosophy and added that her SilverSneakers program will increase muscle strength and range of movement and improve activities for daily living.rnrtfrfCINDY JACKSON/NEWS-LEADERKim Kelly-Speranza, owner of Amelia Fit, leads a class. Classes currently include Jazzercise LO, Centered on Yoga, and SilverSneakers. Classes average 15-20 participants.f Cleary NL 6 col. Wed 05.02.indd 4 5/1/18 11:18 AM

PAGE 5

TRAVEL IN STYLE! AROUND TOWN OR AROUND THE WORLD We have Apparel, Footwear and Gear for everywhere you go! 904-321-2430www.horizonsameliaisland.comDinner: Tues.-Sat. 5pm-9pm Lunch: Tues.-Sat. 11pm-3pmPark Place 5472 First Coast HighwayLes DeMerle TrioMay 4th and 5th BUY ONE GET ONE50%OFFLUNCH OR DINNERCannot be used with special menu, or events or other discount offers. Expires 5/ 9/18. 18% Gratuity will be added before the discount.Brunch BuffetMAY 13TH 10:30AM-2PMWill be playing the first and fourth weekends of every month. In Loving Memory of my beautiful wife Linda BallardIt has been eight years. We still love you very much and we miss you very much! s Loving husband, Buddy & Chad s rfHumans have been eating oysters since the first person had the courage to open a shell and gobble up the somewhat slimy contents. Since then, that courage, with the addition of a little lemon, has led to a multi-million dollar industry. According to a New York Post article from 2014, cultured oyster sales are substantial $50 million on the East Coast and another $50 million to $60 million on the West and Gulf Coasts. The overall industry totals more than $1 billion, including wholesale and restaurant sales. Floridas oyster industry is based on the eastern oyster (Crassostrea virginica), said Kal Knickerbocker, aquaculture director for the Florida Department of Agriculture and Consumer Services, and 90 percent of Floridas oysters are harvested in Apalachicola Bay in Franklin County. While no one is legally harvesting wild oysters or growing their own in Nassau Countys waters yet, that could change if the water is ever deemed clean enough. Wild oyster harvesting and oyster farming is currently prohibited in Nassau County waters based on tests last conducted about 30 years ago. A map published by the Florida Fish and Wildlife Conservation Commission showing all areas in the state where oyster harvesting is officially open and closed does not reflect any data for Nassau County, instead showing no information available. The same map shows prohibited areas in Duval County around the Talbot Islands. Jill Fleiger, an environmental administrator with the Florida Department of Agriculture, said their last records for testing waters in the county are from the late 1980s. She said thats when the states Department of Natural Resources recommended waters in Nassau County be downgraded, prohibiting the harvest of shellfish due to fecal coliform. They saw elevated levels of fecal coliform in the water samples throughout the harvest area which did not meet the National rfntrrr PHOTOS BY JULIA ROBERTS/NEWS-LEADERAbove, at low tide wild oysters can be seen in Egans Creek, but it may not be safe to eat them and the state prohibits anyone harvesting them to see. Recreational oystering is not allowed in Nassau County because the Florida Department of Agriculture has not classified area waters. Jill Fleiger, an environmental administrator with the Florida Department of Agriculture, said their last records for testing waters in the county are from the late 1980s. At right, oysters are a favorite at local restaurants, but these are not local oysters. The state currently prohibits wild oyster harvesting and oyster farming in the waters of Nassau County, but thats based on tests conducted about 30 years ago.nntnnnbt Shellfish Sanitation Programs; model ordinance criteria for harvest of shellfish, Fleiger wrote in an email to the News-Leader. The elevated FC levels also did not correlate with any environmental factors, so a predictive management plan could not be developed, therefore the area could not be managed properly. She said the lack of classification also prohibits any commercial shellfish operations in the county. The Florida Department of Health makes determinations regarding whether bacteria levels may present a risk to human health, according to Russell Simpson with the Florida Department of Environmental Protection. Knickerbocker said that department, following the FDA requirements spelled out in the National Shellfish Sanitation Programs Guide for the Control of Molluscan Shellfish Guide, determines the open or closed status of shellfish harvesting waters. It is new to northern Florida, he said. It has been a hot topic for two or three years. There are no big commercial operations so far. Nassau County currently has no classified water, meaning it has no near-shore waters that have been tested and deemed safe for aquaculture. The testing is just part of the long process of starting a commercial oyster farm, according to Knickerbocker, and can take up to two years. We build a small model which tells us about bacteria count, and sample it in different conditions when there are events such as rainfall and storms, he said. Knickerbocker added that, if testing proves the water in a certain area is clean enough for farming, the Florida Department OYSTERS Continued on 11A NL 6 col. Wed 05.02.indd 5 5/1/18 4:10 PM

PAGE 6

Sondra Roberts, & more!Bosom Buddies Hobo Traveleon Brahmin Designer Handbags HANDBAGS JEWELRY GIFTS Mon-Sat 10-5 Sun 11:30-4:30 114 Centre Street., Amelia Island PATRICIA NASH SIGNATURE MAP TOTE 3 Delicious Meals a Day Housekeeping, Laundry and Maintenance Services Vibrant Activities Program complemented by many events Transportation for Outings and Medical Appointments Private Suites Offering Several Floor Plans Personalized Service Plans for Each Resident Savannah Grand is an assisted living and memory support community nestled amongst scenic oak trees located just one block from the beach. North American wolf packs can feast on bison or elk and then go two weeks before the next kill. But the wolves bodies and brains still perform at high levels as they hunt for their next meal, researchers say. Humans, too, appear well-adapted to periods of hunger. This is likely a trait evolved from early human hunter-gatherers who, like wolves, alternated between periods of feast and famine. The answer as to how the body manages this, University of Florida researchers said, provides insight into an increasingly popular dieting strategy intermittent fasting. UF Health researchers said in a recent study published in the journal Obesity that emerging findings in scientific literature show intermittent fasting can be a reliable means of weight loss and may optimize physiological functioning, enhance performance and slow the aging and disease process. To understand why, researchers said, one must look to how the body essentially flips a metabolic switch during fasting. This means the body moves from burning glucose, or sugar, for energy to fatty acids and their byproduct, ketones. During fasting, the body converts fat into fatty acids, which can be absorbed by the blood. Stephen Anton, Ph.D., the division chief of clinical research for the UF College of Medicines department of aging and geriatric research and the papers lead author, said research indicates ketones are the preferred fuel for the brain and body during periods of fasting and extended exercise. Ketones, he said, are a cleaner source of energy than glucose, protein or carbohydrates, the bodys other sources of energy. That is because ketones produce fewer metabolic disrupters or molecules that can harm cells. This switch can happen after a certain period of time fasting, said Anton, who also is affiliated with the UF Institute on Aging. Its a gradation in which your metabolism over time shifts to use higher and higher amounts of ketones for energy. Typically, he said, after eight to 12 hours of fasting, the levels of ketones in the blood significantly increase. You can watch a video about the effects of fasting on weight loss at youtu.be/c9VO7ZqujCo. Antons paper looked at two popular forms of intermittent fasting. The first is time-restricted feeding, when the dieter eats during discrete windows during the day. For example, they might fast up to 16 hours a day, eating during the other eight hours. And in that window, the dieter isnt restricted to what they eat. Of course, we recommend healthy food, Anton said. The second approach is called alternateday fasting. In the more common model of this Disappointment comes to everyone. As adults we, hopefully, have learned that, while people or activities may sometimes let us down, we can keep such things in perspective and find ways to overcome our dashed hopes. Disappointment is perhaps the most immediate emotion children experience after a perceived failure. Disappointment involves the feelings of thwarted desire, loss, and discouragement when children fail to fulfill their hopes and expectations or those of others. Children are going to feel disappointment when they do not achieve their goals or believe they have let you down. For children, disappointment can come in numerous forms. Even a seemingly minor hurt can often seem like such a complete disaster that the child truly has a difficult time accepting and dealing with it. And, in many cases, such as when a beloved pet dies or a close friend moves away, the hurt can be very real and deep and will not disappear easily. Many parents today try too hard to smooth away lifes rough edges in the hopes of keeping disappointment at bay. Children with no experience solving lifes little setbacks have a much harder time when they are faced with the big ones. Placating your children does not allow them to understand what caused the disappointment and figure out how to not feel disappointed in the future. While responding to childhood disappointments can seem difficult, there are solid reasons to do it in a healthy way. We can make our child feel less sad, avoid more serious emotional issues and, when we respond well, we help open communication that can strengthen the child-parent relationship. How do you begin to respond to a childs disappointment? Listening is step one. Do not minimize or discount the story your child has to tell, even if it seems trivial to you. It is very real to your child, and a response such as thats no big deal or youll forget about it by tomorrow only serves to convince your child that you do not really understand or even care. Offering your children a different perspective on their disappointment I know it feels bad right now, but what can you learn from it? gives them tools they can use to avoid or minimize their disappointment in the future, and to turn the obstacles to their advantage by increasing resilience, motivation, and confidence. You also do not want to hurry in with a pleasant experience or reward to make the hurt go away. This can establish flawed patterns that carry over into adulthood and can present very real future problems. Instead, talk with your child, rather than to him or her. Do not begin an interrogation when something seems wrong but instead tell them in a gentle way that you have noticed they are unhappy and encourage them to tell you what has happened. Do not be judgmental about what is being reported but instead offer sympathy and understanding. Let your child know you empathize because you have suffered your own disappointments. Do not try to top your childs story, but instead listen and sympathize. Just being able to share can do much to minimize the hurt. In some cases, being a good listener may not be enough. If you notice a persistent change in behavior over time, and if your child is refusing to talk about what is wrong, it may be appropriate to seek help from a trained professional counselor. Your childs school counselor is always a good place to start. Janice Clarkson, Ed.D., a Fernandina Beach resident, is a Licensed Mental Health Counselor and Certified Addiction Professional. Readers with confidential questions may e-mail her.rf nfrtfbnYou can watch a video about the effects of fasting on weight loss at youtu.be/ c9VO7ZqujCo.UF HEALTH/ YOUTUBE.COMFASTING Continued on 10Annbtb bn rfnttbb NL 6 col. Wed 05.02.indd 6 5/1/18 3:54 PM

PAGE 7

rfO n Nw ttE brr The News-Leader is published with pride weekly for the people of Nassau County by Community Newspapers, Inc., Athens, Georgia. We believe that strong newspapers build strong communi ties Newspapers get things done! Our primary goal is to publish distinguished and profitable community-oriented newspapers. This mission will be accomplished through the teamwork of professionals dedicated to the truth, integrity, quality and hard work. R P tD r E Ar BO r rr fC p E Rbr D B b Sp E G CD EB R rf P tD r ntbrf DrnN Sm r Tm Cm rf ntnntb tntnnnt nt nf Its getting to be that time of year again, a time that, if you are a city commissioner, you either love or hate budget time. As a former commissioner, Ive worked with fellow commissioners and city managers to put together 24 budgets. Listening to the various commissioners and managers discuss their perceptions of the budgeting process and the final product was always interesting. Some commissioners saw the budget as a guide, a kind of recipe for spending that was changeable and could vary from week to week or month to month. Some saw the budget as sacrosanct, etched in stone, and some saw it as a little bit of both. Accordingly, given those various perceptions which prevailed among the commissions majority, there could be eight, or nine or 10 budget workshops, or there could be one or two. I remember one year, a year in which the majority had indicated a disdain for meeting generally, when there was just one workshop a gathering of department heads, a mostly mute commission and a city manager armed with a slide show that explained how the city was going to spend its money and where they were going to get it. I was the commissions lone dissenter I wanted more meetings, more information, more input. My concerns were tolerated, barely, then buried; groupthink defined. I dont know whats going to be happening this year, but heres a short list of what I hope the commission and the city manager address: 1. The golf course and marina revenue shortfalls. As enterprise funds, city corporations really, each is supposed to bring in sufficient revenue so as to not to require taxpayer subsidies. In that regard both have failed, miserably. If the business plans are flawed, fix the business plans. If revenues are insufficient, find ways to increase them. If expenditures are incompatible with revenue, fix the expenditures. Bottom line: if the commission considers both funds as part of the overall recreation program and theyre not really worried about revenue generation, okay, but tell the people that. If they are worried about revenue and expenditures, then both funds have to be fixed. Doing nothing is no longer an option. 2. Are much talked about projects really going to happen, or not? If they are, then tell the people why theyre necessary and how much theyre going to cost. Example: is the commission really moving forward with the opening of Alachua Street? If so, why, and how much is it going to cost? Ive heard numerous commissioners both current and former express their support for this ridiculous escapade, but Ive never heard a rationale for the opening that makes sense. 3. Another project is Front Street. Ten years ago, the commission met with Front Street property owners and voted unanimously to spend $3 million on Front Street improvements underground utilities, boardwalk, historic lighting and landscaping. Those improvements never happened, and later commissions have struggled, mightily, to come up with a workable waterfront plan. Like always, there appears to be a plan in the works, a plan that requires more consultants, more financial planners and more public meetings, all seeking to gather wait for it public input again. Spoiler alert: Probably nothings going to happen, but if the commissions tired of doing nothing and is bent on including some project with some expenditures as line items in the projected budget, then be upfront with city taxpayers about how much its going to cost and where the money is going to come from. 4. I hope the commission starts talking about how to deal with the massive impacts on infrastructure associated with unrestrained population growth. How do you expand fixed city streets that were designed to handle a maximum population of 8,000 to 10,000 people? I dont know. How do you develop a parking strategy within a fixed land area to handle these new and unthinkable population numbers? I dont know. What do you do about already over-burdened beach accesses and parks? I dont know, but at least all these things should be talked about. My friends say that the city, given all the growth, should be awash in money. Yes, but theyre also awash in promised projects with promised expenditures. Its an old political adage that nobody cares about the budget as long as their trash gets picked up. Well, maybe this year will be different; it should be, especially with all thats been promised. Promises are the parents of expectations and expectations either met or unmet are the parents of successful or unsuccessful re-election bids. Given that, coupled with recent commission turnover, expect something to happen project-wise; the spin and the machinations are going to be fun to watch.Two years ago, on the Sunday of the Shrimp Festival weekend, May 1, 2016, and the Monday afterward, May 2, the Fernandina Beach Police Department responded to two significant reports: an armed robbery and then a murder. Fernandina Beach Police Chief James Hurley and prominent members of the community believe the two incidents are related. Theres a mighty lengthy history through the years involving all these players, Hurley said at the time. Someone acting out of retaliation is the way this is going to play out. Though what you know and what you can prove are sometimes two different things, as one local leader said in reference to the murder, specific names have been mentioned to the police and there has been plenty of talk on the streets, referred to as an open secret, about who killed Johnell Richo. So why has no one been arrested? Here is what the News-Leader knows. John Patrick Wilson, who lived in Knoxville, Tenn., was visiting his mother and stepfather, Robbie and Johnell Richo, during the 2016 Shrimp Festival. According to witnesses, Wilson approached two men, Jerrald Owens and Larry Roberts, as they sat on the porch at 909 S. 12th St. early on Sunday morning, May 1. Wilson reportedly pointed a .22 caliber rifle at them and demanded money. A shot was fired. Roberts struggled with Wilson for control of the rifle and more shots were fired. Roberts was reportedly able to hold Wilson until law enforcement arrived. Roberts was transported to Baptist Nassau on Sunday, and then released. Wilson was first transported to Baptist Medical Center Nassau and then flown to UF Health in Jacksonville, believing he had been shot in the head. Wilson refused to talk with police and was discharged after it was determined his head wound was not caused by a gunshot and was not life-threatening. Larry Roberts was arrested on Sunday evening, May 1, for selling cocaine and spent the next 168 days in Nassau County Jail. On Monday morning, Wilsons stepfather, Johnell Richo, was shot dead at his home at 1123 Gum St. Witnesses said they heard gunshots at 6:38 a.m. and called the police. Wilson was arrested in the middle of the day on Monday, May 2, for the alleged robbery attempt that took place on Sunday. He was initially charged with attempted murder and armed robbery. In December 2017, Wilson pleaded guilty to a lesser charge of possession of a firearm by a convicted felon and was sentenced to five years in Florida State Prison as a result of an agreement with the State Attorneys Office. In October 2017, Roberts pleaded guilty to two charges of sale of cocaine. Two other charges were dropped. Roberts was also sentenced to five years in Florida State Prison. Was Richo shot in retaliation for the Sunday incident, as Hurley believes? If Wilson, a convicted felon, had been arrested sooner and safely in jail on Sunday instead of Monday, would his stepfather still be still alive? From the beginning of the homicide investigation, Hurley has said it has been complicated by limited cooperation, a reluctance of some people to come forward with solid information. Some leaders in the community blame Hurley for not doing enough. Here is what the editorial board of the News-Leader thinks. It is time for the citizens of Fernandina Beach to say enough to open secrets. It is time for those who know more to stand up, speak up, and give the authorities more evidence everything they need to arrest and prosecute the cowardly killer of Johnell Richo. A $3,000 reward through Crime Stoppers is still offered. The We Tip program 1-800-78Crime allows callers to leave anonymous tips. It is time for police and prosecutors to redouble their efforts in the case. It is beyond time for Robbie Richo, Johnells widow, to get the justice she deserves.As another election approaches, two issues normally low in priority need increased attention. One is gun violence. The NRA has previously made it suicidal for candidates to suggest passing ANY laws to reduce gun violence. But the students of Parkland have successfully elevated the issue to its rightful place. We CAN reduce gun violence by passing sensible gun laws without violating the Second Amendment. Climate change is the other issue. We moved to Amelia Island having been told that hurricanes were rare. That is no longer true! Scientists have shown that a warming climate affects the frequency and severity of storms. Yet Governor Scott has buried his head in the sand, and President Trump has withdrawn the U.S. from a climate agreement that the rest of the world supports. Amelia Island is very vulnerable to both sea level rise and severe storms. To improve our future, endorse candidates who represent citizens of Florida, not the NRA, and who recognize that climate change must be addressed. John Findlay Fernandina BeachrfnrtbIt was with shock and profound sadness that I read about the closing of the Nassau County Volunteer Center in the April 25th NewsLeader. Until we both retired two years ago, Gail Shults, the NCVC executive director, and I as administrative assistant worked alongside of thousands of volunteers who gave time, effort, and treasure to improve the lives of the people of Nassau County. Gail Shults gave three decades of her life to the organization, which she helped to build from the ground up. She networked with other nonprofits, businesses, and governmental agencies and devel oped highly successful and worthwhile programs like food drives, school supply drives, holiday gift drives, and volunteer recognition events. She organized the iconic The Taste of Amelia on the island, a hallmark social event for almost three decades. Gail also envisioned the Volunteer Center as a clearinghouse or referral service for potential volunteers to a wide range of other community nonprofits, and she made that vision a reality. Speaking for both Gail and myself, I would like to thank the thousands of people who gave so much to their community as volunteers for the Nassau County Volunteer Center, including the many members of the Board of Directors over the years. The Nassau County Volunteer Center may be closing, but the efforts of those volunteers will forever remain alive in my memory and in that of a grateful community. Kathy Brooks Fernandina BeachnrAs many of you are already aware, April 15 between the hours of 5 and 7 a.m., criminals broke into, robbed and, to cover their tracks, set fire to American Legion Post 9 (home to Boots on the Ground and my second family). The fire was dev astating almost a complete loss. But this will not affect this years Boots on the Ground event on May 12 with the exception of the poker stops at Post 9. Today I ask that you allow me to tell you a little about American Legion Post 9 and its programs. We are the oldest post charter in Jacksonville (established 1919). We are a 100-percent volunteer (no employees) veterans support organization that supports the entire community. Our membership, which I call brothers and sisters, strive on a daily basis to raise charitable funding for our veteran organizations locally and abroad. To help local families in distress, we pro vide thousands of toys for childrens hospitals and childrens charities. We adopt families during holi days to help make their homes a festive time for their children. We support the local schools and ROTCs and local athletic programs. We host (with our partners Flamingo Lake RV Resort and Dicks Wings, and the support of the American Legion Fifth District and the motorcycle community) one of the best motorcycle charity events in Florida, Boots on the Ground, and we provide fellowship and resources for anyone who asks. This is what all American Legions are about, but I personally know that our members have the biggest giving hearts I have ever encountered. This tragedy will only strengthen our resolve to continue forward, to become stronger and provide more assistance to the Jacksonville com munity. To learn more about the sixth annual Boots on the Ground, which travels through Hilliard, visit facebook.com/events/871854636316945/perma link/967256570110084. To donate to the rebuilding of Post 9, visit gofundme.com/american-legion-post-9-jax-fl. Thank you and God bless. Marc Pica Post 9 Editors note: American Legion Edward C. DeSaussure Post 9 is located on New Kings Road in Jacksonville. As of Tuesday they had $10,788 donated toward their $50,000 goal on gofundme.com. rrrtrtrt nt rn rb ED WEXLER-CAGLECARTOONS(DOT)COM Nassau County Commissioners: Danny Leeper, District 1-Fernandina Beach, 261-8029 (h), 430-3868 (cell), email: dleeper@nassaucountyfl.com Steve Kelley, District 2 277-3948 (h), 556-0241 (cell), email: skelley@nassaucountyfl.com Pat Edwards, District 3-Yulee, 335-0260 (cell), email: pedwards@nassaucountyfl.com George V. Spicer, District 4 Hilliard, Bryceville, Boulogne, Kings Ferry, 568-3409 (cell), email: gspicer@nassaucountyfl.com Justin M. Taylor, District 5 -Callahan, West Yulee, 625-5624 (cell), email: jtaylor@nassaucountyfl.com City of Fernandina Beach Commissioners: Mayor: Johnny Miller : 556-3299 (cell), email: jmiller@fbfl.org Vice Mayor: Len Kreger: 432-8389 (home), email: lkreger@fbfl.org Roy G. Smith : 556-0951 (cell), email: rsmith@fbfl.org Phil Chapman : 624-5590 (cell), email: pchapman@fbfl.org Chip Ross: 410-394-0220 (cell) email: cross@fbfl.org NL 6 col. Wed 05.02.indd 7 5/1/18 3:57 PM

PAGE 8

IN THE CI RC UI T COUR T FOR NA SSAU COUN TY FLORIDA PROBAT E DI VISION File No.: 2016CP -311 Division: ______________ IN R E : E ST AT E OF MI NN IE M AE D AM PI ER De ceas ed NO TIC E TO C RE DI TO RS Th e ad mi ni st ra ti on o f th e es ta te o f Mi nn ie M ae D am pi er d ec ea se d, w ho se d at e of de at h wa s July 23, 2016, i s pe ndin g in t he C ir cuit C ou rt fo r Na ss au C ou nt y, F lo ri da Pr ob at e Di vi si on t he a ddr es s of w hi ch is 7 6347 V eter an s Wa y, Y ulee, F lo ri da 32097. Th e name s an d addr es se s of th e pe rs on al r ep re se nt at iv e an d th e pe rs on al r ep re se nt ati ve 's a tt or ney a re s et f or th be lo w. Al l cr edit or s of t he d ec ede nt a nd o t her p er so ns h av in g clai ms o r de ma nd s agains t de cede nt 's e st at e on wh om a c op y of t hi s no ti ce i s re quir ed t o be s er ve d mu st file t he ir c laim s wi th t hi s co ur t ON O R BE FO RE T HE L AT ER O F 3 MO NT HS A FT ER T HE T IM E OF TH E FI RS T PU BL IC AT IO N OF T HI S NO TI CE OR 30 DA YS A FT ER T HE DA TE O F SE RV IC E OF A C OP Y OF T HI S NO TI CE O N TH EM Al l ot he r cr edit or s of t he de cede nt a nd o th er p er so ns ha vi ng c laim s or d em ands agains t de cede nt 's e st at e mu st f ile t he ir c laim s wi th t hi s co ur t WI TH IN 3 M ON TH S AF TE R TH E DA TE O F TH E FI RS T PU BL ICA TI ON OF TH IS N OT IC E. AL L CL AI MS N OT F IL ED WI TH IN T HE T IM E PE RI OD S SE T FO RT H IN F LO RI DA S TATU TE S SE CT IO N 733.702 WI LL BE F OR EVER B A RRE D. NO TW IT HS TA ND IN G TH E TI ME P ER IO DS S ET F OR TH AB OV E, A NY C LA IM F IL ED TW O (2 ) YE AR S OR M OR E AF TE R TH E DE CE DE NT 'S D AT E OF DE AT H IS B A RRE D. Th e da te o f fi rs t pu blic ati on o f th is n ot ic e is A pr il 25, 2018. At to r ney f or P er so na l Re pr es en ta ti ve : K. Mac B ra ce we ll, J r. Fl or ida Ba r Nu mb er : 95529 RO GE RS T OW ER S, P.A 1301 R iver plac e Bo ulev ar d, Su it e 1500 Jack so nv ille, Flo ri da 32207 Te le ph on e: ( 904) 3983911 Fax: ( 904) 3960663 EMail1: MB ra ce we ll@ RT La w. co m EMail2: CC ar ls on @R TL aw .c om Ma ry -F ra nc es D am pier Ni ch ol s 261 Pu ddi n Ridg e Ro ad Mo yo ck N or th C ar olina 27958 JA X\ 250415 2_ 1 2T 425 & 502-2018 #421797 NO TI CE OF A GEN CY ACT ION TAKEN BY TH E ST JOHNS RI VER WATE R MANA GEMEN T DIST RI CT No ti ce is give n th at t he f ol lo wi ng p er mi t wa s is su ed o n Ap r il 10, 2018 Ba pt is t Heal th P ro pe rt ie s, I nc. U ni t 1602, 841 P ru dent ia l Dr Jack so nv ille F L 322078372, p er mi t #153 1961. T he pr oj ec t is loc at ed in Na ss au Co un ty Se ct io n 44 T ow nshi p 2N R ange 27E Th e pe rm it au th or iz es a ut ho ri za ti on o f a St or mw at er M anag emen t Sy st em a nd g ra ding p lans f or SR 200 & Ha rp er C ha pe l Rd O ffi ce P ar k a 24.73 a cr e pr oj ec t to b e cons tr uc te d an d op er at ed a s pe r plan s re ceiv ed b y th e Di st ri ct o n Ap ri l 4 2018 T he r ecei vi ng wa te r bo dy is Pl um me r Cr ee k. A pe rs on w ho se s ub st an ti al int er es ts a re o r ma y be affe ct ed h as t he r ight t o re qu es t an a dm inis tr at iv e hea rin g by f ilin g a wr it te n pe ti ti on wi th t he S t J o hns R iver Wat er Ma na ge m ent D is tr ic t (D is tr ic t) P ur su an t to C ha pt er 2 8106 a nd R ul e 40 C1.1 007, Fl or id a Ad mi ni st ra ti ve C od e (F .A.C.) th e pe titi on m us t be file d (r ec ei ve d) e it her b y de liver y at t he o ff ic e of t he D is tr ic t Cl er k at D is tr ic t He ad quar te rs P. O. B ox 142 9 P alat ka F L 321 78 1429 ( 4049 R ei d St Pa la tk a F L 3 2177) o r by e ma il w it h th e Di st ri ct C le rk a t Cl er k@ sj rw md .c om wi th in tw ent yon e (21) d ay s of ne ws pa pe r publicat io n of t he no ti ce o f Di st ri ct d ecis io n (f or th os e pe rs on s to w ho m th e Di st ri ct d oe s no t ma il o r emai l ac tu al n ot ice) A pe ti ti on mu st c om pl y wi th S ec ti on s 120.54( 5)(b)4 an d 120.569 (2 ) (c ), F lo ri da S ta tu te s (F .S .) a nd Ch ap te r 28 106, F .A.C T he Di st ri ct w ill n ot a ccept a p etiti on s ent b y fa cs imile ( fax) Me diat io n pu rs ua nt t o Se cti on 120.57 3 F .S., m ay b e availabl e an d ch oo si ng m ediat io n do es n ot a ffe ct y ou r ri gh t to a n ad mi ni st ra ti ve he ar in g. A pe ti ti on f or a n ad mi ni str at iv e he ar in g is d ee me d file d up on r ec eipt o f th e co mp le te p et itio n by t he D is tr ic t Cl er k at t he D is tr ic t Head quar te rs in Pa la tk a, F lo ri da du ri ng t he D is tr ic t' s re gu la r bu si nes s ho ur s. T he D is tr ic t' s re gu la r bu si nes s hour s ar e 8 a. m. 5 p .m., e xcludi ng w ee ken ds a nd D is tr ic t holiday s. P eti ti on s re ceiv ed b y th e Di st ri ct Cl er k af te r th e Di st ri ct 's r eg ula r bu si ne ss h ou rs s hall b e de emed file d as o f 8 a.m o n th e Di st ri ct 's nex t re gu la r bu si ne ss day Th e Di st ri ct 's a cce pta nc e of p et itio ns f ile d by e ma il is su bj ec t to c er ta in c on di ti on s se t fo rt h in t he D is tr ic t' s St at em en t of A ge nc y Or ga ni za ti on a nd O pe ra ti on ( is su ed pu rs ua nt t o Ru le 28-101. 00 1, Fl or id a Ad mi ni st ra ti ve C od e) wh ic h is a va il ab le f or v iewing at f lo ri da sw at er .c om T he se co ndit io ns include b ut a re no t limit ed t o t he pe ti ti on b ein g in t he f or m of a P DF o r TI FF file a nd b ei ng c apable o f be in g st or ed a nd p ri nted b y th e Di st ri ct Fu rt her pu rs uant t o th e Di st ri ct 's S tate me nt o f Ag enc y Or ga ni za ti on a nd Op er at io n, a tt em pt in g to f ile a pe titi on b y fa cs imile ( fa x) i s pr oh ibit ed a nd s ha ll n ot c on st it ut e filing. Th e ri gh t to a n ad mi ni st ra ti ve hea ri ng a nd t he r el ev an t pr oc ed ur es t o be f ollo we d ar e go ve rn ed b y Chap te r 120, F lo ri da S ta tute s, C hapt er 28-106, F lo ri da A dm inis tr at iv e Co de an d Rule 40C -1 .1007, Fl or id a Ad mi ni st ra ti ve C od e. Be caus e th e ad mi ni st ra ti ve he ar in g pr oc es s is d es igned to f or mu la te f inal age nc y ac ti on t he f ilin g of a p et itio n me an s th e Di st ri ct 's f in al a cti on m ay b e di ff eren t fr om th e po si ti on t ak en b y it in th is no ti ce Failu re t o file a p et iti on f or a n ad mi ni st ra ti ve he ar in g wi th in t he r eq ui si te ti me f ra me s hall c on st it ut e a wa iver o f th e ri gh t to a n ad mi ni st ra ti ve h ea ri ng (R ul e 28106.111, F .A.C.) If yo u wish t o do so ple as e visi t h ttp : //flo ri da sw at er .co m/ no r_ de c/ t o re ad t he co mp le te N ot ic e of R ight s to de te rm in e an y lega l ri gh ts yo u ma y ha ve c on ce rn ing th e Di st ri ct 's d ecis io n( s) o n th e pe rm it a pplicat io n( s) d esc ri be d ab ov e Y ou c an a ls o re ques t th e No ti ce o f Ri gh ts by c on ta ct in g t he Di re ct or o f Re gu la to ry S uppo rt 4049 Reid St ., P alat ka FL 32177-2529 te le no (386)3294570. 1T 502-201 8 #423810 NO TI CE OF A GEN CY ACT ION TAKEN BY TH E ST JOHNS RI VER WATE R MANA GEMEN T DIST RI CT No ti ce is give n th at t he f ol lo wi ng p er mi t wa s is su ed o n Ap r il 10, 2018 Ba pt is t Heal th P ro pe rt ie s, I nc. U ni t 1602, 841 P ru dent ial Dr Jack so nv ille F L 322078372, p er mi t #153 1961. T he pr oj ec t is loc at ed in Na ss au Co un ty Se ct io n 44 T ow nshi p 2N R ange 27E Th e pe rm it au th or iz es a ut ho ri za ti on o f a St or mw at er M anag emen t Sy st em a nd g ra ding p lans f or SR 200 & Ha rp er C ha pe l Rd O ffi ce P ar k a 24.73 a cr e pr oj ec t to b e cons tr uc te d an d op er at ed a s pe r plan s re ceiv ed b y th e Di st ri ct o n Ap ri l 4 2018 T he r ecei vi ng wa te r bo dy is Pl um me r Cr ee k. A pe rs on w ho se s ub st an ti al int er es ts a re o r ma y be affe ct ed h as t he r ight t o re qu es t an a dm inis tr at iv e hea rin g by f ilin g a wr it te n pe ti ti on wi th t he S t J o hns R iver Wat er Ma na ge m ent D is tr ic t (D istr ic t) P ur su an t to C ha pt er 2 8106 a nd R ul e 40 C1.1007, Fl or id a Ad mi ni st ra ti ve C od e (F .A.C.) th e pe titi on m us t be file d (r ec ei ve d) e it her b y de liver y at t he o ff ic e of t he D istr ic t Cl er k at D is tr ic t He ad quar te rs P. O. B ox 142 9 P alat ka F L 321 78 1429 ( 4049 R ei d St Pa la tk a F L 3 2177) o r by e ma il w it h th e Di st ri ct C le rk a t Cl er k@ sj rw md .c om wi th in tw ent yon e (21) d ay s of ne ws pa pe r publicat io n of t he no ti ce o f Di st ri ct d ecis io n (f or th os e pe rs on s to w ho m th e Di st ri ct d oe s no t ma il o r emai l ac tu al n ot ice) A pe ti ti on mu st c om pl y wi th S ec ti on s 120.54( 5)(b)4 an d 120.569 (2 ) (c ), F lo ri da S ta tu te s (F .S .) a nd Ch ap te r 28 106 F .A.C T he Di st ri ct w ill n ot a ccept a p etiti on s ent b y fa cs imile ( fax) Me diat io n pu rs ua nt t o Se cti on 120.57 3 F .S., m ay b e availabl e an d ch oo si ng m ediat io n do es n ot a ffe ct y ou r ri gh t to a n ad mi ni st ra ti ve he ar in g. A pe ti ti on f or a n ad mi ni str at iv e he ar in g is d ee me d file d up on r ec eipt o f th e co mp le te p et itio n by t he D is tr ic t Cl er k at t he D is tr ic t Head quar te rs i n Pa la tk a, F lo ri da du ri ng t he D is tr ic t' s re gu lar bu si nes s ho ur s. T he D is tr ic t' s re gu la r bu si nes s hour s ar e 8 a. m. 5 p .m., e xcludi ng w ee ken ds a nd D is tr ic t holiday s. P eti ti on s re ceiv ed b y th e Di st ri ct Cl er k af te r th e Di st ri ct 's r eg ula r bu si ne ss h ou rs s hall b e de emed file d as o f 8 a.m o n th e Di st ri ct 's nex t re gu la r bu si ne ss day Th e Di st ri ct 's a cce pta nc e of p et itio ns f ile d by e ma il is su bj ec t to c er ta in c on di ti on s se t fo rt h in t he D is tr ic t' s St at em en t of A ge nc y Or ga ni za ti on a nd O pe ra ti on ( is su ed pu rs ua nt t o Ru le 28-101. 00 1, Fl or id a Ad mi ni st ra ti ve C od e) wh ic h is a va il ab le f or v iewing at f lo ri da sw at er .c om T he se co ndit io ns include b ut a re no t limit ed t o t he pe ti ti on b ein g in t he f or m of a P DF o r TI FF file a nd b ei ng c apable o f be in g st or ed a nd p ri nted b y th e Di st ri ct Fu rt her pu rs uant t o th e Di st ri ct 's S tate me nt o f Ag enc y Or ga ni za ti on a nd Op er at io n, a tt em pt in g to f ile a pe titi on b y fa cs imile ( fa x) i s pr oh ibit ed a nd s ha ll n ot c on st it ut e filing. Th e ri gh t to a n ad mi ni st ra ti ve hea ri ng a nd t he r el ev an t pr oc ed ur es t o be f ollo we d ar e go ve rn ed b y Chap te r 120, F lo ri da S ta tute s, C hapt er 28-106, F lo ri da A dm inis tr at ive Co de an d Rule 40C -1 .1007, Fl or id a Ad mi ni st ra ti ve C od e. Be caus e th e ad mi ni st ra ti ve he ar in g pr oc es s is d es igned to f or mu la te f inal age nc y ac ti on t he f ilin g of a p et ition me an s th e Di st ri ct 's f in al a cti on m ay b e di ff eren t fr om th e po si ti on t ak en b y it in th is no ti ce Failu re t o file a p et iti on f or a n ad mi ni st ra ti ve he ar in g wi th in t he r eq ui si te ti me f ra me s hall c on st it ut e a wa iver o f th e ri gh t to a n ad mi ni st ra ti ve h ea ri ng (R ul e 28106.111, F .A.C.) If yo u wish t o do so ple as e visi t h ttp : //flo ri da sw at er .co m/ no r_ de c/ t o re ad t he co mp le te N ot ic e of R ight s to de te rm in e an y lega l ri gh ts yo u ma y ha ve c on ce rn in g th e Di st ri ct 's d ecis io n( s) o n th e pe rm it a pplicat io n( s) d esc ri be d ab ov e Y ou c an a ls o re ques t th e No ti ce o f Ri gh ts by c on ta ct in g t he Di re ct or o f Re gu la to ry S uppo rt 4049 Reid St ., P alat ka FL 32177-2529 te le no (386)3294570. 1T 502-201 8 #423810 NO TI CE OF PUBLIC MEETING Th e So ut h Ame lia I sl an d Sh or e St abiliz at io n As so ci ati on In c w ill h ol d a Bo ar d of Tr us te es M ee ti ng o n Ma y 9, 2018 a t 3:00p.m i n th e Am elia I sl an d Ma na ge me nt Co nf er enc e Ro om 5 440 F ir st Co as t Hw y, A me lia I sl and, Fl or ida P er so ns w it h di sa biliti es r eq ui ri ng a cco mm od ati on s in o rd er t o pa rt ic ip at e in th is p ro gr am o r ac ti vi ty s houl d call 904-277-5123 at lea st 2 4 ho ur s in a dv an ce t o re ques t su ch acco mm od at io n. 2T 425 & 5 -0 2 -2 018 #422527 IN THE CI RC UIT COUR T, FOUR TH JUDICIA L CIRC UIT, IN A ND FOR NA SSAU COUN TY FLORIDA Ca se No .: 45-2018CA46 Division; A DA N AG RO NO W an d BE CK Y AG RO NO W, Pl aint iffs, vs AN TO NI O RO BI NS ON De fend an t. NO TI CE O F AC TI ON TO : AN TO NI O RO BI NS ON if liv in g, a nd if de ceas ed a ny U NKN OW N HE IR S B ENEF ICIA RI ES DE VI SE ES G RA NT EE S A SS IG NO RS C RE DI TO RS A ND T RU ST EE S OF T HE E ST AT E OF A NT ONI O RO BI NS ON Y OU A RE N OT IF IED th at a n ac ti on t o quie t ti tl e to t he f ol lo wi ng p ro pe rt y in N as sa u Co un ty Flor ida: PA RC EL A Lo t 84, SE CTI ON O NE G EO RG IA 'S F ER NA ND IN A BE AC H" a cco rd in g to t he p la t t her eo f re co rd ed in P la t Bo ok 2 pa ge 3 5 of t he public r ec or ds o f Na ss au Co un ty Flor ida PA RC EL B Lo t Nu mb er ed 155 SE CT IO N TW O G EO RGI A' S FE RN AN DI NA B EA CH ", an u nrec or de d su bd ivisio n be in g mo re p ar ti cula rl y de sc ri be d as fo llo ws : Fo r a PO INT OF B EG IN NI NG st ar t at t he S ou th we st c or ner of L ot 84, S ec ti on O ne, G eo rgia' s Fe rn an di na B each ac co rd in g to p la t th ereo f re co rd ed in Pl at B oo k 2, pag e 35 o f th e public r ec or ds o f Na ss au C ount y, F lo ri da ; t hen ce r un in a We st er ly d ire ct io n al on g wh at w ou ld b e th e So ut h lin e of said Lo t 84 i f sa id lot w as s o extended a di st an ce o f 100.00 f eet t o a po in t on t he E as t bo un da ry li ne of N or th Fle tc her A venu e; t hen ce r un N or th a lo ng t he sa id b ou nd ar y lin e of N or th Fl et ch er A ve nue, a d is ta nc e Of 50.00 f ee t to a p oi nt ; t hen ce r un E as t a di st an ce o f 100.00 f ee t to a p oi nt o n th e No rt hw es t co rn er o f Lo t 84 ; t hen ce r un S ou th a lo ng t he We st b ou ndar y of s ai d Lo t 84 a di st ance o f 50.00 f ee t to th e PO INT OF B EG IN NING ha s be en file d agai ns t yo u an d yo u ar e re qu ir ed t o se rv e a co py o f yo ur w ri tt en d efe nses i f any t o it o n Jo n C. La ss er re E sq ., t he Pl ai nt iff' s at to r ney w ho se a ddr es s is Ro ge rs T ow er s P A 960185 Ga te wa y Bl vd ., S ui te 203, F er na ndina. B each F lo ri da 320347843, t hi rt y (3 0) d ay s fr om t he f ir st d ay o f publ ic ati on a nd f ile t he o ri gi na l wi th th e cler k of t hi s cour t ei th er be fo re s er vi ce o n th e plainti ff' s at to rn ey o r im me diat el y t herea ft er ; ot he rw is e a de fa ul t will b e entered a gain st yo u fo r th e re lie f de ma nd ed in t he c om plai nt o r pe ti ti on WI TN ES S my h an d an d se al of t hi s Co ur t on A pr il 20, 2018. JO HN A C RA WF OR D CL ER K OF T HE C IR CU IT C OU RT By : E ar le ne F. S ca ff As D eput y Cl er k 4T 502-09-16-23-2018 #423128 NO TI CE OF A PPROV AL OF FIN AL DE VELOPMEN T PLAN Na ss au C ou nt y pr opos es to a pp ro ve t he F IN AL D EVEL OPME NT P LA N fo r a Pla nned Un it De ve lo pm en t (P UD ) FD 18 002 Mar sh L ak es P UD Ma rs h Vi ew T ow nh om es In a cco rd ance w ith A rt icl e 25 o f Th e La nd D ev elop me nt Co de Pl an ne d Un it De ve lo pm ent : P UD S ec ti on 25.08 Lo ca ti on : On t he s ou th si de o f SR 200/ A1 A be tw ee n Ma rs h La ke s Dr ive a nd Wad es Pl ace F ernand ina B each Pa rc el I D # 372N -2 8-209T 01430000 A pplica nt : Gille tt e & A ss ociat es A ge nt 20 S ou th 4 th S tr eet Fe rn an di na B ea ch, F L 320 34 Ow ne r: Ar ti sa n Ho me s, LL C 9995 G at ew ay P ar kw ay N ., Su ite 4 00 Jack so nv ille FL 32246 Ac ti on R eque st ed : F D1 8002 will a llo w te n duplex u ni ts (2 0 re si de ntial u ni ts t ot al ) at th e lo ca ti on d es cr ibe d ab ov e. NO TI CE I S HE RE BY G IV EN th at t he N as sa u Co un ty P la nni ng a nd Zoni ng B oa rd w ill ho ld a p ubli c hea ri ng o n Tu es da y, May 1 5, 2018 a t 6: 00 PM o r s oon t he re af te r as t he ma tt er t o be h ea rd T he p ub li c he ar ing w ill b e he ld a t th e Ja me s S. P ag e Go ve rn me nt al Co mp lex, 9 6135 N as sa u Pl ace Y ul ee, F lo ri da 3209 7. Al so th e Na ss au C ou nt y Bo ar d of C om mi ssi on er s will ho ld a p ubli c hea ri ng o n Mo nday J un e 11 2 01 8 at 6:00 P M or s oo n th er ea ft er a s th e ma tte r to b e he ar d. Th e publi c hea ri ng s will be h el d at th e Ja me s S P ag e Go ve rn m ent al C om plex 96135 N as sa u Pl ace Y ul ee, F lo ri da 32097. Th e pu bl ic hea ri ng s will b e he ld a t th e Ja me s S. P ag e Go ve rn me nt al C om pl ex 96135 N as sa u Pl ac e Y ulee, Fl or ida 32097. Al l i nter es te d pa rt ies a re i nv ite d to a tt end t he p ubli c he ar i ng s an d to b e he ar d. Co pies o f th e pr op os ed F ina l De ve lo pm en t Pl an a nd s up po rt ing inf or ma ti on a re a va ilable f or ins pect ion in th e De pa rt m ent o f Pl an ning a nd Ec on om ic Op po rt uni ty 96161 Na ss au P lace Y ulee FL 32097. Co mm ent s ma y al so be d ire ct ed in wr iti ng t o th e De pa rt m ent o f Pla nni ng a nd Ec on om ic O ppo rt un ity ema ile d to d mc do we ll@ na ssa ucou nt yf l.co m, o r re cei ve d by t el epho ne a t (904 ) 5306300. Al l co mm ent s wi ll b eco me p ar t of t he r ec or d in th is ma tt er a nd s ubject t o Fl or ida's p ublic re co rd s law. Pe rs on s wi th d isa bili ti es r equi ri ng a cc om mo da ti on s in or de r to p ar ti ci pa te in th is pr og ra m or a ct ivi ty s ho ul d co nt ac t (904) 5306 300 a t le as t tw en ty -f ou r (24) h ou rs in advanc e to r eq ue st s uc h ac co mm od at ion TH E PU BL IC I S IN VI TE D TO B E PR ESEN T AN D BE H EA RD I F A PE RS ON D EC ID ES T O AP PE AL AN Y DE CI SI ON M AD E BY T HE BO AR D, A GE NC Y OR C OM MI SS IO N WI TH R ES PE CT T O AN Y MA TTE R CO NS ID ER ED A T SU CH M EE TI NG O R HE AR IN G HE /S HE WIL L N EED A R EC OR D OF T HE P RO C EED IN GS A ND FO R TH AT P UR PO SE MA Y NE ED T O EN SU RE T HA T A VE RBA TI M RE CO RD O F TH E PR OC EED IN GS I S MA DE W HI CH RE CO RD I NC LU DE S TH E TE ST IMO NY A ND E VI DE NC E UP ON WH IC H A PPE AL I S TO B E BA SE D. Th e Pl an ning a nd Z on ing Bo ar d an d th e Bo ar d of Co un ty C om mi ss io ner s ma y co ntinu e he ar ing s on t hi s ma tt er Li nda Mo rri s C hai rm an Na ss au C ou nt y Pl an ning a nd Zo ning B oa rd 2T 425 & 502-2018 #421777 NO TI CE OF A PPROV AL OF FIN AL DE VELOPMEN T PLAN Na ss au C ou nt y pr opos es to a pp ro ve t he F IN AL D EVEL OPME NT P LA N fo r a Pla nned Un it De ve lo pm en t (P UD ) FD 18 002 Mar sh L ak es P UD Ma rs h Vi ew T ow nh om es In a cco rd ance w ith A rt icl e 25 o f Th e La nd D ev elop me nt Co de Pl an ne d Un it De ve lo pm ent : P UD S ec ti on 25.08 Lo ca ti on : On t he s ou th si de o f SR 200/ A1 A be tw ee n Ma rs h La ke s Dr ive a nd Wad es Pl ace F ernand ina B each Pa rc el I D # 372N -2 8-209T 0143-0000 A pplica nt : Gille tt e & A ss ociat es A ge nt 20 S ou th 4 th S tr eet Fe rn an di na B ea ch, F L 320 34 Ow ne r: Ar ti sa n Ho me s, LL C 9995 G at ew ay P ar kw ay N ., Su ite 4 00 Jack so nv ille FL 32246 Ac ti on R eque st ed : F D1 8002 will a llo w te n duplex u ni ts (2 0 re si de ntial u ni ts t ot al ) at th e lo ca ti on d es cr ibe d ab ov e. NO TI CE I S HE RE BY G IV EN th at t he N as sa u Co un ty P la nni ng a nd Zoni ng B oa rd w ill ho ld a p ubli c hea ri ng o n Tu es da y, May 1 5, 2018 a t 6:00 PM o r s oon t he re af te r as t he ma tt er t o be h ea rd T he p ub li c he ar ing w ill b e he ld a t th e Ja me s S. P ag e Go ve rn me nt al Co mp lex, 9 6135 N as sa u Pl ace Y ul ee, F lo ri da 32097. Al so th e Na ss au C ou nt y Bo ar d of C om mi ssi on er s will ho ld a p ubli c hea ri ng o n Mo nday J un e 11 2 01 8 at 6:00 P M or s oo n th er ea ft er a s th e ma tte r to b e he ar d. Th e publi c hea ri ng s will be h el d at th e Ja me s S P ag e Go ve rn m ent al C om plex 96135 N as sa u Pl ace Y ul ee, F lo ri da 32097. Th e pu bl ic hea ri ng s will b e he ld a t th e Ja me s S. P ag e Go ve rn me nt al C om pl ex 96135 N as sa u Pl ac e Y ulee, Fl or ida 32097. Al l i nter es te d pa rt ies a re inv ite d to a tt end t he p ubli c he ar i ng s an d to b e he ar d. Co pies o f th e pr op os ed F ina l De ve lo pm en t Pl an a nd s up po rt ing inf or ma ti on a re a va ilable f or ins pect ion in th e De pa rt m ent o f Pl an ning a nd Ec on om ic Op po rt uni ty 96161 Na ss au P lace Y ulee FL 32097. Co mm ent s ma y al so be d ire ct ed in wr iti ng t o th e De pa rt m ent o f Pla nni ng a nd Ec on om ic O ppo rt un ity ema ile d to d mc do we ll@ na ssa ucou nt yf l.co m, o r re cei ve d by t el epho ne a t (904 ) 5306300. Al l co mm ent s wi ll b eco me p ar t of t he r ec or d i n th is ma tt er a nd s ubject t o Fl or ida's p ublic re co rd s law. Pe rs on s wi th d isa bili ti es r equi ri ng a cc om mo da ti on s i n or de r to p ar ti ci pa te in th i s pr og ra m or a ct ivi ty s ho ul d co nt ac t (904) 5306 300 a t le as t tw en ty -f ou r (24) h ou rs i n advanc e to r eq ue st s uc h ac co mm od at ion TH E PU BL IC I S IN VI TE D TO B E PR ESEN T AN D BE H EA RD I F A PE RS ON D EC ID ES T O AP PE AL AN Y DE CI SI ON M AD E BY T HE BO AR D, A GE NC Y OR C OM MI SS IO N WI TH R ES PE CT T O AN Y MA TTE R CO NS ID ER ED A T SU CH M EE TI NG O R HE AR IN G HE /S HE WIL L N EED A R EC OR D OF T HE P RO C EED IN GS A ND FO R TH AT P UR PO SE MA Y NE ED T O EN SU RE T HA T A VE RBA TI M RE CO RD O F TH E PR OC EED IN GS I S MA DE W HI CH RE CO RD I NC LU DE S TH E TE ST IMO NY A ND E VI DE NC E UP ON WH IC H A PPE AL I S TO B E BA SE D. Th e Pl an ning a nd Zon ing Bo ar d an d th e Bo ar d of Co un ty C om mi ss io ner s ma y co ntinu e he ar ing s on t hi s ma tt er Li nda Mo rri s C hai rm an Na ss au C ou nt y Pl an ning a nd Zo ning B oa rd 2T 425 & 502-2018 #421777 IN THE CI RC UI T COUR T FOR NA SSAU COUN TY FLORIDA PROBAT E DI VISION Di vi sion A File No. 2018CP -127 IN R E : E ST AT E OF SH ER MA N DO NA LD D EL K, JR. De ceas ed NO TIC E TO C RE DI TO RS Th e ad mi ni st ra ti o n o f th e es ta te o f S her ma n Do na ld De lk Jr ., d ecea se d, w ho se da te o f deat h wa s Ma rc h 22, 2018 i s p endin g in t he C ir cuit Co ur t fo r Na ss au C oun ty Flo ri da P ro ba te D ivisio n, t he addr e ss o f wh ic h is 763 47 V et er an s Wa y, Y ul ee, F lo ri da 32097. T he n am es a nd a ddr es se s o f th e pe rso na l re pr es ent at iv e an d th e pe rs ona l re pr esent at iv e' s at to r ney a re se t fo rt h belo w. Al l cr edito rs o f th e de ce de nt a nd o t her p er so ns h av in g clai ms o r de ma nd s agains t de cede nt 's e st at e o n wh o m a co py o f th is n oti ce i s re quir ed t o b e se rv ed m us t file t he ir c laim s wi th t hi s co ur t ON O R BE FO RE T HE L AT ER O F 3 MO NT HS A FT ER T HE T IM E OF TH E FI RS T PU BL IC AT IO N OF T HI S NO TI CE OR 30 DA YS A FT ER T HE DA TE O F SE RV IC E OF A C OP Y OF T HI S NO TI CE O N TH EM Al l o th er c re di to rs o f th e de cede nt a nd o th er p er so ns ha vi ng c laim s o r de ma nd s agains t de cede nt 's e st at e mu st f ile t he ir c laim s wi th t hi s co ur t WI TH IN 3 M ON TH S AF TE R TH E DA TE O F TH E FI RS T PU BL ICA TI ON OF TH IS N OT IC E. AL L CL AI MS N OT F IL ED WI TH IN T HE T IM E PE RI OD S SE T FO RT H IN F LO RI DA S TATU TE S SE CT IO N 733.702 WI LL BE F OR EV ER B A RRE D. NO TW IT HS TA ND IN G TH E TI ME P ER IO DS S ET F OR TH AB OV E A NY C LA IM F IL ED TW O (2 ) YE AR S OR M OR E AF TE R TH E DE CE DE NT 'S D AT E OF DE AT H IS B A RRE D. Th e da te o f fi rs t pu blic ati o n o f th is n oti ce is Ma y 2, 2018. At to r ney fo r Pe rso na l Re pr es en ta ti ve : Kris te n D. D ra ke Flo ri da B ar N o 13433 Th e La w Offi ce o f Kris te n D. D ra ke P. A 1403 Pa rk A ve S ui te B Fe rn an dina B ea ch, Flo ri da 32034 Pe rso na l Repr esen tati ve : Me ga n T B ales 85128 Mi ne r Rd Yu le e, Flo ri da 32097 2T 0502-09-2018 #423623 I N THE CI RCU IT CO UR T, FOUR TH JUDICIAL CI RC UIT, IN AND FOR NA SSAU COUN TY FLORIDA CA SE NU MBER: 2018CP -138 DI VISION: B I N RE : T he E st at e Of : CH AR LE S H. J ON ES De ceas ed NO TIC E TO C RE DI TO RS Th e ancilla ry a dm inis tr ati on o f th e es ta te o f CH AR LE S H. J ON ES de ceas ed F ile Nu mb er 18C P 138, is pe nd in g in t he C ir cuit C ou rt f or Na ss au C ou nt y, F lo ri da Pr oba te D ivisio n, t he a ddr es s of wh ic h is 76347 V et er an s Wa y, Yu lee F lo ri da 32097. Th e na me s an d addr es se s of t he pe rs on al r ep re s ent at iv e an d th e pe rs on al r ep re s ent at iv es at to rn ey a re s et f or th b el ow Al l cr edit or s of t he d ec ede nt a nd o t her p er so ns h av in g clai ms o r de ma nd s agains t de ce dent 's e st at e, i ncludin g un ma tu re d, c on ti nge nt o r un liq uida te d clai ms on w ho m a copy o f th is n oti ce is se rv ed m us t file t he ir clai ms w it h th is c ourt WIT HI N TH E LA TE R OF 3 M ON TH S AF TE R TH E DA TE O F TH E FI RS T PU BL IC AT IO N OF T HI S NO TI CE OR 3 0 DA YS A FT ER T HE D AT E OF S ER VI CE O F A CO PY O F TH IS N OT IC E ON T HE M. Al l ot he r cr edit or s of t he de cede nt a nd o th er p er so ns ha vi ng c laim s or d em ands agains t de ce dent 's e st at e, i ncludin g un ma tu re d, c on ti nge nt o r un liq uida te d clai ms mu st f ile t he ir c laim s wi th t hi s co ur t WI TH IN 3 M ON TH S AF TE R TH E DA TE O F TH E FI RS T PU BL ICA TI ON OF TH IS N OT IC E. AL L CL AI MS N OT F IL ED WI TH IN T HE T IM E PE RI OD S SE T FO RT H IN F LO RI DA ST AT UT ES S EC TI ON 733 .7 02 WI LL B E FO RE VE R BA RRE D. NO TW IT HS TA ND IN G TH E TI ME P ER IO DS S ET F OR TH AB OV E A NY C LA IM F IL ED TW O (2 ) YE AR S OR M OR E AF TE R DE CE DE NT S DA TE O F DE AT H IS B A RRE D. Th e da te o f fi rs t pu blic ati on o f th is N ot ic e is A pr il 25, 2018. CL YD E W. D AV IS At to r ney f or P er so na l Re pr es en ta ti ve Fl or ida Ba r No 277266 Da vis B ro us sa rd & S te ge r, PL LC 960185 Ga te wa y Bl vd ., St e. 104 Am e lia I sl and, Flori da 32034 Te le ph on e: (9 04 )2 61 2848 DW IG HT C JON ES Pe rs on al R ep re se nt at iv e 2T 425 & 502-2018 #422531 IN THE CI RC UIT COUR T, FOUR TH JUDICIAL CI RC UIT, IN AND FOR NA SSAU COUN TY FLORID A, CA SE NO.: 18CP -112 DI VISION : B IN R E : T HE E ST AT E OF RO BE RT E AR L SM IT H, JR., De ce as ed NO TIC E TO C RE DI TO RS Th e ad mi ni st ra ti o n o f th e Es ta te o f RO BE RT E AR L SM IT H, JR., d ec ea se d, F ile N um be r 18CP 112 /D IV B is p endin g in th e Ci rc ui t Co ur t fo r Na ssa u Co un ty Flo ri da P ro ba te D iv isi on t he a ddr es s o f wh ic h is P.O. B o x 4 56, F erna ndin a Be ach F lo ri da 32034. T he na me s an d addr es se s o f th e pe rs ona l re pr esent at iv e an d th e pe rs ona l re pr esent at iv e' s at to rn ey a re s et fo rt h belo w. Al l cr edito rs o f th e de ce de nt a nd o t her p er so ns h av in g clai ms o r de ma nd s agains t de ce dent 's e st at e, i ncludin g um na tu re d, c ont in ge nt o r un liq uida te d clai ms o n wh o m a copy o f th is n o ti ce is se rv ed m us t file t he ir clai ms w it h th is c our t WI TH IN TH E LA TE R OF 3 M ON TH S AF TE R TH E DA TE O F TH E FI RS T PU BL IC AT IO N OF T HI S NO TI CE OR 3 0 DA YS A FT ER T HE D AT E OF S ER VI CE O F A CO PY O F TH IS N OT IC E ON T HE M. Al l o th er c re di to rs o f th e de cede nt a nd o th er p er so ns ha vi ng c laim s o r de ma nd s agains t de ce dent 's e st at e, i ncludin g un ma tu re d, c ont in ge nt o r un liq uida te d clai ms mu st f ile t he ir c laim s wi th t hi s co ur t WI TH IN 3 M ON TH S AF TE R TH E DA TE O F TH E FI RS T PU BL ICA TI ON OF TH IS N OT IC E. AL L CL AI MS N OT S O FI LE D WI LL B E FO RE VE R BA RRE D. Th e da te o f fi rs t pu blic ati o n o f th is N oti ce is Ap ri l 25, 2018. LE IG H G M OO NE Y At to r ney fo r Pe rso na l Re pr es en ta ti ve Flo ri da B ar N o 1002357 Da vis B ro us sa rd & S te ge r, PL LC 960185 Ga te wa y Bl vd St e. 104 Am e lia I sl and, Flori da 32034 Te le ph o ne : (904) 2612848 PE GG Y SM IT H Pe rso na l Repr esen tati ve 2T 425 & 502-2018 #421690 IN THE CI RC UI T COUR T FOR NA SSAU COUN TY FLORIDA PROBAT E DI VISION FILE NO.: 18CP -8 5 DI VISION: A IN R E: ES TATE O F DO NNA E S TR IN GF EL LO W, De ceas ed NO TIC E TO C RE DI TO RS Th e ad mi ni st ra ti on o f th e es ta te o f DO NN A E. ST RI NG FE LL OW d ecea se d, Fil e Nu mb er 18CP -8 5 i s pe ndin g in t he C ir cuit C ou rt fo r Na ss au C ou nty F lor ida, Pr ob at e Di vi si on th e addr es s of w hich is Na ss au C ou nt y Co ur th ou se 76347 V eter an s Wa y, S ui te 456, Y ul ee F lor id a 32097. Th e na me s an d ad dr es se s of t he p er so nal r ep re s ent at iv e an d th e pe rs on al re pr esent at iv e' s at to r ney a re se t fo rt h bel ow AL L CR ED ITO RS A RE N OT IFI ED T HA T: Al l c re di to rs o f th e de ce de nt a nd o t her p er so ns h av in g clai ms o r de ma nd s agains t de cede nt 's e st at e on wh om a c op y of t hi s no ti ce i s se rv ed m us t fil e t hei r clai ms wi th t hi s Co ur t WI TH IN T HE L AT ER O F TH RE E MO NT HS A FT ER TH E DA TE O F FI RS T PU BL IC ATI ON O F THIS N OT IC E OR T HI RTY D AY S AF TE R TH E DA TE O F SE RV IC E OF A C OP Y OF T HI S NO TI CE O N TH EM Al l o th er c re di to rs o f th e de cede nt a nd p er so ns h av in g clai ms o r de ma nd s agains t th e dece dent 's e sta te m us t fil e th ei r clai ms w it h th is C ou rt WIT HI N TH RE E MO NT HS A FT ER T HE D AT E OF FI RS T PU BL IC A TIO N OF T HI S NO TI CE AL L CL AI MS A ND D EMA ND S NO T SO F IL ED WIL L BE FO RE VE R BA RRE D. Th e da te o f fi rs t Pu blicati on o f th is N ot ic e is A pr il 25, 2018. At to r ney f or P er so na l Re pr es en ta ti ve : KA TH RY N KN EE E sq ui re Fl or ida Ba r No .: 849571 KA TH RY N KN EE P.A 1027 So ut h 8t h St r eet Fe rn an dina B ea ch, F L 320 34 (9 04) 491178 1 Pe rs on al R ep re se nt at iv e: ER IC T IT CO MB 873 Ni ss en D ri ve Fe rn an dina B ea ch, F L 320 34 2T 425 & 502-2018 #422029 I N THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT IN A ND FOR NA SSAU COUN TY FLORIDA GENERAL JU RISD IC TI ON DI VISION CA SE NO. 17CA000012AXYX WE LL S FA RG O BA NK N .A A S TR US TE E FO R TH E PO OL IN G AN D SE RV IC IN G AG RE EM EN T DA TE D AS O F NO VE MB ER 1 2004 P AR K PL AC E SE CU RI TI ES IN C A SS ET -B AC KE D PA SSTH RO UG H CE RT IF IC AT ES S ER IE S 2004WHQ2 Pla in ti ff, vs ST EVEN L W OR TM AN A /K /A ST EVEN L WO RT M AN, J R. A/ K/ A ST EV EN WOR TM AN A/ K/ A ST EVEN L WO RT MA N AN D CHRI ST Y WO RT MA N A/ K/ A CHRI ST Y M W OR TM AN A/ K/ A CH RI ST Y HU TT O WO RT MA N A/ K/ A CHRI ST Y HU TT O, et al. De fendant (s ). NO TI CE O F FO RE CL OS UR E SA LE NO TI CE I S HE RE BY G IV EN pu rs ua nt t o a F ina l Judg me nt of F or ec lo su re d a te d Ma rc h 12 2018, a nd e nt ered in 17 CA 000012A XY X of t he C ir cuit Co ur t of t he F OU RT H Judicia l Ci rc ui t in a nd f or N a ss a u Co un ty F lo ri da w he re in WE LL S FA RG O BA NK N .A A S TR US TE E FO R TH E PO OL IN G AN D SE RV IC IN G AG RE EM EN T DA TE D AS O F NO VE MB ER 1 2004 P AR K PL AC E SE CU RI TI ES IN C A SS ET -B AC KE D PA SSTH RO UG H CE RT IF IC AT ES S ER IE S 2004WHQ2 is th e Pla in ti ff a nd S TE VE N L W OR TM AN A/ K/ A ST EVEN L WO RT MA N, JR A/ K/ A ST EVEN WOR TM AN A/ K/ A ST EVEN L EE WOR TM AN JR A /K/A ST EVEN L EE W OR TMA N; U NKNO WN S PO US E OF ST EVEN L W OR TM AN A /K /A ST EVEN L WO RT M AN, J R. A/ K/ A ST EV EN WOR TM AN A/ K/ A ST EVEN L EE WOR TM AN JR A /K/A ST EVEN L EE W OR TMA N; C HR ISTY WOR TM AN A/ K/ A CHRI ST Y M W OR TM AN A/ K/ A CH RI ST Y HU TT O WO RT MA N A/ K/ A CHRI ST Y HU TT O; SP RI NG CA ST LE C RE DI T FU ND IN G TR US T T HR OU GH I TS TR US TE E WI LM IN GT ON T RU ST NA TI ON AL A SS OC IA TI ON ; LV NV F UN DI NG LL C a re t he De fe nd ant (s). Jo hn C ra wf or d a s th e Cl er k of t he C ir cuit C ou rt w ill se ll t o th e highes t and b es t bidde r fo r ca sh a t www. na ssa ucle rk .r ealf or ecl os e. com a t 11:30 A M, o n Ma y 17 2018, t he f ollo wi ng de sc ri be d pr op er ty a s se t fo rt h in s aid F ina l Judg me nt to wit : LO T 18 CE DA R RI DG E UN IT ON E A CC OR DI NG T O TH E PL AT R EC OR DE D IN P LA T BO OK 6 PAGE S 95 A ND 96, OF T HE P UB LI C RECO RD S OF NA SS AU C OU NT Y, F LO RI DA TO GE TH ER WIT H TH AT C ER TAIN 1999 HOR NE T FL AT BE D TR AI LE R MO BI LE H OM E CO NTAI NING VI N# H8570 3G L. Pr op er ty A ddr e ss: 95419 BA RB AR AS P L. F /K /A 1 49 3 BA RB AR AS P L. FE RN AN DI NA BE AC H, F L 3203 4 An y pe rs on c la im in g a n inte re st in th e su rp lu s fr om t he sa le i f a ny o t her t ha n th e pr op er ty o wner a s of t he da te o f th e li s pe nden s mu st file a c laim w it hi n 60 d a ys a fte r th e sa le. Da te d th is 2 nd d a y of Ap r il, 2018. Jo hn C ra wf or d As C le rk o f th e Co ur t By : E Mic hele Jo hns on As D eput y Cl er k IM PO RT AN T AM ER IC AN S WI TH D IS AB ILITI ES A CT I f yo u a re a p er so n wi th a d isabilit y wh o need s a ny a cc om mo da ti on i n or de r to pa rt icipa te in th is p ro ce ed in g, y ou a re e nt itle d a t no co st t o yo u t o th e pr ov ision of c er ta in a ss is ta nc e. P lea se co nt act t he A DA C oor dina to r a t (904 ) 5 48-460 0 (the n pr es s 0) a t lea st 7 d a ys b ef or e yo ur sc hed uled c ou rt a ppea ra nc e, o r im me dia te ly u po n re ceiv in g th is n ot ifica ti on if th e ti me b ef or e th e sc he dul ed a ppe a ra nc e is les s th an 7 da ys ; if y ou a re h ea ri ng o r vo ice im pair ed call 711. 2T 502-09-2018 #423088 I N THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT IN A ND FOR NA SSAU COUN TY FLORIDA GENERAL JU RISD IC TI ON DI VISION CA SE NO. 17CA000012AXYX WE LL S FA RG O BA NK N .A A S TR US TE E FO R TH E PO OL IN G AN D SE RV IC IN G AG RE EM EN T DA TE D AS O F NO VE MB ER 1 2004 P AR K PL AC E SE CU RI TI ES IN C A SS ET -B AC KE D PA SSTH RO UG H CE RT IF IC AT ES S ER IE S 2004WHQ2 Pla in ti ff, vs ST EVEN L W OR TM AN A /K/A ST EVEN L WO RT M AN, J R. A/ K/ A ST EV EN WOR TM AN A/ K/ A ST EVEN L WO RT MA N AN D CHRI ST Y WO RT MA N A/ K/ A CHRI ST Y M W OR TM AN A/ K/ A CH RI ST Y HU TT O WO RT MA N A/ K/ A CHRI ST Y HU TT O, et al. De fendant (s ). NO TI CE O F FO RE CL OS UR E SA LE NO TI CE I S HE RE BY G IV EN pu rs ua nt t o a F ina l Judg me nt of F or ec lo su re d a te d Ma rc h 12, 2018, a nd e nt ered in 17 CA 000012A XY X of t he C ir cuit Co ur t of t he F OU RT H Judicia l Ci rc ui t in a nd f or N a ss au Co un ty F lo ri da w he re in WE LL S FA RG O BA NK N .A A S TR US TE E FO R TH E PO OL IN G AN D SE RV IC IN G AG RE EM EN T DA TE D AS O F NO VE MB ER 1 2004 P AR K PL AC E SE CU RI TI ES IN C A SS ET -B AC KE D PA SSTH RO UG H CE RT IF IC AT ES S ER IE S 2004WHQ2 i s th e Pla in ti ff a nd S TE VE N L W OR TM AN A/ K/ A ST EVEN L WO RT MA N, JR A/ K/ A ST EVEN WOR TM AN A/ K/ A ST EVEN L EE WOR TM AN JR A /K/A ST EVEN L EE W OR TMA N; U NKNO WN S PO US E OF ST EVEN L W OR TM AN A /K/A ST EVEN L WO RT M AN, J R. A/ K/ A ST EV EN WOR TM AN A/ K/ A ST EVEN L EE WOR TM AN JR A /K/A ST EVEN L EE W OR TMA N; C HR ISTY WOR TM AN A/ K/ A CHRI ST Y M W OR TM AN A/ K/ A CH RI ST Y HU TT O WO RT MA N A/ K/ A CHRI ST Y HU TT O; SP RI NG CA ST LE C RE DI T FU ND IN G TR US T T HR OU GH I TS TR US TE E WI LM IN GT ON T RU ST NA TI ON AL A SS OC IA TI ON ; LV NV F UN DI NG LL C a re t he De fe nd ant (s). Jo hn C ra wf or d a s th e Cl er k of t he C ir cuit C ou rt w ill se ll t o th e highes t and b es t bidde r fo r ca sh a t www. na ssa ucle rk .r ealf or ecl os e. com a t 11:30 A M, o n Ma y 17 2018, t he f ollo wi ng de sc ri be d pr op er ty a s se t fo rt h in s aid F ina l Judg me nt to wit : LO T 18 CE DA R RI DG E UN IT ON E A CC OR DI NG T O TH E PL AT R EC OR DE D IN P LA T BO OK 6 PAGE S 95 A ND 96, OF T HE P UB LI C RECO RD S OF NA SS AU C OU NT Y, F LO RI DA TO GE TH ER WIT H TH AT C ER TA IN 1999 HOR NE T FL AT BE D TR AI LE R MO BI LE H OM E CO NTAI NI NG VI N# H8570 3G L. Pr op er ty A ddr e ss: 95419 BA RB AR AS P L. F /K /A 1 49 3 BA RB AR AS P L. FE RN AN DI NA BE AC H, F L 3203 4 An y pe rs on c la im in g a n in te re st in th e su rp lu s fr om t he sa le i f a ny o t her t ha n th e pr op er ty o wner a s of t he da te o f th e li s pe nden s mu st file a c laim w it hi n 60 d a ys a fte r th e sa le. Da te d th is 2 nd d a y of Ap r il, 2018. Jo hn C ra wf or d As C le rk o f th e Co ur t By : E Mic hele Jo hns on As D eput y Cl er k IM PO RT AN T AM ER IC AN S WI TH D IS AB IL ITI ES A CT I f yo u a re a p er so n wi th a d isabilit y wh o need s a ny a cc om mo da ti on in or de r to pa rt icipa te in th is p ro ce ed in g, y ou a re e nt itle d a t no co st t o yo u t o th e pr ov isio n of c er ta in a ss is ta nc e. P lea se co nt act t he A DA C oor dina to r a t (904 ) 5 48-460 0 (the n pr es s 0) a t lea st 7 d a ys b ef or e yo ur sc hed uled c ou rt a ppea ra nc e, o r im me dia te ly u po n re ceiv in g th is n ot ifica ti on i f th e ti me b ef or e th e sc he dul ed a ppe a ra nc e is les s th a n 7 da ys ; if y ou a re h ea ri ng o r vo ice im pair ed call 711. 2T 502-09-2018 #423088 NO TI CE OF IN TE NT ION TO CO NSIDER EN ACTM EN T OF OR DI NANC E NO TI CE i s hereb y give n th at t he B oa rd o f Co un ty Co mm is si o ner s of N as sa u Co un ty Fl or ida, a t a Re gu la r m eet in g to b e hel d on M on day t he 1 4t h da y of M ay 2018 at 6 :0 0 P.M. or a s so on t herea ft er a s th e ma tte r ma y be hea rd in t he C om mi ss io n Ch am be rs l oc at ed a t th e Ja me s S. P ag e Go ve rn me nt al Co mp lex, 9 6135 N as sa u Pl ace Y ulee, F lo ri da i nt en ds to c on si de r fo r ad op ti on t he fo llo wi ng p ro po se d or di na nce: OR DI NANC E 2018____ AN O RD IN AN CE O F NA SSA U CO UN TY F LO RI DA P RO VI DI NG T HA T OR DI NANC E 88 31, A S AM EN DED R EG AR DIN G TH E AM EL IA I SL AN D TO UR IS T DE VELO PM EN T TA X, BE F UR TH ER A ME ND ED B Y AM EN DI NG S EC TI ON 1 B Y AD DI NG P AR AG RA PH ( h) T O PR OV ID E FO R TH E LEVY A ND IM PO SI TI ON O F AN A DD I TIO NAL O NE C EN T [5 TH C EN T] O F EA CH D OL LA R AB OV E TH E TA X RA TE ; P RO VI DI NG F OR S EVER AB ILIT Y; PRO VI DI NG A R EPEA LIN G CL AU SE ; AN D PR OV ID IN G AN E FFE CT IV E DA TE Co pies o f th e Or di na nc e ar e availabl e at t he C le rk 's O ffi ce a t t he Robe rt M F os te r Ju st ic e C enter l oc at ed a t 76347 V et er an s Wa y, Y ulee Fl or ida, M on da y th ro ug h Fr iday 8 :3 0 a. m. t hr ou gh 5 :0 0 p.m ., e xc ep t le gal ho liday s. TH E PU BL IC I S IN VI TE D TO B E PR ESEN T AN D BE H EA RD I F A PE RS ON D EC ID ES T O AP PE AL AN Y DE CI SI ON M AD E BY T HE BO AR D, A GE NC Y OR C OM MI SS IO N WI TH R ES PE CT T O AN Y MA TTE R CO NS ID ER ED A T SU CH M EE TI NG O R HE AR IN G, HE O R SH E WI LL N EE D A RE CO RD O F TH E PR OC EED IN GS AN D TH AT FO R SU CH PU RP OS E H E OR S HE M AY NE ED T O EN SU RE T HA T A VE RBA TI M RE CO RD O F TH E PR OC EED IN GS I S MA DE W HI CH RE CO RD I NC LU DE S TH E TE ST IMO NY A ND E VI DE NC E UP ON WH IC H TH E AP PE AL I S TO B E BA SE D. T he Bo ar d of C ou nt y Co mmi ss io ne rs m ay c on ti nu e he ar in gs o n th is m at te r. AT TE ST : BO AR D OF C OU NT Y CO MMI SS IO NE RS OF N AS SA U CO UN TY F LO RI DA BY :/s/ P AT E DW AR DS It s : C ha ir ma n /s/ J OH N A. C RA WF OR D It s : E xOf fi ci o Cl er k In di vi duals wi th d is abilit ie s n eed in g a re as on able a cco mm od at io n to p ar ti cipa te in t hi s pr oc eedin g sh ou ld co nt ac t th e O ffi ce o f th e Ex O ffi ci o Cl er k to t he B oa rd o f Co un ty C om mi ss io ner s at le as t tw o da ys p ri or t o th e pr oc ee ding a t (9 04) 54846 60 or if t he hea ri ng imp ai re d, Fl or id a Re la y Se rv ic e at 1 -8 00 955-877 0 (v ) or 1 8009 558771 (T DD ). 2T 0502-09-2018 #423914 IN THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT IN AND FOR NA SSAU COUN TY FLORIDA CI VIL AC TION Ca se #: 2018CA -000067 DI VISION: A HS BC B an k US A, N at io na l As so ciat io n as T ru st ee in tr us t fo r Ci ti gr ou p Mo rt gage L oa n Tr us t In c. As se t Ba ck ed P as s Th ro ug h Cert ificat es S er ie s 2003HE 3 Plain ti ff, vs.Li sa I H ow ar d a/ k/ a Li sa H Ma rr a ; U nkno wn S po us e of Li sa I H ow ar d a/ k/ a Li sa H Ma rr a ; U nkno wn P ar ti es i n Po ssess io n #1, if living a nd a ll Un kn ow n P ar ti es c laimin g by th ro ug h, u nd er a nd a ga in st th e ab ov e na me d De fe nda nt (s) wh o ar e no t kn ow n to be d ea d or a live w hethe r sa id U nkno wn P ar ti es m ay clai m an interes t as S po us e, He irs D ev is ee s G ra nt ee s o r Ot he r Cl ai ma nts ; U nkno wn P ar ti es in Po ssess io n #2 i f liv in g, a nd a ll U nk no wn P ar ti es clai mi ng b y t hr ou gh u nder an d agains t th e ab ov e na me d De fe ndan t( s) w ho ar e no t kn ow n to b e dead o r alive, w he t her s ai d Un kn ow n P ar ti es m ay c laim a n in te re st as S po us e, H ei rs D ev is ee s, Gr ant ees o r Ot he r Cl ai ma nt s De fend an t( s) NO TI CE O F AC TI ON FO RE CL OS UR E P RO CE ED IN GS P RO P ER TY TO : L is a I. H ow ar d a/ k/ a Li sa H M ar ra : L AS T KN OW N AD DR ES S, 542 49 Four ac re C ir cl e, C alla han F L 32011 a nd Un kn ow n Sp ou se o f Li sa I Ho wa rd a /k/a L is a H. M ar ra : LA ST K NO WN A DD RE SS, 5 4 249 Fo ur ac re C ir cl e, C alla ha n, F L 32011 Re si de nce un kn ow n i f living, inc luding a ny u nkno wn sp ou se o f th e sa id D ef en da nt s, if ei th er h as r em ar ri ed an d if e it her o r bo th o f sa id De fe nd an ts a re d ead, t he ir re sp ec ti ve u nkno wn h ei rs de visees g ra ntee s a ss igne es cr edit or s, lieno rs an d tr us te es an d al l ot her p er so ns c laimin g by t hr ou gh u nd er o r agains t th e na me d De fe nda nt (s ) ; a nd t he a fo re me nti on ed n am ed D ef en da nt (s ) an d su ch o f th e af or em en ti on ed u nk no wn D ef en dant s an d su ch o f th e af or em en ti on ed u nk no wn D ef en dant s as m ay b e in fa nt s, inc om pe t ent s or o t her wise n ot s ui j ur is. YO U AR E HE RE BY N OT IF IE D th at a n ac ti on h as b ee n co mm enc ed t o fo re cl os e a mo rt gage o n th e fo llo wi ng re al p ro pe rt y, lyi ng a nd b ei ng an d si tu at ed in Na ss au C ou nty F lo ri da m or e pa rt icular ly de sc ri bed as fo llo ws : TR AC T NO S IX TE EN ( 16) UN IT T WO ( 2) L EE -S TO NE R SH OR ES U NR EC OR DED, P AR T OF T HE S .A OG IL IV E ES TATE S, IN T HE W IL LI AM G IB SO N GR AN T, S EC TI ON T HI RT YSE VEN ( 37) T OW NS HI P O NE ( 1) NO RT H R AN GE T WE NT YFI VE (2 5) E AST N AS SA U CO UN TY FL OR ID A B EI NG M OR E P AR TI CU LA RL Y DE SC RI BE D AS FOL LO WS: TH E NO RT HE RL Y ON EHA LF (N 1/2 ) OF T HE FOL LO WI NG : CO MME NC E AT A N IR ON PIP E ON T HE E AS TE RL Y SI DE O F ST AT E RO AD # 11 5 (A O NE HU ND RE D (100) F OO T RI GH TOF -W AY ), T HA T IS T HR EE TH OU SA ND T WO H UN DR ED T WE NT YEI GH T AN D FIFT YSI X HU NDR ED TH S (3228.56) F EE T SO UT HE RL Y OF T HE N OR TH ER LY L IN E OF T HE L AN DS D ESC RI BE D IN D EE D BO OK 1 43, P AG E 98, O F TH E P UB LI C RE CO RD S OF S AI D CO UN TY AS M EA SU RE D AL ON G TH E SA ID E AS TE RL Y LI NE O F ST AT E RO AD #115; T HE NC E NO RT H SE VE NT YSE VE N (7 7) D EG R EES TW EN TY -T WO ( 22 ) MI NU TE S, TH IR TY ( 30 ) SE CO ND S EA ST TH RE E HU ND RE D (300 ) FE ET T O TH E P OI NT O F BE GI NN IN G; TH EN CE C ON TI NU E NO RT H SE VE NT YSE VE N (7 7) D EG R EES TW EN TY -T WO ( 22 ) MI NU TE S, TH IR TY ( 30 ) SE CO ND S EA ST TH RE E HU ND RE D (300) F EE T; TH EN CE S OU TH F IF TE EN ( 15) DE GR EE S, S EVEN TE EN ( 17) MI NU TE S, T HI RT Y ( 30) S EC ON DS E AS T T HR EE H UN DR ED (3 00) F EE T; T HE NC E SO UT H SE VE NT YSE VE N (7 7) D EG R EES TW EN TY -T WO ( 22 ) MI NU TE S, TH IR TY ( 30) S EC ON DS W ES T, TH RE E HU ND RE D (300) F EE T, TH EN CE N OR TH F IF T EEN ( 15) DE GR EE S, S EVEN TE EN ( 17) MI NU TE S, T HI RT Y ( 30) S EC ON DS WES T T HR EE H UN DR ED (3 00) F EET TO T HE P OI NT O F BE GI NN ING. mo re c om mo nl y kn ow n as 54249 F ou ra cr e Ci rc le Ca llaha n, F L 32011. Th is a ct io n ha s been f iled agains t yo u an d yo u ar e re quir ed t o se rv e a co py o f yo ur w ri tte n de fe ns e i f an y, up on S HA PIR O F IS HM AN & GA CH, L LP A tt or ne ys f or Plain ti ff, w ho se a dd re ss is 2424 N or th F ed er al H ighway Su it e 360 Bo ca R at on F L 33431, w it hi n th ir ty ( 30) d ay s af te r th e fi rs t publ ic at io n of th is n ot ic e and file t he o ri gi na l wi th t he cler k of t hi s Co ur t ei t her b ef or e se rv ic e on P lainti ff' s at to rn ey o r im me diat el y t her e af ter ; o th er wise a d efa ul t will b e entered a gain st yo u fo r th e re lie f de ma nded in t he C om plaint WI TN ES S my h an d an d se al of t hi s Co ur t on t he 2 0t h da y of A pr il, 2018 Jo hn A C ra wf or d Ci rc ui t and Co un ty C ou rt s By : E ar le ne F. S ca ff De pu ty C le rk If y ou a re a p er so n wi th a di sa bilit y wh o need s an y ac co mm od at io n in o rd er t o pa rti cipa te i n th is p ro ce ed ing, yo u ar e ent itle d, a t no c os t to yo u, t o th e pr ov isio n of c er ta in a ss is ta nce. Ple as e co nta ct t he A DA C oo rd inat or a t (9 04) 548460 0 pr es s 0, a t le as t 7 da ys b ef or e yo ur sch ed ul ed co ur t appear ance o r im me diat el y up on r ecei vi ng t hi s no ti fi ca ti on if th e ti me b ef or e th e sc hed ul ed appe aran ce i s le ss t ha n 7 da ys ; i f yo u ar e he ar in g or v oi ce imp ai re d, call 711. P ho ne (904) 5484909 Fax( 904)548-4949 TT D/ TT YD ial 711 EMailcale wi s@ na ss aucl er k. co m 18-311048 FC 01 WN I 2T 502-09-2018 #423595 IN THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT IN AND FOR NA SSAU COUN TY FLORIDA CI VIL AC TION Ca se #: 2018CA -000067 DI VISION: A HS BC B an k US A, N at io na l As so ciat io n as T ru st ee in tr us t fo r Ci ti gr ou p Mo rt gage L oa n Tr us t In c. As se t Ba ck ed P as s Th ro ug h Cert ificat es S er ies 2003HE 3 Plain ti ff, vs.Li sa I H ow ar d a/ k/ a Li sa H Ma rr a ; U nkno wn S po us e of Li sa I H ow ar d a/ k/ a Li sa H Ma rr a ; U nkno wn P ar ti es in Po ssess io n #1, if living a nd a ll Un kn ow n P ar ti es c laimin g by th ro ug h, u nd er a nd a ga in st th e ab ov e na me d De fe nda nt (s) wh o ar e no t kn ow n to be d ea d or a live w hethe r sa id U nkno wn P ar ti es m ay clai m an interes t as S po us e, He irs D ev is ee s G ra nt ee s o r Ot he r Cl ai ma nts ; U nkno wn P ar ti es in Po ssess io n #2 i f livin g, a nd a ll U nk no wn P ar ti es clai mi ng b y t hr ou gh u nder an d agains t th e ab ov e na me d De fe ndan t( s) w ho ar e no t kn ow n to b e dead o r alive, w he t her s ai d Un kn ow n P ar ti es m ay c laim a n in te re st as S po us e, H ei rs D ev is ee s, Gr ant ees o r Ot he r Cl ai ma nt s De fend an t( s) NO TI CE O F AC TI ON FO RE CL OS UR E P RO CE ED IN GS P RO P ER TY TO : L is a I. H ow ar d a/ k/ a Li sa H M ar ra : L AS T KN OW N AD DR ES S, 542 49 Four ac re C ircl e, C alla han F L 32011 a nd Un kn ow n Sp ou se o f Li sa I Ho wa rd a /k/a L is a H. M ar ra : LA ST K NO WN A DD RE SS, 5 4 249 Fo ur ac re C ir cl e, C alla ha n, F L 32011 Re si de nce un kn ow n i f living, inc luding a ny u nkno wn sp ou se o f th e sa id D ef en da nt s, if ei th er h as r em ar ri ed an d if e it her o r bo th o f sa id De fe nd an ts a re d ead, t he ir re sp ec ti ve u nkno wn h ei rs de vis ees g ra ntee s a ss igne es cr edit or s, lieno rs an d tr us te es an d al l ot her p er so ns c laim in g by t hr ou gh u nd er o r agains t th e na me d De fe nda nt (s ) ; a nd t he a fo re me nti on ed n am ed D ef en da nt (s ) an d su ch o f th e af or em en ti on ed u nk no wn D ef en dant s an d su ch o f th e af or em en ti on ed u nk no wn D ef en dant s as m ay b e in fa nt s, inc om pe t ent s or o t her wise n ot s ui j ur is. YO U AR E HE RE BY N OT IF IE D th at a n ac ti on h as b ee n co mm enc ed t o fo re cl os e a mo rt gage o n th e fo llo wi ng re al p ro pe rt y, lyi ng a nd b ei ng an d si tu at ed in Na ss au C ou nty F lo ri da m or e pa rt icular ly de sc ri bed as fo llo ws : TR AC T NO S IX TE EN ( 16) UN IT T WO ( 2) L EE -S TO NE R SH OR ES U NR EC OR DED, P AR T OF T HE S .A OG IL IV E ES TATE S, IN T HE WIL LI AM G IB SO N GR AN T, S EC TI ON T HI RT YSE VEN ( 37) T OW NS HI P O NE ( 1) NO RT H R AN GE T WE NT YFI VE (2 5) E AST N AS SA U CO UN TY FL OR ID A B EI NG M OR E P AR TI CU LA RL Y DE SC RI BE D AS FOL LO WS: TH E NO RT HE RL Y ON EHA LF (N 1/2 ) OF T HE FOL LO WI NG : CO MME NC E AT A N IR ON PIP E ON T HE E AS TE RL Y SI DE O F ST AT E RO AD # 11 5 (A O NE HU ND RE D (100) F OO T RI GH TOF -W AY ), T HA T IS T HR EE TH OU SA ND T WO H UN DR ED T WE NT YEI GH T AN D FIFT YSI X HU NDR ED TH S (3228.56) F EE T SO UT HE RL Y OF T HE N OR TH ER LY L IN E OF T HE L AN DS D ESC RI BE D IN D EE D BO OK 1 43, P AG E 98, O F TH E P UB LI C RE CO RD S OF S AI D CO UN TY AS M EA SU RE D AL ON G TH E SA ID E AS TE RL Y LI NE O F ST AT E RO AD #115; T HE NC E NO RT H SE VE NT YSE VE N (7 7) D EG R EES TW EN TY -T WO ( 22 ) MI NU TE S, TH IR TY ( 30 ) SE CO ND S EA ST TH RE E HU ND RE D (300 ) FE ET T O TH E P OI NT O F BE GI NN IN G; TH EN CE C ON TI NU E NO RT H SE VE NT YSE VE N (7 7) D EG R EES TW EN TY -T WO ( 22 ) MI NU TE S, TH IR TY ( 30 ) SE CO ND S EA ST TH RE E HU ND RE D (300) F EE T; TH EN CE S OU TH F IF TE EN ( 15) DE GR EE S, S EVEN TE EN ( 17) MI NU TE S, T HI RT Y ( 30) S EC ON DS E AS T T HR EE H UN DR ED (3 00) F EE T; T HE NC E SO UT H SE VE NT YSE VE N (7 7) D EG R EES TW EN TY -T WO ( 22 ) MI NU TE S, TH IR TY ( 30) S EC ON DS WES T, TH RE E HU ND RE D (300) F EE T, TH EN CE N OR TH F IF T EEN ( 15) DE GR EE S, S EVEN TE EN ( 17) MI NU TE S, T HI RT Y ( 30) S EC ON DS WES T T HR EE H UN DR ED (3 00) F EET TO T HE P OI NT O F BE GI NN ING. mo re c om mo nl y kn ow n as 54249 F ou ra cr e Ci rc le Ca lla ha n, F L 32011. Th is a ct io n ha s been f ile d agains t yo u an d yo u ar e re quir ed t o se rv e a co py o f yo ur w ri tte n de fe ns e i f an y, up on S HA PIR O F IS HM AN & GA CH, L LP A tt or ne ys f or Pla in ti ff, w ho se a dd re ss i s 2424 N or th F ed er al H ighway Su it e 360 Bo ca R at on F L 33431, w it hi n th ir ty ( 30) d ay s af te r th e fi rs t publ ic at io n of th is n ot ic e and file t he o ri gi na l wi th t he cler k of t hi s Co ur t ei t her b ef or e se rv ic e on P lain ti ff' s at to rn ey o r im me diat el y t her e af ter ; o th er wise a d efa ul t will b e entered a gain st yo u fo r th e re lie f de ma nd ed in t he C om plaint WI TN ES S my h an d an d se al of t hi s Co ur t on t he 2 0t h da y of A pr il, 2018 Jo hn A C ra wf or d Ci rc ui t and Co un ty C ou rt s By : E ar le ne F. S ca ff De pu ty C le rk If y ou a re a p er so n wi th a di sa bilit y wh o need s an y ac co mm od at io n in o rd er t o pa rti cipa te in th is p ro ce ed ing, yo u ar e ent itle d, a t no c os t to yo u, t o th e pr ov isio n of c er ta in a ss is ta nce. Ple as e co nta ct t he A DA C oo rd inat or a t (9 04) 548460 0 pr es s 0, a t le as t 7 da ys b ef or e yo ur sch ed ul ed co ur t appear ance o r im me diat el y up on r ecei vi ng t hi s no ti fi ca ti on if th e ti me b ef or e th e sc hed ul ed appe aran ce i s le ss t ha n 7 da ys ; i f yo u ar e he ar in g or v oi ce imp ai re d, call 711. P ho ne (904) 5484909 Fax( 904)548-4949 TT D/ TT YD ial 711 EMailcale wi s@ na ss aucl er k. co m 18311048 FC 01 WN I 2T 502-09-2018 #423595 NO TI CE OF IN TE NT ION TO CO NSIDER E NACTM ENT OF AN OR DI NANC E NO TI CE I S HE RE BY G IV EN th at t he N as sa u Co un ty P la nni ng a nd Zon in g Bo ar d will co nduc t a public hea ri ng o n Tu es day M ay 15, 2018 a t 6:00p m or s oo n t herea ft er a s th e ma tt er t o be h ea rd r ega rd in g th e pr op os ed O rd ina nc e Am en dm ent T he public hea ri ng w ill b e hel d at th e Ja me s S P ag e Go ve rn m ent al C om plex 96135 N as sa u Pl ace Y ul ee, F lo ri da 32097. Al so th e Na ss au Co un ty B oa rd o f Co un ty Co mm is si o ner s w ill c on duct a public hea ri ng o n Mo nday Ju ne 1 1, 2 01 8 at 6 :00p m or so on t herea ft er a s th e ma tt er to b e hea rd r eg ar ding t he pr op os ed O rd inan ce A me nd m ent Th e public hea ri ng w ill be hel d at t he Ja me s S. P ag e Go ve rn me nt al C om pl ex 96135 N as sa u Pl ac e Y ulee, Fl or ida 32097. OR DI NANC E NO 2018__ AN O RD IN ANC E OF T HE BO AR D OF C OU NT Y CO MMI SSI ON ER S OF N AS SA U CO UN TY FL OR ID A AM EN DI NG A RT IC LE 37 O F TH E LA ND D EVEL OP ME NT C OD E, S PE CI FI CA LL Y SE CT IO N 37.05 O F TH E LA ND DE VELO PM EN T CO DE NA TU RA L RE SO UR CE P RO TE CT IO N; AM EN DI NG T HE S U PPL EM EN TA L TR EE L IS T FO R L AND SC AP IN G; P RO VI DI NG F OR A LT ER NA TI VE T RE E SP EC IE S PL ANT IN G AD JA CE NT T O UT ILITIE S; PR OV IDIN G FO R BU FFE R PL AN TI NG D ET AIL ; A ME ND IN G PL AN TI NG R EQ UI RE ME NT S; PR OV IDIN G FO R CL AR IT Y IN TH E RE LA TI ON SH IP B ET W EEN BU FFE RS UT ILITIE S AND F EN CIN G ; P RO VI DI NG F OR P UR PO SE A ND I NT EN T; PRO VI DI NG FO R SE VE RA BI L ITY ; P RO VI DI NG FO R CO DI FI CA TI ON ; AND PR OV IDIN G AN E FFE CT IV E DA TE OR DI NANC E NO 2018__ AN O RD IN ANC E OF T HE BO AR D OF C OU NT Y CO MMI SSI ON ER S OF N AS SA U CO UN TY FL OR ID A AM EN DI NG A RT IC LE 37 O F TH E LA ND D EVEL OP ME NT C OD E, N AT UR AL R ESO UR CE P RO TE CT ION ; S PE CI FIC AL LY R ES CI ND IN G TH E CU RRE NT S EC TI ON 37.02 NA TI VE CA NO PY T RE E PR OT EC TI ON AN D AD DI NG A N EW S EC TI ON 37.02 A ME LI A IS LA ND T RE E PR OT EC TI ON A ND R EP LA CE ME NT ; AM EN DI NG A RT IC LE 3 2 OF T HE L AN D DE VE LO PM EN T CO DE D EF INITIO NS ; P RO VI DIN G FO R PE NAL TY ; PR OV ID IN G FO R EN FO RC EMEN T ; P RO VI DIN G FO R SE VE RA BI LI TY ; P RO VI DI NG F OR C OD IF IC AT IO N; AN D PR OV IDIN G AN E FFE CTI VE D AT E. OR DI NANC E NO 2018__ AN O RD IN ANC E OF T HE BO AR D OF C OU NT Y CO MMI SSI ON ER S OF N AS SA U CO UN TY FL OR ID A AM EN DI NG A RT IC LE 35 O F TH E LA ND D EVEL OP ME NT C OD E S TATE R OA D 200/ A1 A AC CE SS M ANAG EME NT O VE RL AY D IS TR ICT, SP EC IFIC AL LY A RT IC LE 35.09 RE GA RD IN G LA ND SC AP IN G CH AN GE S FO R CO NS ISTE NC Y WI TH C ON CURRE NT C HA NG ES TO A R TIC LE 3 2 AN D 37 A ND UP DA TE S TO T WE NT YFI VE FO OT S ET BA CK R EQ UI RE ME NT S ; P RO VI DI NG F OR P UR PO SE A ND I NT EN T; PRO VI DI NG FO R SE VE RA BI L ITY ; P RO VI DI NG FO R CO DI FI CA TI ON ; AND PR OV IDIN G AN E FFE CT IV E DA TE Al l in te re st ed p ar ti es a re in vi te d to a tt end t he p ublic he ar in gs a nd t o be h ea rd Co pies o f th e pr opos ed O rd ina nc e an d su ppo rt in g info rma ti on a re a vailabl e fo r insp ec ti on i n th e De pa rt m ent of P lanni ng a nd E co no mi c O ppo rt un ity 9 6 161 N as sa u Pl ace Y ul ee, F L 32097. Co mm ent s ma y al so b e di re ct ed in w ri ti ng t o th e De pa rt m ent of P lanni ng a nd E co no mi c O ppo rt un it y, e -m aile d to plan ning in fo @n a ssa ucounty fl.c om o r re ceiv ed b y te leph on e at ( 9 04) 530-6300. Al l co mm ent s will b ec om e pa rt of t he r ec or d in t hi s ma tte r an d su bjec t to F lo ri da s public re co rd s law. Pe rs on s wit h di sa bili ti es r equir in g ac co mm od at io ns in or de r to p ar ti ci pa te in th is pr og ra m or a ct ivit y sh ou ld co nt ac t (904) 5306 300 a t le as t tw en ty -f ou r (24) h ou rs i n advanc e to r eq ue st s uc h ac co mm od at io n. TH E PU BL IC I S IN VI TE D TO B E PR ESEN T AN D BE H EA RD I F A PE RS ON D EC ID ES T O AP PE AL AN Y DE CI SI ON M AD E BY T HE BO AR D, A GE NC Y OR C OM MI SS IO N WI TH R ES PE CT T O AN Y MA TTE R CO NS ID ER ED A T SU CH M EE TI NG O R HE AR IN G HE /S HE WIL L N EED A R EC OR D OF T HE P RO C EED IN GS A ND FO R TH AT P UR PO SE MA Y NE ED T O EN SU RE T HA T A VE RBA TI M RE CO RD O F TH E PR OC EED IN GS I S MA DE W HI CH RE CO RD I NC LU DE S TH E TE ST IMO NY A ND E VI DE NC E UP ON WH IC H A PPE AL I S TO B E BA SE D. Th e Pl an ning a nd Zon ing Bo ar d an d th e Bo ar d of Co un ty C om mi ss io ner s ma y co nt inue h ea ri ng s on t hi s ma tt er Li nda Mo rri s C hair pe rs on Na ss au C ou nt y Pl an ning a nd Zo ning B oa rd Pa t Ed w ar ds C hair ma n Na ss au C ou nt y Bo ar d of Co un ty C o mmi ssi on er s 2T 425 & 502-2018 #422423 NO TI CE OF IN TE NT ION TO CO NSIDER E NACTM ENT OF AN OR DI NANC E NO TI CE I S HE RE BY G IV EN th at t he N as sa u Co un ty P la nni ng a nd Zon in g Bo ar d will co nduc t a public hea ri ng o n Tu es day M ay 15, 2018 a t 6:00p m or s oo n t herea ft er a s th e ma tt er t o be h ea rd r ega rd in g th e pr op os ed O rd ina nc e Am en dm ent T he public hea ri ng w ill b e hel d at th e Ja me s S P ag e Go ve rn m ent al C om plex 96135 N as sa u Pl ace Y ul ee, F lo ri da 32097. Al so th e Na ss au Co un ty B oa rd o f Co un ty Co mm is si o ner s w ill c on duct a public hea ri ng o n Mo nday Ju ne 1 1, 2 01 8 at 6 :00p m or so on t herea ft er a s th e ma tt er to b e hea rd r eg ar ding t he pr op os ed O rd inan ce A me nd m ent Th e public hea ri ng w ill be hel d at t he Ja me s S. P ag e Go ve rn me nt al C om pl ex 96135 N as sa u Pl ac e Y ulee, Fl or ida 32097. OR DI NANC E NO 2018__ AN O RD IN ANC E OF T HE BO AR D OF C OU NT Y CO MMI SSI ON ER S OF N AS SA U CO UN TY FL OR ID A AM EN DI NG A RT IC LE 37 O F TH E LA ND D EVEL OP ME NT C OD E, S PE CI FI CA LL Y SE CT IO N 37.05 O F TH E LA ND DE VELO PM EN T CO DE NA TU RA L RE SO UR CE P RO TE CT IO N; AM EN DI NG T HE S U PPL EM EN TA L TR EE L IS T FO R L AND SC AP IN G; P RO VI DI NG F OR A LT ER NA TI VE T RE E SP EC IE S PL ANT IN G AD JA CE NT T O UT ILITIE S; PR OV IDIN G FO R BU FFE R PL AN TI NG D ET AIL ; A ME ND IN G PL AN TI NG R EQ UI RE ME NT S; PR OV IDIN G FO R CL AR IT Y IN TH E RE LA TI ON SH IP B ET W EEN BU FFE RS UT ILITIE S AND F EN CIN G ; P RO VI DI NG F OR P UR PO SE A ND I NT EN T; PRO VI DI NG FO R SE VE RA BI L ITY ; P RO VI DI NG FO R CO DI FI CA TI ON ; AND PR OV IDIN G AN E FFE CT IV E DA TE OR DI NANC E NO 2018__ AN O RD IN ANC E OF T HE BO AR D OF C OU NT Y CO MMI SSI ON ER S OF N AS SA U CO UN TY FL OR ID A AM EN DI NG A RT IC LE 37 O F TH E LA ND D EVEL OP ME NT C OD E, N AT UR AL R ESO UR CE P RO TE CT ION ; S PE CI FIC AL LY R ES CI ND IN G TH E CU RRE NT S EC TI ON 37.02 NA TI VE CA NO PY T RE E PR OT EC TI ON AN D AD DI NG A N EW S EC TI ON 37.02 A ME LI A IS LA ND T RE E PR OT EC TI ON A ND R EP LA CE ME NT ; AM EN DI NG A RT IC LE 3 2 OF T HE L AN D DE VE LO PM EN T CO DE D EF INITIO NS ; P RO VI DIN G FO R PE NAL TY ; PR OV ID IN G FO R EN FO RC EMEN T ; P RO VI DIN G FO R SE VE RA BI LI TY ; P RO VI DI NG F OR C OD IF IC AT IO N; AN D PR OV IDIN G AN E FFE CTI VE D AT E. OR DI NANC E NO 2018__ AN O RD IN ANC E OF T HE BO AR D OF C OU NT Y CO MMI SSI ON ER S OF N AS SA U CO UN TY FL OR ID A AM EN DI NG A RT IC LE 35 O F TH E LA ND D EVEL OP ME NT C OD E S TATE R OA D 200/ A1 A AC CE SS M ANAG EME NT O VE RL AY D IS TR IC T, SP EC IFIC AL LY A RT IC LE 35.09 RE GA RD IN G LA ND SC AP IN G CH AN GE S FO R CO NS ISTE NC Y WI TH C ON CURRE NT C HA NG ES TO A R TIC LE 3 2 AN D 37, A ND UP DA TE S TO T WE NT YFI VE FO OT S ET BA CK R EQ UI RE ME NT S ; P RO VI DI NG F OR P UR PO SE A ND I NT EN T; PRO VI DI NG FO R SE VE RA BI L ITY ; P RO VI DI NG FO R CO DI FI CA TI ON ; AND PR OV IDIN G AN E FFE CT IV E DA TE Al l in te re st ed p ar ti es a re in vi te d to a tt end t he p ublic he ar in gs a nd t o be h ea rd Co pies o f th e pr opos ed O rd ina nc e an d su ppo rt in g info rma ti on a re a vailabl e fo r in sp ec ti on in th e De pa rt m ent of P lanni ng a nd E co no mi c O ppo rt un ity 9 6 161 N as sa u Pl ace Y ul ee, F L 32097. Co mm ent s ma y al so b e di re ct ed in w ri ti ng t o th e De pa rt m ent of P lanni ng a nd E co no mi c O ppo rt un it y, e -m aile d to plan ning in fo @n a ssa ucounty fl.c om o r re ceiv ed b y te le ph on e at ( 9 04) 530-6300. Al l co mm ent s will b ec om e pa rt of t he r ec or d in t hi s ma tte r an d su bjec t to F lo ri da s public re co rd s law. Pe rs on s wit h di sa bili ti es r equir in g ac co mm od at io ns i n or de r to p ar ti ci pa te in th is pr og ra m or a ct ivit y sh ou ld co nt ac t (904) 5306 300 a t le as t tw en ty -f ou r (24) h ou rs i n advanc e to r eq ue st s uc h ac co mm od at io n. TH E PU BL IC I S IN VI TE D TO B E PR ESEN T AN D BE H EA RD I F A PE RS ON D EC ID ES T O AP PE AL AN Y DE CI SI ON M AD E BY T HE BO AR D, A GE NC Y OR C OM MI SS IO N WI TH R ES PE CT T O AN Y MA TTE R CO NS ID ER ED A T SU CH M EE TI NG O R HE AR IN G HE /S HE WIL L N EED A R EC OR D OF T HE P RO C EED IN GS A ND FO R TH AT P UR PO SE MA Y NE ED T O EN SU RE T HA T A VE RBA TI M RE CO RD O F TH E PR OC EED IN GS I S MA DE W HI CH RE CO RD I NC LU DE S TH E TE ST IMO NY A ND E VI DE NC E UP ON WH IC H A PPE AL I S TO B E BA SE D. Th e Pl an ning a nd Zon in g Bo ar d an d th e Bo ar d of Co un ty C om mi ss io ner s ma y co nt inue h ea ri ng s on t hi s ma tt er Li nda Mo rri s C hair pe rs on Na ss au C ou nt y Pl an ning a nd Zo ning B oa rd Pa t Ed w ar ds C hair ma n Na ss au C ou nt y Bo ar d of Co un ty C o mmi ssi on er s 2T 425 & 502-2018 #422423 NO TI CE OF PUBLIC SALE BI LL S TO WI NG g ives N ot ic e of F or eclo su re o f Li en a nd i nt ent t o se ll t hes e ve hicles o n 05/15/2018 8 :3 0 am a t 425 S 8TH ST F ER NAND IN A, F L 320343609 p ur su an t to s ub se ct io n 713.78 o f th e Fl or id a St at ut es BI LL S TO WI NG r eser ve s th e ri gh t to a ccept o r re je ct a ny an d/or all bids 1G1PA 5S H1D 7211595 2013 CH EV RO LE T 1T 502-201 8 #423732 PU BLIC NO TI CE Th e quar te rl y m eet in g of th e Na ss au C ou nt y Tr an spo rt at io n Di sa dv an ta ge d Lo ca l C oor dina ti ng B oa rd w ill ta ke p lace a t 2 p. m. Th ur sda y, M ay 17, 2 018, a t th e Na ss au C ou nt y Co mm is si on Ch am be rs 96135 N as sa u Pl ac e, Y ulee FL A ll in te re st ed pe rs on s ar e invi te d to a ttend Th e No rt hea st F lo ri da R eg io nal C ounc il a dheres t o th e Am er ican s wi th D is abilit ie s Ac t an d will m ak e re as on able mo di fi ca ti on s fo r ac ce ss t o th is m ee ti ng u po n re ques t. Re ques ts s houl d be r ec ei ve d at lea st 7 2 hour s in a dv ance of t he m ee ti ng in or de r to a llo w ti me t o pr ov id e th e re qu es te d se rv ice. F or m or e in fo rm at ion c on ta ct t he No rt hea st F lo ri da R eg io na l Co un ci l at ( 904) 2 79-0880 b et we en th e ho ur s of 8 a m. -5 p m. Mo nday t hr ou gh F ri da y. 1T 502-201 8 #423508 PUBLIC AU CT ION At lant ic S el f St or ag e PU BLI C AU CT IO N will b e on T hu rs da y, M ay 24, 2018 a t 10 :0 0 AM loc at io n: 464017 E S R 200 Yu le e FL 3 2097 U ni t 31 L or i An n Jo ne s (V IN JH 2M C1 3 09F K 02432 7; U ni t 410 Sh inda na A B ro wn ; Un it 4 54 Rich ar d K Rice ; U ni t 416/417 Ch as id y M On ea l Th e ab ov e ar e de linqu en t in r ent a nd u nd er F L St at ut es 83.806 t he c on te nt o f th ei r un it s w ill be s ol d at p ublic sal e wi th a 1 0% b uy er s pr emiu m. Th e ab ov e un it s co nt ai n ho us eho ld g oo ds u nl es s ot her wise n ot ed Al l V ehicl es a re so ld A SIS P AR TS O NL Y T er ms of s al es a re C AS H ON LY a t th e end o f ea ch auc ti on 2T 425 & 502-2018 #422032 IN THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT, IN AND FOR NA SSAU COUN TY FLORIDA CA SE NU MB ER: 45-2012DP -0 7 IN T HE I NT ER ES T OF : K. A. W. D OB : 01/10/2003 A MI NO R CH IL D SU MMO NS AND N OT IC E OF AC TI ON B Y PU BL IC AT IO N FO R TE RM IN AT IO N OF P AR EN TA L RI GH TS TH E ST AT E OF F LO RI DA TO : T ra c ey B on it a Br itt A ddr es s un kn ow n YO U AR E HE RE BY N OT IF IE D th at a P et itio n ha s be en f ile d in t he a bo ve -s ty le d Co ur t by th e ST AT E OF F LO RI DA D EPA RT ME NT O F CH IL DR EN A ND FA MI LI ES f or t er mi na ti on o f pa re nt al r ight s an d pe rm an ent c om mi tm en t fo r su bs equ en t ad op ti on o f th e ab ov e na me d fe ma le c hild K .A.W bo rn o n Januar y 10, 2003 i n Du va l Co un ty F lo ri da Y ou ar e hereb y co mma nd ed t o appe ar b ef or e th e Ge ner al Magi st ra te J anet A Ca rv er a t th e Robe rt M F os te r Ju st ice C enter Th ir d Fl oor C ou rt r oom A, 7 6347 V et er an s Wa y, Y ul ee Fl or id a 32097 a t th e ho ur o f 2:00 p .m on M ay 2 5, 2018. Yo u must a pp ea r at t he hea rin g on t he d at e an d ti me sp ecif ied. YO UR F AI LU RE T O PE RS ON AL LY A PP EA R FO R TH IS A DV ISO RY H EARI NG C ON ST IT UT ES CO NS EN T TO T HE T ER MI NA TI ON O F PA RE NTAL R IG HT S TO TH IS C HI LD I F YO U FA IL T O AP PE AR O N TH E DA TE A ND TI ME S PE CI FI ED Y OU M AY LO SE A LL L EG AL R IG HT S TO TH E CH IL D NA ME D IN T HE P ET ITI ON P UR SU AN T TO S EC TI ON 39.801( 3)(d), F LO RI DA S TATUT ES ( 2 017) Pu rs uant t o se c ti on s 39.802 (4 )(d ) an d 63.082( 6)(g), F lo ri da S tatute s ( 2017 ) yo u ar e he re by inf or me d of t he a vail abilit y of p ri va te p lac em en t wi th a n ad op ti on ent ity a s de fi ne d in s ec ti on 63.032(3) Fl or id a St at ut es ( 2017) Yo u ha ve t he r ig ht t o be r ep re s ented b y an a tt or ne y in t hi s ma tt er a nd b y cou rt -a ppo in ted c ou nsel i f yo u ar e indi ge nt In di vi duals wi th d is abilit ies n eed in g a re as on able a cc om mo da ti on t o pa rt icipat e in t hi s pr oc eedin g sh ou ld c on ta c t th e ADA C oor dina to r as s oon a s po ssi bl e, t eleph on e (9 04) 548 4600; o r if he ar in g or v oi c e im pair ed call 711. WI TN ES S my h an d as c le rk of s ai d Co ur t an d th e Se al t her eo f, t hi s 3r d da y of A pr il, 2018. Jo hn C ra wf or d as C le rk o f Sa id C ou rt By : Kar en J. L oc ke tt As D eput y Cl er k L A nn H end ri c ks E sq ui re S eni or A tt or ne y/ Ch ildr en' s Le gal Se rv ic es Fl or ida Ba r No .: 0834394 ST AT E OF F LO RI DA DE PA RT ME NT O F CH IL DR EN AN D FA MI LI ES 463688 St at e Ro ad 200 Su it e 3 Yu le e, F L 320 97 (9 04)557-910 2 4T 411-1825 & 502-2018 #418406 IN THE CI RC UIT COUR T OF TH E FOUR TH JUDICIAL CI RC UIT, IN AND FOR NA SSAU COUN TY FLORIDA CA SE NU MB ER: 45-2012DP -0 7 IN T HE I NT ER ES T OF : K. A. W. D OB : 01/10/2003 A MI NO R CH IL D SU MMO NS AND N OT IC E OF AC TI ON B Y PU BL IC AT IO N FO R TE RM IN AT IO N OF P AR EN TA L RI GH TS TH E ST AT E OF F LO RI DA TO : T ra c ey B on it a Br itt A ddr es s un kn ow n YO U AR E HE RE BY N OT IF IE D th at a P et itio n ha s be en f iled in t he a bo ve -s ty le d Co ur t by th e ST AT E OF F LO RI DA D EPA RT ME NT O F CH IL DR EN A ND FA MI LI ES f or t er mi na ti on o f pa re nt al r ight s an d pe rm an ent c om mi tm en t fo r su bs equ en t ad op ti on o f th e ab ov e na me d fe ma le c hild K .A.W bo rn o n Januar y 10, 2003 in Du va l Co un ty F lo ri da Y ou ar e hereb y co mma nd ed t o appe ar b ef or e th e Ge ner al Magi st ra te J anet A Ca rv er a t th e Robe rt M F os te r Ju st ic e C enter Th ir d Fl oor C ou rt r oom A, 7 6347 V et er an s Wa y, Y ul ee Fl or id a 32097 a t th e ho ur o f 2:00 p .m on M ay 2 5, 2018. Yo u must a pp ea r at t he hea rin g on t he d at e an d ti me sp ecif ied. YO UR F AI LU RE T O PE RS ON AL LY A PP EA R FO R TH IS A DV ISO RY H EARI NG C ON ST IT UT ES CO NS EN T TO T HE T ER MI NA TI ON O F PA RE NTAL R IG HT S TO TH IS C HI LD I F YO U FA IL T O AP PE AR O N TH E DA TE A ND TI ME S PE CI FI ED Y OU M AY LO SE A LL L EG AL R IG HT S TO TH E CH IL D NA ME D IN T HE P ET ITI ON P UR SU AN T TO S EC TI ON 39.801( 3)(d), F LO RI DA S TA TUT ES ( 2 017) Pu rs uant t o se c ti on s 39.802 (4 )(d ) an d 63.082( 6)(g), F lo ri da S tatute s ( 2017 ) yo u ar e he re by inf or me d of t he a vail abilit y of p ri va te p lac em en t wi th a n ad op ti on ent ity a s de fi ne d in s ec ti on 63.032(3) Fl or id a St at ut es ( 2017) Yo u ha ve t he r ig ht t o be r ep re s ented b y an a tt or ne y in t hi s ma tt er a nd b y cou rt -a ppo in ted c ou nsel if yo u ar e indi ge nt In di vi duals wi th d is abilit ie s n eed in g a re as on able a c c om mo da ti on t o pa rt icipat e in t hi s pr oc eedin g sh ou ld c on ta c t th e ADA C oor dina to r as s oon a s po ssi bl e, t eleph on e (9 04) 548 4600; o r if he ar in g or v oi c e im pair ed call 711. WI TN ES S my h an d as c le rk of s ai d Co ur t an d th e Se al t her eo f, t hi s 3r d da y of A pr il, 2018. Jo hn C ra wf or d as C le rk o f Sa id C ou rt By : Kar en J. L oc ke tt As D eput y Cl er k L A nn H end ri c ks E sq ui re S eni or A tt or ne y/ Ch ildr en' s Le gal Se rv ic es Fl or ida Ba r No .: 0834394 ST AT E OF F LO RI DA DE PA RT ME NT O F CH IL DR EN AN D FA MI LI ES 463688 St at e Ro ad 200 Su it e 3 Yu le e, F L 320 97 (9 04)557-910 2 4T 411-1825 & 502-2018 #418406 NO TI CE OF AGEN CY AC TION TAKEN BY TH E ST JO HNS RI VE R WAT ER MANA GEMEN T DIST RI CT No ti ce is give n th at t he f ol lo wi ng p er mi t wa s is su ed o n Ma rc h 20, 2018: Fi rs t Na ti on al B an k S outh P.O B ox 2 028, A lma G eo rg ia 31510 p er mi t # 1430313 T he pr oj ec t is loc at ed in Na ss au Co un ty Se ct io n 24, 25, T ow nsh ip 3 N So ut h R an ge 2 8 Ea st Th e pe rm it a ut ho ri ze s a su rfa ce wat er m an agem ent s ys te m on 2 4. 05 a cr es f or m ul ti fam ily h ou si ng k no wn a s Vi nta ge A me lia T he r ecei vi ng wa te r bo dy is Jack so n Cr ee k. A pe rs on w ho se s ub st an ti al int er es ts a re o r ma y be affe ct ed h as t he r ight t o re qu es t an a dm inis tr at iv e hea rin g by f ilin g a wr it te n pe ti ti on wi th t he S t J o hns R iver Wat er Ma na ge m ent D is tr ic t (D is tr ic t) P ur su an t to C ha pt er 2 8106 a nd R ul e 40 C1.1 007, Fl or id a Ad mi ni st ra ti ve C od e (F .A.C ) t he p etit io n mu st b e file d (r ec ei ve d) e it her b y de liver y at t he o ff ic e of t he D is tr ic t Cl er k a t Di st ri ct H ea dquar te rs P. O. B ox 142 9 P alat k a FL 321 78 1429 ( 4049 R ei d St P alat k a FL 32177) o r by e ma il w it h th e Di st ri ct C le rk a t Cl er k@s jr wm d.com, w it hi n tw ent yon e (21) d ay s of ne ws pa pe r publicat io n of t he no ti ce o f Di st ri ct d ecis io n (f or th os e pe rs on s to w ho m th e Di st ri ct d oe s no t ma il o r emai l ac tu al n ot ice) A pe ti ti on mu st c om pl y wi th S ec ti on s 120.54( 5)(b)4 an d 120.569 (2 ) (c ), F lo ri da S ta tu te s (F .S .) a nd Ch ap te r 28 106, F .A.C T he Di st ri ct w ill n ot a ccept a p etiti on s ent b y fa cs imile ( fax) Me diat io n pu rs ua nt t o Se cti on 120.57 3 F .S., m ay b e availabl e an d ch oo si ng m ediat io n do es n ot a ffe ct y ou r ri gh t to a n ad mi ni st ra ti ve he ar in g. A pe ti ti on f or a n ad mi ni str at iv e he ar in g is d ee me d file d up on r ec eipt o f th e co mp le te p et itio n by t he D is tr ic t Cl er k a t th e Di st ri ct H eadquar te rs in Pa la tk a, F lo ri da du ri ng t he D is tr ic t' s re gu la r bu si nes s ho ur s. T he D is tr ic t' s re gu la r bu si nes s hour s ar e 8 a.m 5 p .m e xcludi ng we eken ds a nd D is tr ic t ho lida ys P etit io ns r ec ei ve d by th e Di st ri ct C le rk a ft er t he D is tr ic t' s re gu la r bu si nes s ho ur s sh al l be d eemed f ile d as o f 8 a. m. o n th e Di st ri ct 's n ex t re gular b us ine ss da y. T he D is tr ic t' s acce pt an ce o f pe titi on s file d by e -m ai l is s ubject t o ce rt ai n co ndit io ns s et f or th in th e Di str ic t' s St at emen t of A ge nc y Or ga ni za ti on a nd O pe ra ti on (i ss ue d pu rs uant t o Rule 28101.001, Flo ri da A dm inis tr at iv e Co de) w hich is availabl e fo r vi ew in g at www.sj rw md .c om T hes e co nd itio ns inclu de b ut ar e no t limit ed t o t he p et itio n be in g in t he f or m of a P DF o r TI FF file a nd b eing c apable o f be in g st or ed a nd p ri nt ed b y th e Di st ri ct F ur t her p ur su an t to t he D is tr ic t' s St at em en t of Ag enc y Or ga ni za ti on a nd Op er at io n, a tt em pt in g to f ile a pe titi on b y fa cs imile ( fa x) i s pr oh ibit ed a nd s ha ll n ot c on st it ut e filing. Th e ri gh t to a n ad mi ni st ra ti ve hea ri ng a nd t he r el ev an t pr oc ed ur es t o be f ollo we d ar e go ve rn ed b y Chap te r 120 F lo ri da S ta tute s, C hapt er 28106, F lo ri da A dm inis tr at iv e Co de an d Rule 40C 1 .1007 Fl or id a Ad mi ni st ra ti ve C od e. Be caus e th e ad mi ni st ra ti ve he ar in g pr oc es s is d es igned to f or mu la te f inal age nc y ac ti on t he f ilin g of a p et itio n me an s th e Di st ri ct 's f in al a cti on m ay b e di ff eren t fr om th e po si ti on t ak en b y it in th is no ti ce Failu re t o file a p et iti on f or a n ad mi ni st ra ti ve he ar in g wi th in t he r eq ui si te ti me f ra me s hall c on st it ut e a wa iver o f th e ri gh t to a n ad mi ni st ra ti ve h ea ri ng (R ul e 28106.111, F .A.C.) If y ou wis h to d o so ple as e visi t ht tp ://www. sj rw md .co m/ no r_ de c/ t o re ad t he co mp le te N ot ic e of R ight s to de te rm in e an y lega l ri gh ts yo u ma y ha ve c on ce rn in g th e Di st ri ct 's int en de d deci si on (s ) on t he p er mi t applicati on (s ) de sc ri be d ab ov e. Y ou ca n al so r eq ue st t he N ot ic e of R ig ht s by c on ta ct in g th e Di re ct or o f Re gu la to ry S up po rt 4049 R ei d St ., Palat ka F L 321772529, t ele. n o. ( 386 ) 3294570. #423485 1 FNL05020502EEEE96 1 5/1/18 1:13 PM

PAGE 9

The following report was compiled by Pamela Bushnell of the News-Leader from the April 26 court docket of the Circuit Court of Judge Robert M. Foster. Sierra Leanne Adams admitted to violation of probation for possession of a controlled substance, possession of cocaine, possession of controlled substance paraphernalia and possession of new or legend drugs without a prescription. She was adjudicated guilty and sentenced to five months in Nassau County Jail after which probation will be reinstated. Sean Wilson Armstrong pleaded guilty to two charges of resisting arrest with violence and one charge each of driving under the influence, driving while his license was suspended or revoked, refusal to submit to a DUI test and giving false identification to a law enforcement officer. He was adjudicated guilty on all counts and sentenced to nine months in Nassau County Jail with credit for time served followed by one year of probation. Within 30 days of release he must enroll in Level 2 DUI school and enroll in the Victim Impact Panel. Within 60 days of release he must submit to a drug and alcohol evaluation and follow treatment recommendations. His drivers license will be suspended for six months and he must use an ignition interlock device on his vehicle for one year. He was ordered to pay $418 in court costs, $100 to the State Attorneys Office, $150 to the Public Defenders Office plus $1,000 in fines. Brenda Carol Brown pleaded guilty to four charges of possession of a controlled substance and one charge each of possession of controlled substance paraphernalia and improper attachment of a license tag to a vehicle. She was adjudicated guilty and sentenced to six months in Nassau County Jail with credit for time service, to be followed by 18 months of drug offender probation. Conditions of probation include submission to a drug and alcohol evaluation within 60 days of release, compliance with treatment recommendations and random urinalysis. She must pay $518 in court costs, $100 to the State Attorneys Office and $150 to the Public Defenders Office. Ramiro Rene Cortez pleaded guilty to possession of a controlled substance and aggravated fleeing and eluding of a police officer. He was adjudicated guilty and sentenced to two years in Florida State Prison with credit for time served in NCJ. He was ordered to pay $1,036 in court costs and $200 to the State Attorneys Office. Jakob Nathaniel Crow denied violation of probation for possession of a weapon on school property. Marissa Dominic Davila pleaded guilty to grand theft of a motor vehicle, introducing contraband into a county jail, possession of cocaine and possession of controlled substance paraphernalia. Adjudication was withheld. She was sentenced to 90 days in Nassau County Jail with credit for time served followed by enrollment in an inpatient substance abuse treatment program within 30 days of release and 18 months of subsequent drug offender probation to include random urinalysis. She was ordered to pay $836 in court costs and $100 to the State Attorneys Office. Devin Joshua Dawley admitted violation of probation for possession of a controlled substance. He was adjudicated guilty. Probation was revoked and terminated. He was sentenced to 13 months in Florida State Prison and ordered to pay $1,111.76 in outstanding court costs. Ginger Lynn Freet pleaded guilty to grand theft. She was adjudicated guilty and sentenced to time served in Nassau County Jail and 12 months of probation. She must pay $8,000 in restitution, $418 in court costs, $100 to the State Attorneys Office and $150 to the Public Defenders Office. Kristen Murdaugh Griffin admitted violation of probation for possession of a controlled substance and driving under the influence. Adjudication was withheld. Probation was reinstated under original terms with conditions she continue outpatient treatment and parenting classes. There will be no consideration of early termination of probation. She must pay $1,944.08 in outstanding court costs. Jason Brandon Harris pleaded not guilty to the sale or delivery of heroin. Christina Lynn Hayes pleaded guilty to two charges of the sale or delivery of a controlled substance. She was adjudicated guilty and sentenced to time served in Nassau County Jail and 18 months probation. She must remain in jail until an inpatient bed is available at Gateway and must comply with their aftercare program upon discharge. She was ordered to pay $1,036 in court costs, $200 to the State Attorneys Office and $300 to the Public Defenders Office. Samuel Ishmael Bernard Herrings motion to dismiss a violation of probation charge was granted. John Johnson II pleaded guilty to aggravated stalking and criminal mischief. He was adjudicated guilty on both counts and sentenced to time served in Nassau County Jail and 18 months probation. He must successfully complete inpatient treatment at Stewart-Marchman-Act Behavioral Healthcare in Deland. He was ordered to pay $418 in court costs, $100 to the State Attorneys Office and $150 to the Public Defenders Office. Kiree Shonell Lanier pleaded guilty to the sale, manufacture or delivery of a controlled substance. Adjudication was withheld. He was sentenced to four months in Nassau County Jail with credit for time served and four months of probation. He must pay court costs of $518, $100 to the State Attorneys Office and $150 to the Public Defenders Office. Leroy Shane Lee waived his right to a speedy trial on charges of possession of a concealed firearm by a convicted felon, possession of ammunition by a convicted felon and driving while his license was suspended or revoked. Tyrone Lavon Lee Jr. pleaded guilty to two charges of the sale, manufacture, or delivery of a controlled substance. He was adjudicated guilty and sentenced to three years in Florida State Prison with credit for time served. He must continue to take medication as prescribed and must obtain a mental health evaluation within 30 days of release and comply with treatment recommendations. He was ordered to pay $1,036 in court costs, $200 to the State Attorneys Office and $300 to the Public Defenders Office. Eric Lavan Lokey pleaded guilty to four charges of burglary of a structure or conveyance and three charges of fraudulent use of a credit card. He was adjudicated guilty and sentenced to time served followed by 18 months probation, which will be served in South Carolina. He must pay $2,000 in restitution, $418 in court costs, $100 to the State Attorneys Office and $150 to the Public Defenders Office. Garet Lee Massengill pleaded guilty to habitually driving while his license was suspended and to possession of controlled substance paraphernalia. He was adjudicated guilty and sentenced to 44 days of time served in Nassau County Jail. He must pay $418 in court costs, $100 to the State Attorneys Office and $150 to the Public Defenders Office. Kirston Lionel Morison pleaded not guilty to aggravated fleeing and eluding a police officer with injury or damage and driving while his license was suspended or revoked. Malik Angelo Young Moultrie pleaded guilty to the sale of cannabis. He was adjudicated guilty and sentenced to time served in Nassau County Jail and three years of drug offender probation. He must obtain a drug and alcohol evaluation within 60 days and comply with treatment recommendations. Early termination of probation may be considered after 18 months of compliance. He was ordered to pay $518 in court costs, $100 to the State Attorneys Office and $150 to the Public Defenders Office. Paul Matthew Patterson denied violation of probation for dealing in stolen property and grand theft. David Lawton Petty pleaded guilty to fleeing and eluding a police officer. He was adjudicated guilty and sentenced to 13 months in Florida State Prison with credit for time served. He must pay $418 in court costs, $100 to the State Attorneys Office and $150 to the Public Defenders Office. Jennifer Rebecca Pope admitted violation of probation for possession of a controlled substance and possession of controlled substance paraphernalia. She was adjudicated guilty. Probation was revoked and terminated. She was sentenced to three months in Nassau County Jail followed by 18 months of probation. She must enroll in and attend the Starting Point drug treatment program immediately upon release. She must pay $1,259.44 in outstanding court costs. Leo Thomas Rains Jr. pleaded not guilty to lewd or lascivious battery. Barbara Valentine Ringklib pleaded guilty to possession of a controlled substance. Adjudication was withheld. She was sentenced to time served in Nassau County Jail and ordered to pay $518 in court costs, $100 to the State Attorneys Office and $150 to the Public Defenders Office. David Cecil Scheider admitted violation of probation for three counts of possession of a controlled substance and one count of possession of less than 20 grams of cannabis. Adjudication was withheld. He was sentenced to time served in Nassau County Jail. Probation was reinstated under original terms and conditions and extended six months. William Christopher Short admitted violation of probation for the use of anothers identification without consent and grand theft. He was adjudicated guilty. Probation was reinstated subject to original terms and conditions and extended 12 months. He was ordered to continue paying $50 per week toward outstanding court costs and to submit three job applications weekly. Jackie Alan Southerland pleaded not guilty to driving while his license was permanently revoked and waived his right to a speedy trial. Marcel Antonio Arness Stewart admitted violation of probation for possession of a controlled substance, possession of cocaine, possession of less COURT Continued on 10A VAPE on 8th...NOW OPEN! NOW OPEN! FLORIDA SUNConstruction Specializing in everything under the sun Call: 904-206-0857 CongratulationsTonya Rice 1st Quarter Top Sales Agent474303 E. State Road 200 Fernandina Beach, FL 32034 Cell: (904) 608-1540 email: tonyaricerealtor@gmail.com B B B USINESS USINESS USINESS C C C C C C ARD ARD ARD C ARD C C C ARD C ARD C ARD C C C ARD C B B B ILL ILL ILL B B B OARD OARD OARD Island Art Association Island Art Gallery A Co-Op Gallery of Nassau County Artists904.261.7020 18 N 2nd Street | Fernandina Beach, FL 32034 www.islandart.org creating educating inspiring F LOCALLY OWNED & OPERATED Bruce Jackson, Ownerbcjackson@rocketmail.comLICENSED AND INSUREDGULF COAST ALUMINUM, INC. Carports Patio Covers Screen Rooms Pool Enclosures Screen Repairs850-933-0582 Deer Walk Shopping Center next to Dave Turner Plumbing474378 East State Road 200 (A1A) 904.310.6915MOST RECOMMENDED VAPE SHOP IN NE FLA! PREMIUM VAPEE-CIGS MODS COILS E-JUICE VAPE on 8th... 3032 S. 8TH ST. FERNANDINA BEACH FLORIDA 32034 OFFICE: 904-677BUGS (2847) OFFICE MGR, 904-321-4000 CELL 904-682-1374 OLD FASHIONED SERVICE WITH THE FINEST CHEMICALS. WHERE CUSTOMER SERVICE IS THE DIFFERENCERON ALLEMAN 20 YEAR PLASTER MOST RECOMMENDED VAPE GULF COAST ALUMINUM VAPE on 8th... next to Dave Turner Plumbing 474378 East State Road 200 (A1A) 904.310.6915 Contact Your News-LeaderAdvertising Salesperson for Details On Including Your Business On the Business Card BillBoard261-3696 Contact Your News-Leader NL 6 col. Wed 05.02.indd 9 5/1/18 3:58 PM

PAGE 10

fasting regimen, people limit their meals on one day, usually 500 calories. On the next day, they can eat anything at all. It can be truly called a feasting day, Anton said. A second version of this fasting method is to eat nothing at all on one day while feasting the next. In a review of scientific literature, Anton and his colleagues found that people lost significant body fat in 10 of 10 clinical trials involving alternate-day fasts. So in my mind, its not a question of whether it works for producing fat loss, Anton said. Three of four time-restricted feeding studies demonstrated significant fat loss. In most studies, participants did not lose significant lean tissue, which is tissue other than fat that includes the bodys organs, muscles and skeleton. An adequate amount of lean tissue, Anton said, is necessary to help maintain good physiological function as people age, among other health benefits. Other forms of dieting, however, often lead to a reduction in both fat and lean tissue, he said. Anton said research in rodents and other nonhuman species points to the possibility that food restriction, and the turning of that metabolic switch, can lengthen lifespan, improve metabolic health, cognitive and physical performance, lower inflammation and lead to superior cardiovascular health. An important takeaway is that we all have the ability to switch our metabolism from glucose to ketone utilization, said Anton. And that switch has the potential to have profound health benefits for us, in addition to the positive changes in body composition. Anton urges anyone considering a new diet to consult with a physician, noting fasting may not be the right for everyone. Co-authors of the paper include William T. Donahoo, M.D., an associate professor in the UF College of Medicines division of endocrinology, diabetes and metabolism; Stephanie A. Lee, a doctoral student in the UF College of Medicines department of aging and geriatric research and the department of clinical and health psychology in the UF College of Public Health and Health Professions; Arch G. Mainous III, Ph.D., the Florida Blue Endowed Professor of Health Administration and chair of health services research, management and policy in the UF College of Public Health and Health Professions; Christiaan Leeuwenburgh, Ph.D., a professor and chief of the UF College of Medicines division of biology of aging who also is affiliated with the UF Institute on Aging; and researchers from The Johns Hopkins University and the National Institute on Aging Intramural Research Program, both in Baltimore.Continued from 6A Pamela Bushnell of the News-Leader compiled this report from records at the Nassau County Clerk of the Circuit Court. Arrest indicates suspicion of a crime, not guilt. To report information about a crime, contact the Fernandina Beach Police Department at 277-7342 or the Nassau County Sheriffs Office at 225-5174. The We Tip program 1-800-78Crime also allows callers to leave anonymous tips. Joseph Abraham Hamza, 19, 45107 Booth St., Callahan, April 19, burglary of an unoccupied dwelling, four charges of contributing to the delinquency of a minor and allowing an unauthorized minor to drive. Jakob Nathaniel Crow, 20, 2736 Karas Circle, Hilliard, April 20, armed burglary and theft of a gun from a building. Dante Anthony Galloro, 25, 594 Amelia Circle, Fernandina Beach, April 20, aggravated battery with a deadly weapon. David Wayne Holcombe, 48, 86173 Palmetto St., Yulee, April 20, possession of a weapon by a convicted felon, possession of a controlled substance with intent to sell, possession of a controlled substance, possession of drug paraphernalia with residue and three charges of the sale of a controlled substance. Michael Sean Taber, 46, 8432 Bining St., Jacksonville, April 21, retail theft. Clayton Tyler Crews, 19, 371352 Kings Ferry Road, Hilliard, April 22, aggravated assault with a deadly weapon. Laura Nicole Modinger, 40, 85793 Avant Road, Yulee, April 22, possession of a controlled substance.rfrfA Florida appeals court ruled in March 2018 that a jury should hear a case concerning injuries a woman sustained in 2014 while volunteering at the Nassau County Humane Societys dog park in Fernandina Beach. The case involves a complaint filed in 2015 with the Fourth Judicial Circuit Court by Deborah Davison of Fernandina Beach against Rebecca Berg and the Nassau Humane Society, Inc. claiming negligence. Davison was a volunteer at the dog park located on Airport Road in Fernandina Beach. The Nassau Humane Society operates the park. According to court records, Davison was knocked down in December of 2014 by Bergs dog while it was running with other large dogs at the park. Davisons leg was broken in the incident. Davisons case alleged that the NHS failed to warn her about the danger of the dog and to make Berg take precautions so that the dog would not be a danger to her while on the premises. In his March 2017 summary judgment in favor of Berg, Judge Steven M. Fahlgren said that the Humane Societys consent form and posted rules at the park warned Davison of the danger of injury from working at the park. Plaintiff actually consented to participate in the risk-inherent activity of volunteering at the park, Fahlgrens judgment reads, noting the presence of Dog Park Rules and Enter at Your Own Risk signs, taken together and ... (putting) defendant on notice of the canine-related behavior and risks at play here. However, the First District Court of Appeal found that the signs at the park did not give notice that a bad dog is on the premises. The signs are not designed to warn visitors not to enter the dog park due to the presence of dangerous dogs, the decision on March 22 reads. The purpose of the statutory sign requirement is to give genuine, effective and bona fide notice that a bad dog is on the premises, the decision reads. The trial court erred in finding that the Dog Park Rules signs were equivalent to Bad Dog signs to preclude liability. The appeals court ruling states that, while Davison was aware of the danger of her volunteer work, an actual consent of assumption of the risk defense cannot bar liability. Rather, the Legislature requires these facts to be presented to the jury. ... For these reasons, we reverse the trial courts entry of final summary judgment in favor of Berg. The jury trial had not been scheduled as of last week.rrfnrntbnbn SUPPORT LOCAL BUSINESSApril 29 May 5, 2018 904-310-3175 fernandinabeachgolfclub.com & Easter Egg Hunt YUC46441 S UNDAY, APRIL 5th 10am BRUNCH 12pm EGG HUNTRSVP in the Restaurant or Call 90 4. 31 0. 31 75Reservations Requested $1 5.95 ADULTS | $7 .95 CHILDREN 12 & UNDER Come Golf with us!Fernandina Beach Golf Club FOUNDED IN 1957 904-310-3175 2800 Bill Melton Rd. Fernandina Beach, FL 32034 www.eternityfuneralhome.comDonna & Rex D. Gill, Owners96092 Victorias Place Yulee, FL 32097 (904) 261-2700 www.eternityfuneralhome. AT NEED PRICING THRU MAY 31stCall for more Information (904) 261-2700 FUNERAL SERVICE $3,500.00 I ncludes casket and 1 hour viewing prior to service. CREMATION $695.00 David Single ton Bandits Outback ANTIQUE LIGHTING Repairs & Rewir ing 910-547-0674 Slinger13@gmail.com 1014 Beech Street Fernandina Beach, FL www.americanflooringyulee.com 904-321-1775 1006 S. 14thSt.(Amelia Island 8 Flags Center) $12.95Haircut Cash Only Hair Styles for all ages904-321-17751006 S. 14th St, Fernandina BeachHaircuts Cash only$12 H ARBOR L IGHTSCustom Framing since 1982 Historical & Natural History Prints Antique Maps & Charts Audubon Prints & Posters Collectibles & Ephemera1546 South 8th Street (904) 261-9763 www.harborlightsgallery.com ameliaframer@gmail.com Everything ElectricalWhy Wait?....Call Today Office Hours: Mon-Fri 8am to 4pm 24 Hour Emergency Service Available Same Low RateFAMILY OWNED & OPERATED 100% SATISFACTION GUARANTEED 904-491-1422 ER0004148 Residential Commercial Recycling Roll-off( 904 ) 849-5122463106 State Road 200 Yulee, FL 32097 Designer fabric Re-Upholstery Slip Covers Custom-Built Upholstered Furniture Upholstered Antique Restoration Boat Interiors Carpets HunterDouglas Certified Showcase Dealer Custom Bedding Designs Draperies, Valances & Cornices Come visit our showroom and ON-SITE workroom rowlandsuph@gmail.comwww.RowlandsUpholsteryofAmelia.com rowlandsuph@gmail.com 1120 S. 8TH STREET FERNANDINA BEACH(904) 261-5842 Owned and operated in Fernandina Beach by the Rowland family for 65 years AT THE COLOR PALETTEContact: ELAYNA WORKMAN OWNER | Color Specialist 904.528.7763 | @colorpalettestudio & JOSEY DAY Color Specialist | Make-Up Artist 904.314.5934 | @joseyhamuaAccepting New Clients474421 E. State Road 200 Fernandina Beach, FL | 32034 Come see us and Save Thousands 904-775-5083 ameliaislandescaperooms@gmail.com 1008 South 14th St. Fernandina Beach, FL 32034 Doubled in Size! 3 New Rooms Coming Soon! Plan Your Escape Today! NEW r rfntbb than 20 grams of cannabis and possession of controlled substance paraphernalia. Probation was revoked and terminated. He was adjudicated guilty and sentenced to six months in Nassau County Jail with credit for time served and ordered to pay $1,172.08 in outstanding court costs. Wrenn Killian Taylor forfeited bond by failing to appear in court to face charges of delivery of a controlled substance to a minor and child abuse without great bodily harm. A warrant was issued for her arrest. Matthew Charles Wazelle admitted to violation of probation for habitually driving while his license was suspended, possession of heroin and possession of controlled substance paraphernalia. He was adjudicated guilty. Probation was revoked and terminated. He was sentenced to three months in Nassau County Jail with credit for time served. He must pay $1,432.16 in outstanding court costs. Dakota Leeann Wilson admitted violation of probation for shooting or throwing deadly missiles into a dwelling. She was adjudicated guilty. Probation was revoked and terminated and she was sentenced to 60 days in Nassau County Jail with credit for time served. She was ordered to pay $630.07 in outstanding court costs.Continued from 9A NL 6 col. Wed 05.02.indd 10 5/1/18 4:00 PM

PAGE 11

THE SCHOOL BOARD OF NASSAU COUNTY, FLORIDA NOTICE OF INTENT TO ADOPT AND AMENDNotice of Intent to Adopt Administrative Rule 6.69 Monitoring by Project Managers Administrative Rule 6.70 Personnel Cost on Federal Projects Administrative Rule 6.71 Cash Management on Federal Projects Notice of Intent to Amend Administrative Rule 6.41 General Practices In compliance with the Administrative Procedure Act, Chapter 120, Florida Statute, a public hearing may be held if requested within twenty-one (21) days of this notice at the place, time, and date indicated below: Place: Nassau County School Board 1201 Atlantic Ave. Fernandina Beach, FL 32034 Time: 6:30 P. M. Date: May 24, 2018 No signicant economic impact is anticipated. Copies of the Administrative Rules and amended policies are located in all schools, the transportation and facility shops and the School Board oce. Thank You! To Our Light Up A Life Sponsors and In-Kind DonorsTake Stock in Children Nassau would like to thank our Sponsors and In-Kind Donors for helping to make this years Light Up A Life Gala such a huge success. It is because of you and your generous donations that 157 Nassau County students have a scholarship opportunity, the friendship of a mentor, and HOPE for their academic futures. David Easterly Adam and Dee Kaufman Bill and Melissa Hendrickson, and The Lee Family Foundation Toby and Robin LentzNL/PSA TSIC LUAL Sponsors EVENT SPONSOR PLATIMUM SPONSOR GOLD SPONSOR SILVER SPONSORS BRONZE SUPPORTERTHE LEE FAMILY FOUNDATION EVENT SUPPORTER FRIENDSBaptist Medical Center Nassau, Inc. The Edwards Company Jay and Ginger Mock Donna Lynne Custom Homes Jim and Diane OMalley Laurie A. Kitson, DMD, PLLC WestRock Nick and Kim Gillett Wells Fargo Artisan Homes Chaplin Williams Realty Berkshire Hathaway Mandy Terbrueggen801 Kitchen & Bar ABC Wine and Spirits Addison House Advanced Muscle Therapy Amelia Island Chamber Music Amelia Island Escape Rooms Amelia Island Museum of History Amelia Community Center Amelia Hotel at the Beach Amelia Island Golf Club Amelia National Golf and Country Club Amelias Attic Furniture Amelia Island Wine Co. Amelia Kilnworks Amelias Treasures Andrea Mateer BarZin Bistro Wine Bar Baxters Bar and Grill Beach Diner Bill Birdsong Blue Heron Inn Brandies Ace Hardware Caf Karibo Callahan BBQ Carmike-Coastal Cinema Catty Shack Ranch Changes Hair & Nail Salon Coastal Concierge Services Coastal Cottage Computer Guys of Amelia Cottonways Crawford Jewelers Cucina South Debonair Dawna Moore Dean Grunewald Golf Lesson Donna Overly Embroidery and Stitch By Penny Emma Bledsoe Evelyne Talaman Fairbanks House Fancy Sushi FB Golf Club Fernandina Clay Fernandina Observer Fired Up Fernandina Friends of Melba Craven FSCJ Artist Series Golf Club of North Hampton Go PC, Inc. Great Escape Room Jacksonville Greyfield Inn Pilates of Amelia Harris Teeter Holistic Wellness Horizons House Portraits Images Hair Salon Island Flowers & Garden Island Consulting Jacksonville Jaguars John Mateer Judy Easterly Kayak Amelia Karen McFadyen Le Clos Lee Buchannan Lindys Jewelry Lorraine King Lulus at the Thompson House Magnas, A Full Body Salon Marche Burette Massage Envy Maurer Fine Art Marlene Strobach Nana Teresas Bake Shop Nassau Health Foods Nassau Jewelry Company New York Nails Olive Amelia Omni Amelia Island Plantation P5 Productions Parkway Grille Pilates of Amelia Paula Porterfield-Izzo Paul Clark Ford Paul Massing Pelindaba Lavender Peppers Mexican Grill & Cantina Peterbrooke Chocolatier Pilates of Amelia PI Infinity Combinations Pineapple Patch Red Otter Outfitters Redbones Gourmet Dog Bakery & Boutique Ritz-Carlton, Amelia Island Robin Branch Design Robinson Jewelers Scott and Sons Fine Jewelry Sharon Haffey Shoe Visions Starbucks Coffee Steve Leimberg Story & Song Bookstore Bistro Sue Schraft Susan Brisach The Addison House on Amelia The Crab Trap The Dome Healing Center The Fairbanks House The Plantation Shop Turner Ace Hardware Vickie Malley Villa Villekula Toy Store Westside Journal Willie Jewels BBQ Yulee BugleInterested in becoming a mentor, volunteer, or donor? Please call Take Stock in Children Nassau, Director Dr. Andrea Cummings at 904-548-4464, or visit www.takestocknassau.org. Geoff and Lynn Meyer IN-KIND DONORSof Agriculture begins searching for a location for a farm in conjunction with the states sovereignty submerged lands leases program, which issues leases on public lands to individuals. He said that people often want to farm in creeks, or at the mouths of creeks, but that those areas are often not suitable due to pollution. Tests are conducted by the state of Florida, and those results are forwarded to the U.S. Food and Drug Administration, which also takes action to approve or disapprove of harvesting, according to St. Marys Riverkeeper Rick Frey. Frey said that he has had no inquiries from anyone interested in harvesting oysters from local waters, but that the contamination that affects oyster harvests has been traced to humans through testing. The bacterial pathogens found in human waste and discharged into the river from failing septic systems or wastewater treatment facilities is the main obstacle to harvesting, Frey said. This is the reason the Riverkeeper and its team of citizen scientist volunteers, many from Fernandina, are actively involved in monthly bacterial testing, and this is why the Riverkeeper is involved with Camden County (Georgia) through an EPA grant to replace 30 failing residential septic systems responsible for polluting our river water with dangerous pathogens and poison the waters for humans and fish, including the filter feeding shellfish. The Florida Department of Agriculture also governs other aspects of oyster farming. While the state allows the import of spat, or oyster seed, from other states, that seed must come from Florida brood stock, Knickerbocker said. All brood stock must pass inspection by the state. Sometimes people simply want to grow oysters for their own consumption. Southeast Georgia resident Dan Deguire told the NewsLeader that his foray into oyster farming began when he was part of an effort between the University of Georgia and the Georgia Shellfish Growers Association. Deguire lives on the Crooked River on Cumberland Island. He said he noticed that oysters were growing on concrete boat ramps. I knew I didnt want to eat oysters that had grown in a polluted area like a boat ramp, Deguire said. But, I figured if those oysters like that concrete, I could put concrete on my clutches. Clutches are the habitats on which oysters grow, often old shells or rocks. Farmers create their own clutches, Deguire said, using old crab traps or other material. He said that he started putting concrete slurry on his clutches, and that the oysters thrived on it. Deguire said he believes the lack of local commercial oyster farming is due in part to the effect of science, in the form of an oyster that he likens to GMO foods. To me, it never got a good go because the markets are leaning to triploid oysters, he said, referring to a type of sterile oyster developed by the Virginia Institute for Marine Science. According to VIMS, since the triploid puts no energy in the effort to reproduce, it is fatter and meatier and can be harvested year-round. He said his oyster growing spots could still be producing, although he has stopped farming. Its too hard to carry around 50-pound bags, he said. Commercial oyster farming is labor-intensive, Knickerbocker said, and the startup costs are steep. According to the University of Florida, the first year can run more than $150,000. Knickerbocker said that, while interest in oyster farming is growing, he is unaware of any plans for commercial farming in Nassau County. It is expensive to start, and can take a year or two to get going, he said. And, it is very labor intensive. But, in the right place, I think it could be profitable. For a statewide map of areas that are officially open and closed to oyster harvesting, go to https://atoll.floridamarine.org/ indevelopment/shellfish_pub/.Continued from 5A Students from all of Nassau County School Districts schools created shrimp for the districts float in the 55th annual Isle of Eight Flags Shrimp Festival parade. A school bus will be transformed into a shrimp boat for the parade, and the shrimp created by the students will be caught in its net. District employees are in the process of voting for the best shrimp entries. rfntbbrbrbJULIA ROBERTS/NEWS-LEADER NL 6 col. Wed 05.02.indd 11 5/1/18 4:13 PM

PAGE 12

Whenever Bucko and I want to escape the hubbub of Amelia Island, we get in our car and drive west, across the state to Cedar Key. This charming little fishing town has its own share of tourists but nothing compared to ours. Some people go there to fish, to kayak, or to visit the small shops and seafood restaurants. We go there to relax, plain and simple. For us, relaxing often means taking car drives on local country roads. Sunday driving they used to call it. There are a number of natural areas in and around Cedar Key with dirt roads heading through the wilderness, perfect places to drive slowly and look at nature. This trip, this time, was all about the roadways. In late April the roads beyond Gainesville were all decked out in annual phlox, with masses of purple, pink, and white flowers bordering the roadways and filling the medians. Here and there, patches of yellow daisies stood out in vivid contrast. These wildflowers were all seeded here for their beauty and are not native to this area. They are stunning nonetheless. White butterflies and black-andwhite swallowtails flitted from flower to flower. The wet ditches bordering the roads had their own contingent of flowers, masses of purple pickerelweed flowers alternated with white flowering duck potato plants. Every now and then I asked Bucko to stop the car so I could shoot yet more photos of the scenes of flowers, roads, and pastures full of cattle and cattle egrets. Bucko is not much of a flower person, but he had his own road entertainment. Yes, he was driving, but he also was keeping his eyes peeled for snakes. Beginning from our early days together in the 1970s, back in Miami, we spent many a day driving the backroads of the Everglades looking for snakes. When Bucko was at the University of Miami, he made a side income catching and selling venomous snakes to the Miami Sepentarium, where they extracted their venom for medical purposes. He has long ago thank God stopped catching venomous snakes, but his interest in all snakes continues. As we drove on the highways, Bucko pointed out some road kills: a rattlesnake, a pine snake, a black racer. The real fun starts for him when we venture down the dirt roads of the Lower Suwanee National Wildlife Refuge and the Cedar Key Scrub Preserve. I found wild Louisiana irises, pickerelweed, and coral bean flowers to photograph. He found a rat snake to admire, a live one at last. Overhead, swallow-tailed kites entertained us. Phalanxes of pelicans flew by, heading to the coast, and woodpeckers knocked on the pine and cypress trees around us. Perfect. Clams are the thing in Cedar Key. The area is widely known for its clam mariculture operations and clams are on the menus everywhere. I stuffed myself with steamed clams, then picked more cooked clams from the shells and packaged them up with the clam broth so I can prepare my own version of clam chowder at home. On the way out of Cedar Key, I bought some smoked mullet and pepper jelly at the country store in Otter Creek. A friend was having a group of us over for a low country boil, and in keeping with the theme I was preparing some Cedar Key favorites of smoked mullet dip and pepper jelly with cream cheese. (Dont knock it until youve tried it!) We still had one final stop on our road trip before driving back to Fernandina: Browns Farm in Melrose. When I went to the University of Florida, I lived in that area, and always revisit this produce stand. The produce changes from season to season, but most of it originates in their fields beside the road. This time they were selling cauliflower in colors Ive never seen before bright green, vivid yellow, and even purple. We bought some to try. Other patrons were stooping in the field, picking their own strawberries, but by now we were ready to drive the two hours back home again. Another road trip to Cedar Key completed! Every time we go there we have a different focus depending on the season and the circumstances, but we always have a good time. We also come back to busy Fernandina a bit more relaxed then we left. This time, the road itself stole the show! Pat Foster-Turley is a zoologist on Amelia Island. She welcomes your nature questions and observations. *W.A.C. All rebates apply to price. All prices plus tax, tag & fees. Navigation, One Owner ONLY $24,700 Stk#A3025Local trade, One owner ONLY $31,989 Stk# 8181A2014 Chrysler 300Leather, local trade ONLY $13,144 Stk# A2999A Sunroof, Navigation, 1 OwnerONLY $14,220 Stk#8131BLocal Trade, Spray-in BedlinerONLY $20,635 Stk#A3022Local Trade, One Owner ONLY $17,424Stk #8107A2018 Jeep Cherokee LatitudeRetail $26,915 Keffer Discount $3,776Keffer Price $22,639 2018 Ram 1500 ExpressRetail $39,470Keffer Discount $6,217Keffer Price $33,253Stk# 80872018 Jeep Renegade Latitude 4x2Retail $28,350Keffer Discount $4,804Keffer Price $23,546Stk#7550 2018 Chrysler PacificaFully loaded, all power equipment, great savingsSAVE Thousands Starting under $26,9952018 Jeep WranglerOver 48 New Jeep Wranglers to choose fromStarting at $29,999Or up to $3,500 OFF 2018 Dodge Charger SXTFull Loaded, sport packageSavings over $3500Stop by and shop here! Stk# 8293 Stk# 8216 Stk# 8071 One Owner, Local TradeONLY $12,035Stk#8114BOne Owner, Local Trade ONLY $16,200Stk#8210A WEEKLY SPECIALS A rat snake crosses the dirt road in the Lower Suwanee Wildlife Refuge.rfrfrrnnrrtrfAbove, cauliflower in different colors on sale at Browns Farm in Melrose. Below, purple pickerelweed flowers fill the roadside ditches. b tffnt PHOTOS BY PAT FOSTER-TURLEY/FOR THE NEWS-LEADERAnnual phlox and daisies adorn the highways beyond Gainesville. NL 6 col. Wed 05.02.indd 12 5/1/18 11:18 AM

PAGE 13

oo T rf Nw ntbtlon PHOTOS BY PETE KOVALICK/SPECIALFernandina Beach, Yulee and West Nassau high schools were represented in the regional track and field meet in Tallahassee April 25 in Tallahassee. Several qualified for the 2A state meet Friday and Saturday at the University of North Florida in Jacksonville. John Sorensen, left, qualified in the two-mile run with a time of 10:05; he placed seventh in the region. Teammate Walker Bean, right, qualified in two events; he was first in the discus and second in the shot put. West Nassaus Edward Smith, second from left, placed fourth in the high jump to qualify. Yulees Lydia Parker, second from right, competed in the 1,600-meter and 3,200-meter runs and on the 4x800-meter relay team; she qualified individually in the 3,200-meter run. Also qualifying are Yulees Sydney Lake (discus), Malik Brown (discus) and Mackenzi Griffin (high jump). More photos, 4B. The Lady Hornets cruised past Ribault 12-1 and blanked Bishop Kenny 10-0 in the District 4-5A tournament last week but found a more formidable foe in West Nassau in the title game Thursday in Callahan. It was the only loss in the month of April, said Chris Hicken, head softball coach at Yulee High School. Yulee committed eight errors, giving up six runs with two outs in the 8-1 loss. We made more errors in that one game then the previous 10 games, Hicken said. I think we came out tight and did not play up to our capabilities. Christa and Faith both pitched well but its hard to overcome that many fielding mistakes. Linzie LaFavor had two hits, and Sidney Hayworth and Zoe McKendree had one apiece. Both West Nassau and Yulee advance to the playoffs. Yulee takes on host Baker County at 7 p.m. tonight in a regional quarterfinal matchup. Yulee opened district play with a 12-1 thrashing of Ribault in the quarterfinal round. Nevin pitched a two-hitter, collecting her 11th win of the season. Kayla Bradberry had three hits and scored four runs. Linzie LaFavor had five RBIs and a missed hitting for the cycle by a home run, and Caliegh BRIAN LACROSS/SPECIALBalestra missed the cycle by a double, as she hit a towering home run in the third inning, Hicken said. Yulee got its 20th win of the season on April 24 with a 10-0 shutout of Bishop Kenny in the semifinals. The Lady Hornets scored five in the top of the fifth to run-rule the Lady Crusaders. It was the ninth win in a row for the Hornets, and ninth-grader Christa Pritchard pitched her first no-hitter as a high school player, Hicken said. Every starting player had a hit as the Hornets. the District 4-5A baseball tournament this week. Games started Monday with the quarterfinal. Yulee, the top seed, and the second-seed hosts played Tuesday in the semifinals. The championship game is at 7 p.m. Thursday. Yulee (18-8) lost to Bolles 8-3 and beat Atlantic Coast 3-0 and Stanton 6-2 to close out the regular season last week.rfnrfnftttn bn AMANDA REAM/COMMUNITY NEWSPAPERS Yulees senior catcher, Zoe McKendree, keeps a Lady Warrior from scoring Thursday, left. Hannah Love tags out a Lady Warrior, right. rfnt Saturday was the first day in full gear for the spring football season, and the Fernandina Beach High School Pirates were out bright and early. Jamborees are in two weeks.PHOTOS BY BETH JONES NEWS-LEADER NEW Sports Wed.indd 1 5/1/18 10:41 AM

PAGE 14

Find The News-Leaderon the World Wide Web www.fbnewsleader.com Read the news, e-mail the staff, check the classifieds, or subscribe to Floridas Oldest Weekly Newspaper! Find The News-Leaderon the World Wide Web www.fbnewsleader.com Read the news, e-mail the staff, check the classifieds, or subscribe to Floridas Oldest Weekly Newspaper! r f n t b n t f n b n r f n Display Advertising deadline for Wednesday is 3 p.m. Friday Classified Advertising deadline is 5:00 p.m. Monday.Display Advertising deadline for Friday is 3 p.m. Tuesday Classified Advertising deadline is 5:00 p.m. Wednesday.Please call 261-3696 to place your advertisement. rfntbDONT LITTERSPAY~NEUTER rfntbDONT LITTERSPAY~NEUTER rfntbDONT LITTERSPAY~NEUTER Attention!NASSAU COUNTY!Y ou can get SAME DAY DELIVERY of the News-Leader every week, delivered by the US Postal Service, directly to your home or business. See page 2A for more details. Attention!NASSAU COUNTY!Y ou can get SAME DAY DELIVERY of the News-Leader every week, delivered by the US Postal Service, directly to your home or business. See page 2A for more details. rThe Fernandina Beach High School boys basketball coach Matt Schreiber will host two camps this summer, a basketball camp from 9 a.m. to noon June 4-7 and an allsports camp from 9 a.m. to noon June 11-14 at the FBHS gym. The all-sports camp includes badminton, basketball, kickball, ping pong, volleyball and soccer. The camp is open to boys and girls entering third through ninth grades next school year. Camp objectives include improving skill level, enhancing knowledge of rules and strategies and teaching the importance of good sportsmanship. Fee is $100. Register the first day of camp. For information, contact Schreiber at 635-2612.fntbThe U.S. Coast Guard Auxiliary is offering a recreational boating safety education program. The course is aimed at the new boater. Flotilla 14-1 is offering this course at the Amelia Island Fernandina Beach, from 8 a.m. to 5 p.m. on May 19 and June 9. Registration starts at 7:45 a.m. Fee is $10. Attend the course and pass the exam to receive a Florida Boater Education card. To register or for information, contact Harry Tipper at (912) 576-6659 or email htipper3@comcast.net.fbfAmelia Island Youth Soccer is holding travel team tryouts. Register by May 4. Tryouts are from 6-7:30 p.m. May 7 and May 9 for U11-13 and from 6-8 p.m. May 8 and May 10 for U14-19. Season includes fall league and spring college showcase tournaments. Interested players and licensed coaches should email diradvcomp@ aiysoccer.com. To register, visit www.aiysoccer.com.fnntffn for Frogmen 5K will be at 8 a.m. May 19 at the Fernandina Beach Golf Club, 2800 Bill Melton Road. The Tadpole Trot for children 2-6 years old will also be held that morning. Sponsorships starting at $100 are available; each sponsorship comes with a free 10x10 booth. Email ameliaislandfl@jogginforrogmen.com for information. Both the 5K and the Tadpole Trot are hosted by the Navy SEAL Foundation, and 100 percent of the proceeds go to the foundation; its mission is to provide immediate and continuing support to Special Welfare community, including spouses and children. Go to www.jogginforfrogmen/ameliaislandfl for information and to register. Early registrations indicate even more runners will participate in 2018. Packet pickup will be from 3:30-6:30 p.m. May 18 at the Fernandina Beach Golf Club.nThe Amelia Island Sailing Club meets the first Tuesday of the month at the Kraft Athletic Club at Ten Acres, located off Buccaneer Trail. Social hour starts at 6:30 p.m., followed by a potluck dinner, business meeting and guest speaker presentation. Guests are welcome. The AISC is a great way to meet new friends who share a love of the water and boating. Current boat ownership or sailing skills are not prerequisites to joining. Club activities throughout the year may include day/overnight excursions by water and/or land, sailboat racing, social activities such as tubing, swimming with manatees, picnics and parties; as well as assisting with local conservation and environmental efforts in surrounding waters. Contact Commodore Tom Maguire at (703) 298-1714.ffAmelia Island Nassau County Youth Lacrosse is a developmental youth lacrosse program for youths ages 8-12. Registration is now open for the spring season. There are teaching clinics throughout the year. No prior experience or knowledge of the sport is required. The league is completely volunteer-driven and is looking for adult volunteers, with or without experience. Register at www.tshq.bluesombrero.com/ameliaislandlax. Email aincyouthlacrosse@ gmail.com or contact organizer Fred McFarlin at (252) 2297033 or 277-6702.fThe Amelia Island Boules Club holds petanque pickup games on the petanque courts at the south end of the downtown marina Saturdays at 9:30 a.m. and most afternoons on weekdays. Petanque (pay-tonk) is a cousin of both horseshoes and bocce, the Italian bowling game. The public is always welcome. Call 491-1190.The Nassau Sport Fishing Association holds its monthly business meetings on the second Wednesday of each month. The monthly social gettogether is held on the fourth Wednesday of each month. The location for both meetings is Kraft Ten Acres, 961023 Buccaneer Trail, Fernandina Beach. All are welcome. The Nassau Sport Fishing Association, founded in 1983, is a 501(c)(3) nonprofit organization created to develop and promote saltwater fishing in the Nassau County area while adhering to state, federal and local regulations, to encourage compliance with rules of water safety by club members and the general public, and to promote youth-related community and other civic-minded activities. Burke at (256) 453-4744 or email info@nsfafish.net.fTickets for the all-new Monster Jam Triple Threat Series are on sale soon for the Sept. 1 tour stop at the Veterans Memorial Arena in Jacksonville. Show times are 1 p.m. and 7 p.m. Purchase tickets at www. MonsterJam.com.The McArthur YMCA offers Walk with Me, a program designed for people to walk with other people. The trail will be Amelia Park. The goal is a 50-minute walk with five minutes of stretching before and after the walk. The program is held at 8 a.m. Mondays. Meet at the McArthur YMCA, 1951 Citrona levels are welcome. Call 2611080 for information.nThe North Florida Bicycle Club offers several organized bicycle rides each week at various times and locations on Amelia Island and in Nassau County. Cyclists of all abilities are welcome. Helmets and a bicycle in good working condition are required. Bicycle safety will be emphasized at the start of each ride. Cyclists typically split into groups, depending on pace and skill level, and there are options to cut the ride short. Anyone who joins the group will not be left behind. Lunch is optional. Call 261-5160, or visit www.ameliaislandcycling.com, www.ameliaislandtrail.org or www.nfbc.us for information.fnnSenior league bowling is offered at 9:30 a.m. Wednesdays at the bowling alley off U.S. 17 in Yulee. The group also meets for Christian league at 6 p.m. Thursdays.bU.S. Coast Guard Auxiliary, Amelia Island Flotilla 14-1 meets the first Thursday in the Amelia Island Lighthouse Lane on Lighthouse Circle. Call 261-1889 for information. To submit an item for this column, contact Beth Jones at 261-3696 or email information to bjones@fbnewsleader.com. MemberPlus tax Everyday after 1:00pm$18Plus tax Everyday after 1:00pm$22Beach Card Plus tax Everyday after 1:00pm$25Public 9 Hole Special $15Plus tax After 5:00pm Call today for your Tee Time 904-310-3175 fernandinabeachgolfclub.com & Easter Egg Hunt YUC46441 S UNDAY, APRIL 5th 10am BRUNCH 12pm EGG HUNTRSVP in the Restaurant or Call 90 4. 31 0. 31 75Reservations Requested $1 5.95 ADULTS | $7 .95 CHILDREN 12 & UNDER Not valid with any other specials or discounts Long Point at the Amelia Island Club held its annual three-day Womens Member-Member tournament April 25-27. Forty-four participants played in the match play format, which featured five nine-hole matches over the course of the event. In the first flight, the winners were Jeanne Tennyson and Melonie Murphy, with a total of 24.5 points. Runners-up were Gail Biondi and Cherie Billings, posting a total of 24 points. The second flight winners were Maureen Nussman and Cathy Ratliff, with a team total of 27.5 points. Second place was awarded to Diane Lord and Sarah Ramsey, finishing with a total of 25 points. The third flight results were also extremely close. The team of Joyce Wells and Annamae LePorin won first-place honors with a total of 28.5 points, while the second-place team of Mary Kaulfuss and Kathy Smith scored a total of 28 points. In the fourth flight, Dee Sullivan and Wendy Wessels were winners with a total of 27 points. Second place was secured by Cathy Fetzek and Fran Shea, with a total of 26 points. After the flight winners were determined, all assembled immediately for a three-hole shootout, which featured a Stableford format. The overall winners of the tournament were the team of Cathy Ratliff and Maureen Nussman. The nine-hole division was held April 26 and 27. Four teams competed, utilizing the medal play format. The overall winners were Jane McCormick and Dora Yelk. There was a second-place tie between the teams of Kris Landers and Gayle Howard and the team of Judith Pines and Linda Rajfer.ttnftfbTest your skills against Sheriff Bill Leeper, fellow law enforcement officers and area leaders while helping to raise money to benefit the community. The Nassau County Sheriffs Office and NCSO Charities are sponsoring the fourth annual Sheriffs Golf Tournament on June 22 at the Golf Club at North Hampton, Fernandina Beach. Registration starts at 7:30 a.m., and the scramble shotgun start is at 8:30 a.m. The event will be followed with an awards ceremony and a meal. Form a four-person team for $500. Sponsorships are also available. Contact Larry Boatwright at 548-4027 or lboatwright@nassauso.com for information.nThe Amelia Island Jazz Festival will combine golf, jazz, fun prizes and lunch for its first-ever Swingin With Jazz Golf Tournament, a scholarship fundraiser set for May 12 at the Fernandina Beach Municipal Golf Club, 2800 Bill Melton Road. A 10 a.m. shotgun start is set for the four-person scramble event, and the public is invited to participate. Players may enter as a foursome team or will be grouped into teams at the golf club. Included in the entry fee will be 18 holes of golf, a cart and range balls, lunch and four chances to win a golf trip to Las Vegas; Kauai, Hawaii; Treetops Resort, Mich.; or French Lick, Ind. An array of additional prizes will be raffled off, and mulligans will also be available for purchase. Following play, there will be an awards luncheon featuring live jazz in the clubs dining area. Several of the festivals longtime popular musicians will be teeing off in the tournament, including J.B. Scott, trumpet, former leader of New Orleans Dukes of Dixieland; Dave Steinmeyer, trombone, former leader of the Airmen of Note, U.S. Air Force Band; and Lisa Kelly, jazz vocalist in the Jacksonville Jazz Festival Hall of Fame. Entry fee will be $80 per person. Hole sponsorships for $100 per hole and more sponsorship opportunities may be viewed online. For information or to register for the event, visit www.ameliaislandjazzfestival. com, contact the festival hotline at 5044772 or call event chairperson Steve Murphy at 310-3178. Proceeds from the Swingin With Jazz tournament will help support the Amelia Island Jazz Festivals scholarship, Jazz for Seniors and Jazz in the Schools programs.fffThe third annual Blake Bortles Foundation Charity Golf Tournament will return to the World Golf Village for the annual event this June. The event will kick off with a concert and pairings party held at the Renaissance Resort Hotel Convention Center on June 24. The golf tournament will return to the King & Bear Golf Course on June 25. The Blake Bortles Foundation Charity Golf Tournament is a two-day event that combines music, golf, local flavors and a first-class good time. The tournament and concert were created in 2016 as a main fundraising platform for the Blake Bortles Foundation. For more information about this event or to purchase tickets and register for the tournament visit www.blakebortlesfoundation.com or contact info@blakebortlesfoundation.com. ttf SUBMITTED PHOTOSThe Amelia Island Clubs 2018 Womens Member-Member Championship overall and shootout champions are Cathy Ratliff and Maureen Nussman, left. The nine-hole champions are Jane McCormick and Dora Yelk, right. NEW Sports Wed.indd 2 5/1/18 10:14 AM

PAGE 15

Several fishing seasons ago, I discovered one of my favorite places to fish for redfish, Cumberland Sound. I have redfished with my son, Terry David, pretty much all through the coastal areas of the United States, where warm, shallow waters harbor hardfighting redfish, and have concluded that Cumberland Sound must rank in the top 10 for best redfish waters.It all began several redfishing seasons ago when Terry David and I were casting gold spoons for flood tide redfish at Cumberland Sound. It was May, and water temperatures were heating up the local redfish action after a long, cold spring. Several manatees had migrated into the shallows of Cumberland Sound to feed on the abundance of sea grasses. I was right in the middle of a long cast to the edges of the spartina grasses when I noticed a manatee following our shallow water boat. The inquisitive manatee was so close, I could almost reach down and pet it. I instructed T.D. to hand me my camera right in the middle of his long redfish cast. His fishing rod and reel were being jerked out of the boat by a redfish that had eaten his gold Johnson spoon while it was lying lifeless on the bottom. T.D. quickly picked up his rod and reel and was soon fighting a nice 30-inch redfish. Just ahead of our saltwater skiff, we noticed the water had changed from a light coffee color to a brilliant orange. It was one of the largest schools of redfish we had ever seen and was the start of many exciting days of redfishing in Cumberland Sound. One of the best tides when targeting Cumberland Sound redfish is the last few hours of the flood and the first few hours of the falling tide. Look for points of spartina grass close to large concentrations of oyster bars. Having a small feeder creek nearby is a bonus. Drifting a live shrimp under a small float up close to the grass is key when targeting schooling redfish. However, my favorite redfish technique is to adjust my electric trolling motor on low speed while keeping a good distance from the flooded marshes. Casting a topwater Chug Bug or Top Dog usually is a good redfishing technique for locating Cumberland Sound reds. Once a school is located, I will power pole down and change my lure to a plastic Berkley Gulp shrimp or a gold spoon. Keeping my redfish rod and reel simple, I prefer a sevenfoot medium action spinning rod with a light tip action that affords for long casts. My 4,000 spinning reels are filled with 15-pound braided fishing F ERNANDINA B EACH T IDES T ides, Sun & Moo n : May 2 May 9, 2018 Sat. 5/5 Sun. 5/6 Mon. 5/7 Tues. 5/8 Fri. 5/4Thurs.5 /3 Wed.5/9 Sunrise 6:41A Moonset 8:40A Sunset 8:04P Moonrise 10:39PWed.5/2 Low 5:01A 1.56 High 11:16A 7.55 Low 4:58P 1.75 High 11:39P 8.25 Sunrise 6:40A Moonset 9:23A Sunset 8:05P Moonrise 11:31P Sunrise 6:39A Moonset 10:10A Sunset 8:06P Moonrise --PLow 5:43A 1.84 High 11:55A 7.29 Low 5:36P 2.07 High -P --0 High 12:17A 7.95 Low 6:24A 2.14 High 12:35P 7.07 Low 6:15P 2.38 High 12:56A 7.68 Low 7:07A 2.41 High 1:16P 6.90 Low 6:59P 2.67 Moonrise 1:07A Sunrise 6:37A Moonset 11:49A Sunset 8:07PHigh 1:37A 7.44 Low 7:55A 2.61 High 2:01P 6.80 Low 7:50P 2.89 Moonrise 1:49A Sunrise 6:36A Moonset 12:42P Sunset 8:08P Last Qtr. 10:11PHigh 2:23A 7.25 Low 8:47A 2.70 High 2:52P 6.78 Low 8:49P 2.99 Moonrise 2:29A Sunrise 6:36A Moonset 1:36P Sunset 8:08PTide calculations are for Amelia River, Fernandina Beach. No corrections are necessary.Sun & Moon events are also calculated for Fernandina Beach, although actual times may vary because of land masses.High 4:16A 7.13 Low 10:32A 2.50 High 4:47P 7.08 Low 10:52P 2.73 High 3:17A 7.14 Low 9:40A 2.66 High 3:48P 6.87 Low 8:52P 2.93 Moonrise 3:07A Sunrise 6:35A Moonset 2:30P Sunset 8:09P Moonrise 12:21A Sunrise 6:38A Moonset 11:49A Sunset 8:07P Call us at (904) 321-4001 or stop by one of our offices474303 E. State Road 200, Fernandina Beach, FL 32034 1721 S. 8 th Street, Fernandina Beach, FL 32034 LOOKING TO BUY OR SELL YOUR HOME IN 2018?We welcome walk-ins Monday-Friday from 9:00am to 5:00pm Courtney Fassbender plays a big red she hooked with light spinning tackle while Bill Fassbender encourages her angling efforts, left. Both recently obtained their Coast Guard captains licenses. Cumberland Sound offers excellent fishing waters for small boat fishing and family fishing too. David Vining is pictured with son Mathew and a nice Cumberland Sound redfish, right. FERNANDINA BEACH PARKS & RECREATION DEPARTMENT RECREATION ROUNDUP Visit www.fbfl.us for information on any of these programs or activities. SPORTS/FITNESS SOCCER MADE IN AMERICA SUMMER SOCCER CAMP from 9 a.m. to noon June 18-22 at Hickory Street Park. Ages 4-17. Nationally-renowned training program with professional coaches. Participants will improve their technical and tactical knowledge of soccer, with emphasis on proper body mechanics. Each player should bring a soccer ball, shin guards and water bottle. Fees are $160 for the first family member, $150 second family member. Register at the Atlantic Center. on Elm Street. Team registration fee of $350 is due at registration. Twelve-person roster limit per team. Teams must have matching uniform shirts with numbers on backs. Ten-game Season begins June 7. For information, contact John Coverdell at 310-3351 or jcoverdell@ fbfl.org. game $72 refundable forfeit fee due June 1. USA Softball rules. 6/4 maletofemale ratio. ASA-approved bats allowed, all bats must have league-issued decals to be allowed for use. Eight games per team regular season and single elimination tournament. Season begins June 4 at the Ybor Alvarez Softball Fields. Visit www.leaguelineup.com/fbflsoftball or contact 12-13 at the Central Park multi-purpose court. Open to players ages 19 and up. Divisions 4.0, 4.5+. Registration fees are $25/person for first event, $10 for second event. Registration at the Atlantic Center by April 13. Registration forms available at the Atlantic Center or may be downloaded from www.fbfl.us. Contact tournament director Scott Mikelson at 310-3356 or smikelson@fbfl.org. Jeff Weisfeld. Open to boys and girls ages 4-18. Summer session May 9-June 27 on Wednesdays from 1-3 p.m. Fee is $2/student per day city residents, $5 non-city. Pay for eight-week session on May 9, and the fee is $15 city residents, $20 non-city. Call 3103354 or email jweisfeld@fbfl.org. games on two courts. Teams selected each have parental consent form signed by parents and notarized before participating). Fee are $2/ day city resident, $5 non-city. Tuesdays and Fridays 3-6 p.m. for school and club teams. Players must have adult coach or adult supervision. Call at 24 hours in advance to reserve courts, 310-3353. Fee is $2/day city resident, $5 non-city. have parental consent form signed by parents and notarized before participating). Fees are $2 city residents, $5 non-city residents. ROUNDUP Continued on 4B AMELIA SHOTGUN SPORTS WINTER HOURS: WED.-SUN. 9:00AM-5:30PMwww.AmeliaShotgunSports.com Jimmy Muller www.MullerChokes.com Seasoned Shooters Or New To Shooting WE HAVE WHAT YOU NEED! 86300 Hot Shot Trail, Yulee FL Located Minutes From I-95 and JAX International Airport (GPS Address: 86512 Goodbread Road, Yulee, FL 32097) Dawn Grant www.DawnGrant.com line, while a three-foot section of 20-pound fluorocarbon is attached to the as a shock leader using back-to-back uni knots. With this setup, I will be able to fish with live baits and lures without having to have several different fishing rods and reels on board. During low tide periods large bull reds can be targeted in the deeper waters of Cumberland Sound while fishing dead on the bottom with a piece of blue crab, fresh shrimp or cut baits. Cumberland Sound is located within a mile of the Fernandina Harbor Marina public boat ramp. If you launch your redfish boat from the public Dee Dee Bartel park and boat ramp, you will be right in Cumberland Sound. Crank up your outboard and navigate in a northeasterly direction and, within a five-minute ride, you will land right in some of the best redfishing waters in the country. If you launch your redfish boat from the Egans Creek Marina, Leaders & Sinkers bait and tackle will have on hand a variety of live and dead redfish baits. The 27th annual Amelia Island Blue Water Shootout kicks off with a captains meeting at the Down Under Restaurant at 6 p.m. Thursday. Entry fee is $400 per boat, with fishing taking place on Saturday. Tournament boats may leave from Mayport, St. Simons or the St. Marys inlets. Starting time is 3 a.m. and lines may be in the water at 7 a.m. Tournament boats have to be checked in at the Egans Creek boat ramp by 7 p.m. Points will be given for a variety of blue water gamefish, including wahoo, dolphin, tuna, sailfish and marlin. An awards ceremony will follow at Leaders & Sinkers on Saturday evening. For information, contact Steve Pickett at 591-0190 or steve@ pickettconstruction.com. PHOTOS BY TERRY LACOSS/SPECIALDanny Messier pictured with a big red he caught and later released while casting a topwater plug close to flooding spartina marshes at Cumberland Sound. NEW Sports Wed.indd 3

PAGE 16

summer); Wednesday 11 a.m. to 5:15 p.m.; and Tuesday and Friday 11 a.m. to 2 p.m., based on court availability. Persons under the age of 16 must be accompanied by adults age 18 or older. Photo identification required. PICKLEBALL at the Central Park multipurpose court 3 p.m. Sunday, beginner and social play; 5 p.m. Sunday, intermediate and advanced open play; 8 a.m. Tuesday, intermediate and advanced play; 10 a.m. Tuesday, social play; 11 a.m. Tuesday, beginner play and lessons; 3 p.m Wednesday, intermediate and advanced play; 8 a.m. 10 a.m. Friday, social play; 11 a.m. Friday, beginner play and lessons. Email dcultice@ yahoo.com. OPEN ROLLER HOCKEY at the Main Beach. Adult skate Tuesdays and Saturdays 6-8 p.m. and family skate Tuesdays from 5-6 p.m. and Saturdays from 9-10 a.m. Call Ray Matz at (215) 852-7038. MAHARAJ TENNIS at Central Park courts ics June 4-7, June 18-21, June 25-28, July 9-12, July 16-19, July 23-26 and July 30-Aug. 2. Red Ball 1 (Monday/Wednesday from 10:30-11:15 a.m.) and Red Ball 2 (Monday/Wednesday from 11:15 a.m.-noon). Cost is $14/week city residents, $16.80 non-city; Orange Ball (Tuesday/Thursday from 3:304:30 p.m.) and Green Ball (Monday/Wednesday from 3:45-4:45 p.m.). Cost is $18/ week city residents, $21.60 non-city; Junior Intermediate (Tuesday/Thursday from 4:306 p.m.) and Junior Advanced (Monday/Wednesday from 4:45-6:15 p.m.). Cost is $26 city residents, $31.20 non-city. Red Ball 1 (Tuesday/Thursday from 2:45-3:30 p.m., ages 4-8), $56 city residents, $67.20 non-city. Red Ball 2 (Monday/ Wednesday from 3-3:45 p.m., ages 6-10), $49 city residents, $58.80 non-city. Orange Ball (Tuesday/Thursday from 3:30-4:30 p.m., ages 8-12), $72 city residents, $86.40 non-city. Green Ball (Monday/ Wednesday from 3:45-4:45 p.m.), $63 city residents, $75.60 non-city. Junior intermediate (Tuesday/Thursday 4:30-6 p.m., ages 11 and up), $104 city resi-dents, $124.80 non-city. Junior advanced (Monday/Wednesday 4:456:15 p.m., ages 14 and up, high school and USTA tournament players), $91 city residents, $109.20 non-city. (3.0-3.5) Tuesdays from 6:15-7:45 p.m. Strokes clinics Wednesdays from 8-9 a.m. (2.5-3.0) and 9-10:30 a.m. (3.0-3.5). Intermediate drills clinics (3.0-3.5) Thursdays from 9-10:30 a.m. Intermediate/advanced drills clinics (3.5-4.0) Thursdays from 6-7:30 p.m. $10/person/ hour for one-hour clinics, $12 non-city; and $15/person for 1 1/2-hour clinics, $18 non-city. Pre-registration required (minimum of three per clinic). be scheduled with Head or an assistant professional, $60/hour with head professional, $50/hour with assistant professional. Customized clinics also available. lessons are also available. $60/hour city residents, $70 non-city. Call 548-1472 or email michelemaha@msn. com to schedule. To register or for information, email rodgibsontennis@gmail.com or call 891-6927. Schedule and description of clinics are available at the Atlantic Avenue Recreation Center or at www. fbfl.us. gate keys can be purchased at the Atlantic Center for a $5 fee. Keys may be purchased during normal business hours, Monday-Friday from 7 a.m.-7 p.m., Saturday from 8 a.m.-4 p.m. AQUATICS SUMMER GROUP SWIMMING LESSONS. Register at the Atlantic Center. American Red Cross Levels 1-2 (1-week classes): $40 city residents, $50 non-city. Levels 3-4 (two-week classes): $55 city residents, $68 non-city. Morning lessons at Atlantic pool on Atlantic Avenue, evening lessons at MLK Jr. pool on Elm Street. Full schedule of lessons available at the Atlantic Center or at www.fbfl. us. SUMMER AQUAADVENTURE CAMP from July 2, 3, 5 and 6 from 9 a.m. to 4 p.m. for three days, one day from 8:30 a.m.-6 p.m. Meet at the Atlantic Center. Planned off-site activities at St. Augustine Aquarium, Jekyll Island Turtle Hospital, Huguenot Park and river tubing adventure. Campers should bring lunch and refillable water bottle every day. Ages 10-15. $150 city residents, $187 non-city. Register at the Atlantic Center. Contact Kathy Russell at 627-8303 or krussell@fbfl.org. JUNIOR LIFEGUARD EXPLORATION program for ages 9-13 (participants must be able to swim one full length of the pool unassisted and tread water for two minutes). This course explores several lifeguarding environments, including pool, beach, water park and river. Classroom and water sessions; from 9 a.m .to 4 p.m. June 18-22 or July 23-27 (meet at the Atlantic Center). $150 city residents, $187 non-city. Register at the Atlantic Center in person or call 310-3350, ext. 1. Email Kathy Russell at krussell@ fbfl.org. OCEAN BEACH JUNIOR LIFEGUARD program for ages 10-15 (participants must be able to swim two full pool lengths proficiently, using front crawl and/or breaststroke, swim 10 yards underwater and tread water for three minutes). This program emphasizes physical fitness and personal safety and explores ocean aquatic safety techniques. It is primarily held at Main Beach and will be from 9 a.m. to 4 p.m. June 11-15, June 25-29 or July 9-13. Meet at the Atlantic Center for transportation to Main Beach). $150 city residents, $187 non-city. Register at the Atlantic Center in person or call 310-3350, ext. 1. Email Kathy Russell at krussell@fbfl.org. POOL LIFEGUARD CERTIFICATION COURSE at the Atlantic Center. Pre-test at Atlantic Pool (participants must be at least 15 years old and pass a swimming pre-test in order to enroll for the full course); call for a date/time before April 1, 904-627-8303. Classroom and skills sessions dates and times (participants must attend all sessions; a portion of the academics will be completed at home online prior to first classroom session): April 5 from 5-8 p.m.; April 6 from 5-9 p.m.; April 7 from 9 a.m.-6 p.m.; and April 8 from 8 a.m.-5 p.m. $159 city residents, $199 non-city. Register at the Atlantic Center. Contact Kathy Russell at (904) 627-8303 orkrussell@fbfl.org. SPRING HOMESCHOOLPool Tuesdays and Thursdays through May 17, 11-11:50 a.m. Ages 4 and up. Swimmers must be able to demonstrate endurance by completing 25 yards continuously and unassisted in order to register. $25/month city residents, $31 non-city. Call 310-3350, ext. 1, or email krussell@fbfl.org for information.From 3BPHOTOS BY PETE KOVALICK/SPECIALThe regional track and field meet was held April 25 in Tallahassee. Steven Durr, top right, competed in the 1,600-meter run for FBHS. Top left, Kenzie Branch competes in the 100meter run for FBHS. Above left, Morgan Wrye (FBHS) and Shavonne Bellamy (Yulee) compete in the 4x800-meter relay. Reggina Alexander takes the baton from her teammate in the 4x100-meter relay, above center. Evan Shuman competes in the 300-meter hurdles, above right. Find The News-Leaderon the World Wide Web www.fbnewsleader.com Read the news, e-mail the staff, check the classifieds, or subscribe to Floridas Oldest Weekly Newspaper! Find The News-Leaderon the World Wide Web www.fbnewsleader.com Read the news, e-mail the staff, check the classifieds, or subscribe to Floridas Oldest Weekly Newspaper! r f n t b n t f n b n r f n Display Advertising deadline for Wednesday is 3 p.m. Friday Classified Advertising deadline is 5:00 p.m. Monday.Display Advertising deadline for Friday is 3 p.m. Tuesday Classified Advertising deadline is 5:00 p.m. Wednesday.Please call 261-3696 to place your advertisement. rfntbDONT LITTERSPAY~NEUTER rfntbDONT LITTERSPAY~NEUTER rfntbDONT LITTERSPAY~NEUTER Attention!NASSAU COUNTY!Y ou can get SAME DAY DELIVERY of the News-Leader every week, delivered by the US Postal Service, directly to your home or business. See page 2A for more details. Attention!NASSAU COUNTY!Y ou can get SAME DAY DELIVERY of the News-Leader every week, delivered by the US Postal Service, directly to your home or business. See page 2A for more details. NEW Sports Wed.indd 4 5/1/18 10:42 AM

PAGE 17

Nw rfntr CnbwbSb bplln W e all read articles and watch reporters telling us about the aging population. At the Anderson house we are that demographic. The challenges are many from health to how to use the new time we now have on their hands. Many of us remember that age 65 used to mean true retirement little activity and rocking on the porch. It is a new world with many of us seniors finding another, exciting stage in our lives. For many of us it has also meant an adjustment to a very different climate and lifestyle. For the Big Guy and me, it was a move from the Midwest and adjusting to a Florida lifestyle. No more wing tips and panty hose. We learned to embrace flipflops and resort casual. Many couples studiously plan for their financial security but fail to consider the challenges of being together more of the time. Some find that on the first day of retirement they are staring at each other and wondering what to do next. Women report that, while they have spent a lifetime with the home being their space and domain, all of a sudden he is there all the time and constantly asking where she is going. Men want structure and schedules. No surprises. Women are emotional and love surprises. Women tend to be more spontaneous, perhaps because they have had to adjust to the schedules of children, housekeeping, etc. A man may suffer from an identity crisis without a job to define him. A woman all of a sudden loses her privacy and sense of freedom. Most men are quick to solutions and women want to discuss the problem in detail. At our house sometimes one of us is too quick to speak. We have found that, if we just rewind, reword and restart the discussion, there is a happier ending. It works. Amazing, a little thought and more careful wording and peace returns. The Big Guy and I have settled into a routine that is part work, part our exercise choices he swimming, me tennis and volunteer work. Separate space in the home is highly recommended. Both the Big Guy and I still work and have home offices; his office is on the west side of the house and mine on the east, so we joke about the East Wing and the West Wing. Sometimes we communicate by cell phone or computer despite the short distance between our man and woman caves. For us, our senior years have offered a chance to do things we never had a chance to do before in our too busy lives. We agree it is one of the happiest times of our lives, but it does take mutual respect and a bit of flexibility and using our bonus time carefully. To receive her weekly newsletter or get information about her books including her four From the Porch books contact Dickie at dickie.anderson@gmail.com. More than 200 Nassau County teens and approximately 50 hiring managers from some of the areas largest employers turned out recently for the Nassau County School Districts first Reverse Job Fair at the Lewis Red Bean Nassau Technical Center on the Yulee campus of Florida State College of Jacksonville, accord ing to a news release, noting that approximately 40 adults seeking employment also participated. The event was divided into three sessions one for the districts Class of 2018, one for high school students, and one for adults. During each session, participants remained station ary while employers rotated around the room for one-minute meetings with candidates. Brent Lemond, the districts director of Career Education, likened the format to speed dating. Were very proud of the turnout, both in terms of employ ers and applicants. Many of our career education students throughout the district were able to connect with employers look ing for their specific skills. For example, we had 36 seniors set to earn a nursing assistant license meet with HR representatives from Osprey Village, Baptist Nassau, and LifeCare of Hilliard. Our building construction and HVAC students met several contractors and apprenticeship groups including Miller Electric, Johnnys AC, and Northeast Florida Builders. Students with these and other related skills met representatives from WestRock, Rayonier Advanced Materials, and specialty retailers like Lowes and Home Depot. Our culinary students learned about opportunities at the Omni and Ritz-Carlton and other area restaurants. Finally, our technol ogy and business student were matched with companies like CSX Technologies and VyStar Credit Union, Lemond stated in the release. Employers were also pleased with the event, he noted. Tina Bowen, Osprey Villages business manager, described the event as wonderful, according to the release. We came away with more rfnnnttb NASSAU COUNTY SCHOOL DISTRICT/SPECIALNearly 240 candidates and 50 hiring managers turned out for the fair held in April at the Lewis Red Bean Nassau Technical Center on the Yulee campus of Florida State College of Jacksonville. Hiring managers rotated from station to station to meet candidates during Nassau County School Districts first Reverse Job Fair. potential employees than I thought we would. In terms of solid leads, this was one of the most successful events I have attended, Bowen said in the release. Florida Sun Printings John Milton added, There are some possible hires for us and there were seeds planted for nurturing and growing into the future. (Im) looking forward to next years second ever Reverse Job Fair! The Nassau County Career Education Department began planning the fair about two months ago and received help from several organizations and businesses. The Nassau County Economic Development Boards staff assisted the Career Ed staff in recruiting employers and man aging the event. CareerSource volunteered to assist in review ing resumes, and staff from FSCJs Nassau Center provided tours and information to partici pants. VyStar Credit Union spon sored the student and employer lunches and the West Nassau High School and Yulee High School VyStar Academy teach ers and students handled feeding the groups. This is an example of the type of impact that can be made when so many community stake holders come together. We could see students gaining confidence with each introduction, so it was truly a learning event. Best of all, employers found the talent they were seeking and many students and adults walked away with new opportunities. Well definitely look to do it again, and hopefully even better, next year, Lemond said. SUBMITTED The Friends of the Hilliard Library donned genuine Italian masks at an April 23 board meeting. The masks were the gifts of Secretary Michael Hinkle and his wife, Sonja, who had recently returned from a trip to Italy. Hinkle teaches Spanish and Italian at the library free of charge and resided in Italy for seven years. The Friends are holding a book sale from May 17 to 19 in the Hilliard library. Hours for the event are 10 a.m. to 6 p.m. Thursday and Friday and 9 a.m. to noon Saturday.rfnntThe staged reading of You Dont Know Me, directed by Diana Herman and hosted by Story & Song Neighborhood Bookstore Bistro, raised $540 for the Womens Center of Jacksonville Nassau County Rape Crisis Center during National Sexual Assault Awareness Month. Actors pictured are, front row from left, Nassau County Rape Recovery Team Advocate Lori Anderson, director Diana Herman, and Story & Song co-owner Donna Paz Kaufman, and, back row from left, Don Maley, Edie Blankenberg, Toni DAmico, Cynthia Riegler, and Will Wiley.SUBMITTED bt tnUF/IFAS Nassau Master Gardener Joanne Roach and her husband, Dan, joined in this years cleanup effort at Lofton Creek. Other Master Gardeners, led by County Extension Director Becky Jordi, worked on the cleanup project, as well. Their base and drop off point for the collection bags was the Melton O. Nelson Boat Ramp.REBECCA JORDI/SPECIAL NL 6 col. Wed 05.02.indd 13 5/1/18 9:49 AM

PAGE 18

Friendly, affectionate Gryffin knows how to be a great family dog! Hes a 3-year-old Labrador Retriever mix, and hes very loving. He adores being petted and cuddling and snuggling with you. Hes also a leaner who will gently lean in on you to soak up all the loving he can. His family said he was playful with children and might do best in a home with no cats. He does well with most other dogs so if you have a dog please bring your pet over for a meet and greet. He enjoys going for walks but needs someone who can handle a big, strong dog. He prefers to do his business outside and likes to play with squeaky toys. He also enjoys car rides, going to the beach, playing in water, quiet companionship and being brushed. His family said hes sweet and a wonderful companion, and his ideal new home would be with a loving family. Hes a big guy, about 90 pounds, with a tan coat and lovely brown eyes. Gryffin will greet you with a big smile, and he wants to share it with you forever. Please come see for yourself! This beauty is going to steal your heart! Pierogi is a grey and white longhaired cat with the prettiest green eyes. She enjoys lounging in the cattery and watching all the activities. She is a gentle, sweet soul who will be a wonderful companion. Shes a sweet senior, a domestic longhair mix. Pierogi is spayed and vaccinated and has a microchip. If youre interested in seeing her, please call us at 321-1647 or visit NassauHumaneSociety. com to see if shes at our cattery or one of our remote adoption locations. She is ready to meet you now! Great news: Our adoption center at 639 Airport Road in Fernandina Beach now is open an hour later on weekdays, so you can come over after work! Were open 11:30 a.m. to 6 p.m. Tuesday through Friday, 11 a.m. to 4 p.m. Saturday and 11 a.m. to 3 p.m. Sundays. Starting March 7, Wednesday hours will be from 1 p.m. to 7 p.m. You can see pictures and videos of our adoptable pets anytime at our website, NassauHumaneSociety.com. You can contact us at 321-1647 or info@nassauhumane.org, and follow us on Facebook. Brownie is one of our senior felines at the Cats Angels Adoption Center. He has dark brown and black tabby fur and a super sweet face. Brownie can usually be found on the top bunk of the cat tower so he can be face to face with visitors and he appreciates when they stop and give him a head rub. He has a very laid back and friendly disposition with people and other cats. Please stop by Cats Angels Adoption Center to meet and give some love to Brownie and our other cats that are patiently waiting for their forever homes. They all have been spayed or neutered and micro-chipped and are current on their vaccinations. Our Adoption Center is open 11 a.m. to 4 p.m. Monday through Saturday or call 3212267 to make an appointment to visit. Cats Angels is a volunteerbased organization helping the community since 2001 with low-cost spay and neuter services and TNVR (Trap-NeuterVaccinate-Return to Caregiver). We receive no local or federal government funding and operate solely on private donations, fund raising, grants and sales from our Thrift Store. Your support is appreciated. If you want to know more about how to support or donate to Cats Angels, visit www. catsangels.com and click on How To Help where you will find many ways to lend a hand. Recycle your aluminum and cat food cans at the bins in our parking lot at 709 S. Eighth Street. We graciously accept donations for cat care and resale items at our Thrift Store. Our volunteer application is online or you can call or stop by Cats Angels to sign up. The Thrift Store at Cats Angels is open 11 a.m. to 5 p.m. Monday through Friday and 10 a.m. to 5 p.m. Saturday. Cats Angels can help you get the animals in your care spayed or neutered. Visit the Spay/ Neuter TNVR page on our website or call us at 321-2267 for help with feral and community cats or information on low-cost spay-neuter services. Spay and Neuter The Responsible Solution. rfKatrina Robinshon-Wheeler, community liaison and Mental Health First Aid instructor at Starting Point Behavioral Healthcare, has been named a Top 100 Instructor by the National Council for Behavioral Health, according to a news release. The honor recognizes the total number of classes taught by MHFA instructors, ranging from 60 to more than 160. Wheeler was recognized on April 22 at the national Mental Health First Aid Instructor Summit in Washington, D.C. Since launching Nassau Countys first MHFA training program in 2014, Wheeler has taught 123 eight-hour courses to more than 1,800 residents of Northeast Florida. Like first aid or CPR training, the Mental Health First Aid program teaches individuals skills they can use to help someone in a crisis as well as know how to direct them to professional intervention or care. Wheeler is the community liaison and Mental Health First Aid instructor and educator at Starting Point Behavioral Healthcare, a community-based behavioral health treatment agency in Northeast Florida, where she has worked for the past 17 years. She has worked in several different capacities in the agency, with 11 years as a therapist specializing in womens treatment and five years in management as the behavioral health team leader and clinical director. Wheeler received her masters degree in mental health counseling in 2009 from Webster University and is a licensed mental health counselor in Florida, a licensed professional counselor in Georgia, and a masters level certified addiction professional and substance abuse professional. A graduate of the National Council for Behavioral Healths inaugural Addressing Health Disparities Leadership Program in 2011-2012, Wheeler also is a graduate of the Leadership Nassau program for 2014. Wheeler received the Professional of the Year awards for both Florida Alcohol and Drug Abuse Association and the Florida Certification Board in 2007. In 2014, Starting Point received support from Baptist Health that has provided the funds to offer the classes at no charge to everyone. The MHFA program includes several specialized courses including adult, youth, veterans, public safety officers, older adults and more. More than 1 million people across the U.S. have been trained in MHFA since the program was created in 2001. The evidencebased course is designed to help someone who is developing or experiencing a mental health problem or crisis, including substance abuse disorder. For more information about Mental Health First Aid or to register for an upcoming class, visit MHFANassau.com.ntbThe U.S. Constitution Scholarship Foundation recently graduated 33 students and awarded five $5,000 scholarships to Nassau County students, according to a news release. To graduate, students needed to attend at least five of six classes held throughout the school year and pass a rigorous exam about the U.S. Constitution. Each graduate had an opportunity to submit a 2,000to 3,000-word essay on, in his or her judgment, the most important Supreme Court decision. The organizations board of directors awarded 17 students with $100 each because of the quality of their submissions. An evaluation committee led by Judge Robert Foster conducted a blind review to choose the scholarship winners, which included Grant Graves from Hilliard Middle-Senior High School, Brody Mandelbaum from Fernandina Beach High School, Olivia Lanaghan from Yulee High School, Allison Ventrone from Yulee High School and Isabel Burbo, a home-schooled student. The 2018 Medical Directory is a full color, glossy, user-friendly magazine and has an extended shelf life because it is kept by readers to use throughout the year. TO REACH OVER 48,000 READERS MAKE SURE YOUR BUSINESS OR PRACTICE IS LISTED IN THE2018 MEDICAL DIRECTORY. AD DEADLINE FOR BUSINESS LISTINGS IS JUNE 8, 2018 $10000 PER LISTING Be sure your business or practice is listed in the 2018 Nassau County Medical Directory published in the News-Leader June 27, 2018 and in the Nassau County Record June 28, 2018. 2018 MEDICAL DIRECTORY BUSINESS LISTINGPLEASE INCLUDE A COLOR PHOTOGRAPH TO ACCOMPANY YOUR LISTING Name (Owner/Contact): __________________________________________________________(For Company Use Only)Specialty/Category: ______________________________________________________________ Name of Business: _______________________________________________________________ __________________________________________________________________ ____________________________________________________________ ______________________________________________________________ _______________________________________________________________________ ______________________________________________________________________ _________________________________________________________ ______________________________________________________________________ ___________________________________________________________________ Hospital Status: __________________________________________________________________ ______________________________________________________________ __________________________________________________________________Contact Samantha, Candy or Meghan or mail the coupon below with payment to the News-Leader at P.O. Box 16766, Fernandina Beach, FL 32035. MEDICAL DIRECTORY 8 NASSAU COUNTY Nassau County Record Proud To Be YOUR Hometown Newspaper Since 1930 Since1854511 Ash Street, Fernandina Beach, FL(904) 261-3696fbnewsleader.com617317 Brandies Ave., Callahan, FL (904) 879-2727nassaucountyrecord.com In addition to distribution in the News-Leader and Nassau County Record, the publication will be uploaded onto the home pages of our websites, fbnewsleader.com and nassaucountyrecord.com Your Color Photo Here Robinshon-Wheeler SUBMITTED PHOTOSThird grade students at Emma Love Hardee Elementary School in Fernandina Beach recently participated in a project that required them to choose a U.S. president, living or deceased, and research him in order to answer a number of questions and give a presentation. Grady Stevens was so impressed with the life of President George H. W. Bush that he decided to write him a letter. Soon after, he received the response, right, from the former president. Above, Stevens holds an autographed photo of Bush and his dog, Ranger, that was included with the presidents letter. The photo was taken Aug. 10, 1991 in Kennebunkport, Maine. Stevens also recently sent his condolences to Bush over the passing of his wife, Barbara Bush. Also pictured are Assistant Principal Bryce Cubbal, third grade teacher Lori Rose and Principal Rebecca Smith. PHOTOS BY ROBYN NEMES/SPECIALThe Wild Amelia Junior Naturalist Program, in partnership with Shady Ladies Art Studio, sponsored a Pelican Art Workshop for children, taught by artist Mary Libby. Participants such as Lily Sellers created both whimsical and realistic pelican art. Pictured are, first row from left, Elsa Jerez-Young, Landon Sellers, Lily Burke, Zoe Hoover, and Maren Ferderick; second row from left, Kaitlyn Burke, Wyatt Smith, Matilda Virgillo, and Lily Sellers; third row from left, Emily Gunnlaugsson, Carleigh Johns, Gabi Seibert, Olivia Virgillo, Gianna Coyle, and Cason Sorrells. For more information about all of the programs of Wild Amelia, visit wildamelia.org and Wild Amelia on Facebook. SUBMITTED NL 6 col. Wed 05.02.indd 14 5/1/18 10:12 AM

PAGE 19

The Amelia Island Museum of History will hold its next Brown Bag Lunch at noon today. Special guest Dr. Kent Nielson will pres ent The Impact of Florida (Geologically Speaking). Florida is perhaps the most distinctively shaped state in the U.S. Yet, the current land above sea level reveals only about half of the actual conti nental fragment that is Florida. This presentation will describe the full extent of Florida, the origin of that landmass, the path way followed to unite with North America, and the effect of Florida upon its arrival on the scene. Nielson is a retired professor of geology from the University of Texas at Dallas, member of the American Geophysical Union, and senior fellow of the Geological Society of American. He and Nannette, his wife of 39 years, are fairly recent additions to Amelia Island, and to Florida. They are working hard to understand this place they now call home. This program is free and open to the public. Seating is first-come/firstserved. For more information, contact Gray at 261-7378, ext. 102, or gray@ameliamuseum. org. Amelia Island Museum of History is located at 233 S. Third St. in Fernandina Beach. Ballroom On Amelia offers Two for Tuesday group classes with East Coast Swing at 7 p.m. followed by Foxtrot at 8 p.m. Tuesday classes are $10 per person or both for $15. Latin in Motion fitness class are at 7:45 p.m. Wednesdays. A dance work shop is offered from 7 to 8:30 p.m. Thursdays. Wednesday and Thursday classes are $10 per person. There will be no Friday Night Dance Party in May. Ballroom On Amelia is at 1897 Island Walkway at RAD Studios. Neither a partner nor a reservation is required. For information, call 624-0886 or visit ballroomonamelia.com or the Ballroom on Amelia Facebook page. The parade to kick off the 55th annual Isle of Eight Flags Shrimp Festival will begin at 6 p.m. Thursday. The parade will move west on Ash Street from Central Park, turn onto Front Street and then continue east on Centre Street back to the park. The Plantation Guild & Gallery will hold a public reception from 5:30 to 7:30 p.m. Friday to introduce a Kaleidoscope. Osprey Village will be sponsoring the event and serving light refreshments. The charity will be the Humane Society. The guest artist for Baker Hinton. She will have for sale some of her latest work Gallery artists will also be present. The Gallery is located in the Omni Spa & Shops, 94 Amelia Village Circle on Amelia Island. For more infor mation, call 432-1750 or visit artamelia.com. The Dynamic Les DeMerle Jazz Trio with Bonnie Eisele will Swing Into Spring with performances at Horizons Restaurant, 5472 First Coast Highway on Amelia Island. The group is scheduled to perform 6 to 9 p.m. Friday and Saturday as well as May 25-26. For reservations, call 321-2430. $15 music charge.Dickie Anderson will offer a presentation highlighting some of the homes found in toric district at 5 p.m. May 9 at Story & Song Neighborhood Bookstore Bistro. Her book, Great Homes of Fernandina: Architectural Treasures from shares stories of the communi ty leaders who built the beauti ful Victorian-era homes that have made Fernandina Beach a living museum. Anderson is a docent and volunteer at the Amelia Island Museum of History, writes a weekly col umn for the News-Leader and articles for the Amelia Islander Her book will be available for purchase at the event. The store is located at 1430 Park Ave. in Fernandina Beach. Amelia Community Theatre will hold auditions for An Act of God at 6:30 p.m. May 9 at 209 Cedar Street. Three men are needed for the cast of this comedy by David Javerbaum, which starred Jim Parsons on Broadway. In the play, God and his wingmen, Michael and Gabriel, revisit the Ten Commandments and answer some of the questions that have plagued mankind since creation. Laura Swaim will direct the ACT production, which is rated R, with perfor mances in July on the studio stage. For more information, call 261-6749 or visit amelia communitytheatre.org. The White Oak Conservation Foundation will hold Winos for Rhinos at 5:30 p.m. May 10. The event includes a tour of the organi rhino facilities where you will meet rhinos and their caretak ers to learn about the con servation breeding programs at White Oak. During your stops at the different areas, you will receive a refreshing beverage that wine stewards will describe to you while you The tour will finish at Gilman Hall, where you will enjoy a gourmet dinner and have the opportunity to recount the evening with your new friends. Cost is $200 per person. Call 225-3396 between 8 a.m. and 4 p.m. Monday through Friday for more details and to make reservations. The Friends of the Library Book Club will meet Thursday, May 10, at 7 p.m. Episcopal Church to discuss by Bernard Moitessier. The program is free, and open to the public. Future meeting dates and books to be discussed are June 14, Never Let Me Go by Kazuo Ishiguro; July 12, by Geraldine Brooks; Aug. 9, by Jesmyn Ward; Sept. 13, Persepolis by Marjane Satrapi; Oct. 11, by Arundhati Roy; Nov. 8, Mortal by Atul Gawande; Dec. 13, by Henry James; Jan. 10, A Gentleman in Moscow by Amor Towles; Feb. 14, The Noise of Time by Julian Barnes. The Amelia Island Genealogical Society will hold its regular monthly meeting at 7 p.m. Tuesday, May 15, in the Community Room of the Fernandina Beach Branch Library, located at 25 N. Fourth St. in Fernandina Beach. Melody Porter will present Census First. The census is a timeline to our ancestors names, places and other data but what about reading the rest of the columns and the cen taken the time to do exactly that and will pass on the infor mation. This presentation is great for those new to geneal ogy as well as intermediate researchers who need to go back and take another look at things they might have missed. All censuses through 1940 will be covered. Porter began her career in banking and mort gage finance, but as business es transformed and began using computer software, she became a business analyst and project manager. She is a lover of history and family sto ries. In her spare time, she has been researching her genealo gy for over 30 years. Escaping to Thomasville, Ga., she is pursuing genealogy fulltime as a genealogy and history researcher, lecturer and writer. Porter specializes in Florida, Georgia and Native American research but has a soft spot for French and English his tory. Proud to be a Native American (both Cherokee and Choctaw), Porter is a voting member of the Western Cherokee Tribe in Oklahoma. She is a graduate of Agnes Scott College in Decatur, Ga. She has attended The Institute of Genealogy & Historical Research at Stamford University in Birmingham, Ala. as well as local, state and national genealogy conferences to stay current on the newest trends. As a DAR member, she is constantly improving her research skills by helping others join DAR. She has had her DNA DNA and enjoys finding new cousins. The public welcome is welcome to attend. The Amelia Island Museum of History will hold its next 3rd on 3rd Street presentation at 6 p.m. Friday, May 18. Special guest Medardo Monzon will present The Genealogy of Genes. For centuries, genealogists have based their studies on ancient records and oral affida vits to establish line of descent. Fifty years after the discovery of DNA, the age of genealogi cal DNA testing was launched, providing us with scientific methods to prove relation ships. But how were DNA This entertaining presentation will focus on describing the thrills, intrigue and espionage associated with the amazing race to solve the puzzle of this remarkable molecule by three competing scientific teams. Monzon will also describe the different types of DNA genetic testing, and will show how his own DNA test results encapsu late the story of human migra tion. Monzon began his career as an entrepreneur in his native Colombia, moving to the United States in 1981, where he worked for Dow Chemical, Equistar (now Lyondell) and International Paper. He obtained a chemistry degree from the National University of Colombia and a master degree in chemistry from Central Michigan University. He is a graduate of the Mahler Advanced Management Skills Program and is certified in neuro-linguistic programming and several personality diag nostics. Monzon is retired and a resident of Amelia Island. His hereditary material shows links to points across the globe: Europe, sub-Saharan Africa, East Asia and the Americas. This program is free for museum members with a suggested donation of $5 for non-members. Seating is firstcome, first-served. For more information, contact Gray at 261-7378, ext. 102, or gray@ ameliamuseum.org. Amelia Island Museum of History is located at 233 S. Third St. in Fernandina Beach. Amelia Community Theatre will present The Phantom Tollbooth a play for young audiences and their families based on the classic novel by Norton Juster, at 7 p.m. May 18-19 and 24-26 as well as at 2 p.m. May 20 and 26 in Studio 209, located at 209 Cedar St. in Fernandina Beach. The show is recom mended for ages 5 and up; children under 12 must be accompanied by an adult. Tickets are $15 for adults and $8 for children and students. Call 261-6749 or visit ame liacommunitytheatre.org for tickets and information. The U.S. Coast Guard Auxiliary is offering a recreational boating safety course aimed at new boaters, including teens. Flotilla 14-1 will conduct the course at the Amelia Island in Fernandina Beach, from 8 a.m. to 5 p.m. on May 19 and June 9. Registration starts at 7:45 a.m. and costs $10. If you pass an exam, you will receive a Florida Boater Education card. The Amelia Island Museum of History will hold a Brown Bag Lunch at noon Wednesday, June 6. Special guest Chip Kirkpatrick will deliver a presentation entitled Metal Detecting: Finding Buried Treasure on Amelia Island. Kirkpatrick will recount the fascinating history of the first metal detector, which was made by Alexander Graham Bell in an attempt to save the life of President James Garfield. He will then discuss metal detecting and tell us about some of his most interesting finds, including a silver medallion found by Kirkpatrick last January, which is believed to be of Scottish origin and may have a compelling con nection to local history. Join us as we learn about metal detecting and the artifacts that provide a link between past and present. Kirkpatrick and his wife, Grace, are lifelong residents of Northeast Florida. Retired after 32 years with Bellsouth/AT&T, Kirkpatrick was an avid fisherman until a friend got him interested in metal detecting. He has sold his three boats and most of his fishing gear and now does dirt fishing. His wife says he still gets as dirty as before but occasionally smells better at the end of the day. An avowed history buff, he despairs that so much of our history is rusting and rotting away, in the ground beneath our feet. He is dedicated to recovering as much as possible, restoring it and finding places for it in schools, museums and librar ies. This program is free and open to the public. Seating is first-come/first-served. For more information contact Gray at 261-7378, ext. 102, or gray@ameliamuseum. org. Amelia Island Museum of History is located at 233 S. 3rd St. in Fernadnina Beach. The kick-off event for the One Book, One Community program will be held at 6 p.m. June 7 at Caf Karibo. The 2018 One Book, One Community event will feature bestselling author Steve Berry, who will discuss his recent Professor Chris Twiggs will serve as the guest moderator for the program. One Book, One Community is a county wide program that encourages Nassau residents to read and discuss the same book. Various programs dealing with the theme, era and subject of the book will be offered throughout Nassau County. This program is in partnership with the Nassau County Public Library System and the Amelia Island Book Festival and is sponsored by the Fernandina Beach Friends of the Library. This is a plated, ticketed event that costs $25 per person; reservations need to be com pleted by June 4 and should be made early. Seating is lim ited. Plate choices are chicken dinner or vegetable lasagna. A cash bar will be available. Checks should be made pay able to the Fernandina Beach Friends of the Library. For more information, visit the library website at nassau reads.com or call the library at 530-6500. The Fernandina Beach High School Class of 1978 is planning its 40-year reunion. A meet and greet will be held at 5 p.m. Friday, Aug. 30, at Sandbar & Kitchen at Main Beach (no charge). Dinner and dancing will take place 6-10 p.m. Saturday, Sept. 1, person). A pre-reunion gettogether will be held June 9 on Amelia River Cruises. For questions or more informa tion, contact Johnny at 3217875, Brenda at 753-0235, or Kim at 415-3243, or visit the FBHS Class of 1978 page on Facebook.Resin epoxy, dirty pour art classes are being held 6:30 to 8:30 p.m. Wednesdays and Fridays at Clay Times Art Center, located at 112 S. Third St. in Fernandina Beach. All materials are provided for you to create your own 12-by12-inch piece of art, which can be picked up the next day when it has cured to a glasslike finish. Cost is $45. To register, contact Julie Delfs at 518-322-7937. Four six-week adult beginning guitar classes are being offered by the Nassau County Adult Education Department beginning in June. Two classes will be held in the old middle school in Yulee at 850935 U.S. 17 in room 16-01 and will run on Tuesdays from June 12 to July 24 (no class July 3). The first class will run from 5:30 to 6:45 p.m. The second class will run from 6:45 to 8 p.m. The two other classes will be held in Fernandina Beach at the Nassau County School District administra tion building at 1201 Atlantic Ave. in the Team Center on Thursdays from June 14 to July 26 (no class July 5). The first class will run from 5:30 to 6:45 p.m. The second class will run from 6:45 to 8 p.m. The class limit for all classes is six. The cost for a class is $80 for instruction and materials. Call Michelle at 650-823-1767 to register or for information. The Amelia Knitting Club meets from 3 to 5 p.m. on the first Thursday of each month at the BuyGO store on South Eighth Street. Kings Bay RC Modelers, established in 1989, is located Bluff Road and Oakwell Road in Kingsland, Georgia. We are a small Club with excellent facilities, consisting of friendly people passionate about our hobby. We welcome pilots of all levels. To learn more please visit bit.ly/2xDcFBd. ACBL Duplicate Bridge, Peck Center, 516 S. 10th St., Fernandina Beach. Amelia Island Duplicate Bridge Club hosts the only sanctioned ACBL duplicate bridge games on the island. Monday, 1 p.m.; Wednesday, 9:30 a.m.; Thursday, 1 p.m. For information, contact fredstokes50@ gmail.com or (770) 616-7664. Bingo is played every Thursday at American Legion Post 54, 626 S. Third St. The public is invited to play in the meeting hall. Doors open at 5:30 p.m., and early bird games begin at 6:05 p.m. Regular session, which consists of nine games for $20, begins at 6:30 p.m. Cash prizes, and proceeds are donated to help veterans and the community. You must be 18 to be in the hall during play. Call 261-7900. Lions Club bingo, every Thursday and Sunday, Yulee Lions Club Bingo Hall. Doors open at 4 p.m., warm-ups at 5:15 p.m. Early birds play at 5:45 p.m. with the regular program at 6:30 p.m. Participants must be 18 years old; minimum purchase $15. Information, 708-2591. r p ffntnb rntnbTOURIST DESTINATIONS ACROSS 1. Dog show out casts 6. Pose a question 9. Mr. Potato Head, e.g. 13. ____ tower 14. Holstein sound 15. Liable to cry 16. Was rebroad casted 18. Packers QB 19. *Where ATMs have instructions in Latin 21. Army bathroom 23. Surf turf 24. At ____, soldier! 25. Pat 28. University head 30. Pre-wedding agreement 35. Caspian Sea river 37. Like the fairy tale duckling 39. Pore in a leaf 40. Hindu Mr. 41. Intrudes 43. Month before Nisan 44. Perpendicular to the keel 46. Pronto! 47. Highway hauler 48. Magazine col lection 50. Bike maker 53. Start of a conclusion 55. Look through a scope 57. *Popular allinclusive location, pl. 61. *Where to visit the happiest place on Earth 66. Crematorium jar 68. Dip a ____ ____ the water 69. General direction 70. Be indisposed 71. Jagged 72. Trees on Freddy 73. Spade for stony ground 74. Roller derby turf, pl. DOWN 1. Type of nuclear missile 2. Eye layer 3. Legal wrong 4. *Orient Express, e.g. 5. On the same page 6. Echoed by the flock 7. Chronic drinker 8. *Down Under marsupial 9. Scorch 10. ____wig or ____winkle 11. *Middle name hometown 12. Unit of force 15. *Taking the ____, or going to Baden-Baden 20. Consumed 24. Joins the military 25. *Location of building 26. Omani and Yemeni 27. ____ in Toyland 29. *Where to see Taj Mahal 31. #17 Across, pl. 32. Source of lymphocytes, pl. 33. Savory sensation 34. *Chunnel ride from London 36. *Party in Maui 38. *Sydney Harbour is one of first to ring in the new one 42. Ancient fishing tool 45. Modus operandi 49. Female pronoun 51. In working order 54. Run-of-the-mill 56. Native New Zealander 57. Memory unit 59. Throat-clearing sound 60. Flipside of pros 61. Unrivaled 62. *Vegas light 63. Floppy storage 64. Change for a five 67. *Home to Christ the Redeemer NL 6 col. Wed 05.02.indd 15 5/1/18 10:13 AM

PAGE 20

ANNOUNCEMENTS Lost & Found Personals Public Notice Miscellaneous EMPLOYMENT Help Wanted Business Opportunity Work Wanted Services EDUCATION Schools & Instruction Tutoring Lessons/Classes FARM & ANIMAL Equipment Livestock & Supplies Pets/Supplies Services MERCHANDISE Garage Sales Articles for Sale Antiques-Collectibles Produce Appliances Home Furnishings Muscial Instruments Auctions Wanted to Buy Free Items Miscellaneous RECREATION Boats/Watercraft RVs/Campers/TrailersREAL ESTATE Homes for Sale Condominiums Mobile Homes Ocean/Waterfront Lots & Land Farms & Acreage Commercial/Retail Investment Property Other Areas Wanted to Buy RENTALS Apartments Condominiums Homes Rooms Mobile Homes Vacation Rentals Office Commercial/Retail Roommate Wanted Wanted to Rent TRANSPORTATION Automobiles SUVs Trucks Vans Motorcycles/ATVs rfntffbbbbb rf ntbbb The News-Leader at 261-3696 to put the Service Directory to work for you! PEST CONTROL SERVICE DIRECTORY r rfntb tbtbnr bbbb bb btbnr bn ftbnr nb nf bbrb LAWN MAINTENANCE LAWN MAINTENANCE LAWN MAINTENANCE LAWN MAINTENANCE HANDY MAN SERVICES rfntb nn nff r rfrn ftrbt fntbbn rfnn CONSTRUCTION CLEANING SERVICES rfrnftnnfbn b bt PAINTINGDo you need an affordable way to let the community know about the services you offer? ROOFING Re-Roofing Is Our Specialty COASTAL ROOFING SYSTEMSNassau County s Largest Roofing & Siding Contractor Serving Satisfied Homebuilders & Homeowners Since 1993 Re-Roofing New Roofing Siding Soffit & Fascia261-2233Free Re-Roof Est imatesACoas tal Building Sys tems Co CCC-057020 IF YOU ARE READING THIS WE CAN HELP!Service Directory Ads Reach Your Customers! Call 261-3696 and find out how to put your advertising dollars to work for you! Service Directory Ads Reach Your Customers!Call 261-3696 and find out how to put your advertising dollars to work for you! Removal & Installation $475 per pallet. Sod, Labor & Tax included.No fees up front. Call anytime (904) 868-7602SOD REPLACEMENT PRESSURE WASHING rfnr trbnr BLUEPRINTS EASY AS 1. 2. 3. 1. Email us your Blueprints 2. Tell us how many sets 3. They will be ready when you get here! FASTEST SERVICE IN NASSAU 904-261-0740www.ameliaislandgraphics.com shoplocal@aigraphics.net 2162 Sadler Road Fernandina Beach, FL 32034 rf r f n tr tb rfrr GARAGE DOORS GRASS TOO TALL?GIVE SHAWN A CALL! 904-318-3700Insured Licensed Also, House Cleaning BUSH HOGGING DRIVEWAY GRADING LAWN MAINTENANCE GARDEN TILLING HONEY DOS CLEANING & HANDYMAN SERVICE 25 YEARS EXPERIENCE HOMES CONDOS RENTALS RUN ERRANDS GROCERY SHOPPING, ETC. GREEN FX LAWN CARE We Measure Excellence by the Yard Full Service Lawn Maintenance Free Estimates, Spring Cleanup Residential & Commercial Mike Rogers mrogers121@yahoo.com 904-556-1688 HANDYMAN Interior & Exterior Work 1 8 Years Experience No Job Too BigSenior & War Vet Discounts(904)-849-7608 cell (586)-563-0228NO MONEY DOWN Electrical Plumbing Deck Repairs Any Electrical or Plumbing NO JOB TOO SMALL904-903-1175terry.layman500@yahoo.com Insured & Bonded Find The News-Leaderon the World Wide Web www.fbnewsleader.com Read the news, e-mail the staff, check the classifieds, or subscribe to Floridas Oldest Weekly Newspaper! Find The News-Leaderon the World Wide Web www.fbnewsleader.com Read the news, e-mail the staff, check the classifieds, or subscribe to Floridas Oldest Weekly Newspaper! r f n t b n t f n b n r f n Display Advertising deadline for Wednesday is 3 p.m. Friday Classified Advertising deadline is 5:00 p.m. Monday.Display Advertising deadline for Friday is 3 p.m. Tuesday Classified Advertising deadline is 5:00 p.m. Wednesday.Please call 261-3696 to place your advertisement. rfntb DONT LITTER SPAY~NEUTER rfntbDONT LITTERSPAY~NEUTER rfntbDONT LITTERSPAY~NEUTER Attention!NASSAU COUNTY!Y ou can get SAME DAY DELIVERY of the News-Leader every week, delivered by the US Postal Service, directly to your home or business. See page 2A for more details. Attention!NASSAU COUNTY!Y ou can get SAME DAY DELIVERY of the News-Leader every week, delivered by the US Postal Service, directly to your home or business. See page 2A for more details. DEEP WATER LOT Spectacular Views, Excellent Location, Small Gated Community, .87 Acres, Build Ready, Electric/Artesian WellDeepWaterAmelia.com904-497-1111 (904) 261-40112057 S. Fletcher Ave. LONG-TERM RENTALS Fernandina Beach Realty Amelia-ERA.com CARTESIAN POINT 3 bedroom, 2 bath house with 2 car garage. 1500 sq. ft. $1295 per month. Available 4/26/18. Looking for a Long Term Property Manager?With 150+ properties and over 30 years of experience we are here for you. Contact Chuck Lynch for more information. Pre-sale items dates April 25, 26, 27, 28Auction dates May 4 & 5Martha Elizabeth Monk Johnson EstateReal Estate: 110 E. Main Street Bldg. & 195 First St., Folkston, GA & Murray Landing River Lot.Personal Property: Large inventory of Johnson Bros. Hardware Store items; plumbing, woodwork, piping, nails, hand tools, workshop equipment, farm equipment, etc. Mrs. Johnson Estate collectible, furniture, goods (at live auction only)hansfordrealauction.com Ofce (912) 285-5687 or Jeffery (912) 390-1648 10%BP added GAL #254 Tell a friend REAL & PERSONAL PROPERTY60b042518pp.jc rfn ttbttt tttbbrtt bttt nt f 1 FNL05020502EEEE97 1 5/1/18 10:23 AM

PAGE 23

3 Community Partners & Sponsors Event Partners & SponsorsERA/Fernandina Beach Realty First Coast Railroad Nassau Humane Society Keep Nassau Beautiful Lott's Furniture O'Steen Volvo Tobacco Free Nassau Nassau County Emergency Management Police Auxiliary CorpsPort Consolidated Richard B. Goodsell Ricky's Coast to Coast Nets WestRock Historic Fernandina Business Association NassauTRANSIT P5 Productions David Cook NACDAC Sunbelt Rentals Southern Glazers Wine & Spirits United Rent-All Amelia Island Paint & Hardware Artistic Florist Bean School of Dance Burbank Sports Nets Compass Self Storage Storage On SadlerSchool Art Display: Island Art Association & Nassau County School Board Pirate Parade: Residence Inn Amelia Island 51st Annual Topsy Smith Memorial Beard Contest: The Marina Restaurant Adult Pirate Costume Contest: Ye Ole Pirate Fishing Charters Kids Fun Zone Infant's Comfort Station: Baptist Medical Center Nassau Auxiliary Shrimp Festival Ambassadors: Fernandina Pirates Club, Inc. Fine Arts and Crafts Show: Island Art Association Pirates in Training and Little Pirate Contests: Mason's Refrigeration & Air Conditioning, Inc. Ice Cream Eating Contest: DeNuccis Soft Serve Miss Shrimp Festival 2018 Scholarship Pageant: Hampton Inn & Suites, Amelia Island "Historic Harbor Front Hotel" 5K Shrimp Run/Walk, 1-mile Katie Caples Youth Run and a 1/2-mile Popcorn Run: McArthur Family YMCA Captain Sponsors Harbormaster sponsors First mate sponsorsMedia sponsors by BCI Acrylic Jumbo Shrimp Baseball Club Presenting Sponsor Official Radio Station Official Television Station

PAGE 24

4 Essentials, News-Leader, SHRIMP FESTIVAL 2018

PAGE 25

5 Essentials, News-Leader, SHRIMP FESTIVAL 2018 The Isle of Eight Flags Shrimp Festival will again partner with NassauTRANSIT to provide free transportation for this years festival. NassauTRANSITs modern, safe and comfortable buses will shuttle festival-goers and their families between the Fernandina Beach High School park-and-ride and the festivals pick-up and drop-off locations. Meanwhile, the Island Hopper will operate with extended hours on its regular route around Amelia Island and downtown Fernandina Beach. Transportation Hours Park-and-Ride Shuttle and Island Hopper Friday, May 4 5 p.m. to 11 p.m. Saturday, May 5 8:30 a.m. to 7:30 p.m. Sunday, May 6 9:30 a.m. to 6 p.m. Park-and-Ride Shuttle Pick-Up/Drop-Off Locations Central Park Atlantic Avenue at 11th Street Downtown Alachua Street at Second Street Uptown Centre Street at Eighth Street All NassauTRANSIT buses, including the Island Hopper, are accessible for passengers with disabilities. Although a parking fee will apply at the parkand-ride location, shuttle transportation to and from the Shrimp Festival will be free. In addition, all transpor tation on the Island Hopper during the three-day festival will be free. Were excited about our continued partnership with the Isle of Eight Flags Shrimp Festival, said Liz Dunn, marketing and communication director at Nassau County Council on Aging, operator of NassauTRANSIT. Its an opportunity to serve the public transportation needs for locals and visitors alike, and we really enjoy contributing to our island homes amazing traditional event. NassauTRANSIT is Nassau Countys public transportation system. Paratransit service for qualified passengers is provided countywide and into Jacksonville. Also, a convenient public bus system connects Hilliard, Callahan, Yulee, Fernandina Beach and Jacksonville with scheduled routes and designated bus stops. The Island Hopper provides hop on, hop off local transportation on Amelia Island. All NassauTRANSIT bus operators and buses are FDOT-credentialed. Whether for work, school, errands, shopping, entertainment, appointments or social activities, NassauTRANSIT is a safe and affordable way to Get Around! For more information, call 904-261-0700 or 800-298-9122 or visit www.nassautransit.org. rfnnr fftb

PAGE 26

6 1. The Isle of Eight Flags Shrimp Festival is permitted by franchise and area defined by the City of Fernandina Beach Code of Ordinances, Section 14-1. The following items are prohibited within the Festival area by ordinances issued by the City of Fernandina Beach: NO alcoholic beverages permitted on any public street, highway, right of way, sidewalk and boardwalk, unless an enclosed area is so licensed and designated by the Shrimp Festival Committee. NO Roller or In-Line Skates NO Skateboards or Hoverboards NO Bicycle Riding Use of nuisance items such as Silly String, Poppers, or High-Powered Water Guns is STRICTLY PROHIBITED. The Fernandina Beach Police Department and Code Enforcement strictly enforces ALL City ordinances. 2. All activities within the Festival area must comply with Festival Regulations and City Code. All exhibitors, vendors and entertainment in the Festival area must be permitted by the Shrimp Festival Committee. No unauthorized street vendors or entertainers will be allowed. Businesses and residents in the City of Fernandina Beach should continue to comply with City and State licensing codes unless otherwise permitted by the Shrimp Festival Committee. 3. Businesses operating with a license from the Florida Department of Alcohol, Tobacco & Firearms (i.e. restaurants, bars, pubs, etc.) should not deviate from their normal licensed operating procedure and should practice due diligence to ensure their customers do not enter the Festival area with any alcoholic beverages. (See Regulation 1). 4. This event will be held rain or shine. Exhibitor booth fee may be refunded if cancellation is received in writing no later than one month in advance, unless otherwise noted. No refunds will be given for late arrivals or no-shows. 5. Hours of Festival Operation (unless otherwise permitted): Thursday, 6:00 p.m. until complete (parade through the downtown area the Sounds on Centre begtween 2nd and Front streets) Friday, 6:00 p.m.-10:00 p.m. (Riverfront and Kids Fun Zone Only) Saturday, 9:00 a.m. to 6:00 p.m. (Riverfront Entertainment and food booths open until 7:00 p.m.) Sunday, 10:00 a.m. to 5:00 p.m. 6. The Kids Fun Zone is designated as a Tobacco-Free and Alcohol-Free Zone. 7. Pets must be on a leash and in accordance with the Citys leash laws. 8. NO distribution of advertising literature or marketing items or any other such documents will be allowed. Neither raffles, tip jars, walking billboards, snipe or sandwich type signage nor other fundraising efforts will be allowed unless otherwise permitted by the Shrimp Festival Committee. 9. Costumed mascots or characters must apply and, if approved, have paid a Sponsor permit for access issued by the Shrimp Festival Committee at least thirty (30) days prior to the first day of the festival. They will be assigned to a specific area and are not allowed to roam (unless otherwise permitted by the Shrimp Festival Committee). No unauthorized costumed mascots or characters will be allowed in the Festival area. Street performers and street entertainers are not allowed. Approval is not guaranteed. 10. These regulations are for the safety of our festival attendees, vendors, exhibitors, volunteers and workers. Failure to comply with these regulations and/or city code may result in a citation, censure or possible expulsion from the Festival area. 11. The Shrimp Festival Committee reserves the right to make any changes or additions to these regulations at any time without prior notice.Thursday 6:00 p.m. until complete. ( Parade through the downtown area, then Sounds on Centre between Second and Front streets) Friday   6:00 p.m.-10:00 p.m. Riverfront and Kids Fun Zone only. Saturday   9:00 a.m. to 6:00 p.m. Kidz Zone and Food booths end at 9:00 p.m. Sunday   10:00 a.m. to 5:00 p.m.rrftbn For the safety and comfort of Isle of Eight Flags Shrimp Festival sponsors, vendors, exhibitors, participants, volunteers, guests, residents and businesses, please adhere to these regulations within the Festival area. All rules are strictly enforced: ftb

PAGE 27

rfntfbntf 55th Annual Shrimp Festival Joining our friends and neighbors to celebrate our 55th Annual Shrimp Festival May 4, 5 & 6, 2018 Fernandina Beach For more information, contact your Edward Jones financial advisor. rrffr fnffrf rtb nffrf tr bn Kim R Harding-Boylan.1403 Park Ave Suite A 904-321-2044 Crystal L Henning.4810 First Coast Hwy 904-277-6756 Fernandina Beach Fernandina Beach Jodi Collins.95766 Amelia Concourse 904-261-9392 Fernandina Beach Fernandina Beach Brian P Henning, AAMS.95766 Amelia Concourse 904-261-9392 Fernandina Beach Steven G Gibb.11 North 4th Street 904-277-2466 rrffr fnffrf rtb nffrf tr bn Kim R Harding-Boylan.1403 Park Ave Suite A 904-321-2044 Crystal L Henning.4810 First Coast Hwy 904-277-6756 Fernandina Beach Fernandina Beach Jodi Collins.95766 Amelia Concourse 904-261-9392 Fernandina Beach Fernandina Beach Brian P Henning, AAMS.95766 Amelia Concourse 904-261-9392 Fernandina Beach Steven G Gibb.11 North 4th Street 904-277-2466 rrffr fnffrf rtb nffrf tr bn Kim R Harding-Boylan.1403 Park Ave Suite A 904-321-2044 Crystal L Henning.4810 First Coast Hwy 904-277-6756 Fernandina Beach Fernandina Beach Jodi Collins.95766 Amelia Concourse 904-261-9392 Fernandina Beach Fernandina Beach Brian P Henning, AAMS.95766 Amelia Concourse 904-261-9392 Fernandina Beach Steven G Gibb.11 North 4th Street 904-277-2466 rrffr fnffrf rtb nffrf tr bn Kim R Harding-Boylan.1403 Park Ave Suite A 904-321-2044 Crystal L Henning.4810 First Coast Hwy 904-277-6756 Fernandina Beach Fernandina Beach Jodi Collins.95766 Amelia Concourse 904-261-9392 Fernandina Beach Fernandina Beach Brian P Henning, AAMS.95766 Amelia Concourse 904-261-9392 Fernandina Beach Steven G Gibb 11 North 4th Street 904-277-2466 rrffr fnffrf rtb nffrf tr bn Kim R Harding-Boylan.1403 Park Ave Suite A 904-321-2044 Crystal L Henning.4810 First Coast Hwy 904-277-6756 Fernandina Beach Fernandina Beach Jodi Collins.95766 Amelia Concourse 904-261-9392 Fernandina Beach Fernandina Beach Brian P Henning, AAMS.95766 Amelia Concourse 904-261-9392 Fernandina Beach Steven G Gibb.11 North 4th Street 904-277-2466

PAGE 28

8 Beth Stambaugh, For the News-Leaderearly a quarter of a century thats how long Baptist Medical Center Nassau has been in Fernandina Beach. Thats 25 years of providing residents a unique blend of neighborhood friendliness with advanced medical care, a precious find among the many treasures the island has to offer. Baptist Nassau team members have a strong commitment to patient safety and providing the highest quality medical care possible, said Hospital President Ed Hubel. We strive to provide the best patient and family experience, and continually go that extra mile to ensure our patients are treated like family. It all started when Baptist Health purchased Nassau General from the county in 1994. The hospital was in need of capital upgrades and operational improvements along with specialty physician recruitment. Along with the purchase, Baptist Health promised to invest $20 million in improvements. Since purchasing Nassau General, Baptist has invested more than $130 million in significant upgrades to facilities, technology and services. Today, Baptist Nassau is a nationally recognized community hospital, providing high-quality comprehensive care for every stage of life from pediatrics to cardiology and everything in between. People dont realize we have 26 different specialties right here at Baptist Nassau, said Hubel. Residents can stay here in Nassau County for all of their health care needs. With 62 beds and 432 employees, Baptist Nassau is one of the largest employers in the county and designated among the best in the United States for quality patient care.A new, advanced Surgery and Procedural CenterThe most recent addition to Baptist Nassau is a 30,000-square-foot Surgery and Procedural Center that measures half the size of a football field. The hospital invested $22.5 million to build the center, which was designed with the patient and family in mind and the most advanced technology. It features four smart operating suites, 20 large private patient rooms, two endoscopy suites and another suite for minor procedures. Also part of the new center is a large 56-foot watercolor mural that spans the length of the wall in the new waiting room. Painted by Fernandina Beach artist William Maurer, it depicts the natural environment of the entire county Baptist Nassau serves and helps promote a sense of calm and healing for patients and families. Every aspect of the Surgery and Procedural Center is designed to provide a better experience for patients, family members and physicians, said Hubel. Safety and comfort were the driving factors at every stage of design. Another recent example of Nassaus growth is a new Cardiac Rehabilitation Center, which provides heart patients with physical therapy and monitored workouts so they can return to their normal active lives. The center has an array of cardiovascular and strength equipment, occupational and speech therapists and exercise trainers providing all rehabilitation services under one roof. The lead donors for the center were Jane and William OMalley. Through the years, the hospital has continued to grow along with the community. In 2009, the Betty and David Berkman Building opened with 48 spacious patient rooms opened. In 2014, Community Hospice opened in the hospitals Medical Office Building.Keeping an ear close to the groundCommunity involvement is a large part of what makes Baptist Nassau successful. We want to make sure the hospital provides medical services that match the demographic needs of the local area, said Hubel. Thats why we stay closely involved in the community and listen to their input when deciding what services to add. Our board of directors has been especially helpful identifying those services. Staying close to the community means being involved and providing in-kind services with organizations like Barnabas Health Services, the Council on Aging, and the Boys & Girls Club of Nassau County. Im a firm believer that if youre going to lead a hospital, you need to be out in the community, said Hubel. This is Baptist Nassaus second year as the presenting sponsor of the annual Shrimp Festival. The hospital will host a tent at the festival with health information, free giveaways and opportunities to talk to local physicians. rfb ftbnnnn ttnfr ttnfrn

PAGE 29

9 A SALES AND SERVICE DEALERSHIP321-1422OceanOutboardMarine.com OCEAN OUTBOARD MARINE1619 North 14th St. Fernandina Beach, FLAuthorized Key West Dealer Everything ElectricalWhy Wait?....Call Today Office Hours: Mon-Fri 8am to 4pm 24 Hour Emergency Service Available Same Low RateFAMILY OWNED & OPERATED 100% SATISFACTION GUARANTEEDRESIDENTIAL COMMERCIAL INDUSTRIALHome or Commercial Standby Generator Systems Service Changes/Upgrades Electrical Inspections Tech Lighting /Rope Lighting Recess Can Installation Remodel Rewiring New Construction Structure Wiring Low Voltage Landscape Lighting Dock Lighting Trailer Pole Installation 904-491-1422 ER0004148 Bacardi Rum1.75L$1999light or dark Sale prices not valid with any other discounts. Prices valid thru 5/ 9 /1 8 DRIVE THRU SERVICE Monday-Thursday 8am-11pm Friday & Saturday 8am-Midnight Sunday 2pm-10pm VOTED BEST LIQUOR STORE 21 YEARS! 2112 S. 8th St. 261-3640 One Mile Past Intracoastal Bridge on the Right Locally Owned & Operated Marlin & BarrelBearing Amber Rum$2599 Makers Mark750 mL$2499 SHRIMP FESTIVALSPECIALS!5 POINTS LIQUORS Titos Vodka1.75L$2999Crown Royal750 mL$2299Captain Morgan1.75L$2299

PAGE 30

10 Christine M. Scott, For the News-Leader Ricky Douberly was born July 29, 1962 in Nahunta, Ga. He grew up in Yulee, Fla. and graduated from Fernandina Beach High School in 1980. In 1979 while still in school, he started making nets with Burbank Trawl Makers at Standard Marine Supply Co. Some years later, he and Bill Skipper opened Atlantic Coast Nets in Mayport, Fla., where they ran a successful net shop with many shrimp boats in the area at that time. Tides changed, and he moved to Fort Myers Beach, Fla. During that time, he spent several years traveling the coast and back and forth to the Gulf to make and repair nets. In 1996, he started Rickys Coast To Coast Nets at the Tampa Shrimp Docks and made custom nets, including shrimp nets, sport nets, nets for Sea World, Busch Gardens and many other major parks and baseball fields. Six years later, Standard Marine Supply Co. would buy out the marine supplies and offer him their net shop back in Fernandina Beach, where it all started. He volunteered with the Duval County school system and worked with the Florida Folklife Program to help archive photos and documents to preserve the history of net making, an art that has all but disappeared. He loves being one of the few who still make shrimp nets by hand. Ricky, also known as The Net Man, continues making custom nets and selling commercial marine supplies today. He is passionate about keeping the history of shrimping and net making alive. When he isnt working, he enjoys hunting, fishing, and cooking especially seafood! We are pleased to honor Mr. Ricky Douberly as our grand marshal of the 55th annual Isle of Eight Flags Shrimp Festival.fntfPhoto by Christine M. Scott fnnn The Pirate Parade starts at 6 p.m. from Central Park at Ash Street, travels west along Ash Street, turns north on South Second Street to Centre Street and continues east on Centre Street back to Central Park. Sounds on Centre starts after the parade at Centre and Second streets. Featuring DECAdDESBANdD Amelia Islands Premier Party Band

PAGE 31

11 John W. McClane III O.D.Glasses, Contacts, Primary eyecareJ. Russell Stackhouse, M.D.Cataract, Corneal, and LASIK surgeon Full Optical Shop over 1,000 Frames in Stock Now accepting Medicare, Tricare VSP and EyeMed Patients6 South 14th Street 904-261-5741Anthony L Stubits O.D.Glasses, Contacts, Primary eyecare Auto Homeowners Condominium Flood Commercial Auto Commercial Property General Liability Motorcycles Boats Jet Skis Golf Carts Personal UmbrellaLouis Llerandi 904 310 3803501 Centre St Suite 126Fernandina Beach FL 32034ligfernandina@gmail com mumconline.com 601 Centre Street 904-261-5769 Festival Parking FRI, SAT or SUN With a $10 donation Worship Worship with Us Sunday Morning Before the Festival May 6th at 10:00AM Come Dressed for the Fest! Casual Worship in Memorials Sanctuary. to Youth@Memorial. And pick up an Award-Winning Shrimp Quesadilla from the Youths booth at the corner of 6th St. & Centre St. S erving Amelia Island f or over 196 y ears!

PAGE 32

12 Essentials, News-Leader, SHRIMP FESTIVAL 2018 Food Booth Locations Key List By Number Marina Area 1. Buck Fever 2. NSFA 3. Yulee Inzone 4. FBHS Band 5. Faith Christian Academy 6. Yulee High School 7. Black Rock Baptist 8. NAACP Centre Street 9. Amelia Island Museum of History 10. FBHS Basketball 11. Yulee HS Band 12. The Bridge 13. FBHS Cheerleaders 14. Set Free Nassau 15. Prince of Peace Church 16. Nassau County Vietnam Veterans 17. Memorial United Methodist Church 18. Friends of Aviation Kids Fun ZoneCentral Park Fernandina Stingrays Team Journey Church

PAGE 33

13 Mark Deaton Entertainment Director, Isle of Eight Flags Shrimp Festival For the News-LeaderIts springtime once again, and that means the annual Isle of Eight Flags Shrimp Festival is here and bringing with it three days filled with great entertainment on the Riverfront Stage in historic downtown Fernandina Beach. Kicking off the festival on the evening of Friday, May 4, immediately following the opening ceremonies at 6 p.m. and the Miss Shrimp Festival Scholarship Pageant at 6:30 p.m., is flipturn. In late 2015, a group of high school friends started playing music in a Fernandina Beach garage. It did not take long for the five to realize their mutual ambition of playing music on a national stage. Today, they make up the band flipturn, taking the Florida indie scene by storm and capturing the hearts of music lovers around the world as they seamlessly blend elements of surf rock, garage, new wave, and pop. March 2017 saw the release of flipturns debut EP, Heavy Colors. Achieving over 500,000 streams in less than a year, Heavy Colors has been met with a wave of positive reviews from critics and fans alike. Entertainment begins again early on the morning of Saturday, May 5, with a performance by the award-winning Fernandina Beach High School Jazz Ensemble at 9:30 a.m., along with a featured performance by the FBHS Rose Saxophone Quartet. Next up at 11 a.m. are Amelia Islands favorite classic rockers, The Honey Badgers. Whether playing to packed houses locally in North Florida or performing for the troops at Guantanamo Bay, Cuba, individual members of the Honey Badgers execute their craft with passion and technical precision. Known for their spot-on, note-for-note covers, the band will be performing a special Tom Petty tribute set. Taking the stage at 1 p.m. on Saturday is the Sean McCarthy Band. Seans music and performance style reflects the carefree, laid-back atmosphere of life by the sand and sea. Sean has long been one of the most popular entertainers on and around Amelia Island among locals and tourists alike. He is also a Nashville recording artist and respected singer and songwriter with several national credits. His original songs are a colorful blend of tropical, pop and country. Backed by his talented band of fellow Fishin Musicians, Sean will be performing songs from his CDs Life In A Beach Town and A Bad Day of Fishin. At 4 p.m. on Saturday, multi-instrumentalist Dominic Gaudious makes a return visit to the Shrimp Festival stage. If you have had the pleasure of visiting Disney Springs (formerly Downtown Disney) in Orlando within the past few years, chances are you have been among the thousands mesmerized by Dominic, who has become one of the attractions most popular entertainers. A finalist on FOX TVs 30 Seconds to Fame, Dominic plays 6and 12-string acoustic guitars while incorporating exotic instruments such as the Australian didgeridoo to create a uniquely intricate playing style that blends the sounds of classical, jazz, flamenco, rock, and worldbeat. Dominic always engages the audience with his amazing talent and exciting, highly entertaining style. At 4:30 p.m. on Saturday, The Greatest Hits on Earth Live! will present Rock & Pop Masters, a live concert event filled with nonstop, million-selling hits performed by the artists who made them famous, featuring John Elefante, former lead singer of Kansas, Randall Hall, formerly of Lynyrd Skynyrd, and Jimmy Hall, of Wet Willie and formerly of the Jeff Beck Group. These featured artists will perform an exciting, hit-filled show backed by an incredible band of renowned musicians including percussionist Charlie Morgan, who toured and recorded for 13 years as drummer for Elton John. John Elefante began his tenure as front man of the iconic rock group Kansas in 1981 rrn nfnf nfnt SUBMITTEDRandall Hall, formerly of Lynyrd Skynyrd, John Elefante, former lead singer of Kansas, and Jimmy Hall of Wet Willie take the Shrimp Festival Riverfront Stage at 4:30 p.m. Saturday, May 5. Continued on Page 23 presented by2018 Riverf ront Stage and Kids Fun Zone Schedule FRIDAY, MAY 4, 2018 SATURDAY, MAY 5 201 8 SATURDAY, MAY 5 201 8

PAGE 34

14 John Scherer, For the News-Leader Sponsored by Hampton Inn & Suites Amelia Island-Historic Harbor Front, The 2018 Miss Shrimp Festival Scholarship Pageant contestants will be judged on poise, personality, appearance and interview responses. Miss Shrimp Festival 2018 will win a $1,000 scholarship, and participants are expected to attend several events before and after the pageant and will participate in the Shrimp Festivals Pirate Parade on May 3. The pageant will be held at 7:30 p.m. on Friday, May 4, after the festivals opening ceremonies. Miss Shrimp Festival 2018 is expected to judge a variety of contests including the Best Beard Contest, The Best Dressed Adult Pirate Costume Contest, the Little Pirate contests, and the Blessing of the Fleet. Other requirements include participating in the 2019 Pirate Parade and the 2019 Miss Shrimp Festival Pageant to help crown the next years winner. Miss Shrimp Festival will also participate in other parades and events during her reign. Kaisen Henderson is an 18-year-old senior at Fernandina Beach High School. She enjoys singing, baking, and spending time with her friends. She also enjoys her job of two years at Zaxbys. After high school, Kaisen plans to obtain a small business degree as well as attend pastry school so she can open her own bakery one day. Jenna Edwards is an 18-year-old senior at Fernandina Beach High School. She is the senior class president and homecoming queen. Her interests include dancing and flag football. She is in the National and Spanish honor societies and Student Government Association. Jenna plans to attend a university in Florida and major in biology. After college she plans to pursue a dental career. Kaleigh Beasley is a 17-year-old West Nassau High School junior who enjoys soccer, tennis, golf, track, and flag football. She participates in the AVID (Advanced Via Individual Determination) college prep program and plans to attend college and pursue a career in trauma nursing. Jaclyn Rogers is an 18-year-old senior at Fernandina Beach High School. She is an Honors and AP student and participates in Little Women. Her hobbies are pageants, modeling, and working with the Humane Society. In her free time, Jaclyn spends time with her friends at the beach. She plans to study marketing and merchandise at Georgia Southern University. Taylor Alvare is a 17-year-old junior at Fernandina Beach High School. Her hobbies are reading, going to the beach and throwing the discus for her schools track team. She also enjoys leading bible studies. She participates in the Youth Group at Five Points Baptist Church, National League of Junior Cotillions and National Honor Society. Taylor plans to get a two-year degree at Florida State College at Jacksonville and then transfer to a university to study speech and language pathology for special needs kids. Faith Twiggs is a 16-year-old junior at Fernandina Beach High School. Faiths hobbies include running, swimming, hiking, biking, and watching football. She is a swim coach at a recreation center, participates in band, is on the swim team, and serves as a yearbook editor. Faiths plans for the future include attending West Point, majoring in mechanical engineering and serving in the United States Army until retirement. Emily Conner is a 16-year-old junior at Fernandina Beach High School. She is a competitive weight lifter who also participates on her schools track team. Her hobbies include art, makeup and music. Emilys plans for the future are to attend college for a business degree and to become certified in cosmetology so she can open her own salon. Myla Karpel is a 17-year-old junior at Fernandina Beach High School who serves as the treasurer for the Interact Club, volunteers at the Humane Society, and participates in Beach Buddies and the Youth Group at First Baptist Church in Fernandina Beach. Her hobbies include dancing and dance instruction at Bean School of Dance. Mylas plans for the future are to attend Florida State University to major in sociology, and minor in dance. She hopes to be a social worker and dance teacher. Emily Colson is an 18-year-old senior at Fernandina Beach High School. She participates in National Honor Society, cheerleading, Future Business Leaders of America, Little Women, and is also a yearbook editor. Her hobbies include going to the beach, fishing, scalloping, snorkeling, and spending time at the pool. Emilys future plans are to attend University of Central Florida to major in business communications and minor in graphic design. While in school, she hopes to participate in an internship at Disney. She wants a career as a graphic design artist. Shelbea Holland is a 17-year-old junior at Fernandina Beach High School who enjoys softball and Fernandina Beach Little League. Her hobbies include going to the beach, hanging out with friends, and helping coach Little League. Shelbeas plans for the future are to play softball at Tallahassee Community College on a scholarship and to work her way into the medical field. Isabella Thompson-Davoli is an 18-year-old senior at Episcopal School of Jacksonville. Her hobbies include playing lacrosse, swimming, crocheting, and hanging out with her family. She is president of Daniel Club and an Eagle Ambassador at her school. Isabellas future plans are to go to college and study pediatric nursing. Kendall Kay Hunter is an 18-year-old senior at Fernandina Beach High School. Her school activities include varsity and competition cheerleading, and she is corresponding secretary for Little Women. Her hobbies are volunteering at the Humane Society, traveling abroad, riding her bike, and spending time with animals. Kendall plans on attending college to study exotic animals. Arriell Drayton is an 18-year-old senior at West Nassau High School. Her hobbies include cheerleading, volunteering at school, and playing basketball and flag football. She was homecoming queen in 2017. Arriell plans to attend Florida Agricultural and Mechanical University to major in broadcast journalism.ftbPictured from left are, first row, Isabella Thompson-Davoli, Myla Karpel, Taylor Alvare, Shelbea Holland, and Emily Colson; second row, Kendall Kay Hunter, Jaclyn Rogers, Emily Conner, Faith Twiggs, and Kaleigh Beasley. Missing from the photo are Arriell Drayton, Kaisen Henderson, and Jenna Edwards.

PAGE 35

15 presented by2018 Riverf ront Stage and Kids Fun Zone Schedule FRIDAY, MAY 4, 2018 presented by 2018 Riverf ront Stage and Kids Fun Zone Schedule FRIDAY, MAY 4, 2018

PAGE 36

16 16 16 Essentials, News-Leader, SHRIMP FESTIVAL 2018 FRIDAY, MAY 4, 20185:00 pm 10:00 pm Visit our expanded Kids Fun Zone for LOCALS APPRECIATION NIGHT Friday only purchase a wristband to ride all night for one low price!* 2+ Acres of fun for the entire family A night of family fun, filled with activities, rides, and interactive entertainment featuring performances by and*Some exclusions, including pony rides, apply to ride all night promotion SATURDAY, MAY 5, 20189:00 AM -6:00 PM Rick Hubbard's Kazoobie Show and JuggleSTUFF(Performances throughout the day)10:00 AM Pirate In Training Contest (Ages 5 & under) and Little Pirate Contest (Ages 6 & up) S ponsored by Mason's Refrigeration & Air Conditioning Inc.11:00 AM Bean School of Dance 1:00 PM 2:30 PM From a galaxy far away Bring your camera or phone for photos with Florida Garrison 501stLegion Squad 7! 3:30 PM Learn to be a Pirate with the Fernandina Pirates Club The fun continues until 9:00 PM with extended Saturday Fun Zone hours! 9:00 PM End of Daily Events SUNDAY, MAY 6, 201 810:00 AM -5:00 PM Rick Hubbard's Kazoobie Show and JuggleSTUFF performances throughout the day 11:00 AM Pak's Karate Academy 12:00 PM Learn to be a Pirate with the Fernandina Pirates Club 1:00 PM 2:30 PM Bring your camera or phone for photos with Florida Garrison 501stLegion Squad 7! 3:30 PM Learn to be a Pirate with the Fernandina Pirates Club 5:00 PM End of Daily Events and Festival E vent times and entertainment are subject to changeor cancellation without notice

PAGE 37

17 ttnThe Isle of Eight Flags Shrimp Festival is known for its family fun and entertainment, but there are a wide variety of contests in which your family members can enter and participate. Find the contestant entry booth located at the riverfront for applications, entries and more information. If you would like to learn more and print your entries at home, visit ShrimpFestival.com and click Events. Kids of all ages are invited to don their best pirate apparel and enter one of the contests suited for every age group in the Best Dressed Pirate Contest for youngsters, to include the Little Pirates Contest and Pirates in Training, and of course, for adults, the Best Dressed Adult Pirate Contest! The Kids Fun Zone stage is the location for children to compete for trophies as they show off their best eye patches, pirate boots, puffy blouses, and feather-adorned hats. They will wear their fanciest pirate attire! Hosted by the Fernandina Beach Pirates Club Inc. and sponsored by Masons Refrigeration and Air Conditioning Inc., the Pirates in Training Contest is for ages 5 and younger and the Little Pirates Contest is for ages 6 and older. The childrens contests will be held at the Kids Fun Zone at 10 a.m. Saturday, May 5. The Best Dressed Adult Pirate Contest is open to ages 18 and older and is sponsored by Ye Old Fishing Charters & Tours of Fernandina Beach. Be forewarned if ye plan to enter this contest that all adult contestants apparel must be G-rated and suitable for viewing by children of all ages! All those participating in the adult Best Dressed Pirate Contest may be eligible for cash prizes in first, second and third place, and bragging rights for sure! This contest will be held at the Pirate Ship Stage next to the riverfronts main stage at 12:30 p.m., Saturday, May 5. The 51st annual Topsy Smith Memorial Beard Contest could be a perfect choice for you and your bearded buddies. Beards will be judged on texture and appearance, and this great contest is sponsored by The Marina Restaurant, which is been prominent in downtown historic Fernandina Beach for decades. So me hearties, comb out those mutton chops, goatees, full beards, and many more styles, and step up to enter this great traditional contest! Judging begins at 2 p.m. Saturday, May 5, by the riverfronts main stage. At 1:30 p.m. on Sunday, May 6, the Best Decorated Shrimp Boat Contest gets underway in the Amelia River at the foot of Centre Street, viewable in the marina area. There will also be an Ice Cream Eating Contest taking place at 3:15 p.m. on Sunday at the riverfronts side stage, sponsored by DeNuccis Ice Cream, a local tradition. The contest is responsible for the ultimate brain freeze for our brave contestants!

PAGE 38

Essentials, News-Leader, SHRIMP FESTIVAL 2018 18 SATURDAY, MAY 5 201 8

PAGE 39

19

PAGE 40

20 Frank ElkinsManager Assistant Haleigh JohnsonLeasing Assistant Barbara CrankRepair Specialist Chris GoldsmithLeasing AssistantCarlene McDuffieProperty Manager Call one of our top producing agents today!904-321-4001www.palm3realty.comor Come Visit our Offices1721 South 8th Street, Fernandina Beach or off island at 474303 E. State Rd. 200 Call today or Drop In: 474303 E State Rd 200 palm3rentals3@gmail.com 904-321-0457 1-877-725-6444 Welcome to Paradise Enjoy our 55th Annual Shrimp Festival Norman Watson904-753-0727Brian Crane904-206-6881 Carlene McDuffieBroker/Owner, GRI 904-753-1522Sarah Wood904-476-9316Kara Kato 904-335-7824Jim Platt904-535-7721Donna McRannolds904-583-6591Patsy Windham 904-583-3130 Kathy White904-753-2705 MaryAnn Chase904-557-3531 Tonya Rice 904-608-1540Patty Murray904-430-3999Sherry Quattlebaum904-415-1018Mary Bunk 904-206-2261 Looking for Property Management?At Palm III Property Management we work tirelessly to find the best tenants for your property, so you dont have to! Covering all Nassau County and Duval. We provide operation, control and oversite of your Real Estate Investments with 24 hour monitoring and accountability. Frank ElkinsManager AssistantHaleigh JohnsonLeasing AssistantBarbara CrankRepair SpecialistChris GoldsmithLeasing AssistantCarlene McDuffieProperty ManagerCall one of our top producing agents today!904-321-4001www.palm3realty.comor Come Visit our Offices1721 South 8th Street, Fernandina Beach or off island at 474303 E. State Rd. 200Call today or Drop In: 474303 E State Rd 200 palm3rentals3@gmail.com 904-321-0457 1-877-725-6444Welcome to Paradise Enjoy our 55th Annual Shrimp FestivalNorman Watson904-753-0727Brian Crane904-206-6881Carlene McDuffieBroker/Owner, GRI 904-753-1522Sarah Wood904-476-9316Kara Kato 904-335-7824Jim Platt904-535-7721Donna McRannolds904-583-6591Patsy Windham 904-583-3130Kathy White904-753-2705MaryAnn Chase904-557-3531Tonya Rice 904-608-1540Patty Murray904-430-3999Sherry Quattlebaum904-415-1018Mary Bunk 904-206-2261 Looking for Property Management?At Palm III Property Management we work tirelessly to find the best tenants for your property, so you dont have to! Covering all Nassau County and Duval. We provide operation, control and oversite of your Real Estate Investments with 24 hour monitoring and accountability.

PAGE 41

21 Frank ElkinsManager AssistantHaleigh JohnsonLeasing AssistantBarbara CrankRepair SpecialistChris GoldsmithLeasing AssistantCarlene McDuffieProperty Manager Call one of our top producing agents today!904-321-4001www.palm3realty.comor Come Visit our Offices1721 South 8th Street, Fernandina Beach or off island at 474303 E. State Rd. 200 Call today or Drop In: 474303 E State Rd 200 palm3rentals3@gmail.com 904-321-0457 1-877-725-6444 Welcome to Paradise Enjoy our 55th Annual Shrimp Festival Norman Watson904-753-0727 Brian Crane904-206-6881 Carlene McDuffieBroker/Owner, GRI 904-753-1522 Sarah Wood904-476-9316 Kara Kato 904-335-7824Jim Platt904-535-7721 Donna McRannolds904-583-6591 Patsy Windham 904-583-3130 Kathy White904-753-2705 MaryAnn Chase904-557-3531 Tonya Rice 904-608-1540 Patty Murray904-430-3999 Sherry Quattlebaum904-415-1018 Mary Bunk 904-206-2261 Looking for Property Management?At Palm III Property Management we work tirelessly to find the best tenants for your property, so you dont have to! Covering all Nassau County and Duval. We provide operation, control and oversite of your Real Estate Investments with 24 hour monitoring and accountability. Frank ElkinsManager AssistantHaleigh JohnsonLeasing AssistantBarbara CrankRepair SpecialistChris GoldsmithLeasing AssistantCarlene McDuffieProperty ManagerCall one of our top producing agents today!904-321-4001www.palm3realty.comor Come Visit our Offices1721 South 8th Street, Fernandina Beach or off island at 474303 E. State Rd. 200Call today or Drop In: 474303 E State Rd 200 palm3rentals3@gmail.com 904-321-0457 1-877-725-6444Welcome to Paradise Enjoy our 55th Annual Shrimp FestivalNorman Watson904-753-0727Brian Crane904-206-6881Carlene McDuffieBroker/Owner, GRI 904-753-1522Sarah Wood904-476-9316Kara Kato 904-335-7824Jim Platt904-535-7721Donna McRannolds904-583-6591Patsy Windham 904-583-3130Kathy White904-753-2705MaryAnn Chase904-557-3531Tonya Rice 904-608-1540Patty Murray904-430-3999Sherry Quattlebaum904-415-1018Mary Bunk 904-206-2261 Looking for Property Management?At Palm III Property Management we work tirelessly to find the best tenants for your property, so you dont have to! Covering all Nassau County and Duval. We provide operation, control and oversite of your Real Estate Investments with 24 hour monitoring and accountability.

PAGE 42

22 Essentials, News-Leader, SHRIMP FESTIVAL 2018 SUNDAY, M AY 6 201 7

PAGE 43

23 when the band was one of the top-grossing concert acts in the world. He sang the lead vocals and played keyboards on two Kansas albums and was a major songwriting contributor for the band, writing or co-writing several of the bands highest charting Top 40 singles. Following his work with Kansas, Elefante found a new passion as a record producer, quickly becoming one of the most in-demand producers in Nashville. For several years in the early s, Randall Halls first band, Running Easy, toured as the opening act for Lynyrd Skynyrd. Hall went on to play with hit singer/songwriter Melanie and write songs for the Skynyrd side project, The Allen Collins Band. In 1987, original Skynyrd guitarist Allen Collins asked Hall to take his place in Lynyrd Skynyrd following Collins paralyzing car accident. Hall remained a member of the band until 1994 and appeared on the albums Southern by the Grace of God, Lynyrd Skynyrd 1991, and The Last Rebel. Southern rock legend Jimmy Hall first gained notoriety as the front man for the band Wet Willie as his unique brand of R&Binfused rock-and-roll swagger propelled the groups Keep On Smilin into the Top 10 on the Billboard singles chart in 1974. The band scored two more Top 40 singles in 1977 with Street Corner Serenade and Weekend. As a solo artist, Jimmy appeared in the Top 40 yet again with Im Happy That Love Has Found You in 1980. He was nominated for a Best Male Vocalist Grammy for his work on Jeff Becks 1986 album Flash. Gregg Allman, The Marshall Tucker Band, The Amazing Rhythm Aces, Johnny Russell and many others have recorded his songs. Since the 1980s, Hall has also been bandleader, vocalist, saxophonist and harmonica player for Hank Williams Jr. Sundays lineup begins at 11 a.m. with Back From The Brink, an acoustic country and bluegrass band with respect for the old and love for the new. Following Back From The Brink at 12 p.m. on Sunday is The Dynamic Les DeMerle Band featuring Bonnie Eisele, a high-energy act with electric visual impact and arrangements. The band powerfully performs many styles of jazz, ranging from swing and standard ballads, plus blues, Latin, R&B, Cajun grooves, Broadway show favorites and more. World-renowned drummer Les DeMerle picked up drums at age 10, jammed with Lionel Hampton and Gene Krupa at age 15, and went on to tour and record with the Harry James Big Band from 1970 to 1982. One of those recordings, The King James Version, won a Grammy Award. Les toured for three years and recorded with Wayne Newton. He also toured and recorded with the Manhattan Transfer and has appeared with many other musical greats including David Sanborn, Lou Rawls, Sammy Davis Jr., Frank Sinatra, Mel Torm and Joe Williams. In addition, Les and Bonnie have shared the stage with numerous stars including Diana Krall, George Benson, Al Jarreau, Tito Puente, The Neville Brothers and Grover Washington Jr. Closing out the weekend following the Blessing of the Fleet, which begins at 1:30 p.m., will be the 29th consecutive Shrimp Festival performance by the festivals official house band the Swingin Medallions, beginning at 2:30 p.m. In September 2009, Bruce Springsteen was joined onstage by members of the Swingin Medallions to perform what he called the greatest fraternity rock song of all time, their classic hit Double Shot of My Babys Love. Following in the footsteps of original bandleader John McElrath, the current Medallions, including Johns sons, Shawn and Shane, and original member Jimmy Perkins, continue to thrill audiences of all ages with their unique, high-energy party style. Their act, like their music, is timeless. Their diverse song list has made them popular with college audiences as well as more seasoned rock and rollers. Performing the original bands signature hits, including the classics Double Shot of My Babys Love and Hey, Hey Baby plus beach music and a mixture of music from the s to today, the Swingin Medallions live up to their reputation as the Party Band of the South! In addition to entertainment at the Riverfront Stage, festival favorites Rick Hubbards Kazoobie Kazoo Show and JuggleSTUFF starring Ben Mathews will be performing in the Kids Fun Zone with shows throughout the weekend. More information and a complete schedule of events can be found by visiting shrimpfestival.com.EntertainementContinued From Page 13 SUNDAY, M AY 6 201 7

PAGE 44

24 Marian Phillips, For the NewsLeaderHere come the Fernandina Pirates. Fire in the hole! Ensuing with a loud bang is the firing of a cannon by the name of Big John. This phrase has been shouted since October 1973, when a group of local businessmen came together to form the Fernandina Pirate Club. With the Shrimp Boat races (as it was called then) approaching, the men decided that, since pirates roamed this island at one time, why not form a club to help promote the festival. This was a lively group who loved to have fun. To liven things up, they created a jail cell that they would pull in the parades to capture locals as the parade would progress through town. Later, the Pirates Revenge would replace the jail cell. Back then, women were not allowed in the club; later, the men decided that women were pirates too, and could help in promoting Fernandinas rich history, the Shrimp Festival and Nassau County. The Pirates have been entertaining crowds far and wide. The city of Fernandina Beach and Nassau County have deemed the Fernandina Pirate Club as the Good Will Ambassadors to the World. The Fernandina Pirate Club is a nonprofit corporation. The crew includes local business owners, educators, realtors, and retirees from the community who dedicate their time to entertain, promote the Isle of Eight Flags Shrimp Festival, attend pirate for hire events, participate in parades, help Joy to the Children, join the downtown Fernandina merchants annual pajama party at Christmas, read at local schools, and attend other special events including Relay for Life, Sounds Fernandina Pirates Club: Shiver me timbers Contestants from the 2017 Pirate in Training and Little Pirate contest. The childrens contests will be held at the Kids Fun Zone at 10 a.m. Saturday, May 5, and are sponsored by Masons Refrigeration and Air Conditioning Inc. The Pirates in Training Contest is for ages 5 and younger and the Little Pirates Contest is for ages 6 and older. Continued on Page 26

PAGE 45

25 Crown PlumbingServices, Inc.SERVING NASSAU COUNTY24-HOUR PROFESSIONAL RESIDENTIAL & COMMERCIAL SERVICESwww.crownplumbingservices.comCFC1427610261-8129 225-2323 3030 South 8th St. 904-491-8684Fernandina Beach, FL 32034 904-887-8266 Cell loper.1993@att.net www.rnlnursery.com James R. LoperLandscape Designer/Horticulturist Specializing In Florida Native Plants of NatureRe flectio ns Honest and Professiosnal Automotive Repair & Maintenance At Sonyas Tire & Automotive Center we are here for you! 1310 South 14th Street Fernandina Beach, FL 32034 904-277-3777

PAGE 46

26 on Centre, the Fernandina Beach High School homecoming parade, football games, NAMI Walk, and more. The Fernandina Pirate Club also offers an annual scholarship to all Nassau County seniors entering college or the military. How do you become a Pirate? Well, first you must swab the deck (in pirate lingo) as a Swabbie. During this time, you must earn the right of passage to be a pirate by attending three meetings of the club, three in-town events, and three out-oftown events (anything over the bridge). Under the direction of your Pirate in good standing who has agreed to train you, you will learn to talk like a pirate, dress like a pirate, and act like a pirate. Once you have completed the requirements, your Pirate nominates you for membership to be voted in by the club. Once you are a Pirate, you have full voting rights and can learn to shoot black powder or maybe fire one of the cannons! If you are interested in becoming a Fernandina Pirate or would like more information, please visit fernandinapirates.com or like us on Facebook at Fernandina Pirate Club. Meetings are held the third Tuesday of each month. Locations and times can be found on our website or you can email RumRunner@FernandinaPirates.com or use the U.S. postal mail P.O. Box 17243, Fernandina Beach, FL 32035. Ahoy mate wed love to have you aboard! The Best Dressed Adult Pirate Contest is open to ages 18 and older and is sponsored by Ye Old Fishing Charters & Tours of Fernandina Beach. Be forewarned if ye plan to enter this contest that all adult contestants apparel must be G-rated and suitable for viewing by children of all ages! All those participating in the adult Best Dressed Pirate Contest may be eligible for cash prizes in first, second and third place, and bragging rights for sure! This contest will be held at the Pirate Ship Stage next to the riverfronts main stage at 12:30 p.m. Saturday, May 5.

PAGE 47

27 Festival Directors and Committee MembersPictured is the Executive Board of the 55th annual Isle of Eight Flags Shrimp Festival. From left, Treasurer Dawn Lunt, Executive Board member Hope Harbin, Vice Chair Pat Kaminski, Chairman Harry Harrison, Executive Board member Ralph Watson and Secretary Mary Sikes. Not appearing is Executive Board member Allan Haney. Most people dont realize what it takes to put on a festival of this size. Almost 150,000 people attend the annual event. The planning never stops and is done year-round by the seven-member Executive Board and committee members. The Shrimp Festival Committee is comprised of 20 area directors, about 25 committee members who assist the directors, 10 advisory members (ranging from various city personnel to the TDC/CVB to FPU) and the Executive Board. This is solely a volunteer organization and no member gets paid for his or her time. These members are your friends, neighbors, and local business people who love Fernandina Beach, Amelia Island and Nassau County. The estimated $15 million dollar economic impact is huge for the area. Whether its the local shops, hotels, restaurants or non-profit organizations, the benefits are realized either during the weekend itself or on the return visits throughout the year by the attendees. The Isle of Eight Flags Shrimp Festival is the largest event in the county and has changed, grown and expanded during its 55-year history. Many of the old time locals still refer to it as the Shrimp Boat Festival as the roots began with competitive shrimp boat races in the river. The winner had bragging rights for a year and it was a great way to start the local shrimping season. We hope you love and support the Shrimp Festival as much as we do! Its almost here, arent you excited? Members of the 55th annual Isle of Eight Flags Shrimp Festival include, from left, back row: Sponsorship Director John Scherer, Pirate Club Director Steve Powers, Beverage Director Debbie Stalego, Food Booths Committee member John Steele, At-Large Director Pierre Guite, Executive Board member and Logistics Committee member Allan Haney, Executive Board member and Food Booths Director Ralph Watson, Sponsorship Committee member Jim Kaminski, At-Large Committee member Ken Cofield and Marina Director Joe Springer; middle row, Hospitality and Volunteers Committee member Kim Thompson, Hospitality and Volunteers Director Jennifer Fritts, Food Booths Committee member Kathy Williams, Food Booths Committee member Linda Kostelny, Fine Arts & Crafts Director Mark Bennett, Food Booths Committee member John McAfee, Riverfront/Shrimpers Director Ricky Douberly, Antiques Director Beth Park, Kids Fun Zone Director Frances Watson, Festival Committee Secretary Mary Sikes, Festival Chairman Harry Harrison; and front row, Parade Director Billie Childers, Communications and HQ Director Roger Wasik, Festival Vice Chair Pat Kaminski, Contest Director Marie Cumberland, Miss Shrimp Festival Pageant Director Crystal Haney, Merchandise Director Andrea Mateer, Riverfront/Shrimpers Committee member Christine Scott, and Antiques Committee member Mary Beth Douglas. Directors not appearing are Festival Treasurer Dawn Lunt (shes behind the camera), Executive Board member and Opening Ceremonies Director Hope Harbin, Entertainment Director Mark Deaton, Logistics Director William Turnock, and Transportation Director Debra Ewald. Committee members not appearing are Mary Donn Bowman, Pipar West, Charlie Finnigan, Kellene Sauls, Rolen Sauls, Robyn Spink, and Kathleen Garner.

PAGE 48

28 rrfntb

PAGE 49

29 he Island Art Association is a nonprofit volunteer organization whose mission is exclusively philanthropic and educational. Its purpose is to develop and sustain an interest, appreciation, and enjoyment of the arts in Nassau County, Fla. Our gallery houses the works of more than 50 local artists and our Education Center is utilized for classes, workshops, and scheduled events. IAA honors Vickie Maley for being awarded the Melba Craven Artist of the Year. The award is named in memory of Melba Craven, past IAA president and dedicated IAA member. As recognition by ones peers of outstanding service and dedication to the organization, this is one of the finest honors I have received. IAA is a family of gifted artists who also are community-minded and conscientious workers. It is a significant recognition by them one I still am working to deserve! Maley said. We value our members, supporting members and art patrons. To enhance our art appreciation and outreach efforts, we invite you to join us through our various membership and support levels. For information, please visit islandart.org or the IAA Gallery at 18 N. Second St. in Fernandina Beach. The IAAs goals are to: provide its membership exhibiting opportunities; sponsor an annual exhibit for students; maintain a high school scholarship fund; contribute to community development efforts; and sponsor arts and crafts education. IAA has organized the Arts Show at the annual Isle of Eight Flags Shrimp Festival for over 50 years. The IAA members judge hundreds of artists applications to select almost 400 arts and crafts vendors from across the country to participate in the Shrimp Festival Arts Show. To further community arts appreciation, IAA hosts the annual juried art show as an integral part of the Shrimp Festival. Mark Bennett, returning IAA Shrimp Festival chairperson, states, We are looking forward to the 55th year of our participation in this years festival. With close to 600 artist applications, I want to thank the many volunteers that continue to make this one of the best shows in the South. Im looking forward to welcoming our guest artists and seeing their individual creations. He is assisted by co-Chair Pipar West, an IAA exhibiting member, the IAA Shrimp Festival Committee and membership. Board President Gwen Cowart invites everyone to join IAA in welcoming and purchasing from the exhibiting and guest artists at this years show!Sharon BadenochSharon, an accomplished oil, acrylic and watercolor artist, hails from the Midwest (LaSalle, Ill.). She moved to Amelia Island in 1991 with husband Jim, and they love the small town atmosphere of Fernandina. She is happy to be able to pursue her favorite hobbies painting, golf, piano, acting, singing, etc. all on this beautiful island. Sharon says, Watercolor is as challenging as golf! badenochj@bellsouth.netPam BennettPam relocated to Fernandina Beach with her husband, Mark, and two children in 1998. Pam was a freelance fine jewelry designer for other jewelers and private customers in Jupiter Fla., while working as a diagnostic ultrasonographer and raising her family. After retiring, Pam decided she wanted to do something new and ultimately decided to learn the art of stained glass. To enhance her stained glass, she studied glass fusing and traditional glass painting. Pam has added oil painting as a medium to also explore and have fun with.Cori BeychokCori Beychok dancer, biochemist, jewelry junkie/ rock hound and now jewelry artist began collecting gems as a toddler. Recently, hoping to forestall a midlife crisis, she studied both jewelry making at Bostons North Bennet Street School and gemology at the Gemological Institute of America. After graduating, she spent a few years working for fine jewelers in Boston but decided to dance to her own music to create unique works of art through her jewelry design. A recent transplant to Amelia Island, she is happily creating away, finding limitless inspiration in her new surroundings. coribdesigns@gmail.comSuzanne BinnieObserving colors, textures and scenes in the natural world are starting points for my work. I use a limited palette for pleasing color harmonies. I like the viewer to be drawn into my paintings and be provoked into their own interpretation and conclusions. Moving to Florida has opened new possibilities for study of art in all mediums. I graduated from Penn State University with a fine arts degree. Prominent artists Janet Walsh (floral painting), Tom Lynch and Stephen Quiller (landscapes), Margaret Huddy (color theory), and Susan Abbott (design theory) have been instrumental to my artistic style, as well as classical artists Paul Klee, Morris Lewis, Richard Diebenkorn, and Helen Frankenthaller. suzybinnie@gmail.comCamille BreenCamille, a native of Pennsylvania and a graduate of the University of Miami, worked as a professional potter for 25 years in Coral Gables, Fla., selling to galleries throughout the world. After moving to Amelia Island, she became fascinated by found objects on our beaches sharks teeth, sea glass, shells, odd stones and metal pieces. She combines these objects with silver, copper and gold Island Art Association Badenoch Maley Breen(IAA) A Volunteer Co-op of Nassau County Artists Beychok Continued on Page 30The 2018 Island Art Associations Gallerys Exhibiting Membership Binnie

PAGE 50

30 fill to make One of a Kind jewelry. Fascination with these found and recycled objects also became the basis for her home accessories art to create One of a Kind vases, mirrors and wall pieces. breencamille@gmail.comWalter A. CartateguiWalter is a pipe-fitter welder and artist who creates exquisite drawings and paintings using India ink and watercolors. Birds are his usual subject matter that he renders in great detail. He prefers to work on a large scale. He was born in Uruguay but has lived in the states for 44 years. He is an American citizen who served with the Armys 82nd Airborne Division and trained as a paratrooper. He has lived in Nassau County for 26 years. snakeman1954@yahoo.comMike ClemensMike retired to Fernandina Beach from Naples, Fla. and decided to become serious about throwing pots. He had taken numerous adult education pottery classes over the years and loved working with clay. After winning a few awards in art shows, he felt it was time to get serious and joined IAA in 2005. He has served on the associations board for six years as treasurer and president. He has also worked as a volunteer for Potters for Peaces clean water projects. He takes great pleasure in making pots and hopes the buyers receive pleasure from owning and using them. mclem5fam@comcast.netGwen CowartGwen Cowart is a graduate of the University of Georgias fine arts program. After retiring to Fernandina Beach, Gwen is now focusing on her art. As a mixed media artist, her work spans media such as embossed pewter, encaustics, watercolor, tin collage, and wood burning. Her work involves a strong use of repetitive mark making and frequently portrays native Florida wildlife. She exhibits at the Island Art Association Gallery. Marilyn Evans EfleinFor 38 years, Marilyn shared her talents teaching visual arts at Fernandina Beach High School. A Nassau County Teacher of the Year, she founded the county school art exhibit at Fernandinas Shrimp Festival and the Eight Flags Shrimp Festival in 2005 was dedicated to her. A Florida native born in Orlando, Marilyn is a Gator alumni and a charter member of the Island Art Association. Marilyns style using the fluid medium of watercolor highlights Amelia Island and regional scenes. She enjoys portraying the ordinary, daily life sometimes taken for granted that actually renders our lives more satisfying and complete. art46teacher@yahoo.comBarbara FullerBarbara is a graduate of Pratt Institute, the art school in Brooklyn, N.Y. Her focus as a serious artist happened after her children had left the nest. While still in New Jersey, she studied under well-known artists there. At that time, watercolor was her medium of choice. After her move to Amelia Island, she continued to study with artists who she felt would help her develop as an artist. Now her paintings in mediums of watercolor, acrylics and oils hang in homes and offices here and abroad. Her artwork can also be seen at The Plantation Artists Guild & Gallery.Sharon HaffeySharons contemporary landscape paintings are colorful, bold and playfully designed to evoke emotion through their simplicity and intensity. In addition to pursuing a B.A. in art at Ohio State University, she has studied at the Spruill Center for the Arts in Atlanta and spent two seasons as an Artist in Residence at the Nantucket School of Art and Design. Her current focus is to explore more energizing techniques utilizing acrylics and oils. In addition to the Island Art Association, her work is on display in her studio at The Blue Door on Centre Street. sharonhaffey.comDiane HamburgDiane discovered traditional quilting more than 20 years ago. After a surface design workshop with Jane Dunnewold of Complex Cloth, her creative artsy self emerged! She loves the spontaneous process of surface designing dyeing, monoprinting, printing, stenciling, screening, painting, stamping, foiling, and discharging. Inspired by a photo, artwork, or Mother Nature, a new piece begins. Her canvas is created. She designs each piece with different threads and free motion sketching, embellishing with hand stitching, beads, buttons, shells, twigs, etc. Surrounded by her tools, Diane finds freedom to create art amidst the beautiful sand dunes and ocean seen from her studio. dianehamburg.com dianehamburgart.blogspot.comM. Jane HedgecockJane Hedgecock is an Island Art Association artist/artisan who creates masterful, beautiful handwoven baskets in the traditional Nantucket style, which is her specialty. Jane is an accomplished woodworker as well, learning the trade from her family members who were in the business. She has more than 40 years experience as an artisan and manager. Jane, a native of North Carolina, has been a resident of Nassau County for the last five years. marthahedgecock@comcast.netSusan HendersonSusan holds a Bachelor of Fine Arts from Ohio State University and has lived and painted in Fernandina Beach since 2006. Working in watercolor and oils, she captures the unique light and color found in the natural areas and plant life of Florida and the Southwest. While mostly representational, the work presents a unique statement of how she perceives the world. An exhibitor in regional and local shows, she is a member of the Florida Watercolor Society, Jacksonville Watercolor Society, and Women Painters of the Southeast. Susan exhibits at IAA and JW Frame Gallery. shendersonart.blogspot.comRichard HultbergHonored as a Member Emeritus, Dick Hultberg graduated with a BFA in design from the Massachusetts College of Art. He worked 5 years as a technical illustrator for the Navy in Washington, D.C. and then became head of the Presentations Section of Goddard Space Flight Center at NASA in Maryland, where for 25 years he ran the Goddard Conference Centers, Publications and Printing Sections. Dick retired in 1985, and with wife Ellen moved to Amelia Island. He joined the Island Art Association and has exhibited every year since 1987 in the Shrimp Festival receiving four third-place awards, and, in 2001, a first-place award in his category. Cartategui Clemens Cowart Eflein Fuller Haffey Hamburg Continued on Page 31

PAGE 51

31 Paula Porterfield-IzzoPaula Porterfield-Izzo is a successful photographic artist and psychotherapist on Amelia Island. She creates SeaScape Portraits for individuals and families. Her large Waves canvas art is a favorite amongst patrons. Her passions in photography are photographing sacred spaces and creating contemplative photography workshops. Her websites are seascapeportraits.com and godistheoriginalartist.com.Bill KinneyFor a significant portion of my life I was a student, scientist, entrepreneur, boat builder/sailor, artist/crafter, and shop owner. I earned a Bachelor of Science in Photographic Science and Technology from Rochester Institute of Technology. Now retired, I have returned to my roots, refreshing my photographic education and recently redefining my artistic endeavors by producing panoramic imagery of the local scenery. I dont take pictures, I make pictures is my mantra emphasizing composition since I believe it is paramount to picture quality. I also wrote a book titled Sanctuary, an autobiographical adventure story of my life. To learn more about my work, visit BillKinney-PhotoPainter.com.Carol KishCarol is originally from the East Coast Pennsylvania, New Jersey, New York City. She graduated from San Francisco State University in California with degrees in art and psychology in 1982. She worked for the state of California until 2005. When she retired, she moved to Mustang Island, Texas. As a member of the Art Center for the Islands, she rediscovered her love of art. Currently, she exhibits at the Island Art Association in Fernandina Beach. She is also a member of the American Society of Marine Artists. She loves to travel and takes many pictures on her journeys, using them as a basis for her paintings. She works in oils, acrylics, watercolors and pan pastels. So come and take a trip with her! Her mantra is art is life and life is art. carolkish.comLisbeth KrawieckiLis moved to Amelia Island from Atlanta, Ga. three years ago. As a licensed clinical social worker, she worked at Childrens Healthcare of Atlanta, as well as having a private therapy practice. About 10 years before her retirement, she decided to take a pottery class and ever since hasnt been able to keep her hands away from clay. She now enjoys creating pottery inspired from the ocean. She is excited to further the creativeness of her ceramics now that she is able to focus on that full time.Vickie MaleyVickie studied for seven years with Cleda Curtis Neal. Upon retiring and moving to Amelia Island in 2012, Vickie has seriously pursued oil painting depicting the natural beauty of Amelia Island with realistic landscapes and seascapes. She has sold paintings to customers all over the U.S. She created the cover for the Newcomers Club of Amelia Island 2016 Membership Directory. She currently is a board member and exhibiting member of the Island Art Association and a member of the Plantation Artists Guild & Gallery. Vickie was named the 2017 IAA Artist of the Year.Barbara Martin-DavisArt studies at the Corcoran Gallery, George Washington University, and American University in Washington, D.C. convinced Barbara she was an artist, even after graduating pre-law from The College of William & Mary in Williamsburg, Va. Post-graduate art studies at the University of Richmond and the University of Rogaland in Norway confirmed this decision. Her favorite field is sculpture, particularly wood, but she works also in marble, bronze, and aluminum. Paintings and mixed media works involve acrylic, oils, pen and ink, and found materials. Her work reflects her interests in light, water, reflection, and the human form.Paul MassingPaul, a retired engineering technologist, was a service representative in the industrial gases industry. He graduated from The Albright Art School in Buffalo, N.Y. in art and illustration. He exhibited in art organizations in New York. Upon retiring, after a long hiatus from art, he moved to Amelia Island in 1994 and renewed his interest in painting and drawing. He won IAAs Melba Craven Award, Artist of the Year in 2015. His artwork is in private and corporate art collections in the U.S. and Canada. He shows at the IAA, the St. Augustine, Fla. Art Society and the Arts Center in St. Petersburg, Fla.John MateerFor the past 15 years Johns personal objective has been to see how far he can go in creating something unique and pleasing for the art enthusiast. He finds warm glass to be his medium of expression and the perfect way to use his imagination and creativity to combine color and texture into distinctive fused glass art. His work may be seen at the Island Art Association Gallery, Clay Times Art Center, and Booth 117 at the Shrimp Festival.Emylee McBreartyFor Emylee, painting is a passion. When not painting, she is in her studio reading and thinking about art and painting. She is fascinated with color and the interplay of light and shadow. (904) 491-0369 emyleem@aol.comRebecca McDannoldRebecca McDannold originally worked for Hallmark Greeting Cards Inc. and then taught in public high schools and college classes. McDannold is a veteran of over 50 art fairs across 14 states and her award-winning work has exhibited in private collections, galleries, museums, and public buildings. Currently working in oils and mixed media, McDannold is now showing in the Island Art Association Gallery and at the Plantation Artists Guild & Gallery. Studio visits by appointment are welcomed. rebecca.mcdannold@gmail.com mcdannold.com (618) 531-6831Karen McFadyenKaren, an oil painter in the realist tradition of painting from life, works also in watercolor, acrylic and all drawing media. Karen often studies a series on one subject, exploring color motifs and compositions. She loves painting portraits and landscapes pleine aire. A member of IAA since 1993, Karen has served on the board, as Gallery director and president. A member of the St. Augustine Art Association and the Portrait Society of America, her works are in many private collections, the IAA Porterfield-Izzo Krawiecki Kinney Kish Maley Continued on Page 33 Massing Mateer McBrearty McDannold McFadyen

PAGE 53

33 Gallery and her home studio by appointment. She welcomes commissions and offers private lessons in drawing and painting.Jim McKinneyJim McKinney created wearable gold and silver jewelry years ago. He cut his own semi-precious stones, incorporating them into unique designs. Leaving behind his military and computer industry careers, Jim returned to his first love painting upon moving to Fernandina Beach. He paints landscapes in oils and acrylics of local areas and countries he has visited. Jim is currently working on an Amelia Island Lighthouse series. His work can be found in private and corporate collections. Jim has served Island Art Association as its president, chair for the Annual Juried Shrimp Festival Art and Craft Show and Gallery director. jimmck39@comcast.netRoger MooreHonored as Member Emeritus and a native of upstate New York, Roger served as photographer with the Navy in World War II. After earning a degree in engineering from the University of Rochester, he began a career in construction contracting and owned a bridge building company. Roger and wife Edie retired in 1990 to Amelia Island, where he has photographed the abundance of natural beauty on the island. He taught photography at Florida Community College, Nassau Institute for Community Education. He recently co-authored with Ron Kurtz, Amelia Island and Fernandina Beach, a book of his photographs of local items of interest with historical background by Mr. Kurtz.Louise MozenaLouise Mozena graduated from the University of Michigan, majoring in history of art and fine arts. Living on Amelia Island is a watercolorists dream with the areas ever-changing light and marsh and beach scenes. Louise is an active member of the Island Art Association and participates in the juried shows in the Jacksonville and Florida Watercolor Societies. She is a former board member of the IAA and the Jacksonville Watercolor Society. Her work is also shown at the Plantation Artists Guild & Gallery. lmozena@bellsouth.netGeorganna MullisGeorganna, now a full-time resident of Amelia Island, visited the island in summers and in intervals during the school year in middle and high school to be with family. She graduated from high school here. She moved away after graduation and began her own family before returning in 1970. I love the island, and I have been painting its many moods in various mediums and styles ever since. My work may be seen at the Island Art Association Gallery, the Blue Door Studios and Gallery and also at my sons restaurant, T-Rays Burger Station. bluedoorartist.comDenise MurphyDenise Murphy is an award-winning glass and mosaic artist. Taking one idea and viewing it through multiple media is the inspiration for my artistic work. Whether assembling a mosaic or fusing and reshaping glass, my goal is to bring together textures, colors and thoughts and create from them a new and cohesive whole. Transforming raw materials into art challenges her to achieve that delicate balance of skillful technique and creativity. Denise currently exhibits her creations at Island Art Association, Plantation Artists Guild & Gallery, and The Vault at 1930 in Jacksonville. denisemurphyglass.comMary QuinlanAfter retiring to Amelia Island several years ago, I was finally able to devote the necessary time to one of my lifelong passions painting. Throughout my life I have studied drawing, painting, photography and design and display. I was fortunate to find a very vibrant Island Art Association here on Amelia Island that I could become involved with and pursue art. It has been, and continues to be, a journey of development and inspiration as I work to express my love of color, form and design in my paintings.Susan SchraftSue Schraft has been creating art most of her life and was an art educator for 34 years. Her art has been shown throughout the country, including Manhattan, Chicago and Los Angeles. Establishing a connection between the natural and the geometric has been an emerging theme in most of her work. She likes to work in many layers of materials. This creates artworks of mixed media building up from the surface with found imagery, text, natural objects and layers of paint and drawings. The result is a surreal quality that suggests a variety of interpretations from the viewer. susanschraft.comSusan SellnerSusan Sellner is a relatively new painter. Her skill and technique evolve and change each passing year. Renowned for pet portraits, Susan uses the money acquired from the sale of her works to help find homes for animals in Nassau County. However, she also dabbles in landscape and still life painting. Florida flora and fauna inspire her. She loves sharing her perceptions of the world around us. In addition to the Island Art Association, Susans work can be found for sale at the local restaurant La Mancha. Private viewings of her complete body of work can be seen in her home studio by appointment.Milt ShirleyMilt Shirley moved to Amelia Island in 1969 as an environmental engineer with ITT Rayonier. He is a graduate of Louisiana Tech. He was a member of IAA in the early years when he took art lessons from an instructor from Jacksonville. He became involved in local politics until June 2002 when he again picked up his brushes. He works in oils and paints scenes from beautiful Amelia Island. Milt is where he has been for many years, at booth 601. milt@miltshirleyart.comVirginia StewartVirginia Stewart was interested in art at an early age. As a child she was always drawing, painting and trying something new. She states that during her college, marriage and career/work phases, there was little time to devote to art, yet she managed to continue taking art classes at the City Art Museum in Worcester, Mass. as well as other institutions in New England. Her media of choice is watercolor. She describes her work as ethereal and has been told it looks Asian. Virginia now has the time to devote to art. stewv123@hotmail.com McKinney Moore Mozena Mullis Murphy Continued on Page 34 Quinlan Schraft Shirley Sellner Stewart

PAGE 54

34 Marlene StrobachAs a young girl, Marlene loved to draw and paint and hoped to study art further, but as college led to a business career, marriage and a family, art was put on the back burner. Upon retirement in 1987, Marlene and her husband moved to Amelia Island. Happily, she found herself right in the middle of an art community. Watercolor became her passion, and she developed an impressionistic style in her work. By use of bright color, she paints to create a happy mood. Marlene was awarded the Artist of the Year Award by the Island Art Association in 2014. estrobach@comcast.netCarol TaberCarol Taber likes to draw. Her professional work includes botanical drawings for plant catalogs, landscapes for television gardening shows and characters for childrens books. Taking a break from these projects, she was visiting family in Fernandina Beach when her daughter signed her up for a Kathy Maurer painting class. Years, mermaids and many brushes later, Carol is still on vacation here in paradise. With a Best of Show to her credit, she exhibits at the Island Art Association Gallery and donates artwork to fundraisers for the Boys & Girls Club, the Humane Society and the Folds of Honor Auctions.Karen TrowbridgeKaren Trowbridge moved to Amelia Island in 1997 from Boulder, Colo. She attended the University of Colorado, majoring in art history and fine arts. Her most inspirational education was received at the Golden Art Center in Golden, Colo. She works in pastel, acrylic and collage. Her primary focus is landscape and abstract painting. kalentwo@bellsouth.net Libby WeigelElizabeth Weigel is a selftaught gourd artist who has been creating gourds since 2005. Using a variety of techniques including pyrography, carving, and coloring, she creates a wide variety of gourds as well as smaller items including necklaces, ornaments and nightlights. Through the years, many of her gourds have received recognition by the Florida Gourd Society at their annual Gourd Festival in Melbourne, Fla.Pipar WestPipar has resided on Amelia Island for two years. She teaches art at a middle school in Jacksonville as well as at a university on a part-time basis. Her diversity and skills in teaching at various levels is also displayed in her artworks. Pipar works in mixed media, often finding her project doesnt turn out as expected, but with a better result through the creative process. She conducts art programs at the local Council on Aging Senior Center and at Island Art conducts childrens programs. She co-chairs the Shrimp Festival Committee. Gretchen WilliamsGretchen Williams has been a longtime participant in the Shrimp Festival Arts Show. She has exciting new work, prints and note cards and a sale bin of some of her work from her former home in Key West. Her work will be available all month in a special section of the Gallery. Come inside, meet the artists, and cool off in the air-conditioned gallery! Nancy WilliamsNancy is an Amelia Island artist who has lived and painted on the island for 28 years. She was born and educated in Mississippi, where she attended Mississippi State University for Women and received a Bachelor of Fine Arts. Nancys work includes collage, acrylics, watercolors, monotypes and painting on silk fabric. It is whimsical and experimental. She joined the Island Art Association in 1991. nancyart@comcast.netJoe WinstonJoe is a graduate of the University of The Arts in Philadelphia, where he studied design and ceramics. His work has taken him to Japan and many Asian countries including China. After a career as a product designer, textile design and creating ceramics, Joe moved to Fernandina in 1994 to live and work as a studio potter and sculptor. Joe has been an exhibiting member of the Island Art Association since 1995. His work can be seen in galleries in Florida, Georgia and the Northeast U.S. He has been in the Shrimp Festival in the past. jswinston@bellsouth.net JoeWinstonCeramicsDiane WithrowDiane and her husband relocated from Jacksonville to Amelia Island 18 years ago. She regards the Island Art Association a valued asset to our community with its many talented and dedicated artists. After retirement, she studied painting with Kathleen Maurer. Several years ago, she began portrait painting with Martha Carpenter and found a true passion. Her first project was their seven grandchildren. Her portraits feature the wonderful faces of people they meet and observe in their travels. Barb WylieBarb Wylie moved from Virginia to Amelia Island when her husbands CSX job transferred here in 2001. She joined the Island Art Association that same year. Her family hails from Savannah and Cumberland Island. It was like coming home. She is self-taught, creates in all mediums and both 2D and 3D art. She became an exhibiting member of Island Art Association in 2016. Taber West G. Williams N. Williams Winston Weigel Withrow

PAGE 55

35 Nofa DixonNofa Dixon has been a professional artist and an active member of the Jacksonville community for over 30 years. She served as curator of education at the Jacksonville Art Museum (MOCA) for 12 years. Presently, Nofa is an associate professor of drawing, painting and design at the University of North Florida. She also served as an artist-in-residence for Duval county schools from 1997-99. Her sculpture and vessel forms are included in major corporate and private collections and have been exhibited throughout the United States. In 2004, Nofa completed a major commission for the Art-in-Public Place Program organized by the Cultural Council of Greater Jacksonville. This commission included glazing tiles for eight murals, which were installed on the floor of the lobby area of South Mandarin Branch Library. During the same year, another project was creating 28 bricks specifically for the Maternity Ward of the Baptist South Hospital in Jacksonville. Finally, Nofa created 20-25 plaques for the Womens Center of Jacksonville to honor major donors who helped purchase the building where the center is located. Through the UNFs Department of Art and Design, Nofa has facilitated numerous for-credit Art-in-Public Place classes with UNF students. Four permanent mosaic (24 x 5) columns and five ceramic wall murals have been created and installed at the campus of the university. Future projects are in the works. In addition to creating ceramic and sculptural forms, she also works on canvas and creates collage images, which will be on exhibit at the Haskell Gallery at JIA from July to September.Stefan AlexandresStefan Alexandres is a sculptor and jeweler who, from 1964 to 1972, apprenticed for the metal arts through organized guilds of Greece. His training was based on the Byzantine Art and in archaic designs. He specialized in repousse, filigree and titanium. In 1974, he opened his first studio in Athens, Greece. He immigrated to America in 1988 with his wife and daughter. Currently, Stefan teaches at the Creald School of Art in Winter Park, Fla. and with the Florida Society of Goldsmiths. He received a United Arts of Central Florida individual artists award in 2007 and 2010. The character and the concept of his artwork is based on his intuition for singular design through experimentation resulting in authenticity. Mr. Alexandres has an extensive background in lecturing, teaching, and judging art shows and has received an impressive number of awards for his jewelry and sculpture pieces. His artwork can be found in many private and permanent public collections throughout the region. Shrimp Festival Judges Jennifer Miller BroadusJennifer Miller Broadus has been an artist since childhood and received her first set of oil paints for Christmas when she was just eight years old. After receiving a Bachelor of Fine Arts in Painting and Illustration from Kent State University with minors in photography and art history, Ms. Broadus went on to work in New York as an art director and later as a freelance illustrator in advertising and publishing. She has also worked extensively as a graphic designer. Until recently, Jennifer has enjoyed a successful career as creative director of Broadus Advertising, a full service advertising and marketing firm which she owned with her husband, Bob Broadus. Yet, painting and photography have always been her true passions, along with travel. Combining the three, Ms. Broadus has traveled the world capturing intriguing images with a camera that she later translates into paint on canvas. Painting is now her full-time career. Jennifer has been the recipient of numerous awards for her creativity in Atlanta and the Southeast, and her work currently appears at ArtTrends Gallery and Glynn Visual Art Center on St. Simons Island, Ga., and The Porch on South Main in Alpharetta, Ga. She is active in the St. Simons Island arts community where she currently resides. rffrnbfntb tbrnr Published by the News-Leaderbn

PAGE 56

36 Theresa AllenAlma, GA Antiques, shabby chic soapJim & Carla BarbareeScarlotts Horse Antiques Rock Hill, SC Repurposing old vintage cansCarl & Terry BodekerPort Charlotte, FL Antiques, glassware, pottery, vintage jewelry, and misc.Lorna ChambersNavarre, Ohio Vintage jewelry, misc.Barbara E. and Frank C. CharboneauBushnell, FL Small men and women collectiblesMichael ColucciKissimmee, FL Vintage antiques, fashion decorCindy CrossCitra, FL Antiques and collectiblesLaura L. CzarneckiHolly Hill, FL VintageThomas H. Di CreaseDania Beach, FL Asian items, cut glass, art glass, and silver jewelry Debra J. DouthitRustic Stuff Of The South Marietta, GA Old windows, repurposed wood, rustic art signs, rustic cooler, and tailgate benches Linda M. Foster-MurpheyStockbridge, GA Collectible, handmade watches, handmade leather and assorted jewelryDonna Beth FrankelLady Lake, FL JewelryJimmy FulkDunnellon, FL Vintage antique and fashion decorJanis S. GagerOrlando, FL Oil beadsLaurie A. GiffordDavenport, FL Fiesta, signs, and collectiblesRandy HallenbeckNiagra, WI Cal 1860s 1950s, most Montagues advertising signs, radios, folk art, auto related, and VictorianShawn & Christie HalleyAltamonte Springs, FL Antiques and collectiblesDonald HamiltonPinellas Park, FL Antiques, furnitureJim and Lea HarmonHarmony In Design Antique silverware made into unique wearable art set with gemstonesMiranda HenryAntiques, furniture, oddities, jewelryJean M. HughesJacksonville, FL Vintage antiques, glassware, china, metal items, and misc.Randy S. JesterDunnellon, FL Vintage antiques, dcorRobert L KaroubHale, MI AntiquesElizabeth Kiefer Spring Hill, FL Quilts, linens, jewelry, potteryPatricia A. KosmoskiFlagler Beach, FL Antiques, jewelry, chinaConnie KunkesFernandina Beach, FL Vintage toys, dcor, small furniture, dolls, shadow boxJoe MendelsohnZellwood, FL CollectiblesMarilyn MeredithAntiques, porcelain, crystal, china, figurines, glassware, and silver jewelryLarry R. & Kay A. MessingerPort Orange, FL Linens, small furniture, glass, and jewelryMikey MottAntiques, furniture, oddities, jewelryJohn NetcherOlde Tyme Antiques Jacksonville, FL Jewelry, silver, nautical bottles, primitives, etc.Ortega TradersJacksonville, FL Vintage jewelry and wood creationsCindy PinyardDover, FL Antique scarf pinsSief Ben RejebMaster Wood Carver Inc. Tampa, FL Collectibles, Handmade rose woodEnrique L. Lescano RiveraHandmade e-curio, pendantsTonya SanteWeivsdule, FL Small antiques, collectiblesSandra V SmithZephyrhills, FL Nautical, antiques, collectiblesMichael B St. GeliasNeptune Beach, FL Old signs and flagsChelsea WaldrenCallahan, FL Lava bead jewelry, rice pack w/ essential oilsDonald A WeekesBushnell, FL Antiques and collectiblesDonald WilliamsMelbourne, FL Small collectibles, glass old lighting, art and papersLeroy Williams, JrCollege Park, GA Antiques, furniture, glass, and CollectiblesRon & Carlotta YanceyFlor City, FL Vintage clothes, glass, jewelry, linens, and kitchenHarry T. ZajloBradenton, FL Antiques, crystal beads, shells, fossils and other antiquesBridget ZelnickTampa, FL Antique glass and smalls 2018 Antique VendorsAntique vendors are located on South Fourth, Fifth, Sixth and Seventh streets between Centre and Ash streets.

PAGE 57

37 Name Discipline Booth Adamson, Carol Fiber / Leather 407 Alcorn, Tammy Creative Crafts N516 Alexander, R.L. Oils 208 Amrani, Orna Mixed media/Graphics/Pastels/Printmaking 303 Anderson, Gertrud Photography S241 Andrews, Abbie Creative Crafts N424 & N426 Armulowicz, Ted Wood/Glass/Metal/Stone 201 Aronson, Robin Jewelry 115 Astolfi, Giuseppe Watercolors S311 Aunchman, Kenneth Oils 611 Aurand, Laurie Acrylics N308 Ayala, Sue Watercolors 315 Bachman, Bob Photography S217 Bahringer, Charles Jewelry 707 Bane, Dreanna Fiber / Leather 612 Barnard, Brian Acrylics S326 Barnes, Deborah Jewelry 510 Barnes, Robert Creative Crafts N517 Barreneche, Juan and Schemel, Daniel Jewelry N336 Beauvais, Margeret Wood/Glass/Metal/Stone N314 Becker, Jason Wood/Glass/Metal/Stone S339 Becker, Mary Lou Creative Crafts N733 Bellows, Suzanne Acrylics 215 Berger, Pauletta Fiber / Leather 206 Biggs, Deborah Wood/Glass/Metal/Stone S202 Billman, Mark Jewelry S342 Binns, Heather Creative Crafts N413 Blackmore, Brian Jewelry S213 Blum-Cuthbert, Sheree Wood/Glass/Metal/Stone N230 Boase, Ryan Creative Crafts N404 Borelli, Frank Fiber / Leather 617 Bottary, Adriana Mixed media/Graphics/Pastels/Printmaking S209 Bove, Jason Ceramics 313 Bowman, Scott Creative Crafts N704 Boxberger, Kelli Creative Crafts N717 Boyce, Robert Wood/Glass/Metal/Stone S304 Bradshaw, Dalene Creative Crafts N430 Bramblett, Carol Creative Crafts N739 Brandow, Douglas Jewelry 613 Branning, John Creative Crafts N506 Brass, Drew Mixed media/Graphics/Pastels/Printmaking N231 Brawley, Deborah Fiber / Leather N232 Brooke III, Richard Wood/Glass/Metal/Stone S211 Brooks, Isaac Wood/Glass/Metal/Stone N202 Brown, A.J. Oils 511 Brown, Mike Acrylics 622 Brummett, LeAlta Jewelry S331 Buccina, Scot Wood/Glass/Metal/Stone 213 Bullard, Tim Ceramics 107 Butterfield, Wendy Creative Crafts N408 Byers, Mark Wood/Glass/Metal/Stone S229 Camarata, Teresa Fiber / Leather N321 Camp, Pam Creative Crafts N415 Camp, Pam Creative Crafts N417 Cappelluzzo, Carly Jewelry N201 Caristo, Linda & Carl Jewelry 513 Carnevale, Kathy Jewelry N229 Carrell, Jim Ceramics 619 Carroll, Marianne Creative Crafts N735 Carter, Tim Wood/Glass/Metal/Stone N208 Cassell, Greg Mixed media/Graphics/Pastels/Printmaking S352 Cebula, Lynn & Steve Mixed media/Graphics/Pastels/Printmaking 108 Chavez, Loran Acrylics 224 Clark, Jim Wood/Glass/Metal/Stone N316 Clautice, Tina Wood/Glass/Metal/Stone N239 Clements, Doris Fiber / Leather N333 Clibbon, Robert Photography 600 Cockman, Pui-Lan Watercolors 506 Colby, Bill Ceramics 500 Colls, Armando Photography S214 Conner, Wanda Creative Crafts N724 Copeland, Laurie Creative Crafts N508 Cordell, Carolyn Mixed media/Graphics/Pastels/Printmaking N329 Coy, Kim Jewelry 618 Crayton, Wendy Acrylics S237 Crosby, Charlie Wood/Glass/Metal/Stone N303 Cupstid, Salli Creative Crafts N515 Davis, Alan Wood/Glass/Metal/Stone 216 Davis, Sheron Wood/Glass/Metal/Stone S201 Dayvault, Laurie Creative Crafts N725 Deaton, Delores Creative Crafts N718 Deel, Ronald Oils 310 DeLaCruz, Dave Acrylics 207 DeMichele, M. Mixed media/Graphics/Pastels Printmaking S220 & S222 Dennison, Cindy Creative Crafts N736 DiCarlo, John Wood/Glass/Metal/Stone 317 Dietrich, Craig Photography 302 Dimarco, Marc Jewelry 209 Dixon, James Creative Crafts N711 Doherty, Christoper Photography N214 Douglas, Sally Ceramics 509 Dunn, Daniel Creative Crafts N714 Durant, Barbara Acrylics N210 Edmund, David Acrylics 304 Edwards, Mark Wood/Glass/Metal/Stone 212 Ehrenfeld, Lauren Creative Crafts N728 & N730 Eifert, Michelle Ceramics N218 Ekamby, Germain Wood/Glass/Metal/Stone S212 Eriksen, Tom Wood/Glass/Metal/Stone S224 2018 Artist/Vendor, Locations, Discipline 1 Eighth Street Front Street Music And Stage Centre Street

PAGE 58

38 Name Discipline Booth Erskine, Everette Creative Crafts N405 Exley, Steven Photography 628 Fager-George, Daniel Mixed media/Graphics/Pastels/Printmaking N3T2 Farish, Connie Creative Crafts N737 Fears, Princy & John Fiber / Leather 111 Fenwick, Tracy Jewelry 602 Ferguson, Jeff Creative Crafts N710 Ferrell, Stephen Mixed media/Graphics/Pastels/Printmaking 709 Figlinski, Martin Oils 711 Finerman, Dan Wood/Glass/Metal/Stone N225 Fisher, Fred Mixed media/Graphics/Pastels/Printmaking 715 Fitzgerald, Tim Wood/Glass/Metal/Stone N323 Fizer, Richard Wood/Glass/Metal/Stone 504 Flores, Alli Ceramics S305 Flynn, Brenda Mixed media/Graphics/Pastels/Printmaking N227 Fobert, Nancy Wood/Glass/Metal/Stone N205 Forsythe, Kevin Wood/Glass/Metal/Stone S337 Fortney, Mick Wood/Glass/Metal/Stone 416 Fulwiler, R.C. Photography 319 Gaedtke, Deborah Oils 414 Gao, Wayne Mixed media/Graphics/Pastels/Printmaking 312 Garcia, Miguel Creative Crafts N501 Geer, Mike Creative Crafts N431 Gerber, Russ Ceramics N233 Gibson, Mike Jewelry N223 Gilbert, John Watercolors 615 Glennon, Christina Watercolors S335 Godfrey, Mary Lou Fiber / Leather S313 Goodlett, Robert Oils 604 Gorskey, Cyndi Creative Crafts N407 Gouse, Sue Oils 210 Graham, Kangee Creative Crafts N425 Green, Gail Creative Crafts N726 Greenhill, Emma Acrylics 121 Guadiane, George Wood/Glass/Metal/Stone 116 Guerra, Constance Mixed media/Graphics/Pastels Printmaking S320 & S322 Hadi, Joyce Photography N342 & N344 Hagaman, Jennifer Creative Crafts N511 Hamby, Quincie Jewelry S203 Hand, Christopher Creative Crafts N741 Haney, Debbie Fiber / Leather S239 Hardesty, Lynn Jewelry 218 Hawkins, Phil Creative Crafts N719 & N721 Hecker, Ingrid Jewelry N309 Heilman, Charlene Wood/Glass/Metal/Stone 400 Hemphill, Katherine Creative Crafts N709 Hendrix, Ed & Melissa Mixed media/Graphics/Pastels/Printmaking 405 Hernandez, Guido Wood/Glass/Metal/Stone N226 Hester, Terri Creative Crafts N427 Hildinger, Deborah Fiber / Leather 314 Holehouse, Jim Watercolors 119 Holstein, Scott Photography 202 Howard, Karen Jewelry 408 Hudson, WaaDee Creative Crafts N419 Hudson-Loose, Marissa Ceramics N203 Hughes, Melissa Creative Crafts N428 Hung, Serge Jewelry N327 Iglesias, Renzo Jewelry N313 Israel, Karen Jewelry S324 Ivanov, Vasil Wood/Glass/Metal/Stone S323 Jackson, Darryl Ceramics 418 Jackson, Kasey Creative Crafts N509 Jalsa, Ann Jewelry S338 Jamison, Leah Creative Crafts N513 Jantzen, Jen Creative Crafts N510 Jasinski, Michael Photography N213 Jefferson, Mary Fiber / Leather 620 Jenney, Curtis Ceramics N324 Johns, Keith Martin Oils 401 & 403 Johnson, Brenda & Ray Creative Crafts N713 Johnson, Jeffry Wood/Glass/Metal/Stone S336 Johnson, Morris Mixed media/Graphics/Pastels/Printmaking 624 Johnson, Ronald Jewelry S233 Jones, Robert Photography 127 Jones, Scott Creative Crafts N406 Jordan, Candace Jewelry S206 Karnes, Patricia Jewelry 417 Kavosick, John Wood/Glass/Metal/Stone N209 Keane, Bonnie Acrylics 222 Kellum, John Ceramics 502 Kennedy, Kevin Creative Crafts N411 Kennedy, Kristine Jewelry S350 Kent, Lisa Jewelry N319 Kilburn, Larry Wood/Glass/Metal/Stone N216 King, Nancy Oils N340 Kirk, Noah Ceramics S207 Kish, Jen Jewelry N322 Kline, Jeffrey Wood/Glass/Metal/Stone S314 Korff, Rhee & Louis Jewelry N238 Koury, Stephen Acrylics 708 Krawiecki, Lisbeth Ceramics 424 Krueger, Curtis Photography N207 Krysinsky, Tony Mixed media/Graphics/Pastels/Printmaking 503 Lacuesta, Witha Watercolors 203 Laine, Philippe Fiber / Leather 125 Laird, Lorena Creative Crafts N706 Lakiotis, Peter Creative Crafts N712 Lane, Ruth Creative Crafts N729 LaPointe, Sheila Ceramics N307 Larizza, Pixie Wood/Glass/Metal/Stone S325 Lawrence, Byron Wood/Glass/Metal/Stone N346 Leach, David Photography N306 Lee, Anna Belle Creative Crafts N722 Lee, C.C. Ceramics S340 LeFebvre, Guy Oils 113 Leising, Alan Creative Crafts N219 Lemoine, Ronald Wood/Glass/Metal/Stone 626 Lent, Sandy Jewelry 320 Leon, Dayana Creative Crafts N410 Lin, Alan Acrylics 402 Lippard, Lori Creative Crafts N731 Liu, Wen-Mei Creative Crafts N702 Lockridge, Joel Creative Crafts N503 Lorenz, Rick Mixed media/Graphics/Pastels/Printmaking 307 Lorenz, Rick Mixed media/Graphics/Pastels/Printmaking 309 Lott, Rick Photography 605 Lowe, Charles Wood/Glass/Metal/Stone S225 Luke, Ronald Creative Crafts N418 Lundgren, Dr. Eric Jewelry 109 Lutz, Robert Creative Crafts N512 Lynch, Danielle Creative Crafts N727 Manning, Rhonda Jewelry S333 Manos, Gary Wood/Glass/Metal/Stone S215 Maphis, Dacota Mixed media/Graphics/Pastels/Printmaking 717 Markwardt, Terry Creative Crafts N416 Martin, Theresa Creative Crafts N716 Masters, Nikita Fiber / Leather S231 Mateer, Johjn Wood/Glass/Metal/Stone 117 Matthews, Mark Wood/Glass/Metal/Stone 608 Matz Deborah Acrylics 220 McIntyre-Crook, Sylvia Acrylics 110 McLaughlin, Michael Acrylics N237 McPherson, Tanja Jewelry S332 Melchiorre, Claudia Jewelry N211 Mercer, Susan Creative Crafts N707 Mezey, Helma Jewelry S346 Miller, Beverly Creative Crafts N732 Miller, Bill Mixed media/Graphics/Pastels/Printmaking N234

PAGE 59

39 Name Discipline Booth Moore, Eileen Shannon Acrylics 211 Moreland, Nancy Photography S 307 Morse, Jay Wood/Glass/Metal/Stone N215 Mosedale, Andrew Photography S302 Moses, Janet Acrylics N325 Musgrove, Velda Mixed media/Graphics/Pastels/Printmaking S329 Narramore, Ashley Creative Crafts N420 Nelson, Jeffrey Creative Crafts N701 Nelson, Wendi Creative Crafts N715 Nesius, Steven Photography S204 Nichols, Don Wood/Glass/Metal/Stone N326 Nilsson, Robert Jewelry 712 Northcutt, Mark Wood/Glass/Metal/Stone N334 ODriscoll, Danny Acrylics 710 OKeefe, Bonnie Fiber / Leather N320 Olsen, Blake Ceramics 616 Orgunov, Sergei Oils 205 Osborne, Bob Watercolors 106 Pace, Kyle Jewelry 422 Pardue, Cindy Hirt Wood/Glass/Metal/Stone 306 Pardue, Randy Wood/Glass/Metal/Stone 308 Paternoster, Jose Jewelry S318 Peebles, Leslie Mixed media/Graphics/Pastels/Printmaking 214 Peterson, Megan Jewelry N212 Petrarca, Laura Fiber/Leather N217 Petridis, Gaston Oils 614 Phillips, Lynette Ceramics N317 Phillips, Sally Jewelry S309 Pickett, Susan Creative Crafts N514 Pirkle, Linda Acrylics 606 Polacek, Diane Photography N220 Portschy, Donald Wood/Glass/Metal/Stone 505 Price, Josh Wood/Glass/Metal/Stone S317 Pugh, Karen Creative Crafts N421 Qin, Jie Fiber / Leather S348 Raabe, Clair Jewelry N305 Ragan, Aaron Creative Crafts N734 Ramaglia, Robert Jewelry 706 Ramos, Nico Photography S303 Randall, Josh Wood/Glass/Metal/Stone S308 Ricaurte, Carmen Fiber / Leather S344 Ricaurte, Rommel Wood/Glass/Metal/Stone 702 & 704 Richmond, James Photography 301 Ring, Robin Wood/Glass/Metal/Stone S218 Ritter, Kevin Mixed media/Graphics/Pastels/Printmaking S315 Robertson, Chuck Creative Crafts N703 Rogers, Lisa Acrylics 607 Rommel, Robert Photography N315 Ropohl, Patricia Acrylics 512 Roseman, Joyce Creative Crafts N502 Ruangnaopaporn, Pornthep Creative Crafts N723 Ruthem, Jim Wood/Glass/Metal/Stone 703 Santini, Dean Fiber / Leather N228 Sapp, Robin Wood/Glass/Metal/Stone 419 Sargeant, Regina Acrylics S330 Sari, Kenan Oils 406 Scherer, Walter Photography S205 Schilling, Peter Photography N331 Schloss, Dr. Patrick Ceramics S223 Schmidt, Alison Creative Crafts N505 Schoeler, Inna Fiber / Leather N312 Schroeder, Anne Acrylics 409 Shattuck, Dennis Oils 112 Shine, Sherry Creative Crafts N504 Shipley, Phillis Acrylics 410 Shirley, Milt Oils 601 Siegler, Ward Jewelry 114 Simmons, Richard Creative Crafts N708 Sinquefield, David Creative Crafts N401 & N403 Slade, Bill Wood/Glass/Metal/Stone 413 Slaven, Mark Jewelry 610 Smith, Carol Creative Crafts N412 Smith, Larry Oils 623 Smith, Woody Wood/Glass/Metal/Stone S235 Snider, Douglas Wood/Glass/Metal/Stone S354 Snyder, Adam Ceramics S210 Sparks, Paula Fiber / Leather S334 Stacholy, Gloria Jewelry S312 Stanford, James Wood/Glass/Metal/Stone 609 Stanford, Mark Oils 415 Stanley, Summer Jewelry S306 Steverson, Melodye Jewelry N3T1 Stevicks, Becky Fiber / Leather N221 Stillman, Debbie Jewelry S216 Stivers, Andy Wood/Glass/Metal/Stone S341 & S343 Stoddard, Jason Jewelry 300 Storeim, Jeanne Creative Crafts N705 Stout, Sheri Creative Crafts N423 Striewski, Andrea Wood/Glass/Metal/Stone N304 Striewski, Ted Jewelry N302 Taliaferro, Jimmy Wood/Glass/Metal/Stone 316 Tang, Li Photography 404 Tanner, Hugh Wood/Glass/Metal/Stone N330 Taube, Charles Wood/Glass/Metal/Stone 412 Teller, Steven Acrylics 713 Tessier, Rhonda Mixed media/Graphics/Pastels/Printmaking N204 Testor, Nora Jewelry N235 Thamert, Jeff Photography 322 Thomas, Mark Photography 118 Thomas, Tabitha Fiber / Leather 507 Thompkins, Tom Creative Crafts N720 Tinney, Henry Jewelry 217 Tipton, Patricia Ceramics 204 Tome, Nancy Acrylics 705 Tortorelli, George Creative Crafts N409 Tracht, Kelly Acrylics 321 Trent, Kole Acrylics 200 Van Pelt, Samantha Creative Crafts N414 Varela, Ana Ceramics 603 Venghaus, Mike Jewelry 719 Vickery, Courtney Acrylics 508 Villaroman, Karin Ceramics S310 Vostrejs, Dawn Jewelry N332 Wackes, Jane Wood/Glass/Metal/Stone N236 Wallis, Hanna & Kimberly Jewelry N224 Wang, Jenny Jewelry 305 Washington, Bruce Creative Crafts N422 Welsch, Harry Ceramics 501 Wentz, Larry Creative Crafts N402 Wettach, Jim Wood/Glass/Metal/Stone S327 Whijield, Warner Wood/Glass/Metal/Stone 318 Whitlock, Steve Acrylics 420 Wicher, Carolyn Fiber / Leather S316 Williams, Ian Wood/Glass/Metal/Stone 123 Williams, Jill Creative Crafts N507 Williams, Michael Fiber / Leather N328 Wilson, Garay Wood/Glass/Metal/Stone S208 Wise, Nevan Ceramics N310 Witchner, Wendy Jewelry S227 Witt, Christine Jewelry 219 Womack, Tracy Jewelry N318 Younce, Marsha Creative Crafts N429 Young, Leslie Wood/Glass/Metal/Stone 621 Young, Lisa Mixed media/Graphics/Pastels/Printmaking 411 Zandomenego, Cristina Jewelry N206 Zimmass, Hayley Ceramics N338 Zinsmeister, Shari Jewelry N301

PAGE 60

User-Friendly Website With Ability To Book Shooting Time & Rentals www.AmeliaShotgunSports.com Onsite, Revolutionary, Private & Group Instruction for Shooting & Mind Game By Owner-Operators Jimmy Muller & Dawn Grant Learn More About Their Expertise & Successful Clay Shooting Industry Experience At: www.MullerChokes.com and www.DawnGrant.comCOME SHOOT YOUR A.S.S. OFF!904-548-981886300 Hot Shot Trail, Yulee FL Located Minutes From I-95 and JAX International Airport (GPS Address: 86512 Goodbread Road, Yulee, FL 32097) www.mullerchokes.comwww.dawngrant.com Trap 5-Stand Skeet Shotgun Rentals Golf & Push Cart Rentals Long Range Wireless Release System Streamlined Electronic Check-In Shooting, Ballistics & Technical Instruction 20 Station Sporting Clays Course Discounted Ammo New Shooting Stands Newly Renovated Lodge Muller Chokes & Mental Training Products Mental Training & Mind Game CoachingAMELIA SHOTGUN SPORTSUNDER NEW OWNERSHIP & MANAGEMENT

PAGE 61

Pursuant to Chapter 197.062, notice is here by given that on the 23rd day of May 2018, a Tax Certificate Sale will be held online at www.bidnassau.com at 8 a.m. Tax Certificates will be sold on the following described lands to pay the amount due for taxes, herein set opposite the same, together with all costs of such sale and advertising for the 2017 taxes. If you have any questions regarding the Tax Certificate Sale website please contact Grant Street Group at (800)410-3445. ==================================== 1 03-1N-23-0000-0008-0010 582.82 TANNER IRIS C BRADDOCK 2.400AC 2475 STATE ROAD 2 HILLIARD FL 32046 PT OR 111/723 L/E & PT OR 328/413 R498308 EX PAR 8-1L 8-3 8-10 8-12 & EX PAR 8-13 ==================================== 2 04-1N-23-0000-0001-0020 HX 659.47 MILLER SARAH ANN 35.030AC 18150 HOOT OWL HOLW HILLIARD FL 32046 IN OR 1627/431 EX 4-8 & 1-8 2002/FTWD/DW/MH ESMT OR 1596/1914 ==================================== 3 04-1N-23-0000-0001-0080 121.11 MILLER SARAH ANN 5.000AC 18150 HOOT OWL HOLW HILLIARD FL 32046 PT GOVT LOTS 1 & 2 OF SEC 4-1N-23E IN OR 1625/787 ==================================== 4 04-1N-23-0000-0003-0090 819.19 HARTMAN GEORGE ALLEN JR 1.100AC 2476 SR 2 HILLIARD FL 32046 PT GOVT LOTS 7,8,10 & 11 OF SEC 4-1N-23E IN OR 1724/763 ==================================== 5 04-1N-23-0000-0003-0120 656.11 FERGUSON ROBERT DALE 6.000AC 1480 UNCLE CHARLES CIRCLE HILLIARD FL 32046 PT GOVT LOT 8 OF SEC 4-1N-23E IN OR 1666/48 {R622208 & R622209} ==================================== 6 04-1N-23-0000-0005-0010 526.87 TANNER IRIS BRADDOCK 11.000AC 2475 STATE ROAD 2 HILLIARD FL 32046 PT OR 328/413 EX R/W OR 535/356 EX 5-5 5-7 5-9 5-11 5-13 5-14 5-24 5-25 5-26 5-27 5-28 & EX 5-29 ==================================== 7 04-1N-23-0000-0005-0080 581.49 BURNSED JAMES FENTON & 3.120AC BURNSED AARON ELLIS (JT/RS) 17201 OAK HILL RD HILLIARD FL 32046 IN OR 1220/1889 ==================================== 8 04-1N-23-0000-0005-0090 HX 589.89 TANNER IRIS BRADDOCK 6.590AC 2475 STATE ROAD 2 HILLIARD FL 32046 PT OR 328 PG 413 ==================================== 9 04-1N-23-0000-0005-0120 HX 2,068.24 ANDERS JACK D 29.770AC 2450 ECLIPSE WAY HILLIARD FL 32046 IN OR 1792/1836 2001 MERT DW EX 5-15 ==================================== 10 04-1N-23-0000-0005-0130 1,091.87 TANNER IRIS C & 2.000AC LINDA & WILBUR L RYALS 2655 CRENSHAW LN HILLIARD FL 32034 IN OR 968/787 ==================================== 11 04-1N-23-0000-0005-0160 HX 623.12 MIXON JAMES C 1.550AC 2306 TOM CRAWFORD ROAD HILLIARD FL 32046 PT OF GOVT LOTS 9 & 10 PT OR 1663/178 EX 5-19 5-21 5-22 & 5-23 ==================================== 12 04-1N-23-0000-0005-0230 92.43 MIXON JAMES C 1.230AC 2306 TOM CRAWFORD ROAD HILLIARD FL 32046 PT OF GOVT LOTS 9 & 10 PT OR 1663/178 ==================================== 13 04-1N-23-0000-0005-0240 277.60 TANNER IRIS 1.000AC 2475 STATE ROAD 2 HILLIARD FL 32046 IN OR 2097/1746 ==================================== 14 04-1N-23-0000-0005-0270 424.95 TANNER IRIS 2.000AC 2475 STATE ROAD 2 HILLIARD FL 32046 IN OR 2097/1745 ==================================== 15 04-1N-23-0000-0005-0280 582.12 TANNER IRIS BRADDOCK 4.200AC 2475 STATE ROAD 2 HILLIARD FL 32046 PT OR 328/413 EX R/W OR 535/356 ==================================== 16 05-1N-23-0000-0001-0030 1,827.59 BERKE JOSEPH F JR 15.000AC 10435 GEORGE TABOR LANE JACKSONVILLE FL 32218 IN OR 1144/1708 & CASE #42-2009-DR-03490-FJ OR 1821/429 ==================================== 17 06-1N-23-0000-0002-0000 5,500.98 LUCOVSKY JEFFREY D 40.000AC 543619 US HWY 1 CALLAHAN FL 32011 SW1/4 OF SW1/4 IN OR 862/867 ESMT IN OR 862/861 ESMT OR 1056/1642 ==================================== 18 12-1N-23-0000-0007-0010 HX 446.19 GORDON MICHAEL VERNON & 1.000AC GORDON SHEILA T (JT/RS) 15552 HOWARD RD BRYCEVILLE FL 32009 PT OF GOVT LOT 8 IN OR 1726/212 1997 SPRI DW/MH ==================================== 19 12-1N-23-0000-0008-0040 811.34 SNOWDEN DENISE B 1.000AC 15358 HOWARD ROAD BRYCEVILLE FL 32009 PT OF GOVT LOT 2 IN OR 529 PG 1109 & OR 709/259 ESMT OR 532/624 ==================================== 20 12-1N-23-0000-0009-0010 71.83 BARBER GLENDA S 0.178AC 15358 HOWARD ROAD BRYCEVILLE FL 32009 OR 529/1110 & OR 1542/1145 EX 9-3 & 9-4 ==================================== 21 19-1N-23-0000-0006-0010 454.78 GILL JIMMY LEWIS 0.610AC 14739 COUNTY ROAD 121 BRYCEVILLE FL 32009 PT N1/2 OF N1/2 OF SW1/4 OF SW1/4 OF SEC 19-1N-23E BEING ONLY PT LYING E OF SR #121 IN OR 909/1353 {R378491} ==================================== 22 19-1N-23-0000-0006-0020 HX 100.12 PEARCE LISA M 2.480AC 2952 STAR BRIGHT PLACE BRYCEVILLE FL 32009 PT OF N1/2 OF N1/2 OF SW1/4 OF SW1/4 OF SEC 10-1N-23E IN OR 2139/818 (EX PT IN OR 1842/1299) {R359871 & R359872} ==================================== 23 19-1N-23-0000-0007-0030 627.91 JOHNS AUDREY H 1.400AC 6063 ACRE ROAD MACCLENNY FL 32063 NI/2 OF S1/4 OF SW1/4 OF SW1/4 EAST OF ROAD 121 IN OR 1336/1231 (EX OR 1948/1047) 1988 PCHTREE DWMH ==================================== 24 20-1N-23-0000-0003-0080 HX 3,183.03 MUMFORD MELISSA D & HARRY J 10.270AC 2527 JIMMY CONNER PLACE BRYCEVILLE FL 32009 PT OF GOVT LOT 6 IN OR 1441/1365 PARCELS 3-8 & 3-13 ==================================== 25 20-1N-23-0000-0009-0010 2,386.08 MUMFORD JAMES & KAITLAN 10.000AC 13421 PAINTED PONY LN BRYCEVILLE FL 32009 PT GOVT LOT 8 IN OR 2022/1072 BNDRY LINE AGMT OR 1436/869 R673122 & R673123 ==================================== 26 20-1N-23-0000-0009-0030 909.87 ROBINSON STEPHEN L & DENISE B 10.000AC 2658 PARMENTER RD BRYCEVILLE FL 32009 PT OF GOVT LOT 15 OF SEC 20-1N-23E IN OR 2100/1026 (EX PT IN OR 2100/1026 BEING PARAGRAPH 2) & ESMT IN OR 867/1894 ==================================== 27 23-1N-23-034D-0003-0000 901.60 BERNHARDT JOSE M & SARA M 2.440AC 1870 AUGUSTE ST PORT ALLEN LA 70767 LOT 3 IN OR 1913/342 DEEP CREEK PLANTATION PB 7/239 ==================================== 28 23-1N-23-034D-0004-0000 502.56 FABRIZIO ANTHONY JR & 3.420AC REILLY CAREN (JT/RS) 19 WALNUT GROVE RD RIDGEFIELD CT 06877 LOT 4 IN OR 1912/157 DEEP CREEK PLANTATION PB 7/239 ==================================== 29 23-1N-23-034D-0013-0000 824.35 PIAZZA YOLANDE & 12.450AC HODGES TONY A (W&H) 104 STRONG BRANCH DR PONTE VEDRA FL 32082 LOT 13 IN OR 1932/1269 DEEP CREEK PLANTATION PB 7/239 ==================================== 30 23-1N-23-034D-0037-0000 609.71 MARRERO JOSE R & 11.840AC HERNANDEZ OLGA M (H&W) 5629 SR 16 WEST STARKE FL 32091 PT LOTS 37,87 & 88 IN OR 1957/244 DEEP CREEK PLANTATION PBK 7/239 ==================================== 31 23-1N-23-034D-0039-0000 420.01 HERITAGE INVESTMENT CO LLC 6.150AC 50 NORTH LAURA STREET SUITE 2850 JACKSONVILLE FL 32202 LOT 39 IN OR 1544/1936 DEEP CREEK PLANTATION PB 7/239 ==================================== 32 23-1N-23-034D-0059-0000 779.39 THOMAS FURMAN E & JUDITH L 15.580AC 5011 KERNWOOD CT PALM HARBOR FL 34685 LOT 59 IN OR 1926/1065 DEEP CREEK PLANTATION PB 7/239 ==================================== 33 23-1N-23-034D-0062-0000 726.92 SCHULZE WALTER W III & SANDRA 8.140AC 1400 NE 57TH CT FT LAUDERDALE FL 33334 LOT 62 IN OR 1943/1250 DEEP CREEK PLANTATION PB 7/239 ==================================== 34 23-1N-23-034D-0069-0000 741.93 GOLDEN PHILIP G & 5.420AC MCNEILLY REBECCA C (JT/RS) 20608 NW STATE ROAD 16 STARKE FL 32091 LOT 69 IN OR 1910/1126 DEEP CREEK PLANTATION PB 7/239 ==================================== 35 23-1N-23-034D-0082-0000 639.10 COX GROVER CLEVELAND & EVA M 5.640AC 8007 HASTINGS ST JACKSONVILLE FL 32220 LOT 82 IN OR 1926/203 DEEP CREEK PLANTATION PB 7/239 ==================================== 36 23-1N-23-034D-0083-0000 896.47 EL-BAHRI ANDRE 7.310AC 3624 BRIDGEWOOD DR JACKSONVILLE FL 32277 LOT 83 IN OR 1914/1643 DEEP CREEK PLANTATION PB 7/239 ==================================== 37 23-1N-23-034D-0091-0000 916.71 MCMILLAN JAMES M & 5.860AC ELLIS MIRIAN FERNANDEZ(JTROS) 2570 BROWARD RD JACKSONVILLE FL 32218 LOTS 90 & 91 IN OR 1926/205 (EX PT IN OR 1921/1289) DEEP CREEK PLANTATION PBK 7/239 ==================================== 38 23-1N-23-034D-0094-0000 985.00 HOWARD NATASCHA FIEGE & JAMES 7.560AC 13541 VALBUENA CT JACKSONVILLE FL 32224 LOT 94 IN OR 1936/254 DEEP CREEK PLANTATION PB 7/239 ==================================== 39 24-1N-23-0000-0001-0060 1,052.32 HAMMOND HOLDINGS OF 3.000AC JACKSONVILLE LLC 665 DAY AVE JACKSONVILLE FL 32205 PT OF NE1/4 1997 HERI DW/MH IN OR 1986/721 EX 1-15 & 1-16 ==================================== 40 24-1N-23-0000-0001-0130 812.32 STARR FRANKLIN P & LINDA J 5.020AC 3439 HAMP HICKS BRYCEVILLE FL 32009 PT OF NE1/4 R583655 IN OR 1650/1455 ESMT OR 1324/295 ==================================== 41 24-1N-23-0000-0001-0180 1,460.02 PORTER JOHN C II 2.500AC 3342 STARDUST ROAD BRYCEVILLE FL 32009-1166 PT OF NE1/4 IN OR 974/167 ==================================== 42 24-1N-23-0000-0001-0190 HX 439.88 GAMBRELL ROBERT J 2.000AC 3330 STAR DUST ROAD BRYCEVILLE FL 32009 PT OF NE1/4 IN OR 1027/1737 2001 PION DW/MH ==================================== 43 04-1S-23-0000-0007-0010 HX 575.33 HYGEMA DAVID P & SHARON L 1.150AC 2187 KINARD ROAD BRYCEVILLE FL 32009 PT OF SW1/4 2003 MERIT DW/MH IN OR 1806/1014 EX 7-4 ==================================== 44 04-1S-23-0000-0007-0020 HX 1,044.85 MARTIN ROBERT RYAN & 1.010AC KIRKPATRICK BARBARA E 2191 KINARD ROAD BRYCEVILLE FL 32009 PT OF SW1/4 2002 KING DW IN OR 1543/793 EX 7-3 ==================================== 45 04-1S-23-0000-0009-0210 HX 691.57 RAULERSON STEPHEN M & DOROTHY 4.000AC 2662 EASTWOOD DRIVE BRYCEVILLE FL 32009 IN OR 393 PG 71 ==================================== 46 04-1S-23-0000-0009-0260 802.06 COLEMAN JACOB 2.800AC 3009 EASTWOOD DR BRYCEVILLE FL 32009 IN OR 1880/96 ESMT IN OR 446/745 1973 PEACHTREE DW/MH ==================================== 47 07-1S-23-0000-0001-0030 169.37 BRYANT GLENN R SR & TERESA T 1.000AC 1060 BRIE WAY BRYCEVILLE FL 32009 PT OR 658 PG 540 ==================================== 48 08-1S-23-0000-0001-0020 1,628.92 AGUILERA ADAM & 4.610AC BECKERS AMANDA 108 JUPITER LN ORANGE PARK FL 32073 PT OF S1/2 OF NE1/4 OF NE1/4 IN OR 2044/802 ==================================== 49 08-1S-23-0000-0001-0050 HX 1,781.08 WILSON GARY M 3.000AC 1682 PALTO PLACE BRYCEVILLE FL 32009 IN OR 478 PG 485 ==================================== 50 08-1S-23-0000-0001-0080 HX 1,777.28 WILKINSON LUCIA ROSE MARIE 7.620AC 1776 D B HICKS ROAD BRYCEVILLE FL 32009 PT OF S1/2 OF NE1/4 OF NE1/4 OR 339/58 & OR 353/261 & 262 PARCELS 1-8 & 1-9 ==================================== 51 08-1S-23-0000-0002-0010 1,016.62 COLEMAN BENJAMIN JR & KIMBERLY 5.290AC 1701 D B HICKS ROAD BRYCEVILLE FL 32009 PT OF W1/2 OF NE1/4 PT OR 894/1023 EX 2-23 R 106763 & R 106764 ==================================== 52 08-1S-23-0000-0002-0020 2,073.47 HRABEL WM F 15.900AC 36002 RUSTIC ACRES WAY CALLAHAN FL 32011 PT OF W 1/2 OF NE 1/4 IN OR 143 PG 171 ==================================== 53 08-1S-23-0000-0002-0220 534.71 COLEMAN BENJAMIN JR & KIMBERLY 3.000AC 1675 D B HICKS ROAD BRYCEVILLE FL 32009 PT OF W1/2 OF NE1/4 PT OR 894/1023 ==================================== 54 08-1S-23-0000-0002-0230 HX 490.59 COLEMAN BENJY & KIMBERLY 4.180AC 1701 D B HICKS ROAD BRYCEVILLE FL 32009 PT OF W1/2 OF NE1/4 IN OR 553 PG 309 R359385 ==================================== 55 08-1S-23-0000-0006-0180 71.38 BARNES REBECCA E & 1.720AC BARNES DAVID C ET AL 4242 RENDALE DRIVE JACKSONVILLE FL 32210-5138 IN OR 1036/1746 & OR 2112/1727 ESMT OR 1038/1954 ==================================== 56 08-1S-23-0000-0006-0250 247.22 PERRY JUSTIN O 1.000AC 10190 BUCKS WAY BRYCEVILLE FL 32009-2320 PT OF S1/2 OF SW1/4 IN OR 1671/882 ==================================== 57 08-1S-23-1830-0009-0000 HX 699.00 CLANTON PATRICIA 3.340AC 11514 CR 121 BRYCEVILLE FL 32009 LOT 9 OR 672 PG 1518 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 58 08-1S-23-1830-0015-0000 1,613.34 HUBBARD SHARON 2.530AC 11837 CR 121 BRYCEVILLE FL 32009 LOT 15 IN OR 1801/1731 R787737 & R787738 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 59 08-1S-23-1830-0017-0000 HX 505.05 COMBS CATHERINE & 2.000AC SLAY WILLIAM RAY (JT/RS) 11761 CR 121 BRYCEVILLE FL 32009 LOT 17 IN OR 1077/526 & OR 1556/1189 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 60 08-1S-23-1830-0028-0000 794.09 JOHNS MILDRED M 2.700AC PO BOX 859 ARCHER FL 32618 LOT 28 IN OR 1976/205 1985 CHAD DW/MH RIVERSIDE ESTATES #1 PB 5/171 ==================================== 61 08-1S-23-1830-0038-0000 HX 499.97 KEITH THOMAS 2.000AC 11003 COUNTY ROAD 121 BRYCEVILLE FL 32009 LOT 38 2002 FTWD DW/MH IN OR 1077/40 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 62 08-1S-23-1830-0039-0000 961.47 WHIDDON ASHLEE 2.000AC 1500 CALMING WATER DRIVE #2902 FLEMING ISLAND FL 32003 LOT 39 IN OR 1783/908 R673230 & R673231 RIVERSIDE ESTATES #1`PB 5/171 ==================================== 63 08-1S-23-1830-0055-0000 292.33 VAUGHN WEYMAN E & THERESA A 2.650AC 15451 WEST BEAVER STREET BALDWIN FL 32234 LOT 55 PT OR 759/674 RIVERSIDE ESTATES # 1 PB 5/171 ==================================== 64 08-1S-23-1830-0056-0000 338.50 VAUGHN WEYMAN E & THERESA A 2.000AC 15451 WEST BEAVER STREET BALDWIN FL 32234 LOT 56 PT OR 759/674 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 65 08-1S-23-1830-0057-0000 338.50 VAUGHN WEYMAN E & THERESA A 2.000AC 15451 WEST BEAVER STREET BALDWIN FL 32234 LOT 57 PT OR 759/674 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 66 08-1S-23-1830-0058-0000 338.50 VAUGHN WEYMAN E & THERESA A 2.000AC 15451 WEST BEAVER STREET BALDWIN FL 32234 LOT 58 PT OR 759/674 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 67 08-1S-23-1830-0059-0000 338.50 VAUGHN WEYMAN E & THERESA A 2.000AC 15451 WEST BEAVER STREET BALDWIN FL 32234 LOT 59 PT OR 759/674 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 68 08-1S-23-1830-0060-0000 228.47 VAUGHN WEYMAN E & THERESA A 2.000AC 15451 WEST BEAVER STREET BALDWIN FL 32234 LOT 60 PT OR 759/674 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 69 08-1S-23-1830-0066-0000 602.30 WILSON GARY M & PAMELA T 2.000AC 1682 PALTO PLACE BRYCEVILLE FL 32009 LOT 66 R407739 IN OR 1199/1774 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 70 08-1S-23-1830-0073-0000 HX 538.10 MEEKS WALTER C JR EST 2.180AC C/O LEONA MEEKS P O BOX 335 BRYCEVILLE FL 32009 LOT 73 IN OR 1671/696 R672769 & R672770 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 71 08-1S-23-1830-0074-0000 HX 952.48 SISLEY JASON WILLIAM 1.183AC 2286 CR 119 BRYCEVILLE FL 32009 PT OF LOT 74 IN OR 1710/1678 (EX S-1 & OR 1969/1859) RIVERSIDE ESTATES #1 PB 5/171 ==================================== 72 08-1S-23-1830-0094-0000 424.95 GILBERT ALICE FAYE & EARL E 2.000AC 3118 DALEHURST DR WEST JACKSONVILLE FL 32277 LOT 94 IN OR 1781/111 (EX ESMT IN OR 1781/112) RIVERSIDE ESTATES #1 PBK 5/171 ==================================== 73 08-1S-23-1830-0097-0000 HX 574.27 THOMAS RALPH M & BEVERLY J 4.680AC 1647 CR 119 BRYCEVILLE FL 32009 LOTS 97 & 98 2001 FTWD DW/MH IN OR 798/1564 & OR 1055/619 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 74 08-1S-23-1830-0113-0000 1,197.47 BARNCORD PATRICIA 5.000AC 5124 MARLENE AVE JACKSONVILLE FL 32210 LOT 113 R622097 IN OR 715/321 RIVERSIDE ESTATES #1 PB 5/171 ==================================== 75 17-1S-23-0000-0003-0000 1,842.77 WIGHTMAN MARK & JANNETTE 45.630AC 8549 WALDEN RD JACKSONVILLE FL 32244 PT OF NW1/4 IN OR 2118/29 EX 3-14 3-15 & 3-16 EX ESMT OR 1127/880 EX ESMT PT OR 1513/961 ==================================== 76 17-1S-23-0000-0003-0030 3,120.60 BRANNAN RONNIE & 10.500AC BRANNAN RONALD (JT/RS) 1032 SIERRA WOODS RD BRYCEVILLE FL 32009 PT OF NW1/4 IN OR 2065/991 ESMT IN OR 233/552 ==================================== 77 17-1S-23-0270-0004-0000 HX 496.78 EDENFIELD CLAYTON A 1.680AC 1328 COUNTRYSIDE ACRES AV BRYCEVILLE FL 32009 LOT 4 IN OR 832/1609 R672986 & R672987 & R672988 COUNTRYSIDE ACRES PB 5/287 ==================================== 78 17-1S-23-0270-0011-0000 1,351.52 GORDON JEAN & 1.980AC FAYE GILBERT 6796 COUNTY ROAD 119 BRYCEVILLE FL 32009 LOT 11 IN OR 927/1024 COUNTRYSIDE ACRES PB 5/287 ==================================== 79 17-1S-23-0270-0012-0000 HX 520.62 SHROWDER JAMES WADE & 3.010AC MCKINNON SUZANNE (H&W) 1582 COUNTRYSIDE ACRES AVE BRYCEVILLE FL 32009 LOT 12 IN OR 701 PG 1478 R788173 & R788174 CONSERVATION ESMT OR 729/723 COUNTRYSIDE ACRES PB 5/287 ==================================== 80 19-1S-23-0000-0005-0050 HX 1,240.25 MEEKS-JOHNSON SARA MELANIE 1.030AC 631 PEACELILY LANE BRYCEVILLE FL 32009 PT OF GOVT LOT 3 IN OR 681 PG 179 ==================================== 81 33-1S-23-0000-0003-0000 1,345.33 8035 WILDCAT LAND TRUST 3.000AC 3658 BLUEBERRY LN HILLIARD FL 32046 PT GOVT LOT 4 OF SEC 33-1S-23E & PT GOVT LOT 1 OF SEC 32-1S-23E IN OR 2042/107 {R567580} ==================================== 82 33-1S-23-0000-0005-0010 HX 286.71 MANSER JACK 1.820AC 6654 COUNTY ROAD 121 BRYCEVILLE FL 32009 IN OR 896/1470 MH/ID GAFLR7523712WE ==================================== 83 37-1S-23-0000-0006-0020 HX 317.12 LAMPRECHT FRED WILLIAM 3.900AC 6914 COUNTY ROAD 121 BRYCEVILLE FL 32009 IN OR 654 PG 961 R497699 & R497700 TEMP ESMT OR 895/755 ==================================== 84 02-2N-23-0000-0002-0000 3,798.93 MCDANIEL LONNIE J & KIMBERLY L 17.270AC 4489 CR 108 HILLIARD FL 32046 PT SW1/4 OF NE1/4 OF SEC 2-2N-23E & PT LOTS 25,26, 27,28 & 36 IN OR 1627/966 & OR 1627/969 CORNWALL SURVEY OF SEC 2-2N-23E S/D PBK O/31 ==================================== 85 02-2N-23-0000-0004-0010 HX 248.54 LUTRICK GLORIA W 1.000AC 23785 SMITH ROAD NORTH HILLIARD FL 32046-5335 IN OR 763/320 & OR 1759/1146 ESMT IN OR 317/141 ==================================== 86 02-2N-23-0000-0005-0030 540.21 AFSHAR JAMES 3.880AC 400 MERAVAN CT PALM HARBOR FL 34683 PT OF NW1/4 OF SW1/4 IN OR 645/588 ==================================== 87 03-2N-23-0000-0005-0040 329.66 ADAMS MARY RETHA L/E 1.300AC MARK WESLEY ADAMS 24892 CR 121 HILLIARD FL 32046 PT OF E 1/2 OF SW 1/4 OR 171/303 & L/E PT OR 706/411 EX PT OF OR 216/448 EX 5-6 & 5-7 EX R/W OR 246/635 ==================================== 88 03-2N-23-0000-0007-0000 HX 430.61 ADAMS MARY RETHA L/E 16.040AC MARK WESLEY ADAMS 24892 CR 121 HILLIARD FL 32046 PT OF N1/2 OF SW1/4 PT OR 706/411 (EX OR 258/556 & EX R/W OR 246/641 & 7-6 7-7 7-8 7-9 & PAR 8) ==================================== 89 03-2N-23-0000-0007-0030 82.84 ADAMS MARK WESLEY 1.830AC 24892 CR 121 HILLIARD FL 32046 PT NW1/4 OF SW1/4 OF SEC 3-2N-23E IN OR 2100/1223 BEING PARCEL ==================================== 90 03-2N-23-0000-0007-0050 HX 412.09 FOURNIER LORAINE L/E 1.800AC 25014 CR 121 HILLIARD FL 32046 PT NW1/4 OF SW1/4 OF SEC 3-2N-23E IN OR 2038/1719 (EX PT IN OR 2059/446) {R583240 & R583241} ==================================== 91 03-2N-23-0000-0007-0060 50.80 ADAMS MARK WESLEY 3.960AC 24892 CR 121 HILLIARD FL 32046 PT NW1/4 OF SW1/4 OF SEC 3-2N-23E IN OR 2100/1223 BEING PARCEL ==================================== 92 03-2N-23-0000-0007-0080 555.92 ADAMS MARK WESLEY 4.000AC 24892 COUNTY ROAD 121 HILLIARD FL 32046-5378 PT OR 706/411 & PT OR 890/775 1D/2X ==================================== 93 03-2N-23-0000-0009-0010 HX 3,496.70 CORNETT SHELIA M & 5.000AC BRIGHT DAVID M (JT/RS) 3594 CR 108 HILLIARD FL 32046 W1/2 OF NE1/4 OF SE1/4 IN OR 1524/93 EX RW & 9-3 ==================================== 94 09-2N-23-0000-0002-0000 HX 1,564.60 HARRIS SHERRI SIKES 14.000AC 2496 SIKES DRIVE HILLIARD FL 32046 IN OR 1490/561 EX ESMT OR 679/1144 EX 2-1 & 2-2 ESMT PT OR 1462/1572 ==================================== 95 09-2N-23-0000-0003-0000 1,093.32 DEGARMO KEEGHAN 174.000AC 13241 LIAHONA LN JACKSONVILLE FL 32225 IN OR 1889/1240 ==================================== 96 09-2N-23-0000-0005-0000 70.82 MANGES HARRY E 0.790AC 2303 SLIPPERY ROCK CIRCLE BLACKSHEAR GA 31516 PARCEL 5 (EX 5-2 THRU 5-6) IN PT OF OR 287 PG 261 ==================================== 97 10-2N-23-0000-0003-0010 HX 1,418.79 CANADAY ARTHUR L & 5.000AC CANADY REGINALD & KENNETH EST 3364 JESSIE RD HILLIARD FL 32046 IN OR 1073/1943 EX ESMT PT OR 762/756 ==================================== 98 10-2N-23-0000-0007-0000 2,044.42 DYAL KENNETH MYRON 5.000AC 24355 COUNTY ROAD 121 HILLIARD FL 32046 PT OF N1/2 OF NW1/4 CASE #13-CP-135 OR 1861/1488 EX R/W OR 246/647 ESMT PT OR 1818/787 ==================================== 99 10-2N-23-0000-0008-0000 1,267.47 DYAL KENNETH 13.720AC 24355 COUNTY ROAD 121 HILLIARD FL 32046 PT N1/2 OF NW1/4 OF SEC 10-2N-23E IN OR 1316/1595 (EX PT IN OR 1319/1073 & ESMT IN OR 1939/383) ==================================== 100 10-2N-23-0000-0008-0060 346.35 DYAL KENNETH M 2.000AC 24412 CR 121 HILLIARD FL 32046 PT N1/2 OF NW1/4 OF SEC 10-2N-23E IN OR 1319/1073 ==================================== 101 10-2N-23-0000-0008-0080 HX 113.11 JENKINS JONATHAN L & ASHLEY D 0.940AC 2801 ROY SIKES ROAD HILLIARD FL 32046 PT OF N1/2 OF NW1/4 IN OR 1299/628 1993 DEST DW/MH ==================================== 102 10-2N-23-0000-0013-0000 HX 430.91 CARROLL WOODROW W & 7.190AC CARROLL CHARLES WILSON (JT/RS) 25012 WILSON CARROLL LANE HILLIARD FL 32046 IN OR 1605/369 EX 13-2 13-6 & 13-7 ==================================== 103 10-2N-23-0000-0015-0020 837.58 ANDERSON JOSEPH M & BILLIE JO 7.920AC PO BOX 1878 CALLAHAN FL 32011-1878 PT OF SW1/4 PT OR 1264/170 EX 15-19 ==================================== 104 11-2N-23-0000-0005-0020 1,471.51 REID JUSTIN SCOT & KRISTEN L 3.300AC 3307 RIVER RD HILLIARD FL 32046 PT GOVT LOTS 3 & 4 OF SEC 11-2N-23E IN OR 1909/1815 ==================================== 105 13-2N-23-0000-0002-0000 772.87 RNHJ HOLDINGS INC 160.000AC PO BOX 455 CALLAHAN FL 32011-0455 S1/2 OF S1/2 IN OR 1551/825 ESMT OR 1434/470 ==================================== 106 15-2N-23-0000-0005-0270 HX 1,765.03 WHITFIELD MARIE I CACERES 8.430AC 23291 COUNTY ROAD 121 HILLIARD FL 32046 PT OF E1/2 OF NW1/4 IN OR 469 PG 33 ==================================== 107 15-2N-23-0000-0006-0020 HX 388.20 CASTLEBERRY MARVIN C JR & 4.140AC CASTLEBERRY KENNA C EST (M/S) 22090 CREWS RD HILLIARD FL 32046 IN OR 680/711 R673246 PARCELS 6-2 & 6-7 ESMT OR 1634/1949 ==================================== 108 15-2N-23-0000-0006-0040 418.44 BURNSED JAMES F & CHERYL O 1.330AC 2562 FOLLY LANE HILLIARD FL 32046-5470 PT OF OR 578 PG 921 ==================================== 109 15-2N-23-0000-0006-0080 HX 1,084.05 CASTLEBERRY MARVIN C 4.140AC 2691 FOLLY LANE HILLIARD FL 32046 PT OR 835/1051 ESMT OR 1715/774 ==================================== 110 15-2N-23-0000-0006-0100 HX 1,225.96 BEAUDRY ROBERT & DONNA E 5.840AC PO BOX 113 CALLAHAN FL 32011 PT OR 781/1513 R787786 & R787787 ==================================== 111 15-2N-23-0000-0006-0120 399.22 WALKER JASON M & CHRISTY M 1.260AC 22342 CREWS ROAD HILLIARD FL 32046 PT OF NW1/4 OF NW1/4 IN OR 1654/773 ==================================== 112 15-2N-23-0000-0007-0000 954.86 NAYLOR GREGORY R & ELIZABETH D 2.000AC 21964 CREWS RD HILLIARD FL 32046 SW1/4 OF NW1/4 IN OR 2128/1635 2003 REGE DW ==================================== 113 15-2N-23-0000-0008-0000 634.18 MILLIKIN PATRICIA A 0.950AC 22928 CR 121 HILLIARD FL 32046 SW1/4 (EX 8-10) CASE #45-2011-CP-000289 PT OR 1876/1861 ==================================== 114 15-2N-23-0000-0008-0100 380.29 ROWELL DAPHNE M 0.990AC 22864 CR 121 HILLIARD FL 32046 CASE #45-2011-CP-000289 PT OR 1876/1861 ==================================== 115 15-2N-23-0000-0009-0000 152.03 DAKBRA VENTURES LLC 20.000AC 4500 N HIATUS RD SUITE #213 SUNRISE FL 33351 W1/2 OF SW1/4 S1/2 OF NE1/4 OF SW1/4 PT OR 1308/1539 ESMT OR 1531/892 EX 9-1 9-2 9-3 9-4 9-5 & 9-9 ==================================== 116 15-2N-23-0000-0009-0110 430.46 WILSON DAVID 1.000AC 646 N BROAD ST GROVE CITY PA 16217 PT OF SW1/4 OF SEC 15-2N-23E IN OR 1775/1181 {R583776 & R583777} ==================================== 117 16-2N-23-0000-0001-0110 228.91 CASTLEBERRY MARVIN C 0.860AC 2691 FOLLY LANE HILLIARD FL 32046 PT OR 835/1051 ==================================== 118 16-2N-23-0000-0001-0130 1,112.48 BEAUDRY ROBERT & DONNA E 1.600AC PO BOX 113 CALLAHAN FL 32011 PT OR 781 PG 1513 ==================================== 119 16-2N-23-0000-0001-0160 2,050.47 MASTERS RALPH R SR & DIANE M 4.670AC 2496 CHOLERTON LN HILLIARD FL 32046 PT GOVT LOT 1 IN SEC 16-2N-23E IN OR 2010/1483 ==================================== 120 16-2N-23-0000-0003-0000 339.29 DAKBRA VENTURES LLC 64.000AC 4500 N HIATUS RD SUITE #213 SUNRISE FL 33351 LOT 3 (EX PAR 3-2 & 3-3) PT OR 1308/1539 ==================================== 121 16-2N-23-1850-0001-0000 563.79 MANGES HARRY E 4.060AC 2303 SLIPPERY ROCK CIRCLE BLACKSHEAR GA 31516 LOT 1 ESMT PT OR 1433/701 RIVER COUNTRY ESTATES PB 6/170 ==================================== 122 16-2N-23-1850-0002-0000 559.85 MANGES HARRY E 4.030AC 2303 SLIPPERY ROCK CIRCLE BLACKSHEAR GA 31516 LOT 2 ESMT PT OR 1433/701 RIVER COUNTRY ESTATES PB 6/170 ==================================== 123 16-2N-23-1850-0003-0000 593.91 MANGES HARRY E 4.290AC 2303 SLIPPERY ROCK CIRCLE BLACKSHEAR GA 31516 LOT 3 ESMT PT OR 1433/701 RIVER COUNTRY ESTATES PB 6/170 ==================================== 124 16-2N-23-1850-0004-0000 686.92 MANGES HARRY E 5.000AC 2303 SLIPPERY ROCK CIRCLE BLACKSHEAR GA 31516 LOT 4 ESMT PT OR 1433/701 RIVER COUNTRY ESTATES PB 6/170 ==================================== 125 22-2N-23-0000-0002-0000 704.33 CONNER RICHARD 82.990AC 14456 RUTH LN HILLIARD FL 32046 S1/2 OF NE1/4 & N1/2 OF SE1/4 OR 678/1848 LESS R/W (EX PAR 3 2-1 THRU 2-6 & 2-10 EX 2-14 & 2-15 & EX OR 2033/754) ==================================== 126 23-2N-23-0000-0001-0050 HX 903.07 ASHLEY CHRISTOPHER S & SHANNON 10.640AC 4548 RIVER ROAD HILLIARD FL 32046 PT OF NE1/4 IN OR 1727/1046 PARCELS 1-5 & 2-6 1983 DW/MH CHAR ==================================== 127 23-2N-23-0000-0002-0100 HX 219.49 WILLIAMS LACY H 2.960AC 4318 RIVER ROAD HILLIARD FL 32046 PT OF NW1/4 OF NE1/4 OR 834/1584 FLFLH70A14913SP ==================================== 128 23-2N-23-1803-0005-0010 132.88 HORNE CRAIG L & LYDIA R 0.250AC 4357 RIVER ROAD HILLIARD FL 32046 PT OF LOT 5 (S-1) IN OR 1523/851 RANDY ACRES PB 5/242 ==================================== 129 25-2N-23-0000-0002-0010 749.27 TARRIS BOB TRUSTEE 1.000AC OF BOJU TRUST 6134 PO BOX 7441 JACKSONVILLE FL 32238 IN OR 1059/996 ==================================== 130 26-2N-23-0000-0002-0000 2,739.03 RNHJ HOLDINGS INC 35.960AC PO BOX 455 CALLAHAN FL 32011-0455 PT OF NE1/4 IN OR 1551/865 & PARCELS 1-3 & 3-7 & PT OR 1551/823 PARCEL 2 ==================================== 131 26-2N-23-0000-0002-0010 104.04 RNHJ HOLDINGS INC 6.770AC PO BOX 455 CALLAHAN FL 32011-0455 PARCEL 2-1 NW1/4 OF NE1/4 PT OR 1551/823 ==================================== 132 26-2N-23-0000-0005-0020 2,548.63 CONNER GERALD DALE EST 43.060AC 3800 CONNER COLLINS RD HILLIARD FL 32046 SE1/4 OF NW1/4 IN OR 2090/60 ==================================== 133 26-2N-23-0000-0005-0150 291.33 CONNER GERALD DALE EST 40.000AC 3800 CONNER COLLINS RD HILLIARD FL 32046 NE1/4 OF SW1/4 PT OR 648/438 ESMT OR 554/858 ==================================== 134 27-2N-23-0000-0001-0000 1,568.16 NASSAU TIMBER & LAND HOLDINGS 20.850AC LLC PO BOX 1694 CALLAHAN FL 32011 PT GOVT LOT 1 & PT OF E1/2 OF SEC 27-2N-23E LYING WEST OF COUNTY ROAD 121 IN OR 2051/12 (EX OR 2085/1432) ==================================== 135 27-2N-23-0000-0001-0070 804.15 GROUP LLC 450027 OLD DIXIE HWY CALLAHAN FL 32011 PT OF SW1/4 OF SE1/4 OF SEC 27-2N-23E IN OR 2031/1666 ==================================== 136 27-2N-23-0000-0001-0130 1,937.35 GROUP 33.250AC LLC PO BOX 8918 JACKSONVILLE FL 32239 PT OF SW1/4 OF NE1/4 & PT OF NW1/4 OF SE1/4 & PT OF SW1/4 OF SE1/4 OF SEC 27-2N-23E IN OR 1723/1783 BEING PT OF PAR 16 & PT OF ABND R/W IN OR 1999/1497 BEING ONLY PARTS LYING S OF HENRY LEE RD & N OF R/W IN OR 2036/1895 (EX PT IN OR 352/575,OR 354/742, OR 671/692,OR 731/237, OR 792/1840 & OR 2036/1890 & OR 2084/1261) ==================================== 137 27-2N-23-0000-0001-0190 2,307.86 CREATIVE GROUP 30.890AC LLC PO BOX 8918 JACKSONVILLE FL 32239 PT GOVT LOT 1 & PT OF E1/2 OF SEC 27-2N-23E LYING WEST OF COUNTY ROAD 121 IN OR 2051/7 (EX OR 2085/1645) ==================================== 138 27-2N-23-0000-0001-0210 1,014.35 CREATIVE GROUP 10.000AC LLC PO BOX 8918 JACKSONVILLE FL 32239 PT GOVT LOT 1 & PT OF E1/2 OF SEC 27-2N-23E LYING WEST OF COUNTY RD 121 IN OR 2085/1645 ==================================== 139 27-2N-23-0000-0001-0220 1,505.55 NASSAU TIMBER & LAND HOLDINGS 20.000AC LLC PO BOX 1694 CALLAHAN FL 32011 PT GOVT LOT 1 & PT OF E1/2 OF SEC 27-2N-23E LYING WEST OF COUNTY RD 121 IN OR 2085/1432 ==================================== 140 27-2N-23-0000-0003-0030 HX 1,826.19 HUNTER WARREN E & DEBORAH A 13.580AC 20158 GRANNY LANE HILLIARD FL 32046 PT GOVT LOTS 1 & 2 OF SEC 27-2N-23E IN OR 246/216 & OR 352/575 (EX PT IN OR 925/1603 & PT IN R/W OR 408/4) ==================================== 141 27-2N-23-0000-0005-0050 HX 229.83 PECK KEVIN D 4.000AC 19971 JAGUAR DRIVE HILLIARD FL 32046-5413 PT OF SE1/4 OF NW1/4 IN OR 725 PG 1585 R672301 ==================================== 142 27-2N-23-0000-0005-0090 HX 324.71 HUNTER CHRISTOPHER & DANA M 1.000AC 20178 JAGUAR DRIVE HILLIARD FL 32046 PT GOVT LOT 1 OF SEC 27-2N-23E IN OR 925/1603 {HMST14889AGA & HMST14889BGA} ==================================== 143 27-2N-23-0000-0005-0100 857.18 SHOTT KELLY LYNN & CHRISTOPHER 1.284AC 20106 JAGUAR DR HILLIARD FL 32046 PT OF SEC 27-2N-23E IN OR 2054/375 ==================================== 144 27-2N-23-0000-0006-0020 921.11 MUMFORD MELISSA D & HARRY J 4.200AC 2527 JIMMY CONNER PLACE BRYCEVILLE FL 32009 PT OF NE1/4 OF SW1/4 IN OR 1549/245 R673879 & R673880 EX 6-3 6-6 & 6-7 ==================================== 145 27-2N-23-0000-0007-0060 470.82 CONLEY DARRELL S JR & CRYSTAL 1.340AC 3458 BARBARA LN HILLIARD FL 32046 IN OR 1734/248 R583709 (EX R/W & EX 7-18 & 7-19) ==================================== 146 27-2N-23-0000-0007-0180 414.98 RODRIGUEZ NOWELL D & KIMBER N 1.030AC 27210 KRISTIE CIRCLE S HILLIARD FL 32046 IN OR 1872/849 EX 7-20 1982 NOBI SW/MH ==================================== rfnt bnt In accordance with Florida Statute 197.402, the list of unpaid properties is advertised three times. Accounts listed within this publication were unpaid as of April 19, 2018. Please note that some of the listed properties have subsequently been paid. Florida law requires the delinquent list to be organized by account number, not by alphabetical order. DEL. TAX LIST 2017.indd 1 4/30/18 12:20 PM

PAGE 62

147 27-2N-23-0000-0009-0000 1,194.68 RING STEVEN CHARLES 2.120AC 20362 CR 121 HILLIARD FL 32046 PARCEL 9 IN SEC 27-2N-23E & PARCEL 1-9 IN SEC 34-2N-23E IN OR 2058/100 ==================================== 148 27-2N-23-0000-0009-0040 HX 451.84 CLEMONS KELLY G & EVELYN L 2.300AC 20460 CR 121 HILLIARD FL 32046 SE1/4 OF SE1/4 IN OR 664 PG 392 R567543 & R567544 ==================================== 149 28-2N-23-0000-0003-0010 HX 616.38 CREWS RHONDA M & JOHN G 1.000AC 19288 SCENIC RIVER DRIVE HILLIARD FL 32046 PT OF SE1/4 OF SE1/4 IN OR 1595/1630 ==================================== 150 33-2N-23-0000-0001-0010 HX 592.58 PENDERGRASS SANDRA J & JOHN M 4.700AC 2892 BARBARA LANE HILLIARD FL 32046-5610 PT OF E1/2 OF NE1/4 IN OR 1240/1139 ==================================== 151 33-2N-23-0000-0001-0140 HX 135.85 GEORGE PAUL & AMANDA 1.330AC 2761 BARBARA LANE HILLIARD FL 32046 PT OF E1/2 OF NE1/4 IN OR 1656/1612 ORDER VACATING C/TOR 1459/1910 1974 TAHO DW/MH ==================================== 152 34-2N-23-0000-0001-0080 842.54 RING STEVEN C & SANDRA S 1.380AC 20346 CR 121 HILLIARD FL 32046 PT SEC 34-2N-23E RECD IN OR 1966/572 ==================================== 153 34-2N-23-0000-0002-0060 41.12 MCLENDON LUTHER S III & SUSAN 1.620AC 18401 CONNER ROAD HILLIARD FL 32046 IN OR 1726/1495 ==================================== 154 34-2N-23-0000-0002-0080 212.55 MCLENDON LUTHER S III & SUSAN 35.330AC 18401 CONNER RD HILLIARD FL 32046 PT S1/2 & N1/2 OF SEC 34 IN OR 1765/218 ==================================== 155 34-2N-23-0000-0003-0030 1,396.62 FLINK STEVE W 1.580AC PO BOX 584 HILLIARD FL 32046 IN OR 2049/1165 2004 CLAS DW/MH ==================================== 156 34-2N-23-0000-0005-0040 HX 994.27 BLOUNT JAMES R JR & REBECCA L 2.000AC 3117 BARBARA LANE HILLIARD FL 32046 PT OF NW 1/4 OF NW 1/4 IN OR 843/1330 ==================================== 157 34-2N-23-0000-0005-0100 737.98 RAULERSON STEPHEN D 5.390AC 28158 VIEUX CARRE YULEE FL 32097 PT OF W1/2 OF NW1/4 IN OR 1016/1788 ==================================== 158 34-2N-23-0000-0007-0110 1,065.97 MCLENDON LUTHER S & SUSAN A 9.100AC 18401 CONNER ROAD HILLIARD FL 32046-5647 IN OR 729/309 ==================================== 159 34-2N-23-0000-0008-0000 133.60 CONNER RICHARD A 26.440AC 14456 RUTH LN HILLIARD FL 32046 NW1/4 OF SW1/4 OF SEC 34-2N-23E IN OR 807/1840 & ESMT IN OR 342/308 (EX PT IN OR 1008-1533,OR 1011/1627, OR 1963/1450) ==================================== 160 05-2S-23-0000-0003-0040 2,988.82 PINER JAMES FRANKLIN JR 10.840AC 12525 STERLING RUN COURT JACKSONVILLE FL 32225 PT OF GOV LOT 4 (EX 3-17) IN OR 1722/503 EX R/W OR 583/69 ==================================== 161 05-2S-23-0000-0003-0170 346.35 PINER JAMES F JR 3.000AC 12525 STERLING RUN COURT JACKSONVILLE FL 32225 PT OF GOVT LOT 4 IN OR 920/1185 ==================================== 162 05-2S-23-1500-0007-0000 631.75 SMITHS INVESTMENT CORPORATION 1.140AC 2283 S BROOK DRIVE ORANGE PARK FL 32003 LOT 7 IN OR 1490/1331 1987 LIBE DW/MH KAST ESTATES #1 UNR ==================================== 163 06-2S-23-0000-0002-0030 HX 182.81 RAWLINS JESSICA F & JONATHAN M 8.390AC 744 D-FOURAKER ROAD BRYCEVILLE FL 32009 PT OF SE1/4 1979 STAR SW/MH PARCELS 2-3 & 2-4 OR 1069/251 & 253 & OR 1116/1563 ESMT OR 1509/1331 ==================================== 164 06-2S-23-0000-0006-0000 HX 969.25 AVERY TANGIE J 2.000AC 892 MIDDLE ROAD BRYCEVILLE FL 32009 PT OF SE1/4 OF SE1/4 IN OR 1067/904 ==================================== 165 07-2S-23-0000-0003-0070 HX 99.11 EVERS MELISSA A 1.000AC 812 BLACKSMITH PLACE BRYCEVILLE FL 32009 IN OR 847/550 ESMT OR 674/916 R568258 & R568259 & R568260 ==================================== 166 07-2S-23-0000-0003-0080 811.21 WOODARD OLA B & 2.340AC CONSTANTINI JEANETTE CO-TRSTEE 3556 OAK STREET JACKSONVILLE FL 32205 PT OR SE1/4 OF NE1/4 IN OR 1818/1254 1983 NOVA SW/MH ==================================== 167 07-2S-23-0000-0003-0120 588.67 OLA B WOODARD REVOCABLE TRUST 1.160AC 3556 OAK STREET JACKSONVILLE FL 32205 IN OR 1818/1255 1997 REDM SW/MH ==================================== 168 07-2S-23-0000-0004-0070 HX 649.15 PRICE BONNIE J & DARYL B 3.640AC 575 WHOA LANE BRYCEVILLE FL 32009 PARCELS 4-7 & 1-8 IN SEC 18 IN OR 1691/1092 2009 SEHI DW/MH ==================================== 169 08-2S-23-0000-0002-0050 127.60 TRAVIS RICHARD A 12.695AC 8080 GREAT VALLEY TR JACKSONVILLE FL 32244 PT SEC 7-2S-23E & 8-2S-23E IN OR 1991/653 ==================================== 170 15-2S-23-0000-0001-0020 316.01 TOMLIN DANIEL S & DONNA M 7.600AC 3525 COUNTY ROAD 121 BALDWIN FL 32234 PT SW1/4 OF SEC 15-2S-23E & PT SE1/4 OF SEC 16-2S-23E IN OR 1040/1954 BEING ONLY PT LYING E OF OR 1047/1804 ==================================== 171 16-2S-23-0000-0002-0020 743.76 STEWART MATTHEW & FELICIA 4.000AC 3470 CR 121 BALDWIN FL 32234 PT OF S1/2 OF S1/2 OF GOVT LOT 4 OR 1364/1881 (EX 2-3) ==================================== 172 21-2S-23-0000-0002-0010 514.78 CRAWFORD WILLIAM R EST 0.450AC 3347 COUNTY ROAD 121 BALDWIN FL 32234 PT OF N1/2 OF NW1/4 OF NE1/4 IN OR 748/1433 R408007 & R433923 EX ESMT OR 893/404 ==================================== 173 21-2S-23-0000-0002-0040 444.13 CRAWFORD WILLIAM R L/E 1.800AC WENDY L HODGES 3417 COUNTY ROAD 121 BALDWIN FL 32234 PT OF N1/2 OF NW1/4 OF NE1/4 L/E OR 1168/755 ==================================== 174 21-2S-23-0000-0002-0060 HX 532.17 HODGES WENDY LEE 1.000AC 3407 COUNTY ROAD 121 BALDWIN FL 32234 PT N1/2 OF NW1/4 OF NE1/4 IN OR 2002/1403 ==================================== 175 21-2S-23-0000-0003-0000 HX 2,510.75 STEWART MADGE D 14.470AC 1590-28 ISLAND LASE FLEMING ISLAND FL 32003 N1/2 OF NE1/4 OF NW1/4 & OR 173/591 & OR 682/815 PARCELS 3 & 3-1 EX 3-2 & 3-3 ==================================== 176 21-2S-23-0000-0003-0020 HX 598.36 STEWART MATTHEW & FELICIA 5.810AC 2361 PRAIRIE DOG LANE BALDWIN FL 32234 PT OF NW1/4 IN OR 1319/573 1990 FLEE SW/MH PARCELS 3-2 & 3-3 ==================================== 177 21-2S-23-0000-0007-0040 608.39 BECK JAMES D EST 1.530AC 2333 CARTER STREET BALDWIN FL 32234 PT SW1/4 OF SEC 21-2S-23E IN OR 280/582 {R 106627} ==================================== 178 21-2S-23-0000-0008-0000 367.76 BROOKS BOBBY ELBERT 1.500AC 2310 CARTER ST BALDWIN FL 32234 PT OF NE1/4 OF NE1/4 OF SW1/4 OR 373/148 & OR 733/882 ==================================== 179 21-2S-23-0000-0009-0020 134.29 DEDMON DERRY W & M L 1.000AC 2896 RIVER OAK DRIVE ORANGE PARK FL 32073 PT SW1/4 OF SW1/4 OF SEC 21-2S-23E IN OR 227/612 ==================================== 180 02-3N-23-2020-0010-0010 1,196.08 SCHONBRUN HARVEY TRUSTEE 1.000AC 1802 NORTH MORGAN STREET TAMPA FL 33602 W243 FT OF S210 FT OF LOT 10 EX W33 FT FOR R/W IN OR 1711/837 CORNWALL SURVEY ==================================== 181 02-3N-23-2020-0018-0000 213.06 COAST TO COAST INC 40.000AC C/O MAXWELL COBB 523 SOUTH ELLIS ROAD JACKSONVILLE FL 32254 LOTS 18 19 20 & 21 PT OR 646 PG 50 CORNWALL SURVEY ==================================== 182 03-3N-23-0000-0001-00M1 46.25 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 N1/2 OF SEC EX E 59 ACRES PT OR 1313/689 261 ACRES 1/3 INT MINERAL RIGHTS ONLY ==================================== 183 04-3N-23-0000-0001-00M1 44.96 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 N1/2 OF SEC PT OR 1313/689 PARCELS 1 1-1 1-2 & 4-1 1/3 INT 237 ACRES MINERAL RIGHTS ONLY ==================================== 184 04-3N-23-0000-0002-0040 HX 615.12 TAYLOR ASHLEY DIANNE 3.700AC 31599 COUNTY ROAD 121 HILLIARD FL 32046 PT OF N615 FT OF W2078.52 FT OF S1/2 IN OR 1995/1000 2001 FLEET DW/MH ==================================== 185 09-3N-23-2020-0041-0000 546.34 GUYNN SHELTON J 20.000AC 17416 WHISTLER SPRING LANE HILLIARD FL 32046 LOTS 41 THRU 44 IN OR 1107/1449 EX S-1 OF LOTS 41-44 ESMT OR 1088/1953 CORNWALL SURVEY ==================================== 186 09-3N-23-2020-0041-0010 HX 1,113.73 GUYNN SHELTON J & RHONDA L 20.000AC 17416 WHISTLER SPRING LN HILLIARD FL 32046 E1/2 OF LOTS 41 THRU 44 IN OR 879/1974 CORNWALL SURVEY ==================================== 187 09-3N-23-2020-0045-0010 2,714.81 COAST TO COAST INC 24.000AC C/O MAXWELL COBB 523 SOUTH ELLIS ROAD JACKSONVILLE FL 32254 PT LOTS 45,45,47,48 & LOT 52 IN OR 646/50 (EX PT IN OR 1603/1920) CORNWALL SURVEY S/D OF SEC 9-3N-23E PBK O/31 ==================================== 188 10-3N-23-2020-0013-0010 HX 422.72 MOODY WILLIAM A & BECKY & 3.540AC MOODY ALTON VANCE (JT/RS) 17194 BUCKSKIN RD HILLIARD FL 32046 W1/2 OF E1/2 OF LOT 13 & PT OF LOT 14 (S-1) IN OR 1891/469 1980 TIPP DW/MH EX S-3 OF LOT 13 EX S-1 & S-2 OF LOT 16 EX S-2 & S-3 OF LOT 14 EX S-1 OF LOTS 14 & 15 CORNWALL SURVEY PB 0/31 ==================================== 189 12-3N-23-2020-0003-0000 HX 197.98 CARTER CAREY & KAREN 11.000AC 27083 CARTER LANE HILLIARD FL 32046 LOT 3 R673304 IN OR 801 PG 36 EX ESMT OR 983/704 CORNWALL SURVEY ==================================== 190 12-3N-23-2020-0018-0010 HX 1,747.70 SIKES CLAUDE R & TERESA B 1.000AC 27065 PEE WEE LANE HILLIARD FL 32046 S200 FT OF W217.8 FT OF E1/2 OF LOT 18 OR 1092/1395 IN OR 1092/1395 CORNWALL SURVEY ==================================== 191 14-3N-23-2020-0016-0000 424.95 UNIFORM TRADE ASSOCIATES LLC 8.000AC C/O SUSAN KOPE 16931 W SECRETARIAT DR LOXAHATCHEE FL 33470 PT OF LOT 16 IN OR 1762/990 (EX ESMT OR 537/1244) CORNWALL SURVEY SEC 14-3N-23E PBK O/31 ==================================== 192 14-3N-23-2020-0020-0000 2,511.23 CORNWALL DAWN & 18.300AC CHARLES CORNWALL PO BOX 232 DRYDEN NY 13053 LOTS 20 & 21 IN OR 2122/1437 (EX R/W OR 490/460 & EX UTIL ESMT IN OR 1575/935) CORNWALL SURVEY SEC 14-3N-23E PBK O/31 ==================================== 193 16-3N-23-2020-0029-0000 HX 937.98 GEIGER RICHARD A & KRISTIN C 7.740AC PO BOX 206 HILLIARD FL 32046 LOT 29 2007 CMHM DWMH IN OR 1945/1866 ESMT PT OR 1512/148 ESMT PT OR 1724/1142 EX ESMT PT OR 1830/1492 CORNWALL SURVEY ==================================== 194 33-3N-23-0000-0002-0030 708.25 BROWN NANCY VANZANT 0.940AC 31555 CR 121 HILLIARD FL 32046 PT GOVT LOT 4 OF SEC 33-3N-23E IN OR 985/141 {1997 WEST SW} ==================================== 195 37-3N-23-0000-0001-0030 HX 1,476.02 TAYLOR JIMMY DALE 10.600AC 29570 NICK BAY LANE HILLIARD FL 32046 IN OR 1852/1242 ESMT PT OR 1572/1606 2007 HOMI DW/MH ==================================== 196 37-3N-23-0000-0001-0200 544.98 TYSON JACK 1.000AC 10132 MULBERRY LANDING ANNEX HILLIARD FL 32046 IN OR 2018/475 (EX 1-42 & 1-51) ==================================== 197 37-3N-23-0000-0001-0330 HX 450.06 MCCAULEY JAMES & AMANDA 5.170AC 17094 MCCAULEY LN HILLIARD FL 32046 IN OR 1581/625 1981 CROW SW/MH ==================================== 198 37-3N-23-0000-0001-0510 283.88 TYSON JACK 0.940AC 10132 MULBERRY LANDING ANNEX HILLIARD FL 32046 IN OR 1846/423 ==================================== 199 37-3N-23-0000-0001-0530 424.95 SIMMONS JAMES ANDREW 2.000AC 508 BAISDEN RD JACKSONVILLE FL 32218 PT OF SEC 37-3N-23E IN OR 2032/1303 BEING EXHIBIT A ==================================== 200 37-3N-23-2070-0001-0000 HX 396.47 KISER ALAN L & WENDY D 0.000AC 31718 COUNTY ROAD 121 HILLIARD FL 32046 LOT 1 IN OR 2000/1476 1988 HART DW/MH MULBERRY LANDING 1 PB 4/37 ==================================== 201 37-3N-23-2070-0002-0000 462.82 PEDERSEN ROBERT L JR 0.000AC 31688 COUNTY ROAD 121 HILLIARD FL 32046-9467 LOT 2 IN OR 769 PG 181 R278231 & R359312 MULBERRY LANDING 1 PB 4/37 ==================================== 202 37-3N-23-2070-0026-0000 387.18 STOKES MICHAEL T & JESSICA D 0.000AC 1019 MULBERRY LANDING ROAD HILLIARD FL 32046 LOT 26 IN OR 1187/1694 MULBERRY LANDING 1 PB 4/37 ==================================== 203 37-3N-23-2070-0030-0000 HX 331.15 TAYLOR NICHOLAS A 0.000AC 29620 NICK BAY LANE HILLIARD FL 32046 LOTS 30 & 31 1999 BELLA SW/MH IN OR 1852/1241 MULBERRY LANDING UNIT 1 PB 4/37 ==================================== 204 37-3N-23-2070-0053-0000 130.23 PARMLEY CHANCIE & 0.000AC HOLCOMBE JUSTIN 28104 JACKSON TRAIL HILLIARD FL 32046 LOT 53 & W 60 FT OF 54 IN OR 2083/1786 MULBERRY LANDING 1 PB 4/37 ==================================== 205 39-3N-23-1860-0006-0000 897.89 HOLLEY MARCUS & NICOLA 1.000AC 17671 HOLLEY OAKS LN HILLIARD FL 32046 LOT 6 IN OR 1800/1945 1999 FLEETWOOD DW/MH RIVERWOOD ESTATES PB 5/292 ==================================== 206 12-4N-23-0000-0001-0000 1,019.14 SWORD LOIS C 1.780AC 28180 LAKE HAMPTON ROAD HILLIARD FL 32046 TRACT A IN OR 831/949 EX 1-1 ==================================== 207 12-4N-23-0000-0002-0000 436.73 JPMORGAN CHASE BANK 3.090AC 7255 BAYMEADOWS WAY JACKSONVILLE FL 32256 PT GOVT LOT 1 SEC 12-4N-23E IN OR 1913/908 ==================================== 208 14-4N-23-0000-0005-0000 HX 482.62 WACTER STEVE E 6.260AC 28132 CHURCH DRIVE HILLIARD FL 32046 PT OF NE1/4 IN OR 588/708 & OR 588/710 (EX PAR 5-2) ==================================== 209 14-4N-23-0000-0006-0000 HX 300.96 WAITE RONALD W & 1.000AC ISBILL-WAITE JENNIFER L (H&W) 241965 CR 121 HILLIARD FL 32046-7419 IN OR 1476/491 ESMT IN OR 726/1105 ==================================== 210 14-4N-23-0000-0016-0060 1,835.99 MCINTOSH ELIZABETH ANN & 1.000AC PALMER CLYDE V (JT/RS) 241884 COUNTY ROAD 121 HILLIARD FL 32046 IN OR 1080/1794 LOTS H & I ==================================== 211 14-4N-23-0000-0016-0090 HX 228.21 GEIGER KENNETH WAYNE II 1.880AC 28110 YELLOW ROSE LANE HILLIARD FL 32046 PT OF N1/2 OF SE1/4 R787620 L/E IN OR 890/2021 ESMT PT OR 1861/825 ==================================== 212 14-4N-23-0190-0001-0000 HX 1,083.43 MUSGROVE MICHAEL 3.520AC 28154 ORLEANS ROAD HILLIARD FL 32046-2303 PT LOT 1 IN OR 682/161 (EX PT OR 735/1337 & OR 1327/805 & OR 1954/901) BOULOGNE COUNTRY SUB PBK 5/353 ==================================== 213 22-4N-23-0000-0002-0070 76.53 BLALOCK RICKY B 10.000AC 18359 JOHNSON ROAD HILLIARD FL 32046 NW1/4 OF NW1/4 OF NE1/4 IN OR 832/34 ==================================== 214 22-4N-23-0000-0003-0030 260.96 LISTER STEVEN E & 1.000AC FORT STELLA M 1100 SEAGATE AV # 139 NEPTUNE BEACH FL 32266 IN OR 1770/251 EX 3-14 & 3-17 ==================================== 215 22-4N-23-0000-0003-0080 HX 712.33 HARRIS JAMES E 3.900AC 28853 TRIGG RD HILLIARD FL 32046 OR 181 PG 153 R787322 & R787323 ==================================== 216 23-4N-23-0000-0006-0010 HX 122.79 SIMS MARY 1.000AC 28141 FAITH LANE HILLIARD FL 32046 IN OR 1426/1958 1974 CRES SW/MH ==================================== 217 23-4N-23-0000-0007-0060 HX 720.09 COOPER MEGEN 1.000AC 28325 CHARITY LN HILLIARD FL 32046 PT OF S1/2 OF SE1/4 OF NE1/4 IN OR 1892/1342 2007 CLSI DW/MH ESMT OR 1465/810 ==================================== 218 23-4N-23-0000-0013-0010 HX 376.47 YARBERRY REX ALLEN 1.000AC 241835 CR 121 HILLIARD FL 32046 IN NE 1/4 OF SE 1/4 OF NW1/4 IN OR 1624/1033 ==================================== 219 23-4N-23-0000-0013-0020 383.77 MORGAN PHILLIP BRUCE L/E 1.000AC 241836 COUNTY ROAD 121 HILLIARD FL 32046 NE1/4 OF SE1/4 OF NW1/4 IN OR 1969/1372 ==================================== 220 23-4N-23-0000-0013-0030 1,228.00 MADDOX TEISHA 1.000AC 28100 TRIGG RD HILLIARD FL 32046-7328 NE1/4 OF SE1/4 OF NW1/4 IN OR 2020/113 ==================================== 221 23-4N-23-2020-0020-0020 638.44 DEWITT DOUGLASS E EST & 4.630AC JAMES E & NANCY L BUTTON 748 LEE ROAD JACKSONVILLE FL 32225-7502 PT OF LOT 20 (EX S-3) IN OR 839/1526 CORNWALL SURVEY ==================================== 222 23-4N-23-2020-0021-0020 1,851.29 CROCKETT EARLAND M & SARAH J 5.930AC PO BOX 756 YULEE FL 32041 PT OF LOT 21 IN OR 834/1594 R787948 & R787949 CORNWALL SURVEY ==================================== 223 23-4N-23-2020-0023-0010 1,542.24 PHILLIPS GARY & MONICA 4.330AC 241811 CR 121 HILLIARD FL 32046 PT OF LOT 23 IN OR 2078/431 R673075 & R673076 & R673077 CORNWALL SURVEY ==================================== 224 23-4N-23-2020-0050-0010 HX 918.62 ROBLING BETTY JEAN L/E 2.000AC 281101 SUNDBERG ROAD HILLIARD FL 32046 PT OF LOT 50 IN OR 2078/1715 CORNWALL SURVEY PBK 0/31 ==================================== 225 24-4N-23-0000-0002-0000 911.26 ANDREU ALAN A 9.000AC 554041 US HWY 1 NORTH HILLIARD FL 32046 GOVT LOT 6 OF SEC 24-4N-23E IN OR 1491/706 (EX UTIL ESMT IN OR 1321/1969) ==================================== 226 25-4N-23-0000-0003-0040 HX 630.09 STONE CHERYL A 2.260AC 28063 POTOCHINK RD HILLIARD FL 32046 PT OF E1/2 OF SW1/4 OF SE1/4 IN OR 1398/1383 ==================================== 227 25-4N-23-2020-0016-0030 1,924.86 HADDOCK TIMBER INC 1.230AC 27359 GEIGER RD HILLIARD FL 32046 PT OF LOT 16 (S-3) IN OR 1914/1622 CORNWALL SURVEY ==================================== 228 25-4N-23-2020-0029-0000 300.50 STRICKLAND ASHLEY L DONN & 6.840AC STRICKLAND DANIEL J (H&W) 28456 AMBER JACK LN HILLIARD FL 32046 LOT 29 (EX S-1 & S-2 & S-3) IN OR 1851/228 ESMT IN OR 707/1476 & 1480 EX ESMT OR 707/1478 EX ESMT OR 709/163 CORNWALL SURVEY ==================================== 229 26-4N-23-0000-0001-0040 HX 272.64 DYAL JARRETT LEE 3.110AC 28805 SUNBURG RD HILLIARD FL 32046 IN OR 2090/1288 R278013 & R278014 EX 1-26 & 1-28 ==================================== 230 26-4N-23-0000-0001-0050 HX 387.57 BURKETT DALE E & JUDY ANN 3.240AC 28897 SUNDBERG ROAD HILLIARD FL 32046 IN OR 481/764 R378380 & R378381 ==================================== 231 26-4N-23-0000-0001-0150 HX 787.67 KING SANDY 4.800AC 241738 N CR 121 HILLIARD FL 32046 IN OR 1869/275 EX 1-22 ESMT OR 1094/995 2003 JACO DW/MH ==================================== 232 26-4N-23-0000-0001-0250 ,594.94 SIEMER BRUCE & CONSUELA 14.680AC PO BOX 387 HILLIARD FL 32046-0387 PT OR 829/1766 ESMT OR 1165/926 EX 1-27 ==================================== 233 26-4N-23-0000-0001-0340 HX 282.26 POPE JAMES MATTHEW & CHRISTINA 3.000AC 18110 GERANIUM LN HILLIARD FL 32046 IN OR 1923/621 (EX OR 1350/1332 PAR 1-22) 1982 ROYA DW/MH ==================================== 234 26-4N-23-0000-0001-0380 352.34 ROWE REGINA DAWN 1.000AC 241716 CR 121 HILLIARD FL 32046 IN OR 2051/1850 1989 FLEE SW/MH ==================================== 235 26-4N-23-0000-0001-0410 391.46 BARLANTI ROBERT A & KIMBERLY Z 2.500AC 434 KIRKLAND CT ORANGE PARK FL 32065 PT OF SE1/4 OF SW1/4 OF SEC 26-4N-23E IN OR 1882/538 ==================================== 236 27-4N-23-0000-0001-0030 374.37 NELSON LOCUS P & 6.970AC NELSON ALYSON R (JT/RS) 291209 PENNEY HADDOCK RD HILLIARD FL 32046 PT NE1/4 OF NE1/4 OF SEC 27-4N-23E IN OR 1654/692 (EX PT IN OR 1901/1542) ==================================== 237 27-4N-23-0000-0002-0010 HX 789.04 JOHNSON KELLY & BRITTANY 5.000AC 171057 HODGES ROAD HILLIARD FL 32046 PT OF NE1/4 & NW1/4 IN OR 1610/577 R673832 & R673833 ==================================== 238 27-4N-23-0000-0007-0010 767.15 LEE JOSEPH E & KAREN D 12.500AC 18214 JOSEPH LN HILLIARD FL 32046 PT OF NW1/4 OF SE1/4 OF SEC 27-4N-23E IN OR 1819/1979 (EX PT IN OR 1941/546 & OR 2030/1515) ==================================== 239 27-4N-23-0000-0007-0050 HX 190.51 LEE JOSEPH E & KAREN D 1.500AC 18214 JOSEPH LANE HILLIARD FL 32046 PT OF NW1/4 OF SE1/4 OF SEC 27-4N-23E IN OR 1212/1033 (EX PT IN OR 1941/546) {1985 FLEET DW/MH} ==================================== 240 27-4N-23-0000-0007-0100 547.75 21ST MORTGAGE CORPORATION 3.000AC 420 S ORANGE AVE SUITE 700 PO BOX 2346 ORLANDO FL 32801 PT OF NW1/4 OF SE1/4 OF SEC 27-4N-23E IN OR 2122/1820 ==================================== 241 27-4N-23-0000-0008-0050 519.25 JEANPIERRE FRANCENOR & VIOLENE 4.650AC 1713 S KIRKMAN RD APT 117 ORLANDO FL 32811-2376 PT E1/2 OF NW1/4 OF SW1/4 OF SEC 27-4N-23E IN OR 1428/1508 ==================================== 242 27-4N-23-0000-0009-0130 635.83 STEEDLEY PAUL ALLEN 4.610AC 27123 PAWNEE TRAIL HILLIARD FL 32046 PT OF W1/2 OF W1/2 OF SW1/4 IN OR 1958/1757 ==================================== 243 27-4N-23-0000-0011-0000 248.11 HINES MARVIN LEE 40.000AC 11118 PINE ESTATES RD W JACKSONVILLE FL 32218 NE1/4 OF SE1/4 IN OR 65 PG 39 ==================================== 244 28-4N-23-0000-0007-0010 3,498.17 SMITH BARRY D 70.000AC 18520 BROKEN ARROW RD HILLIARD FL 32046 SE1/4 OF SE1/4 E1/2 OF E1/2 OF NE1/4 OF SE1/4 S1/2 OF W1/2 OF NE1/4 OF SE1/4 IN OR 1868/983 ESMT OR 1538/1775 PARCELS 7-1 & 7-5 ==================================== 245 33-4N-23-0000-0006-0020 725.71 BROWN JOHN WAYNE EST 2.000AC C/O BARBARA LUCKEY 1964 THOMPKINS LANDING ROAD HILLIARD FL 32046 PT OF SE1/4 OF SW1/4 OF SEC 33-4N-23E IN OR 537/230 (EX PT IN OR 1077/1116) {R359956 & R359957} ==================================== 246 33-4N-23-2020-0044-0000 296.13 BELL RONALD LESTER 1.180AC 272832 CONNER NELSON RD HILLIARD FL 32046-7614 PT OF LOTS 44 45 46 47 53 LYING NORTH OF SR 121 IN OR 1137/928 EX 44-1 & EX S-2 OF LOTS 44-46 CORNWALL SURVEY ==================================== 247 33-4N-23-2020-0045-0020 HX 2,483.57 BELL RONALD LESTER 18.950AC 272832 CONNER NELSON ROAD HILLIARD FL 32046 PT OF LOTS 45 46 47 & 48 L/E OR 1137/930 EX S-3 OF LOTS 45-48 CORNWALL SURVEY ==================================== 248 33-4N-23-2020-0049-0010 503.53 JAMES TOMMY L & KRISTINA G 3.600AC 76397 LONGLEAF LOOP YULEE FL 32097 PT OF LOTS 49 50 51 52 & 53 SOUTH OF SR 121 PT OR 2102/234 BEING PARCEL 2 CORNWALL SURVEY PB 0/31 ==================================== 249 34-4N-23-0000-0001-0080 880.39 WHITTLE PATRICIA JEAN 2.520AC 29131 SAINT MARYS CIRCLE HILLIARD FL 32046-7043 PT OF W1/2 OF NE1/4 IN OR 1696/181 ==================================== 250 34-4N-23-0000-0001-0090 141.95 MCCULLOUGH DOUGLAS MARK 14.600AC 15561 CR 108 HILLIARD FL 32046 PT OF SEC 34-4N-23E PT OR 2066/395 BEING PARCEL A ==================================== 251 34-4N-23-0000-0002-0060 550.69 LOTT NICOLE 3.960AC 814 NW 65TH AVENUE PLANTATION FL 33317 PT OF W1/2 OF SW1/4 IN OR 1577/1779 ==================================== 252 34-4N-23-2020-0025-0010 HX 566.33 WHITTLE JEAN WILDES 5.500AC 241583 CR 121 HILLIARD FL 32046 LOT 25 LYING EAST OF 121 R/W IN OR 669 PG 735 R674017 & R674018 CORNWALL SURVEY ==================================== 253 35-4N-23-2020-0033-0070 HX 360.42 HENDERSON MARTY C 1.420AC 17801 ANDREWS ROAD HILLIARD FL 32046 PT OF LOT 33 (S-7) IN OR 1708/1094 1996 HARB DW/MH CORNWALL SURVEY ==================================== 254 36-4N-23-2020-0001-0000 1,014.35 HADDOCK RODNEY 10.000AC 27359 GEIGER RD HILLIARD FL 32046 LOT 1 IN OR 2026/1567 LOTS 2-4) EX R/W OR 665/971 CORNWALL SURVEY ==================================== 255 36-4N-23-2020-0002-0010 3,690.36 HADDOCK RODNEY D & BRANDI DALE 12.250AC 27359 GEIGER RD HILLIARD FL 32046-0216 PT LOT 2 & N1/2 OF LOT 3 IN OR 1960/909 CORNWALL SURVEY SUB SEC 36-4N-23E PBK O/31 ==================================== 256 36-4N-23-2020-0003-0020 700.00 HADDOCK BRANDI DALE 5.100AC 27359 GEIGER RD HILLIARD FL 32046 S1/2 OF LOT 3 IN OR 2031/307 CORNWALL SURVEY SUB SEC 36-4N-23E PBK O/31 ==================================== 257 41-4N-23-0000-0001-0050 4,135.02 BECK KAREN LYNN 10.000AC 23 SHARMAN STREET JACKSONVILLE FL 32254 IN OR 522 PG 561 ==================================== 258 41-4N-23-1210-0008-0000 HX 2,059.11 HUCKLEBY RHONDA L 93.520AC PO BOX 1424 HILLIARD FL 32046-1424 LOT 8 OR 648/340 SECS 19-4N-24 & 49-4N-24 R378434 & R378435 ESMT OR 1406/1441 LAKE HAMPTON EST PB 5/336-337 ==================================== 259 41-4N-23-2100-0003-0050 89.51 HADDOCK BRANDI DALE & 0.000AC GEIGER JOSEPH RAY 27359 GEIGER RD HILLIARD FL 32046 BLOCK 3 LOT 5 IN OR 1195/1402 & OR 2109/1502 EX RW IN OR 106/450 ST MARYS HIGHLANDS PB 5/12-13 ==================================== 260 41-4N-23-2100-0004-0070 1,848.46 WHITTLE PATRICIA JEAN 0.000AC 29131 ST MARYS CIRCLE HILLIARD FL 32046 BLOCK 4 LOT 7 IN OR 1573/365 ST MARYS HIGHLANDS PB 5/12-13 ==================================== 261 41-4N-23-2100-0004-0080 359.45 EQUITY TRUST COMPANY CUSTODIAN 0.000AC FBO BONNIE WADE CONNER IRA 770 A1A BEACH BLVD SAINT AUGUSTINE FL 32080 BLOCK 4 LOT 8 PT OR 2058/1223 ST MARYS HIGHLANDS PB 5/12 13 ==================================== 262 41-4N-23-2100-0005-0020 247.22 HARVILL LINDA 0.000AC PO BOX 782 HILLIARD FL 32046-0782 BLOCK 5 LOT 2 IN OR 1013/1865 ST MARYS HIGHLAND PB 5/12 & 13 ==================================== 263 47-4N-23-0000-0001-0040 429.88 THIGPEN LORITA J 2.700AC 2113 JERSEY STREET JACKSONVILLE FL 32210 IN OR 921/1215-1217 EX 1-8 & 1-9 ==================================== 264 49-4N-23-0000-0007-0010 HX 462.43 BOUCHARD JOSEPH E IV & 1.000AC MUSSELMAN DIANE F (M&S)(JT/RS) 2845 FOXGLOVE PLACE HILLIARD FL 32046 IN OR 1299/550 ==================================== 265 01-1N-24-0000-0001-0020 HX 1,576.99 TYNER ALBERT J & MARGARET S 5.000AC 44191 KINGBIRD DRIVE CALLAHAN FL 32011 IN OR 1269/1152 2002 FTWD DWMH 2007 HOME OF MERIT DW/MH ESMT OR 1457/1461 ==================================== 266 01-1N-24-0000-0002-0130 663.03 REAVES SHAWN C 1.010AC 44110 SANDY FORD RD CALLAHAN FL 32011 IN OR 1997/953 2000 KINGS DW/MH ==================================== 267 01-1N-24-0000-0003-0100 HX 605.59 DENMARK DARRELL A 1.000AC 44244 HIGGINBOTHAM DRIVE CALLAHAN FL 32011 IN OR 763/610 & OR 1799/522 ==================================== 268 01-1N-24-0000-0003-0230 301.49 DENMARK DARRELL A & GINA L 1.070AC 44244 HIGGINBOTHAM DRIVE CALLAHAN FL 32011 IN OR 730 PG 1339 ==================================== 269 01-1N-24-1370-0011-0000 HX 2,886.44 GREGG JOSHUA D & 0.000AC GREGG AMANDA G 34295 DAYBREAK DRIVE CALLAHAN FL 32011 LOT 11 IN OR 2141/450 MORNING DOVE ESTATES PB 6/193 ==================================== 270 01-1N-24-192S-0006-0000 HX 1,720.68 BURNS RAYMOND L & GINA E 0.000AC 34322 CALEB COURT CALLAHAN FL 32011 LOT 6 IN OR 874/1870 SANDY FORD ESTATES PB 6/147 ==================================== 271 02-1N-24-2180-1377-0000 778.26 MEADOWS CARSON D & BELVA L 4.000AC PO BOX 440083 JACKSONVILLE FL 32222-0001 LOT 1377 (EX S-1 & S-2) IN OR 666/1516 R567658 TOWN OF CRAWFORD 1973 DNMRK DWMH 1973 NATL SWMH ==================================== 272 11-1N-24-2180-0014-0000 326.42 STEWART WILLIAM 10.000AC PO BOX 1151 CALLAHAN FL 32011-1151 LOT 14 IN OR 1185/1387 ESMT PT OR 1849/175 TOWN OF CRAWFORD ==================================== 273 11-1N-24-2180-0016-0010 HX 391.55 HOLTON DAVID M & MARY F 1.370AC 447398 HWY 301 SOUTH CALLAHAN FL 32011 PT OF LOTS 16 & 17 IN OR 1433/889 GENA 2004 DW/MH EX R/W OR 1140/791 TOWN OF CRAWFORD ==================================== 274 11-1N-24-2180-0040-0040 567.03 MCSWAIN JON DAMIEN & 0.440AC MCSWAIN STEVEN DARELL (JT/RS) 33681 WOOD LN CALLAHAN FL 32011 PT OF LOT 40 IN OR 1836/1332 TOWN OF CRAWFORD ==================================== 275 11-1N-24-2180-0040-0050 794.92 PRESCOTT ARNOLD L EST 0.610AC 33685 WOODS LN CALLAHAN FL 32011 PT OF LOT 40 IN OR 655/805 TOWN OF CRAWFORD ==================================== 276 11-1N-24-2180-0053-0030 66.35 ZAKRZEWSKI RANDY J & SUSAN G 0.150AC 24966 CRAWFORD ROAD CALLAHAN FL 32011 PT OF LOT 53 (S-3) PT OR 1487/1571 TOWN OF CRAWFORD ==================================== 277 11-1N-24-2180-0056-0010 1,136.10 MILLER TRACY DENIEL EST 1.250AC 24890 CRAWFORD ROAD CALLAHAN FL 32011 PT OF LOT 56 1999 SW/MH BELL IN OR 995/1584 TOWN OF CRAWFORD ==================================== 278 14-1N-24-2180-0089-0000 39.17 PICKETT CHARLES A EST 0.932AC 542586 US HWY 1 CALLAHAN FL 32011 LOTS 89,90,91,92,93,94,95 & 96 (EX UTIL ESMT IN OR 1092/951) TOWN OF CRAWFORD S/D IN SEC 14-1N-24E ==================================== 279 14-1N-24-2180-0106-0000 471.77 PICKETT CHARLES A EST 0.677AC 542586 US HWY 1 CALLAHAN FL 32011 LOTS 104,105,106,107,108,109, 110 & 111 (EX PT IN DOT R/W IN OR 1111/219) TOWN OF CRAWFORD S/D IN SEC 14-1N-24E {R498331 & R498332} ==================================== 280 14-1N-24-2180-0517-0000 59.47 ZINN RICHARD L 0.120AC 3707 SAGE WAY OCEANSIDE CA 92057-8323 LOT 517 & E1/2 OF ABAND ST IN RES 2015-13 BEING PAR #1 LYING E THEREOF TOWN OF CRAWFORD S/D IN SEC 14-1N-24E OR 192/440 ==================================== 281 14-1N-24-2180-0539-0000 58.57 ZINN RICHARD L 0.116AC 3707 SAGE WAY OCEANSIDE CA 92057-8323 LOT 539 TOWN OF CRAWFORD S/D IN SEC 14-1N-24E OR 192/440 ==================================== 282 14-1N-24-2180-0699-0000 37.62 HOBBS KATHRYN M 0.070AC 7050 SUNSET DR SOUTH #403 SOUTH PASADENA FL 33707-2872 LOT 699 IN OR 507/265 TOWN OF CRAWFORD S/D IN SEC 14-1N-24E ==================================== 283 14-1N-24-2180-0749-0000 40.82 KUNTZ WALTER F & KENNETH J 0.110AC C/O ANNA J FEARICK 6916 PAR WAY FT MYERS FL 33919 LOT 749 TOWN OF CRAWFORD SUB ==================================== 284 14-1N-24-2180-0761-0000 40.82 SHIRK G M MRS EST OF 0.110AC C/O LORRAINE B PICKETT 34172 PICKETT FAMILY COURT CALLAHAN FL 32011 LOT 761 TOWN OF CRAWFORD SUB ==================================== 285 14-1N-24-2180-1046-0000 71.89 SNYDER DONALD 0.232AC 1430 FARNHAM RD TROY OH 45373 LOTS 1046 & 1047 TOWN OF CRAWFORD S/D IN SEC 14-1N-24E ==================================== 286 14-1N-24-2180-1049-0000 58.57 SNYDER DONALD 0.116AC 1430 FARNHAM RD TROY OH 45373 LOT 1049 TOWN OF CRAWFORD S/D IN SEC 14-1N-24E ==================================== 287 14-1N-24-2180-1184-0000 2,077.56 LINDSEY JAMES & 10.000AC LINDSEY CHARLEE PO BOX 2291 CALLAHAN FL 32011 LOT 1184 IN OR 2060/14 TOWN OF CRAWFORD SUB ==================================== 288 14-1N-24-2180-1190-0000 1,499.22 LINDSEY CHARLES R 10.000AC 8881 ROSEHILL DR S JACKSONVILLE FL 32221 LOT 1190 IN OR 1837/1948 TOWN OF CRAWFORD SUB ==================================== 289 14-1N-24-2180-1191-0010 2,781.02 CHURCH KIM 4.570AC 33350 CRIPPLE HORSE TRAIL CALLAHAN FL 32011 PT LOT 1191 IN OR 2020/1630 TOWN OF CRAWFORD SUB ==================================== 290 14-1N-24-2180-1191-0020 93.39 CHURCH JOSEPH R & KIM 0.250AC 36100 SAGEBRUSH LANE CALLAHAN FL 32011-8758 PT LOT 1191 IN OR 1456/681 (EX OR 2020/1630 &OR 2141/996) ESMT OR 1521/289 TOWN OF CRAWFORD SUB ==================================== 291 15-1N-24-2180-1229-0020 673.07 WELCH LESLEY JUNIOR EST 4.700AC 34477 WELCH ROAD CALLAHAN FL 32011 S1/2 LOT 1229 PT OR 890/1197 TOWN OF CRAWFORD SEC 15-1N-24E ==================================== 292 15-1N-24-2180-1235-0020 HX 527.66 HIGGINBOTHAM CHARLES 2.500AC 33414 WOODS LANE CALLAHAN FL 32011 PT OF LOT 1235 IN OR 1165/1600 & S1/2 OF ABND R/W LYING N THEREOF IN BY RES 1989-50 TOWN OF CRAWFORD S/D IN SEC 15-1N-24E ==================================== 293 16-1N-24-2090-0001-0000 899.92 HARRISON THOMAS J & CARRIE A 8.900AC PO BOX 50 CALLAHAN FL 32011 LOT 1 IN OR 1889/1627 TUPELO PLANTATION PB 7/206 ==================================== 294 16-1N-24-2090-0010-0000 783.52 DEMPSEY ROBERT T 10.200AC 4446 HENDRICKS AVE #227 JACKSONVILLE FL 32207 LOT 10 IN OR 1427/1666 TUPELO PLANTATION PB 7/206 ==================================== 295 16-1N-24-2090-0013-0000 730.46 CONGER GARY DANIEL & 10.300AC CONGER TIFFANY MICHELE M (H&W) 27258 W 1ST AVENUE HILLIARD FL 32046 LOT 13 IN OR 2092/915 TUPELO PLANTATION PB 7/206 ==================================== 296 16-1N-24-2090-0020-0000 783.52 BAHRI NABIL & SOHA 11.500AC 7433 TRAILS END JACKSONVILLE FL 32277 LOT 20 IN OR 1891/1933 TUPELO PLANTATION PB 7/206 ==================================== 297 16-1N-24-2090-0038-0000 671.52 BLAISE JORDYNE & 13.200AC BLAISE DUMARSAIS (JT/RS) 12350 NW 2ND ST PLANTATION FL 33325 LOT 38 IN OR 1907/14 TUPELO PLANTATION PB 7/206 ==================================== 298 16-1N-24-2090-0071-0000 774.67 MCKENZIE JAY 9.900AC 12583 SHALLOW BROOKE CIRCLE JACKSONVILLE FL 32225 LOT 71 IN OR 2144/244 TUPELO PLANTATION PB 7/206 ==================================== 299 17-1N-24-2091-0003-0000 377.56 WOODARD CATHERINE P & BOBBY W 6.200AC 10070 CHESTERTON RD JACKSONVILLE FL 32246 LOT 3 IN OR 1899/500 TUPELO PLANTATION WEST PB 8/17 ==================================== 300 17-1N-24-2091-0005-0000 573.38 RAMIREZ KAREN 4.340AC 6500 NW 114 AVE APT 1038 MIAMI FL 33178 LOT 5 IN OR 1899/1391 TUPELO PLANTATION WEST PB 8/17 ==================================== 301 17-1N-24-2091-0025-0000 556.59 GRAY DANIEL J & AMANDA K 3.560AC 3866 WALSH ST JACKSONVILLE FL 32205 LOT 25 IN OR 1908/34 TUPELO PLANTATION WEST PB 8/17 ==================================== 302 20-1N-24-0000-0002-0050 1,263.01 KELLY JOHN PAUL 5.000AC PO BOX 1201 CALLAHAN FL 32011 IN OR 2079/768 2005 CHNC DW/MH ==================================== 303 20-1N-24-0000-0002-0090 1,107.28 CONLEY DARRELL JR & CRYSTAL 5.000AC 3458 BARBARA LN HILLIARD FL 32046 IN OR 1140/1850 ==================================== 304 23-1N-24-2180-1270-0010 HX 872.29 LIGHTSEY LARRY L 2.500AC 33480 RATTLESNAKE TRAIL CALLAHAN FL 32011 N1/2 OF N1/2 OF LOT 1270 IN OR 309 PG 581 2008 JACB DW/MH ESMT OR 1893/1852 TOWN OF CRAWFORD ==================================== rf rfntb DEL. TAX LIST 2017.indd 2 4/30/18 12:20 PM

PAGE 63

305 23-1N-24-2180-1273-0000 1,014.35 NELSON BRIAN EDWARD 10.000AC 2787 HIDDEN VILLAGE DRIVE JACKSONVILLE FL 32216 LOT 1273 IN OR 1493/1971 ESMT PT OR 1541/1242 TOWN OF CRAWFORD ==================================== 306 23-1N-24-2180-1287-0000 HX 1,001.98 GRIFFIS LAURA MARIE 5.080AC 33136 RATTLESNAKE TRAIL CALLAHAN FL 32011 LOT 1287 (EX S-1 & S-2) IN OR 1765/1255 1999 MERIT DW/MH TOWN OF CRAWFORD SUB ==================================== 307 23-1N-24-2180-1296-0050 259.59 TRUGLIO JOSEPH ANTHONY 1.620AC 55211 SPENCERVILLE ROAD CALLAHAN FL 32011 PT OF LOT 1296 IN OR 2119/884 TOWN OF CRAWFORD S/D IN SEC 23-1N-24E ==================================== 308 23-1N-24-2180-1299-0030 1,468.60 HENDRICKS DANIEL R 1.500AC 33585 MEADOWS LN CALLAHAN FL 32011 PT OF LOT 1299 (S-3) IN OR 2121/767 TOWN OF CRAWFORD 2004 DW/MH DESTINY ==================================== 309 23-1N-24-2180-1299-0050 687.20 HENDRICKS DANIEL R 1.100AC 44500 CATIES WAY CALLAHAN FL 32011 PT OF LOT 1299 (S-5) IN OR 2079/380 1986 DW/MH CHAD TOWN OF CRAWFORD ==================================== 310 23-1N-24-2180-1300-0050 371.26 STRICKLAND RICHARD G 1.290AC 20 MANOUS CIRCLE HINESVILLE GA 31313 OF LOT 1300 & S-2 OF LOT 1301 IN OR 1898/1680 R359628 & R433519 & R787922 TOWN OF CRAWFORD ==================================== 311 23-1N-24-2180-1300-0060 485.58 TRUGLIO JOSEPH 1.860AC 55211 SPENCERVILLE ROAD CALLAHAN FL 32011 PT OF LOT 1300 (S-6) PT OR 2119/880 TOWN OF CRAWFORD SUB ==================================== 312 23-1N-24-2180-1300-0070 406.69 TRUGLIO JOSEPH 1.860AC 55211 SPENCERVILLE ROAD CALLAHAN FL 32011 PT OF LOT 1300 (S-7) PT OR 2119/880 TOWN OF CRAWFORD SUB ==================================== 313 23-1N-24-2180-1307-0000 1,032.04 TRUGLIO JOSEPH ANTHONY 10.180AC 55211 SPENCERVILLE ROAD CALLAHAN FL 32011 LOT 1307 & E1/2 OF ABND R/W LYING W THEREOF BY RES 1987-48 TOWN OF CRAWFORD S/D IN SEC 23-1N-24E ==================================== 314 24-1N-24-0150-0001-0000 HX 334.61 NIGHTINGALE THATCHER C 18.160AC 43235 BLAIR CT CALLAHAN FL 32011 LOTS 1 (EX S-1) & 13 IN OR 1830/773 ESMT OR 1717/1499 1996 CLAY SW/MH BROOK BLAIR EST PB 5/390 ==================================== 315 24-1N-24-0150-0007-0000 HX 85.43 CLAXTON RODNEY B SR & SCARLETT 1.490AC 43436 THOMAS CREEK RD CALLAHAN FL 32011-7338 LOT 7 1987 HART DW/MH IN OR 1731/1644 BROOK BLAIR EST PB 5/390 ==================================== 316 24-1N-24-0150-0008-0000 HX 316.25 SPENCER ZACHARY W & CANDICE J 1.270AC 43428 THOMAS CREEK RD CALLAHAN FL 32011 LOT 8 2000/FTWD/SW/MH IN OR 1986/1942 BROOK BLAIR EST PB 5/390 ==================================== 317 24-1N-24-0150-0012-0000 759.47 TINDOL BOBBY C 1.440AC 3067 WEST 19TH STREET JACKSONVILLE FL 32254 LOT 12 IN OR 1329/1383 BROOK BLAIR EST PB 5/390 ==================================== 318 24-1N-24-0750-0001-0091 HX 587.21 RODRIGUEZ MELISSA L 3.000AC 43338 THOMAS CREEK RD CALLAHAN FL 32011 BLOCK 1 PT OF LOT 9 (S-1) IN OR 1947/841 1997 MERI DW HILLS @ THOMAS CREEK 5/65 ==================================== 319 24-1N-24-0750-0002-0013 701.08 EBY PETER JOHN & 3.690AC JOHNSON ELIZABETH E 431042 KEEN CEMETERY RD CALLAHAN FL 32011 BLOCK 2 PT OF LOT 1 IN OR 1828/1415 HILLS AT THOMAS CREEK PB 5/65 ==================================== 320 24-1N-24-0750-0003-0080 HX 2,717.71 JARVIS KENNETH & ANNETTE 20.000AC 43257 CLAXTON CIRCLE CALLAHAN FL 32011 BLOCK 3 LOT 8 (EX S-1) R583689 IN OR 1912/504 SEC 24-1N-24 ESMT RELEASE OR 507/920 EX ESMT OR 549/715 HILLS AT THOMAS CREEK PB 5/65 ==================================== 321 24-1N-24-0750-0003-0124 560.02 TANNER JUSTIN E & 1.650AC MISINEC ERIN N 44108 OAKWOOD LN CALLAHAN FL 32011 BLK 3 PT OF LOT 12 IN OR 2065/237 HILLS AT THOMAS CREEK PBK 5/65 ==================================== 322 24-1N-24-0750-0003-0282 HX 752.52 LAND THOMAS F JR 2.000AC 43013 LARSEN ROAD CALLAHAN FL 32011 BLOCK 3 PT OF LOT 28 R787732 IN OR 1924/1670 SEC 30-1N-25 HILLS AT THOMAS CREEK PB 5/65 2004 MIRA H180068G(LR) ==================================== 323 24-1N-24-0750-0003-0285 693.56 SHELBY ASHLEY R 1.750AC 43212 THOMAS CREEK RD CALLAHAN FL 32011 BLK 3 PT OF LOT 28 IN OR 1770/292 HILLS OF THOMAS CREEK PBK 5/65 {R583688} ==================================== 324 24-1N-24-0750-0004-0072 HX 1,322.92 MORRIS DENNIS E & MARY M 3.260AC PO BOX 1540 CALLAHAN FL 32011-1540 BLOCK 4 PT OF LOT 7 (S-2) OR 491/1305 SEC 19-1N-25 HILLS AT THOMAS CREEK PB 5/65 ==================================== 325 24-1N-24-0750-0004-0090 HX 1,790.49 WILKES SHEILA D L/E 11.560AC CHRISTINE HUMPHRIES 43002 KIDS COACH LANE CALLAHAN FL 32011 BLOCK 4 LOT 9 (19-1N-25) IN OR 1657/813 R672202 & R672203 HILLS AT THOMAS CREEK PB 5/65 ==================================== 326 24-1N-24-0750-0004-0101 1,143.06 WILKES SHEILA D & 10.810AC HUMPHRIES CHRISTINE 43002 KIDS COACH LANE CALLAHAN FL 32011 BLOCK 4 S-1 & S-2 OF LOT 10 PT OR 1677/632 SEC 19-1N-25 HILLS AT THOMAS CREEK PB 5/65 ==================================== 327 24-1N-24-0750-0004-0152 627.91 BUDZEAK ALAN 1.000AC 10644 MEADOWLEA DR JACKSONVILLE FL 32218 BLOCK 4 PT OF LOT 15 (S-2) IN OR 1816/1684 R433738 & R433739 HILLS AT THOMAS CREEK PB 5/65 ==================================== 328 24-1N-24-0750-0004-0153 HX 102.09 PATTERSON RAMANDA D 1.010AC 43351 LARSEN ROAD CALLAHAN FL 32011 BLOCK 4 PT OF LOT 15 (S-3) IN OR 1559/1546 1986 PEAC SW/MH EX S-4 & S-5 HILLS AT THOMAS CREEK PB 5/65 ==================================== 329 24-1N-24-0750-0004-0161 314.65 WILKES SHEILA D 2.880AC 43002 KIDS COACH LANE CALLAHAN FL 32011 BLK 4 E1/2 LOT 16 IN OR 1677/641 BEING ONLY PARAGRAPH 2 (EX PT IN OR 1727/22 & OR 1910/1975 & OR 1925/330) HILLS AT THOMAS CREEK SUB PBK 5/65 ==================================== 330 24-1N-24-0750-0004-0170 1,473.77 MERCHANT JOHN R & 4.800AC HOUSEHOLDER KATHARINE M 43075 CHEROKEE TRAIL CALLAHAN FL 32011 BLOCK 4 LOT 17 SKYO 1999 TW IN OR 2055/1586 PT IN SECS 19-1N-25 & 30-1N-25 EX S-1 & S-2 HILLS AT THOMAS CREEK PB 5/65 ==================================== 331 24-1N-24-0750-0004-0172 HX 199.30 WRIGHT MITCHELL & DANA 1.000AC 43023 CHEROKEE TRAIL CALLAHAN FL 32011-7908 BLOCK 4 PT OF LOT 17 (S-2) IN OR 1704/1342 2001 OAK DW/MH HILLS AT THOMAS CREEK PB 5/65 ==================================== 332 25-1N-24-0080-0001-0000 HX 564.75 ARENBURGH WILLIAM PAUL 8.780AC 43201 ELLIS AVE CALLAHAN FL 32011 LOT 1 IN OR 799/1104 R673250 & R673251 & R673252 ESMT OR 1048/1616 ARENBURGH ACRES PB 5/384 ==================================== 333 25-1N-24-0080-0004-0000 71.30 ARENBURGH SUSAN 10.000AC 8622 HARE AVE JACKSONVILLE FL 32211 LOT 4 IN OR 772 PG 1826 F/K/A 24-1N-24-0750-0003-0113 ARENBURGH ACRES PB 5/384 ==================================== 334 28-1N-24-0000-0001-0020 343.08 SURRENCY DONALD H JR 4.750AC 13871 US HWY 301 BRYCEVILLE FL 32009 PT NW1/4 OF SE1/4 OF FRACL SEC 28-1N-24E IN OR 1593/481 (EX R/W IN OR 1120/520 & LTD ACCESS RGTS IN OR 1308/122 & EX PT IN OR 1916-991) ==================================== 335 28-1N-24-0000-0001-0210 540.86 ROWLAND WENDELL D 2.590AC 8236 BROOKS RD BRYCEVILLE FL 32009 PT OF NE1/4 OF SW1/4 OF SEC 28-1N-24E IN OR 1958/1881 & OR 2008/685 ==================================== 336 28-1N-24-0000-0002-0000 2,224.23 SURRENCY DONALD H JR 7.130AC 13871 US HWY 301 BRYCEVILLE FL 32009 IN OR 1441/1391 EX ESMT PT OR 881/302 EX R/W OR 1120/516 ESMT OR 1308/125 EX 2-1 ==================================== 337 33-1N-24-0000-0001-0140 1,684.13 BUSTION GERALD W & CYNTHIA A 3.600AC 7901 PODER PLACE BRYCEVILLE FL 32009 PT OR 690/827 R/W OR 953/1105 ESMT OR 986/874 1995 PALM TW/MH 1992 SKYL DW/MH ==================================== 338 33-1N-24-2050-0007-0000 381.18 SMITH JULIE A 1.000AC 701 SPANISH MAIN DR # 234 CUDJOE KEY FL 33042 LOT 7 IN OR 1022/933 EX R/W OR 1051/542 THE PINES UNIT 1 PB 5/78 & 79 ==================================== 339 33-1N-24-2050-0008-0000 1,095.04 WHITE LORETTA K 1.000AC 13200 US HWY 301 BRYCEVILLE FL 32009 LOT 8 IN OR 1555/232 EX R/W OR 986/1980 2009 HOMI DW/MH THE PINES #1 PB 5/78 & 79 ==================================== 340 33-1N-24-2050-0011-0000 394.96 ERVIN-HURD PATRICIA F 1.000AC 13086 US HWY 301 BRYCEVILLE FL 32009 LOT 11 R107667 IN OR 705 PG 1205 EX R/W OR 997/857 THE PINES #1 PB 5/78 & 79 ==================================== 341 33-1N-24-2050-0014-0000 464.11 BUSTION GERALD W & CYNTHIA A 1.000AC 7901 PODER PLACE BRYCEVILLE FL 32009 LOT 14 PT OR 690/827 1994 BELL SW/MH ESMT OR 691/1011 EX R/W OR 953/1106 EX R/W 1027/1726 FEE SIMPLE LIMITED ACCESS RIGHTS ONLY THE PINES UNIT 1 PB 5/78 & 79 ==================================== 342 33-1N-24-2050-0017-0000 1,344.52 MOODY WANELL 1.000AC 586 DEENS LANDING RD BAXLEY GA 31513 LOT 17 IN OR 2058/1428 EX R/W OR 1004/784 THE PINES #1 PB 5/78 & 79 ==================================== 343 33-1N-24-2050-0020-0000 382.08 THOMAS ADRAIN R 1.000AC 12808 US HWY 301 BRYCEVILLE FL 32009 LOT 20 R360131 IN OR 802 PG 764 EX R/W OR 997/1799 THE PINES UNIT 1 PB 5/78 & 79 ==================================== 344 33-1N-24-2051-0005-0000 295.32 TOM FORD BUILDERS LLC 1.150AC 2120 CORPORATE SQUARE BLVD JACKSONVILLE FL 32216 LOT 5 PT OR 1462/1041 EX R/W CASE #03-319-CA THE PINES #2 PB 5/128-129 ==================================== 345 33-1N-24-2051-000A-0000 279.29 TOM FORD BUILDERS LLC 1.080AC 2120 CORPORATE SQUARE BLVD JACKSONVILLE FL 32216 TRACT A PT OR 1462/1041 EX R/W CASE #03-319-CA THE PINES #2 PB 5/128-129 ==================================== 346 33-1N-24-2052-0006-0000 427.60 WYATT LUKEVA F EST & 1.140AC GEORGE HAZEL J 13397 US HIGHWAY 301 BRYCEVILLE FL 32009-1248 LOT 6 IN OR 1298/580 EX R/W PT OR 963/751 R672759 & R672760 ESMT OR 1442/1665 THE PINES #3 PB 5/331-332 ==================================== 347 33-1N-24-2052-0025-0000 293.02 TOM FORD BUILDERS LLC 1.140AC 2120 CORPORATE SQUARE BLVD JACKSONVILLE FL 32216 LOT 25 PT OR 1462/1041 THE PINES #3 PB 5/331-332 ==================================== 348 33-1N-24-2052-0026-0000 277.00 TOM FORD BUILDERS LLC 1.070AC 2120 CORPORATE SQUARE BLVD JACKSONVILLE FL 32216 LOT 26 IN OR 1639/645 EX R/W CASE #03-319-CA THE PINES #3 PB 5/331-332 ==================================== 349 33-1N-24-2052-0027-0000 277.00 TOM FORD BUILDERS LLC 1.070AC 2120 CORPORATE SQUARE BLVD JACKSONVILLE FL 32216 LOT 27 PT OR 1462/1041 EX R/W CASE #03-319-CA THE PINES #3 PB 5/331-332 ==================================== 350 33-1N-24-2052-0028-0000 HX 580.49 MANNING WILLIAM A & ALLISON J 2.280AC 12909 HWY 301 NORTH BRYCEVILLE FL 32009 LOTS 28 & 29 IN OR 837/1739 R788169 & R788170 EX R/W PT OR 993/1127 THE PINES #3 PB 5/331-332 ==================================== 351 37-1N-24-2220-0002-0070 HX 594.13 GARNER DAVID M 4.750AC 445073 US HWY 301 CALLAHAN FL 32011 PT OF LOT 2 (S-7 & S-8) IN OR 1902/1887 2001 MERT DW/MH ESMT IN OR 884/1015 EX R/W OR 1005/1213 ESMT OR 1327/1539 J H WHITTEMORE HEIRS SUB PB 39/311 ==================================== 352 37-1N-24-2220-0002-00M0 38.36 FLORIDA TITLE COMPANY 0.000AC 6545 CORPORATE CENTER BLVD ORLANDO FL 32822 LOTS 2 & 4 1/8 INT 310 ACRES MINERAL RIGHTS ONLY IN OR 1406/1750 J H WHITTEMORE HEIRS SUB PB 39/311 ==================================== 353 37-1N-24-2220-0002-0110 HX 1,334.72 PIKE CALVIN R & NAOMI 2.640AC 14165 ROLLO DRIVE BRYCEVILLE FL 32009 PT OF LOT 2 (S-11) IN OR 1285/647 J H WHITTEMORE HEIRS SUB DB 39/310 ==================================== 354 02-1S-24-0000-0001-0120 1,226.66 KREDELL SAMUEL 10.120AC 1122 WOODRUFF AVE #1 JACKSONVILLE FL 32205 IN OR 1472/701 1979 SATI DW/MH ==================================== 355 02-1S-24-0000-0002-0050 HX 999.48 GANDY JAMES N JR ETAL 7.620AC HARTJE NAOMI R (JTROS) 11385 GOLDEN EAGLE PLACE BRYCEVILLE FL 32009 PT SW1/4 OF SW1/4 OF SEC 2-1S-24E & PT SE1/4 OF SE1/4 OF SEC 3-1S-24E IN OR 1497/1044 & OR 1513/1049) ==================================== 356 02-1S-24-1990-0017-0000 HX 451.84 CARTER ARTHUR M & DONNA LYNN 2.540AC 11773 SUNOWA SPRINGS TRAIL BRYCEVILLE FL 32009 LOT 17 IN OR 473 PG 399 SUNOWA SPRINGS #1 PB 4/75 & 76 ==================================== 357 03-1S-24-0000-0002-0100 HX 718.84 CANTRELL WILLIAM & TERESA 0.650AC 11331 WATERLOO PL BRYCEVILLE FL 32009 PT OF SE1/4 OF SE1/4 OF SEC 3-1S-24E IN OR 1991/1973 ==================================== 358 04-1S-24-0000-0007-0010 HX 3,095.13 PARKER MARIAN S EST 17.730AC 8278 FORD RD BRYCEVILLE FL 32009 IN OR 259 PG 26 EX 7-4 & 7-5 & 7-6 & 7-7 & 7-8 ==================================== 359 04-1S-24-0000-0007-0060 1,278.11 FRITTON ARTHUR J EST 1.000AC C/O MARK FRITTON PO BOX 586 CALLAHAN FL 32011-0586 IN OR 304 PG 127 ==================================== 360 05-1S-24-0000-0003-00M0 42.62 MANN SEAN D ET AL 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 {MINERAL RIGHTS ONLY ASMT} {194.7 ACRES} N1/2 OF SW1/4 OF SE1/4 & S1/2 OF NW1/4 OF SE1/4 & PT OF N1/2 OF NE1/4 & PT OF E1/2 OF SEC 5-1S-24E IN OR 1990/1090 ==================================== 361 05-1S-24-0000-0004-0180 563.27 TRNKA KRISTINA BROWN 2.000AC 12033 HWY 301 BRYCEVILLE FL 32009 IN OR 1868/597 EX R/W IN OR 958/627 EX 4-23 ==================================== 362 05-1S-24-0000-0004-0190 1,180.98 GRIFFIN VICKY & 3.910AC ROBERT KELLY (JT/RS) 11935 US HWY 301 BRYCEVILLE FL 32009 IN OR 2083/873 EX R/W OR 948/527 ==================================== 363 05-1S-24-0000-0014-0010 HX 1,233.89 FORD THOMAS R 7.880AC 7790 FORD ROAD BRYCEVILLE FL 32009 PT OF SE1/4 OF SE1/4 IN OR 350 PG 612 (EX R/W IN OR 1635/81) ESMT OR 1635/84 ==================================== 364 08-1S-24-1610-0008-0000 HX 2,302.78 GREEN RONALD L SR & LYNN W 4.850AC 11143 US HWY 301 BRYCEVILLE FL 32009 LOT 8 IN OR 818/995 EX R/W OR 993/1140 ESMT OR 1024/59 PARKWOOD PB 6/77 ==================================== 365 19-1S-24-0000-0001-0160 1,214.02 RIVER CITY HOLDINGS LLC 1.000AC 9378 ARLINGTON EXPWY #311 JACKSONVILLE FL 32225 IN OR 2104/8 EX ESMT OR 909/78 EX 1-17 2000 PION DW/MH ==================================== 366 19-1S-24-0000-0004-0170 1,134.69 WHITTEMORE MANCIL 2.600AC 6593 CR 119 BRYCEVILLE FL 32009-1821 OR 1917/1730 EX 4-23 EX ESMT OR 568/569 EX ESMT IN OR 795/745 ==================================== 367 29-1S-24-0000-0003-0130 841.29 WILLIAMS TERRI E ETAL 1.500AC 8020 ANDREA PLACE BRYCEVILLE FL 32009 W135 FT OF E1485 FT OF N485.17 FT OF N1/2 OF NW1/4 OF SEC 29 & W135 FT OF E1485 FT OF SW1/4 OF SEC 20 (LYING SOUTH OF RD) IN OR 694/1807 (EX ESMT IN OR 713/1992) ==================================== 368 30-1S-24-0000-0018-0050 488.42 CARR RONALD LEWIS JR 1.000AC 2112 LA VALLE DR JACKSONVILLE FL 32009 PT OF N1/4 OF SEC 30-1S-24E IN OR 2083/1296 ESMT OR 1934/1543 {R621748} ==================================== 369 30-1S-24-2120-0020-0000 HX 2,500.25 ABERNATHY MIA L & PAUL E 1.060AC 7699 HWY 301 BRYCEVILLE FL 32009 LOTS 20 21 36 & 37 IN OR 1967/75 PINE VIEW SUB PB 3/64 ==================================== 370 30-1S-24-2120-0022-0000 517.69 ABERNATHY MIA L & PAUL E 1.056AC 7699 HWY 301 BRYCEVILLE FL 32009 LOTS 22 23 34 35 IN OR 1967/75 ESMT IN OR 303/340 PINE VIEW SUB PB 3/64 ==================================== 371 02-2N-24-0000-0001-0070 1,046.35 RAY RICHARD C & DARA L 5.000AC 85294 TRINITY CIR YULEE FL 32097 PT OF E1/2 OF NW1/4 IN OR 2046/436 1995 HORTON SW/MH ==================================== 372 02-2N-24-0000-0003-0040 494.16 SAWYER MICHAEL J 1.000AC 36070 DYAL RD CALLAHAN FL 32011 PT OF SW1/4 R672153 IN OR 1765/1338 EX R/W IN OR 723/698 ==================================== 373 02-2N-24-0000-0003-0090 1,100.03 GRIFFIN CAROLYN A & 3.370AC GEIGER LINDA S (JT/RS) 452322 OLD DIXIE HWY CALLAHAN FL 32011-3658 IN OR 1655/826 ==================================== 374 02-2N-24-0000-0003-0100 HX 1,429.75 BRANDT STEPHEN & 2.500AC GARRETT PATRICIA (JT/RS) 36160 FAIRVIEW LN CALLAHAN FL 32011 PT SEC 2-2N-24E IN OR 1994/1837 (EX OR 1987/1322) ==================================== 375 02-2N-24-0000-0004-0060 437.80 SHAFFER JIMMY R 0.000AC 452438 OLD DIXIE AVE CALLAHAN FL 32011 PT OR 843/29 1991 FLWD SW/MH ==================================== 376 03-2N-24-0000-0001-00M0 37.46 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 NW1/4 OF NE1/4 SW1/4 OF NE 1/4 W1/2 OF NE1/4 OF NE1/4 1/3 INT 100 ACRE PARCELS 1 2 2-1 2-2 & 2-3 PT OR 1313/689 MINERAL RIGHTS ONLY ==================================== 377 03-2N-24-0000-0003-0000 HX 1,203.12 PALMER CLYDE V 2.960AC 452435 OLD DIXIE HIGHWAY CALLAHAN FL 32011 SE1/4 OF NE1/4 W OF PUBLIC ROAD IN OR 59/160 & OR 1742/682 EX R/W IN OR 236/679 ==================================== 378 11-2N-24-0000-0004-0000 HX 446.31 JOHNSON MARVIN EDWIN & TONIA R 2.050AC 35502 GLORY ROAD CALLAHAN FL 32011 PT OF E1/2 OF SE1/4 OF SE1/4 IN OR 593/450 R788005 & 788006 ==================================== 379 11-2N-24-1641-0002-0000 HX 361.22 GODWIN NADINE TAYLOR 1.000AC 35121 PERRET PLANTATION ROAD CALLAHAN FL 32011 LOT 2 2001 SKYLINE DW/MH IN OR 984/1778 PERRET PLANTATION #2 PB 6/201 ==================================== 380 11-2N-24-1641-0003-0000 HX 205.00 STONE SHARON 1.000AC 35167 PERRET PLANTATION ROAD CALLAHAN FL 32011 LOT 3 2001 DW/MH FTWD IN OR 1388/1803 PERRET PLANTATION #2 PB 6/201 ==================================== 381 11-2N-24-1641-0010-0000 1,212.18 BELL DIANE & 1.000AC SLOVAK JEAN 35041 DUCKPOND CT CALLAHAN FL 32011 LOT 10 IN OR 1388/1621 PERRET PLANTATION #2 PB 6/201 ==================================== 382 12-2N-24-0000-0001-00M1 38.59 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 PARCELS 1 & 1-1 1/3 INT 121 ACRES PT OR 1313/689 MINERAL RIGHTS ==================================== 383 12-2N-24-0000-0003-0080 HX 1,045.31 FOURAKER JOYCE B 2.250AC 35488 BRADDOCK RD CALLAHAN FL 32011 PT SE1/4 & SW 1/4 OF NW 1/4 IN OR 338/145 ESMT OR 1733/660 ==================================== 384 12-2N-24-0000-0003-0120 1,332.32 BIANCO RICHARD & EILEEN 1.500AC 35086 BRADDOCK ROAD CALLAHAN FL 32011 PT NW1/4 & PT SW1/4 OF SEC 12-2N-24E IN OR 2141/1676 ==================================== 385 12-2N-24-0000-0003-0140 466.42 FOURAKER BRANDON & SALLY 1.000AC 35488 BRADDOCK RD CALLAHAN FL 32011 NW1/4 OF NW1/4 & NE1/4 OF NW1/4 IN OR 1859/1272 ==================================== 386 12-2N-24-0000-0003-0150 3,014.93 GRAHAM SHARI T 60.730AC P O BOX 1694 CALLAHAN FL 32011 PT W1/2 & PT OF SE1/4 OF SEC 12-2N-24E IN OR 1931/799 (EX OR 1936/950 & OR 2122/1891 & OR 2128/439) ==================================== 387 12-2N-24-0000-0003-0220 2,242.30 MAXWELL KYLE & GENEVA N 30.000AC 615720 RIVER ROAD CALLAHAN FL 32011 PT OF SEC 12-2N-24E IN OR 2128/439 ==================================== 388 12-2N-24-0000-0003-0230 469.15 G&H LAND & TIMBER INVESTMENTS LLC 1.780AC PO BOX 1694 CALLAHAN FL 32011 PT OF NE1/4 OF SW1/4 OF SEC 12-2N-24E IN OR 1931/794 (EX OR 2122/1891 & OR 2128/439), OR 2141/1676 & OR 2052/1678 ==================================== 389 12-2N-24-0000-0004-0070 421.00 BRADDOCK DOROTHY T L/E 2.640AC FOURAKER JOYCE LYNN 35427 BRADDOCK RD CALLAHAN FL 32011 PT SE1/4 OF NW1/4 L/E OR 1713/1889 & OR 1754/804 & OR 1941/445 ==================================== 390 12-2N-24-1640-0009-0000 HX 423.13 REGISTER CHARLES D 1.030AC 451431 OLD DIXIE HIGHWAY CALLAHAN FL 32011 LOT 9 IN OR 942/190 2000 FLEETWOOD DW/MH PERRET PLANTATION PHASE #1 PB 6/144-145 ==================================== 391 12-2N-24-1640-0014-0000 HX 352.94 LAURAMORE RODNEY W 1.000AC 35579 GLORY RD CALLAHAN FL 32011 LOT 14 OR 881/1404 R787647 & R787648 PERRET PLANTATION PHASE #1 PB 6/144-145 ==================================== 392 13-2N-24-0000-0002-0200 HX 272.69 HALL NANCY J & DARRELL L 20.000AC 35286 CHESTNUT LN CALLAHAN FL 32011 IN OR 2131/1459 R235861 & R235862 ==================================== 393 13-2N-24-0212-0024-0000 640.85 WHALEY KENNETH M & 1.030AC WHALEY TERRY ANNE P O BOX 2154 CALLAHAN FL 32011 LOT 24 IN OR 1661/1954 1989 CHAD DW/MH CALLAHAN PINES PB 5/285-286 ==================================== 394 13-2N-24-0212-0030-0000 623.60 BESSENT SHEILA F 2.040AC 45243 IRIS BLVD CALLAHAN FL 32011 LOT 30 1978 PINE DW/MH IN OR 1001/11 CALLAHAN PINES PB 5/285-286 ==================================== 395 14-2N-24-0000-0004-0060 411.32 COPE MORGAN 2.000AC 35023 QUAIL RD CALLAHAN FL 32011 PT OF SW1/4 OF SW1/4 IN OR 1868/1866 PARCELS 4-6 & 4-8 EX 4-12 ==================================== 396 14-2N-24-0000-0004-0100 HX 612.45 HESSONG JOHN & CONSTANCE 1.020AC 35027 QUAIL ROAD CALLAHAN FL 32011 IN OR 236 PG 666 ==================================== 397 14-2N-24-0000-0004-0110 HX 334.16 MCRAE DAVID A & PATRICIA A 1.000AC 35033 QUAIL RD CALLAHAN FL 32011 SW1/4 IN OR 763 PG 294 R673176 & R673177 ==================================== 398 14-2N-24-0000-0004-0120 HX 994.66 COPE MORGAN & KATHY 1.000AC 35023 QUAIL ROAD CALLAHAN FL 32011 PT OF SW1/4 IN OR 1188/335 ==================================== 399 23-2N-24-0000-0001-0060 HX 510.35 WILLARD QUINTON N & LINDA D 2.500AC 35101 CHESTNUT LANE CALLAHAN FL 32011 PT OF NE1/4 OF SEC 23-2N-24E IN OR 897/1310 & ESMT IN OR 1539/108 (EX ESMT AGMT IN OR 1922/1073 & EX OR 1172/1251,OR 1155/1 & OR 1201/1753) ==================================== 400 23-2N-24-0000-0001-0220 372.22 FRESHWATER CHARLES & JENNIFER 1.520AC PO BOX 51047 JACKSONVILLE BEACH FL 32240-1047 PT OF NE1/4 IN OR 1572/476 ==================================== 401 24-2N-24-0000-0011-0000 471.28 JOHNSON JOHN K III & TAMMY R 8.660AC 35739 QUAIL RD CALLAHAN FL 32011 IN OR 1945/1098 (EX 11-1 & 11-2) (EX R/W OR 247/161) ==================================== 402 24-2N-24-0000-0012-0010 1,426.37 CLINE MARK ALLEN 2.870AC 35752 QUAIL ROAD CALLAHAN FL 32011 PT OF E1/2 OF SE1/4 OF NE1/4 IN OR 1887/1468 ==================================== 403 24-2N-24-0000-0014-0050 795.88 SIMMONS IDELIA 9.720AC 450225 OLD DIXIE HWY CALLAHAN FL 32011 PT OF SE1/4 IN OR 1179/330 (EX 14-19) ==================================== 404 24-2N-24-0000-0014-0060 HX 540.58 RAYSOR CHARLES H & PAULINE F 3.810AC P O BOX 207 CALLAHAN FL 32011-0207 PT NW1/4 OF SEC 24-2N-24E IN OR 868/310 {FLHMLCF157423149A & FLHMLCF15723149B} ==================================== 405 24-2N-24-0000-0014-0110 228.64 NELSON FREDEVA M (1/2 INT) & 47.630AC NELSON CAROL L (1/4 INT) & ELLIS RAY (1/4 INT) 15 MAGNOLIA DR OXFORD GA 30054 PT OF SW1/4 PT OR 1390/172 CASE#50-2006-CP-000548 XXXX MB ==================================== 406 24-2N-24-0000-0014-0150 228.47 SIMMONS DERREL L 2.000AC 450225 OLD DIXIE HIGHWAY CALLAHAN FL 32011 IN OR 672/144 ==================================== 407 24-2N-24-0000-0016-0060 153.35 BALDERSON JERRY M 1.060AC PO BOX 15142 FERNANDINA BEACH FL 32035 IN OR 1358/1820 EX 16-8 & 16-9 ==================================== 408 24-2N-24-0000-0018-0010 44.03 SIMMONS IDELIA 29.400AC 450225 OLD DIXIE HWY CALLAHAN FL 32011 PT OF S1/2 PT OR 570 PG 413 ==================================== 409 25-2N-24-0000-0015-0010 HX 233.43 ALLGEYER SHERL L 0.520AC 34401 HATHAWAY DRIVE CALLAHAN FL 32011 IN OR 2086/1104 ==================================== 410 25-2N-24-0000-0017-0010 1,242.63 PERRET MARY S 9.530AC 615550 RIVER RD CALLAHAN FL 32011 IN OR 1852/822 (EX 17-4) UTILITY ESMT IN OR 867/1830 ==================================== 411 25-2N-24-0000-0017-0040 HX 1,111.22 PERRET MICHAEL E JR 0.690AC 615550 RIVER ROAD CALLAHAN FL 32011 PT OF GOVT LOT 6 IN OR 1321/743 UTILITY ESMT IN OR 869/965 ==================================== 412 25-2N-24-0000-0017-0070 92.92 PERRET MARY S 8.090AC 615550 RIVER ROAD CALLAHAN FL 32011 PT JOHN LOWE MILL GRANT SEC 51-3N-27E IN OR 1852/820 (EX UTIL ESMT IN OR 867/1832 & EX PT IN OR 2084/1685) ==================================== 413 25-2N-24-226B-0060-0040 HX 372.73 REDDISH LINDA SUE & 1.000AC REDDISH DALE ROBERT JR & 35262 GOODBREAD RD CALLAHAN FL 32011 PT OF LOT 60 IN OR 1956/617 A E EWING SUB #2 PB 5/20 ==================================== 414 26-2N-24-0000-0004-0140 HX 570.29 HURST RONNIE HOWARD JR 1.000AC 35056 MARY ROAD CALLAHAN FL 32011 IN OR 1770/38 R583685 ==================================== 415 26-2N-24-0000-0004-0170 HX 1,622.77 HURST RONNIE & HEATHER 1.000AC 35019 MARY RD CALLAHAN FL 32011 PT NE 1/4 OF SW 1/4 OF SEC 26-2N-24E RECD IN OR 1988/1270 (EX 4-22 & 4-26) ==================================== 416 26-2N-24-0000-0011-0010 HX 203.65 AROWOOD SHARON 2.090AC 615258 RIVER ROAD CALLAHAN FL 32011 IN OR 645/538 & OR 1575/1896 ==================================== 417 26-2N-24-0000-0015-0000 37.89 UNKNOWN 0.120AC HILLIARD FL 32046 UNKNOWN ==================================== 418 27-2N-24-0000-0002-0060 HX 1,849.14 SMITH DAVID P 2.040AC 613386 RIVER ROAD CALLAHAN FL 32011 IN OR 1625/1846 UTILITY ESMT IN OR 869/962 ==================================== 419 27-2N-24-228D-0059-0030 41.79 WALTER ERNEST ESTATE 0.114AC C/O ERNEST DAWAL 155 S HIDDENBROOKE DR ADVANCE NC 27006-7298 BLK 59 LOTS 3 & 4 JAX PARK SUB UNIT D PBK 2/7 ==================================== 420 28-2N-24-0000-0007-0040 HX 3,789.93 REAVES SHAWN C 4.400AC 613048 RIVER ROAD CALLAHAN FL 32011 PT OF SE1/4 OF SE1/4 IN OR 1508/1671 EX 7-6 7-12 & 7-13 UTILITY ESMT IN OR 885/1578 ==================================== 421 35-2N-24-0000-0002-0080 HX 381.71 DYAL TERRANCE WARREN JR 5.000AC 34002 SIX CAR LN CALLAHAN FL 32011 PT OF SW1/4 OF NW1/4 L/E OR 661 PG 906 R498093 ESMT OR 542/216 ==================================== 422 36-2N-24-0000-0003-0030 470.13 BARBER ROY E 2.230AC 6213 ALFREDO DRIVE WEST JACKSONVILLE FL 32244 PT S1/2 OF NE1/4 OF NW1/4 OF SEC 36-2N-28E IN OR 1131/1384 ==================================== 423 38-2N-24-0000-0002-0040 1,199.17 MIZELL WALTER S 1.950AC 45200 DORMAN PLACE CALLAHAN FL 32011 IN OR 1627/1643 EX R/W IN OR 723/702 1986 GREE DW/MH ==================================== 424 38-2N-24-0000-0002-0100 1,428.27 HIGGINBOTHAM CHRISTINE & 8.020AC HIGGINBOTHAM WILLIAM R (H&W) 3518 WOODMERE LANE SUGARLAND TX 77478-5225 IN OR 1009/1139 2002 MERT-DW ==================================== 425 03-3N-24-0000-0001-0030 1,246.05 REED HUBERT E 0.950AC 37610 PINERIDGE DRIVE HILLIARD FL 32046 IN OR 1670/970 EX ESMT OR 928/1851 ==================================== 426 03-3N-24-0000-0001-0050 HX 1,036.46 REED HUBERT E JR & DEBBIE SUE 1.890AC 37610 PINERIDGE ROAD HILLIARD FL 32046 PT OF NW1/4 OF SE1/4 IN OR 402 PG 46 EX ESMT OR 924/748 ==================================== 427 03-3N-24-0000-0001-0060 519.78 KINCADE RALPH R & DREMA D 4.250AC 26393 SHEARED STOKES RD HILLIARD FL 32046 IN OR 1839/633 EX R/W OR 908/797 ==================================== 428 03-3N-24-0000-0002-0010 HX 194.19 BARNETTE TAMMY 2.910AC PO BOX 789 HILLIARD FL 32046-0789 IN OR 566 PG 80 R359906 & R359907 ==================================== 429 03-3N-24-0000-0004-0010 HX 513.54 WATERS ANTHONY SHAWN 2.370AC 37148 REED ROAD HILLIARD FL 32046 PT OF W1/2 OF SE1/4 OF NW1/4 IN OR 866/22 R787440 & R787441 ==================================== 430 03-3N-24-0000-0004-00M0 42.36 MANN SEAN D 0.000AC 4230 DUVAL STREET JACKSONVILLE BEACH FL 32250 S1/2 OF NE1/4 NW1/4 OF SE1/4 E1/2 OF NE1/4 OF SW1/4 NW1/4 OF NE1/4 OF SW1/4 PARCELS 4 THRU 4-8 & 1 THRU 1-6,5 & 5-1 PT OR 1313/689 1/3 INT 190 ACRES MINERAL RIGHTS ONLY ==================================== 431 03-3N-24-0000-0004-0110 HX 1,601.65 REED JASON EDWARD 8.320AC 37155 REED ROAD HILLIARD FL 32046-6454 PT OF W1/2 OF SE1/4 OF NW1/4 IN OR 876/668 ==================================== 432 03-3N-24-2020-0023-0110 625.54 DAUGHTRY CHARLES E & MONICA S 1.000AC C/O WANDELLA SMART 545605 US HWY 1 CALLAHAN FL 32011 PT LOT 23 IN OR 712 PG 386 EX R/W IN OR 1467/1495 CORNWALL SURVEY ==================================== 433 03-3N-24-2300-0017-0010 HX 936.50 HODGES RONALD C SR & DORIS A 10.000AC 37123 COYOTE DRIVE HILLIARD FL 32046 E1/2 OF E1/2 OF LOTS 17-20 IN OR 1383/1230 R236093 & R236094 ESMT OR 518/387 ESMT OR 1058/1098 MAP OF TWNS 3 4 5 RGE 23 & 24 ==================================== 434 03-3N-24-2300-0017-0030 1,137.16 WADE TONYA M 10.000AC 37810 OLD PINERIDGE RD HILLIARD FL 32046 E1/2 OF W1/2 OF SE1/4 OF SW1/4 A/K/A PT OF LOTS 17 THRU 20 IN OR 2042/1561 ESMT IN OR 679/426 ESMT OR 1105/1871 MAP TWNS 3 4 5 RGE 23 & 24 ==================================== 435 04-3N-24-0000-0004-0090 1,717.57 PEARSON STEVEN C 24.800AC 6115 NORTH RAGLAND CV ARLINGTON TN 38002 S1/2 OF N1/2 OF SE1/4 WEST OF & ADJACENT TO C-115-A IN OR 2076/881 ==================================== 436 05-3N-24-0000-0007-0010 212.90 MASON WILBUR 0.210AC 80 KLYONA AVE PHOENIXVILLE PA 19460 BLOCK 11 LOTS 1-2-3-4 IN OR 287 PG 44 HILLIARD HGTS (7-1) ==================================== 437 05-3N-24-0000-0014-0010 HX 42.90 HODGES JESSE D 2.300AC 552255 US HIGHWAY 1 HILLIARD FL 32046 IN OR 1221/1796 ESMT PT OR 1861/825 ==================================== 438 05-3N-24-0000-0017-0020 HX 443.68 MUSSELMAN DIANA FREDIA & 0.610AC BOUCHARD CHANITY MARIE (JT/RS) 552355 US HWY 1 HILLIARD FL 32046 IN OR 1909/1677 ESMT PT OR 1861/825 ==================================== 439 05-3N-24-0000-0018-0000 HX 982.75 REED FLAVIUS THOMAS 1.680AC 37028 TRACTOR LANE HILLIARD FL 32046 IN OR 590 PG 996 1964 PKVA SW/MH ==================================== 440 05-3N-24-0000-0029-0030 HX 818.90 YOUNG DARIN P & 0.700AC YOUNG NEAL D (JT/RS) 552169 US HWY 1 HILLIARD FL 32046 PT OF SE1/4 OF SE1/4 IN OR 1840/1227 ==================================== 441 05-3N-24-0000-0031-0000 7,021.31 SMITH BARRY D 0.000AC C/O SMITH MACHINE SERVICE P O BOX 339 HILLIARD FL 32045 IN OR 1341/703 PARCELS 31 & 31-2 ESMT PT OR 1861/825 ==================================== 442 05-3N-24-0000-0031-0010 207.57 SMITH ROBERTA A 0.000AC PO BOX 339 HILLIARD FL 32046-0339 PT OR 1483/454 ==================================== 443 05-3N-24-0000-0031-0030 847.13 SMITH ROBERTA A 0.000AC PO BOX 339 HILLIARD FL 32046-0339 PT OR 1483/454 ESMT PT OR 1861/825 ==================================== 444 05-3N-24-0000-0033-0000 2,447.48 LIBBY ARTHUR DALE & JANICE P 0.000AC 552073 US HWY 1 NORTH HILLIARD FL 32046 PT OF BLKS 25,27 & PT ABND 8TH ST IN OR 2042/1264(EX UTIL ESMT IN OR 1961/825) TOWN OF HILLIARD PBK 1/28 ==================================== 445 05-3N-24-0000-0035-0000 1,942.57 ALLPHIN TRUDI 0.000AC 552210 US HWY 1 HILLIARD FL 32046 IN OR 1822/1974 (EX 35-1) ESMT IN OR 377/465 ==================================== 446 05-3N-24-0000-0035-0010 50.34 HARGROVE ALTAMESE G 0.000AC 1411 W 6TH ST JACKSONVILLE FL 32209 IN OR 649 PG 1129 ==================================== 447 05-3N-24-2020-0001-0010 523.17 CICERO JOSEPH S 5.000AC 272011 GEORGIA ST HILLIARD FL 32046 PT OF LOT 1 (S-1) IN OR 2041/1678 CORNWALL SURVEY ==================================== 448 05-3N-24-2020-0011-0000 649.94 ROWE MELVERINE EST 2.500AC 27093 ROWE LANE HILLIARD FL 32046 LOT 11 (EX S-1 S-2 & S-3) IN OR 358 PG 270 CORNWALL SURVEY ==================================== 449 05-3N-24-2020-0011-0010 509.88 CURRIN SHERRIE L & 2.500AC HARRIS JAMES KEVIN (T/I/C) 18543 ALABAMA HWY 35 SCOTTSBORO AL 35768 W1/2 OF W1/2 OF LOT 11 IN OR 1940/485 MH/ID GDWGA108431673 CORNWALL SURVEY ==================================== 450 05-3N-24-2020-0011-0030 326.53 DAY KATRIENA V E EST 2.500AC C/O ROBERT ROWE 27093 ROWE LANE HILLIARD FL 32046 PT OF LOT 11 CASE 99-1071-CA IN OR 818 PG 821 CORNWALL SURVEY ==================================== 451 05-3N-24-2020-0012-0010 618.38 BELL SENIE D 5.050AC 35041 DUCK POND CT CALLAHAN FL 32011 N1/2 OF LOT 12 IN OR 1433/1230 ESMT OR 1726/281 CORNWALL SURVEY ==================================== 452 05-3N-24-2330-0026-0000 343.88 COBB LINDA L EST 0.000AC 27245 KARA CIR HILLIARD FL 32046 LOT 26 IN OR 840/247 ESMT PT OR 1861/825 KARA ACRES UNR SUB ==================================== 453 05-3N-24-2340-0003-0020 864.62 DONLEY HOLMAN EST 0.000AC C/O HOLMAN DONLEY JR P O BOX 340 CALLAHAN FL 32011-0340 S PT OF LOT 3 IN DB 268 PG 117 LINCOLN SUB ==================================== 454 05-3N-24-2340-0006-0030 911.51 LEE JIMMIE L/E 0.000AC LEE CALVIN & ANDREW B & 37115 CODY CIR APT M6 HILLIARD FL 32046-6959 E1/2 OF LOT 6 IN OR 53/542 & OR 495/372 (EX PT IN OR 17/582) LINCOLN SUB UNR ==================================== 455 05-3N-24-2340-0013-0030 50.88 DONELY ARTHUR & SHEILA 0.000AC 410 25TH AVE VERO BEACH FL 32962 PT OF LOT 13 IN OR 519/803 LINCOLN SUB ==================================== 456 05-3N-24-2340-0014-0040 297.17 BROWN LATASHIA & 0.000AC BYRD DEBORAH EST & 3737 WEBB ST HILLIARD FL 32046 W1/2 OF E1/2 OF LOT 14 (EX S60 FT) IN OR 487/214 & OR 1909/1315 LINCOLN SUB ==================================== rf rfntb DEL. TAX LIST 2017.indd 3 4/30/18 12:20 PM

PAGE 64

457 05-3N-24-2360-0015-0000 HX 502.00 PADGETT CHRISTINA FAY 1.450AC PO BOX 1746 HILLIARD FL 32046-1746 LOT 15 (EX S-1) & PAR 17-3 IN OR 1575/1201 PLEASANT PARK PB 2/21 ==================================== 458 07-3N-24-2020-0050-0000 HX 932.82 MCCONNELL RICHARD W & JANET L 10.000AC 27092 GEORGIA STREET HILLIARD FL 32046 LOT 50 PT OR 874/1552 R787462 & R787463 & R787464 CORNWALL SURVEY ==================================== 459 07-3N-24-2020-0059-0000 HX 549.17 ROBINSON EARL L & SYLVIA I 10.000AC TRUSTEES OF ROBINSON LVG TRUST PO BOX 758 HILLIARD FL 32046-0758 LOT 59 IN OR 1230/843 CORNWALL SURVEY ==================================== 460 07-3N-24-2020-0060-0010 555.92 SADESKY STEVE JR & SHARON 5.000AC PO BOX 22 HILLIARD FL 32046-0022 N1/2 OF LOT 60 IN OR 1211/184 CORNWALL SURVEY ==================================== 461 07-3N-24-2020-0060-0020 HX 579.88 SADESKY STEVE P JR 5.000AC 27708 GEORGIA ST HILLIARD FL 32046 S 1/2 OF LOT 60 OR 190 PG 354 RP 1458-1459 CORNWALL SURVEY ==================================== 462 08-3N-24-2380-0009-0022 826.67 HARRIS ELMO A 0.000AC PO BOX 1076 HILLIARD FL 32046-1077 BLOCK 9 SWLY 200 FT OF LOT 2 IN OR 336/738 EX ESMT OR 340/386 COMM SYS R/W OR 934/1917 ESMT PT OR 1861/825 TOWN OF HILLIARD SEC 9-3N-24E ==================================== 463 08-3N-24-2380-0009-0030 409.59 HARRIS ELMO A 0.000AC PO BOX 1076 HILLIARD FL 32046-1077 BLOCK 9 SWLY 200 FT OF LOT 3 IN OR 332/240 EX ESMT OR 340/386 COMM SYS R/W OR 934/1917 ESMT PT OR 1861/825 TOWN OF HILLIARD SEC 9-3N-24E ==================================== 464 08-3N-24-2380-0010-0033 502.14 GUYNN GERALD J & DAPHNE M 0.000AC PO BOX 1344 HILLIARD FL 32046-1344 BLK 10 PT OF LOT 3 IN OR 1686/1317 BEING PARCEL TOWN OF HILLIARD PBK 1/28 ==================================== 465 08-3N-24-2380-0010-0034 216.86 GUYNN GERALD J & DAPHNE M 0.000AC PO BOX 1344 HILLIARD FL 32046-1344 BLK 10 PT OF LOT 3 IN OR 1686/1317 BEING PARCEL TOWN OF HILLIARD PBK 1/28 ==================================== 466 08-3N-24-2380-0011-0023 134.71 GUYNN GERALD J & DAPHNE M 0.000AC 37059 PECAN ST HILLIARD FL 32046 BLK 11 PT OF LOT 2 IN OR 2088/1972 TOWN OF HILLIARD S/D PBK 1/28 ==================================== 467 08-3N-24-2380-0012-0032 926.10 HOFFMAN JAMES 0.000AC PO BOX 818 HILLIARD FL 32046-0818 BLOCK 12 LOT S1/4 OF 3 IN OR 284 PG 229 TOWN OF HILLIARD ==================================== 468 08-3N-24-2380-0012-0041 434.58 HOFFMAN JAMES 0.000AC PO BOX 818 HILLIARD FL 32046-0818 BLOCK 12 S50 FT OF LOT 4 IN OR 597/83-85 TOWN OF HILLIARD ==================================== 469 08-3N-24-2380-0018-0044 689.44 LARGIN JAMES A EST 0.000AC C/O TERRY LARGIN 37039 W 4TH STREET HILLIARD FL 32046 BLOCK 18 PT OF LOT 4 IN OR 727 PG 831 TOWN OF HILLIARD ==================================== 470 08-3N-24-2380-0019-0042 1,105.46 FIRST STOP FLORIDA LLC 0.000AC 5953 FEATHER LN SANFORD FL 32771 BLOCK 19 S-2 OF LOTS 4 & 1 IN OR 2095/810 TOWN OF HILLIARD ==================================== 471 08-3N-24-2380-0023-0010 2,851.97 SCOTT JEANNE 0.000AC P O BOX 1199 HILLIARD FL 32046 BLOCK 23 LOTS 1 & PT OF 2 IN OR 1180/64 TOWN OF HILLIARD ==================================== 472 08-3N-24-2380-0023-0032 1,323.04 ROBERSON CLIFTON H & ELAINE M 0.000AC PO BOX 1138 WOODBINE GA 31569-1138 BLOCK 23 PT LOTS 3 & 4 (S-2) & PT LOT 3 (S-3) BLOCK 25 PT OF LOTS 1 & 2 (S-2) & PT OF LOT 2 (S-3) & PT OF ABANDONED R/W OR 1015 PG 1310 (EX S-5 IN OR 1698/1582) ESMT PT OR 1861/825 TOWN OF HILLIARD ==================================== 473 08-3N-24-2380-0023-0034 311.63 ROBERSON CLIFTON H & ELAINE D 0.000AC PO BOX 1138 WOODBINE GA 31569 BLOCK 23 PT OF LOTS 3 & 4 IN OR 1671/1569 (EX PT OR 1698/1582 S-6) TOWN OF HILLIARD ==================================== 474 08-3N-24-2380-0023-0035 2,192.31 HADDOCK RODNEY DEWAYNE 0.000AC 27359 GEIGER RD HILLIARD FL 32046 BLK 23 PT LOT 4 & ABND 7TH ST IN OR 2077/851 TOWN OF HILLIARD S/D PBK 1/28 ==================================== 475 08-3N-24-2380-0025-0011 308.31 LIBBY ARTHUR DALE & JANICE P 0.000AC 552073 US HWY 1 NORTH HILLIARD FL 32046 BLK 25 PT OF LOTS 1,2 & 3 IN OR 2093/186 (EX UTIL ESMT IN OR 1861/825) TOWN OF HILLIARD PBK 1/28 {R672404 & R672405} ==================================== 476 08-3N-24-2380-0025-0013 1,455.16 HADDOCK TIMBER INC & 0.000AC RODNEY D HADDOCK 27359 GIEGER RD YULEE FL 32097 BLOCK 25 PT OF LOT 1 & PT OF ABANDONED R/W & PT OF BLOCK 23 LOT 4 IN OR 2122/339 TOWN OF HILLIARD ==================================== 477 08-3N-24-2380-0063-0010 1,013.57 CALHOUN JOE & SHIRLEY MAE 0.000AC WILLIE S & C I SPEIGHT 10247 ALLENE ROAD JACKSONVILLE FL 32219 BLOCK 63 LOTS 1 2 4 & PT ABANDONED R/W IN OR 103/290 & PT OR 1497/750 PT OR 1497/747 ORD #2007-03 (1/2 INT) TOWN OF HILLIARD ==================================== 478 08-3N-24-2380-0063-0033 43.32 HALL STEPHANIE 0.000AC 43 PRESCOTT ROAD FOLKSTON GA 31537 BLOCK 63 PT OF LOT 3 (S-3) IN OR 1609/486 TOWN OF HILLIARD ==================================== 479 08-3N-24-2380-0065-0020 3,173.72 HALL STEPHANIE 0.000AC 43 PRESCOTT ROAD FOLKSTON GA 31537 BLOCK 65 PT OF LOT 2 & PT ABANDONED R/W OR 1497/747 ORD #2007-03 IN OR 1609/488 TOWN OF HILLIARD ==================================== 480 08-3N-24-2380-0066-0032 300.97 SMITH CHARLENE R & REGINALD SR 0.000AC 361963 PINE STREET HILLIARD FL 32046 BLOCK 66 N1/2 OF LOT 3 IN OR 1235/1361 TOWN OF HILLIARD ==================================== 481 08-3N-24-2380-0067-0031 HX 318.83 GORDON JACKIE L 0.000AC P O BOX 1347 HILLIARD FL 32046 BLOCK 67 LOT E1/2 OF 3 LOT 4 LESS LINCOLN SUB IN OR 1244/537 TOWN OF HILLIARD ==================================== 482 08-3N-24-2380-0072-0040 HX 763.02 JACKSON ALFRED & BARBARA 0.000AC PO BOX 187 HILLIARD FL 32046-0187 BLOCK 72 LOT 4 IN OR 467/164 & OR 469/439 TOWN OF HILLIARD ==================================== 483 08-3N-24-2380-0074-0023 174.73 KELLY JOANNE 0.000AC PO BOX 545 CALLAHAN FL 32011 BLOCK 74 PT LOT 2 IN OR 1778/1318 TOWN OF HILLIARD ==================================== 484 08-3N-24-2380-0074-0024 812.11 BARNES J T & BARBARA 0.000AC 37293 WEST FIFTH STREET HILLIARD FL 32046 BLOCK 74 PT OF LOT 2 IN OR 360/511 & OR 88/415 (EX OR 1980/529) TOWN OF HILLIARD ==================================== 485 08-3N-24-2380-0074-0025 546.33 KELLY JOANNE 0.000AC PO BOX 545 CALLAHAN FL 32011 OF LOT 2 IN OR 2089/1101 TOWN OF HILLIARD ==================================== 486 08-3N-24-2380-0074-0031 HX 707.93 MITCHELL LARRY D & SHARON 0.000AC PO BOX 1252 HILLIARD FL 32046-1252 BLOCK 74 E1/2 OF LOT 3 OR 776/353 R672713 TOWN OF HILLIARD ==================================== 487 08-3N-24-2380-0076-0080 897.48 JONES DAVID J & KEISHA M 0.000AC P O BOX 33 HILLIARD FL 32046-0033 IN OR 731/979 TOWN OF HILLIARD ==================================== 488 08-3N-24-2380-0076-0082 308.62 EDWARDS VIRGINIA JORDAN EST 0.000AC PO BOX 33 HILLIARD FL 32046-0033 IN OR 462 PG 298 R567600 TOWN OF HILLIARD ==================================== 489 08-3N-24-2380-0077-0010 HX 571.09 HARRIS ELMO A 0.000AC PO BOX 1077 HILLIARD FL 32046-1077 BLOCK 77 LOTS 1 3 & S1/2 OF 5 OR 310 PG 38 TOWN OF HILLIARD ==================================== 490 08-3N-24-2380-0077-0060 950.19 MITCHELL EDDIE EST 0.000AC C/O GERALD J THOMAS 37498 NEW OAK STREET HILLIARD FL 32046 BLOCK 77 LOTS 6 8 9 10 TOWN OF HILLIARD ==================================== 491 08-3N-24-2380-0083-0011 1,066.50 EASTER TIMOTHY DALE 0.000AC PO BOX 316 BROAD BROOK CT 06016-0316 BLOCK 83 N1/2 OF LOT 1 IN OR 1492/1353 TOWN OF HILLIARD ==================================== 492 08-3N-24-2380-0085-0042 HX 684.79 ATKINSON MARYANN & 0.000AC BEASLEY SANDRA JEANETTE & 37055 W 1ST ST HILLIARD FL 32046 BLOCK 85 PT OF LOT 4 OR 708/125 & CASE #04-108-CP PT OR 1532/592 1/3 HX INT TOWN OF HILLIARD PB 1/28 ==================================== 493 08-3N-24-2380-0094-0080 41.44 MOON JEAN 0.000AC 1545 NORTH STIRLING AVENUE PONTIAC MI 48340-1335 BLOCK 94 LOT 8 PT OR 2030/1492 TOWN OF HILLIARD ==================================== 494 08-3N-24-2380-0102-0020 41.44 POPE W ET AL 0.000AC C/O JOHN G BARROW III 661 US HWY 17 NORTH YULEE FL 32097 BLOCK 102 LOT 2 OR 343 PG 413 TOWN OF HILLIARD ==================================== 495 08-3N-24-2380-0103-0070 41.44 THOMAS W L JR & LAFAYNE 0.000AC BOX 237 FOLKSTON GA 31537 BLOCK 103 LOT 7 TOWN OF HILLIARD ==================================== 496 08-3N-24-2380-0103-0110 50.88 RAM PROPERTIES 0.000AC PO BOX 56272 JACKSONVILLE FL 32241 BLOCK 103 LOTS 11 & 12 IN OR 943/18 TOWN OF HILLIARD ==================================== 497 08-3N-24-2380-0104-0010 2,395.60 ROCK N LEE LLC 0.000AC 515 S 6TH ST MACCLENNY FL 32063 BLOCK 104 LOTS 1-6 13-19 20-24 R583994 R788166 & R621777 1984 CRAN DW/MH IN OR 2100/653 TOWN OF HILLIARD ==================================== 498 08-3N-24-2380-0108-0200 41.44 BARROW ALMA M EST 0.000AC C/O JOHN G BARROW III EST 661 US HWY 17 NORTH YULEE FL 32097 BLOCK 108 LOT 20 PT OF OR 441 PG 637 TOWN OF HILLIARD ==================================== 499 08-3N-24-2380-0110-0090 50.88 RNHJ HOLDINGS INC 0.000AC PO BOX 455 CALLAHAN FL 32011-0455 BLOCK 110 LOTS 9 & 10 PT OR 1551/863 TOWN OF HILLIARD ==================================== 500 08-3N-24-2380-0114-0040 994.86 HOFFMAN JAMES 0.000AC PO BOX 818 HILLIARD FL 32046-0818 BLOCK 114 LOTS 4 THRU 9 & LOTS 13 THRU 17 & 19 THRU 24 IN OR 1715/559 TOWN OF HILLIARD ==================================== 501 08-3N-24-2380-0115-0070 41.44 BARROW ALMA M EST 0.000AC C/O JOHN G BARROW III EST 661 US HWY 17 NORTH YULEE FL 32097 BLOCK 115 LOT 7 PT OF OR 441 PG 637 TOWN OF HILLIARD ==================================== 502 08-3N-24-2380-0117-0090 50.88 BULLOCK LOUIS A EST 0.000AC C/O LIDA SACHNOFF 16435 EUCLID AVE BAINBRIDGE ISLAND WA 98110 BLOCK 117 LOTS 9 10 TOWN OF HILLIARD ==================================== 503 08-3N-24-2380-0117-0190 41.44 REUSS EMILY EST 0.000AC C/O NORMAN REUSS 34 THISTLE HILL DR HINESBURG VT 05461-3019 BLOCK 117 LOT 19 TOWN OF HILLIARD ==================================== 504 08-3N-24-2380-0120-0130 HX 403.34 HIGGINBOTHAM DEAN E & ANN M 0.000AC 27201 W 5TH AVE HILLIARD FL 32046 BLOCK 120 LOTS 13 THRU 18 IN OR 1602/1315 & OR 1780/1828 2000 MERT DW/MH TOWN OF HILLIARD ==================================== 505 08-3N-24-2380-0123-0010 HX 285.95 GEOGHAGAN DANIEL A & MELISSA B 0.000AC 27254 W 5TH ST HILLIARD FL 32046 BLOCK 123 LOTS 1 2 3 4 & 5 1989 FOREMOST DW/MH IN OR 1970/1538 TOWN OF HILLIARD ==================================== 506 08-3N-24-2380-0123-0060 503.05 HIGGINBOTHAM LELAND KIRK 0.000AC 27236 WEST 5TH AVE HILLIARD FL 32046 BLOCK 123 LOTS 6 & 7 IN OR 1225/453 1996 CLAY SW/MH TOWN OF HILLIARD ==================================== 507 08-3N-24-2380-0128-0130 371.84 HOFFMAN JAMES 0.000AC PO BOX 818 HILLIARD FL 32046-0818 BLOCK 128 LOTS 13 THRU 18 IN OR 1715/559 TOWN OF HILLIARD ==================================== 508 08-3N-24-2380-0130-0040 50.88 MIXON RICHARD E JR 0.000AC 5557 MILMAR DRIVE NORTH JACKSONVILLE FL 32207 BLOCK 130 LOTS 4 & 5 IN OR 875/1072 TOWN OF HILLIARD ==================================== 509 08-3N-24-2380-0130-0060 50.88 MIXON RICHARD E JR 0.000AC 5557 MILMAR DRIVE NORTH JACKSONVILLE FL 32207 BLOCK 130 LOTS 6 & 7 IN OR 806 PG 1117 TOWN OF HILLIARD ==================================== 510 08-3N-24-2380-0131-0010 756.40 CONFIDENTIAL 0.000AC CONFIDENTIAL ==================================== 511 08-3N-24-2380-0132-0130 357.82 HERRINGTON STANLEY JAMES L/E 0.000AC HERRINGTON JULIA T 27275 GEORGIA STREET HILLIARD FL 32046 BLK 132 LOTS 13,14,15 & 16 TOWN OF HILLIARD ==================================== 512 08-3N-24-2380-0133-0180 41.44 MCCONNELL RICHARD W & JANET L 0.000AC 27092 GEORGIA STREET HILLIARD FL 32046 BLOCK 133 LOT 18 PT OR 874/1552 TOWN OF HILLIARD ==================================== 513 08-3N-24-2380-0134-0010 HX 836.30 LAWSON ROBERT & JOSETTA 0.000AC 27302 MONTANA STREET HILLIARD FL 32046 BLOCK 134 LOTS 1 THRU 4 IN OR 853/1223 TOWN OF HILLIARD ==================================== 514 08-3N-24-2380-0134-0050 HX 399.79 PENSA ROBERT P 0.000AC 27173 WEST 4TH AVE HILLIARD FL 32046-6839 BLOCK 134 LOTS 5 6 7 & 8 IN OR 1327/1973 TOWN OF HILLIARD ==================================== 515 08-3N-24-2380-0134-0130 258.56 HOFFMAN JAMES 0.000AC PO BOX 818 HILLIARD FL 32046-0818 BLOCK 134 LOTS 13 14 15 & 16 IN OR 419 PG 15 TOWN OF HILLIARD ==================================== 516 08-3N-24-2380-0134-0170 HX 1,235.37 HOFFMAN JAMES 0.000AC PO BOX 818 HILLIARD FL 32046-0818 BLOCK 134 17 THRU 24 IN OR 311/40 & 342/101 TOWN OF HILLIARD ==================================== 517 08-3N-24-2380-0135-0200 41.44 YOUNG R E 0.000AC C/O MRS PATRICIA J ERWIN 2685 EVERETT DR RENO NV 89503 BLOCK 135 LOT 20 TOWN OF HILLIARD ==================================== 518 08-3N-24-2380-0136-0130 HX 47.51 NOBLES WILLIE E JR 0.000AC 27275 IOWA ST HILLIARD FL 32046 BLOCK 136 LOTS 13 THRU 16 IN OR 1883/117 R583234 TOWN OF HILLIARD ==================================== 519 08-3N-24-2380-0138-0130 716.93 HOLLEY MARCUS & NICOLA 0.000AC PO BOX 940 HILLIARD FL 32046-0940 BLOCK 138 LOTS 13 TO 18 OR 1463/1700 R224171 1989 WEST SW/MH 1986 SEVI SW/MH TOWN OF HILLIARD ==================================== 520 08-3N-24-2380-0140-0110 50.88 BADER ULRICH 0.000AC C/O JOHN K CONNERS 804 EMERALD BAY LAGUNA BEACH CA 92657 BLOCK 140 LOTS 11 12 TOWN OF HILLIARD ==================================== 521 08-3N-24-2380-0145-0070 770.10 HOLLEY MARCUS W 0.000AC PO BOX 940 HILLIARD FL 32046-0940 BLOCK 145 LOTS 7 8 9 10 11 12 IN OR 1732/1697 1996 FLTWD SW/MH TOWN OF HILLIARD ==================================== 522 08-3N-24-2380-0147-0180 620.11 LAURENDINE KEE & BENITA F & 0.000AC LYNN CONSTANCE F EST 27206 MISSOURI STREET HILLIARD FL 32046 BLOCK 147 LOTS 18 19 20 21 22 23 & 24 OR 626/349 1/2 HX INT TOWN OF HILLIARD ==================================== 523 08-3N-24-2380-0148-0190 50.88 HAQUE MOHAMMED 0.000AC 3552 STEINWAY ST APT 2 LONG ISLAND CITY NY 11101-1423 BLOCK 148 LOTS 19 & 20 IN OR 1516/922 TOWN OF HILLIARD ==================================== 524 08-3N-24-2380-0150-0010 HX 504.69 HARVILL LINDA G 0.000AC PO BOX 782 HILLIARD FL 32046-0782 BLOCK 150 LOTS 1 2 3 & 4 IN OR 408 PG 555 TOWN OF HILLIARD ==================================== 525 08-3N-24-2380-0150-0050 485.11 HOFFMAN JAMES 0.000AC PO BOX 818 HILLIARD FL 32046-0818 BLOCK 150 LOTS 5 THRU 12 IN OR 451 PG 332 TOWN OF HILLIARD ==================================== 526 08-3N-24-2380-0151-0160 50.88 MOON JEAN 0.000AC 1545 NORTH STIRLING AVENUE PONTIAC MI 48340-1335 BLOCK 151 LOTS 16 & 17 PT OR 2030/1492 TOWN OF HILLIARD ==================================== 527 08-3N-24-2380-0154-0010 469.43 ISHAM ROBERT J & ALANA 0.000AC 27146 WEST 2ND AVE HILLIARD FL 32046 BLK 154 LOTS 1 THRU 12 TOWN OF HILLIARD S/D PBK 1/23 {R583882} ==================================== 528 08-3N-24-2380-0155-0130 271.22 STETSON THEODORE EST 0.000AC 27206 MISSOURI STREET HILLIARD FL 32046 BLK 155 LOTS 13,14 & 15 IN OR 391/182 TOWN OF HILLIARD S/D PBK 1/23 {R108171} ==================================== 529 08-3N-24-2380-0157-0180 1,089.01 BRUCE JOHNNIE F & 0.000AC RICH J W & ROBERT TAYLOR 27312 W FIRST AV HILLIARD FL 32046 BLOCK 157 LOTS 18 THRU 24 IN OR 1406/1495 & OR 2133/1935 TOWN OF HILLIARD ==================================== 530 08-3N-24-2380-0168-0050 HX 1,122.31 BULLARD LUCAS D & CHRISTINE E 0.000AC 27427 WEST 1ST AVE HILLIARD FL 32046 BLOCK 168 LOTS 5 THRU 12 IN OR 1034/229 TOWN OF HILLIARD ==================================== 531 08-3N-24-2380-0173-0040 41.44 HOFFMAN JAMES J & 0.000AC PENSA MARK ANTHONY (JT/RS) PO BOX 818 HILLIARD FL 32046 BLOCK 173 LOT 4 PT OR 1792/1188 TOWN OF HILLIARD ==================================== 532 08-3N-24-2380-0173-0050 457.96 LEE LARRY F EST & 0.000AC LEE JAUNELL 56256 COLBY DRIVE CALLAHAN FL 32011 BLOCK 173 LOTS 5 6 & 7 IN OR 420 PG 26 TOWN OF HILLIARD ==================================== 533 08-3N-24-2380-0176-0070 41.44 MIKKELSON CARL G EST 0.000AC 3756 WEST 3RD STREET HILLIARD FL 32046 BLOCK 176 LOT 7 TOWN OF HILLIARD ==================================== 534 08-3N-24-2380-0178-0170 41.44 DOHR LILAS H TRUSTEE 0.000AC OF THE LILAS DOHR REVOC TRUST 321 SOUTH WALNUT STREET APPLETON WI 54911 BLOCK 178 LOT 17 (LESS S5 FT) IN OR 1009/1486 TOWN OF HILLIARD ==================================== 535 08-3N-24-2380-0180-0090 1,543.57 PIERSON KRISTINA 0.000AC 27353 NEW FRONT ST HILLIARD FL 32046 BLOCK 180 LOTS 9 THRU 12 (LESS TO S RD) IN OR 2043/270 TOWN OF HILLIARD ==================================== 536 08-3N-24-2380-0183-0130 HX 1,302.36 CALHOUN PAULINE 0.000AC 27071 INDIANA ST APT 101 HILLIARD FL 32046 BLOCK 183 LOTS 13 THRU 17 IN OR 1309/86 TOWN OF HILLIARD ==================================== 537 08-3N-24-2380-0184-0180 41.44 BALLARD BERENDA F 0.000AC C/O 2497 DAVIS ST FENTON MI 48430 BLOCK 184 LOT 18 TOWN OF HILLIARD ==================================== 538 08-3N-24-2380-0184-0200 41.44 HOWARD A E ESTATE 0.000AC C/O JUNE HOWARD 702 NEW PORT STREET MACCLENNY FL 32063-4167 BLOCK 184 LOT 20 TOWN OF HILLIARD ==================================== 539 08-3N-24-2380-0197-0080 41.44 STOCKTON C B 0.000AC C/O WAYNE L DETWILER 2951 LA PAZ AVE HEMET CA 92545 BLOCK 197 LOT 8 TOWN OF HILLIARD ==================================== 540 08-3N-24-2380-0199-0140 50.88 BRYCE ROBERT W SR C/O ROBERTA SMITH 305 KNOLL STREET N W VIENNA VA 22180 BLOCK 199 LOTS 14 & 15 PT OR 364/39-46 & 357/13 TOWN OF HILLIARD ==================================== 541 08-3N-24-2380-0199-0220 50.88 BELL RONALD WAYNE & 0.000AC BELL DONALD GARY 45219 MICKLER ST CALLAHAN FL 32011 BLOCK 199 LOTS 22 & 23 PT OR 1028/1690 TOWN OF HILLIARD ==================================== 542 08-3N-24-2380-0201-0130 914.27 JOHNSON HAROLD F 0.000AC PO BOX 1701 HILLIARD FL 32046-1701 BLOCK 201 LOTS 13 THRU 24 PT OR 163/242 & OR 201/178 & CASE #2009-DR-784 OR 1687/534 1978 ALA DWMH TOWN OF HILLIARD ==================================== 543 08-3N-24-2380-0203-0080 41.44 DUNN MITCHELL & 0.000AC MCHENRY SCOTT ANDREW 1550 MARS EVANS CITY RD EVANS CITY PA 16033 BLOCK 203 LOT 8 IN OR 1998/935 TOWN OF HILLIARD ==================================== 544 08-3N-24-2380-0203-0100 408.76 DUNN MITCHELL & 0.000AC MCHENRY SCOTT ANDREW 1550 MARS EVANS CITY RD EVANS CITY PA 16033 BLOCK 203 LOTS 10 THRU 12 IN OR 1998/935 TOWN OF HILLIARD 1986 CUMB SWMH ==================================== 545 08-3N-24-2380-0208-0040 41.44 KELLY JEAN VALERIE 0.000AC C/O MICHAEL KELLY 1220 PARK AVE #7D NEW YORK NY 10128-0716 BLOCK 208 LOT 4 TOWN OF HILLIARD ==================================== 546 08-3N-24-2380-0214-0070 1,572.84 JAN INVESTMENT GROUP INC 0.000AC PO BOX 455 CALLAHAN FL 32011 BLOCK 214 LOTS 7 THRU 12 IN OR 1894/1337 TOWN OF HILLIARD SEC 8-3N-24E ==================================== 547 08-3N-24-2380-0218-0010 1,751.92 SCAFF CHARLES R II 0.000AC 27193 FOURTEENTH AVE W HILLIARD FL 32046 BLOCK 218 LOTS 1 TO 6 IN OR 2076/1115 TOWN OF HILLIARD ==================================== 548 08-3N-24-2380-0219-0210 HX 301.73 HESS JEANNIE 0.000AC 27730 KENTUCKY ST HILLIARD FL 32046 BLOCK 219 LOTS 21 THRU 24 & LOTS 13 THRU 20 OR 683/64 & OR 714/1207 & OR 714/1207 & OR 761/1469 & OR 1555/439 {R622055 & R622056 & R622057} TOWN OF HILLIARD ==================================== 549 08-3N-24-2381-0001-0000 747.94 GUYNN GERALD J & DAPHNE M 0.000AC PO BOX 1344 HILLIARD FL 32046-1344 LOTS 1 & 2 IN OR 1765/563 BUSINESS LOTS S/D OF TOWN OF HILLIARD PBK 1/28 ==================================== 550 08-3N-24-2381-0003-0000 457.44 GUYNN GERALD J & DAPHNE M 0.000AC PO BOX 1344 HILLIARD FL 32046-1344 LOT 3 IN OR 1765/564 BUSINESS LOTS S/D OF TOWN OF HILLIARD PBK 1/28 ==================================== 551 08-3N-24-2420-000E-0140 155.69 SAMPSON JAMES A & STACY LEIGH 0.000AC 37207 CYPRESS STREET HILLIARD FL 32046 LOT 14 IN OR 847/1403 DELLA WARE HEIGHTS SUB PB 3/60 ==================================== 552 08-3N-24-2440-0006-0020 HX 536.41 FOSSICK DEBORAH G 0.000AC PO BOX 1004 HILLIARD FL 32046-1004 SUB LOT E WALKER SUB UNR A/K/A PT OF LOTS 6 & 7 (S-2) OR 291 PG 150 REPLAT OF LOTS 6 THRU 11 HILLIARD TERRACE SUB PB O/15 ==================================== 553 09-3N-24-0000-0004-0070 HX 1,049.00 TERRELL ALVIN D JR & BARBARA L 1.140AC 371440 EASTWOOD RD HILLIARD FL 32046 PT OF NE1/4 IN OR 1813/1065 ==================================== 554 09-3N-24-0000-0020-0000 100.88 DONELY DAVID EST 0.000AC 37060 OXFORD ST HILLIARD FL 32046 IN OR 3 PG 408 CO REC ==================================== 555 09-3N-24-0000-0022-0010 60.33 ANDERSON JAMES A 0.000AC PO BOX 842 HILLIARD FL 32046 IN OR 790 PG 1794 ==================================== 556 09-3N-24-2480-000A-0000 HX 1,613.67 MCLEMORE CHARLES L & EVELYN 0.000AC 37286 MILL STREET HILLIARD FL 32046 PT OF TRACT A & S1/2 LOT 18 & ALL LOTS 19 & 20 & PT LOT 21 IN OR 1244/1117 ESMT OR 1535/1339 POINSETTA PARK SUB 3/68 ==================================== 557 09-3N-24-2480-0018-0010 167.92 MCLEMORE CHARLES L & EVELYN L 0.000AC 37286 MILL STREET HILLIARD FL 32046 N1/2 OF LOT 18 IN OR 1277/1839 PONSETTIA PARK PB 3/68 ==================================== 558 10-3N-24-073A-0001-0000 HX 252.72 GREENWELL KEVIN 1.060AC 151040 COUNTY ROAD 108 HILLIARD FL 32046-6913 LOT 1 IN OR 847/259 R787320 & R787321 HENDRICKS ACRES PB 6/91 ==================================== 559 10-3N-24-0775-0005-0000 539.16 DUBOSE KAREN 1.070AC 151084 CR 108 HILLIARD FL 32046 LOT 5 IN OR 859/945 EX R/W IN OR 860/1122 HOG HILL #1 PB 5/327 ==================================== 560 10-3N-24-2320-0040-0020 HX 551.45 SMITH BRANDON K & DEANNA M 3.000AC 37076 MUNDEE PLACE HILLIARD FL 32046 PT OF LOT 40 IN OR 1637/1305 R672172 & 672173 2009 FLEET SW/MH EX 40-5 DUNN SURVEY ==================================== 561 10-3N-24-2320-0040-0040 546.54 ROBERTSON CYNTHIA T 1.120AC PO BOX 554 HILLIARD FL 32046-0554 PT OF LOT 40 IN OR 1163/721 DUNN SURVEY ==================================== 562 10-3N-24-2320-0040-0050 HX 165.65 HAND BEVERLY J 2.000AC 37030 MUNDEE PLACE AUDT HILLIARD FL 32046 PT OF LOT 40 (S-5) IN OR 1637/1307 1995 FLEE SW/MH DUNN SURVEY ==================================== 563 10-3N-24-2320-0041-0040 HX 76.13 ORENDER MICHAEL R & JANINE A 1.580AC 371067 EASTWOOD RD HILLIARD FL 32046 PT OF LOT 41 IN OR 2033/1916 DUNN SURVEY ==================================== 564 10-3N-24-2320-0042-0050 HX 79.05 NUTTY RANDY A 2.430AC 371049 EASTWOOD ROAD HILLIARD FL 32046 PT OF LOT 42 R583668 IN OR 699 PG 359 DUNN SURVEY ==================================== 565 10-3N-24-2320-0043-0030 917.02 SELLERS TINA & 2.770AC VANGORDER JUANITA A EST 37172 BULFORD ROAD HILLIARD FL 32046 PT OF LOT 43 IN OR 1039/1099 R278256 & R278257 DUNNS SURVEY ==================================== 566 15-3N-24-0000-0002-0000 168.17 OKEFENOKEE II L C 1.140AC PO BOX 50338 JACKSONVILLE BEACH FL 32240 PT OF NW1/4 OF NW1/4 OF SEC 15-3N-24E IN OR 1287/886 (EX PT IN OR 1115/1455 & OR 1148/729) ==================================== 567 15-3N-24-0000-0002-0040 1,893.83 OKEFENOKEE II LC 25.270AC PO BOX 50338 JACKSONVILLE BEACH FL 32250 PT OF NW1/4 OF SEC 15-3N-24E IN OR 557/520,OR 557/527) ==================================== 568 15-3N-24-0000-0002-0050 47.11 OKEFENOKEE II L C 0.000AC PO BOX 50338 JACKSONVILLE BEACH FL 32240 PT OR 956/1102 ESMT OR 557/527 WATER TREATMENT PLANT ==================================== 569 15-3N-24-0000-0002-0060 158.62 OKEFENOKEE II L C 1.060AC PO BOX 50338 JACKSONVILLE BEACH FL 32240 PT OF NW1/4 OF NW1/4 OF SEC 15-3N-24E IN OR 1115/1455 (EX PT IN OR 1148/729) ==================================== 570 15-3N-24-0000-0006-0000 2,367.12 WELLS VIRGINIA J EST 0.000AC 551090 US HWY 1 HILLIARD FL 32046-8293 IN OR 1114/852 ==================================== 571 15-3N-24-2320-0017-0030 3,052.54 HAMMAGE & SKEET LLC 4.150AC 4225 N PEARL STREET JACKSONVILLE FL 32206-6411 ALL LOT 17 W OF HWY & ALL LOT 18 W OF HWY S-2 IN OR 1473/1633 497572 & 497573 & R497574 & 497575 & 497576 DUNN SURVEY ==================================== 572 16-3N-24-0000-0006-0270 HX 769.23 SIMS PATRICK E 1.090AC 3786 JOY LANE HILLIARD FL 32046 PT OF NE1/4 OF NW1/4 IN OR 1376/771 ==================================== 573 16-3N-24-0000-0006-0290 321.79 SIMS PATRICK 1.000AC 3786 JOY LANE HILLIARD FL 32046 PT OF NE1/4 OF NW1/4 IN OR 1577/775 ==================================== 574 16-3N-24-0000-0015-0000 294.92 NICKS JAMES C JR & BETTY M 1.770AC 15801 CR 108 HILLIARD FL 32046 IN OR 137 PG 42 (EX 15-2) ==================================== 575 16-3N-24-0000-0015-0010 636.15 GUYNN SHELTON 5.000AC 17106 GUYNN DR HILLIARD FL 32046 IN OR 2040/1339 ==================================== 576 16-3N-24-0000-0024-0050 229.54 SMALLWOOD CHARLES A 0.000AC 540 NE 45TH CT OCALA FL 34470 PT OF S1/2 OF NE1/4 OF SE1/4 OF SEC 16-3N-24E IN OR 1998/844 ==================================== 577 16-3N-24-1270-0004-0000 1,768.56 ALESSI MICHAEL 0.000AC 37166 LORENA DRIVE HILLIARD FL 32046 LOT 4 IN OR 1651/1375 ESMTS PT OR 899/471 & 474 LORENA SUB PB 5/313 ==================================== 578 16-3N-24-1270-0014-0000 1,487.87 MUMFORD MELISSA 0.000AC 3755 LORENA AVE HILLIARD FL 32046 LOT 14 IN OR 1458/243 LORENA SUB PB 5/313 ==================================== 579 16-3N-24-2020-0034-0030 886.31 LATHAM EMILY EST 0.000AC C/O ALLAN DALE LATHAM & 45208 BISMARK RD CALLAHAN FL 32011 PT OF LOT 34 IN DBK 272/54 CORNWALL SURVEY S/D OF SEC 16-3N-24E PBK O/31 ==================================== 580 16-3N-24-2320-0001-0000 594.09 NYREN GERALD 16.540AC 3911 PARK STREET JACKSONVILLE FL 32205 LOTS 1 & PT OF LOTS 2 & 3 IN OR 357/542 EX S-1 & S-2 OF LOTS 1 & 2 EX S-1 & S-2 OF LOT 3 DUNN SURVEY ==================================== 581 16-3N-24-2320-0001-0020 244.22 NYREN GERALD 1.250AC 3911 PARK STREET JACKSONVILLE FL 32205 PT OF LOTS 1 & 2 (S-2) PT OR 357/542 DUNN SURVEY ==================================== 582 16-3N-24-2320-0002-0010 379.41 OKEFENOKEE II L C 4.340AC PO BOX 50338 JACKSONVILLE BEACH FL 32240 PT OF LOTS 2 & 3 PT OR 956/1102 SEWER PLANT DUNNS SURVEY ==================================== 583 16-3N-24-2320-0003-0020 80.83 NYREN GERALD 0.230AC 3911 PARK STREET JACKSONVILLE FL 32205 PT OF LOT 3 (S-2) PT OR 357/542 DUNN SURVEY ==================================== 584 16-3N-24-2580-0029-0020 HX 872.88 BOWMAN WENDY 0.000AC 37017 LITTLE MAGNOLIA CT HILLIARD FL 32046 PT OF LOT 29 & 30 IN OR 2010/1678 SUB OF NW 1/4 PB 1/3 ==================================== 585 17-3N-24-2020-0022-0040 HX 539.23 RIVER CITY HOLDINGS LLC 1.050AC 9378 ARLINGTON EXPRESSWAY #311 JACKSONVILLE FL 32225 PT OF THE N1/2 OF THE S1/2 OF NE1/4 OF SW1/4 OF SEC 17-3N-24E IN OR 2134/171 AKA LOT 22 CORNWALL FARM LAND COMPANY PBK O/31 ==================================== 586 17-3N-24-2020-0037-0000 HX 627.28 STOKES RAYMOND CHRISTOPHER 10.000AC 27138 BENT CREEK CIRCLE HILLIARD FL 32046 LOT 37 IN OR 448 PG 666 CORNWALL SURVEY S/D OF SEC 17-3N-24E PBK O/31 ==================================== 587 17-3N-24-2020-0053-0100 230.95 HOLDEN DAVID & MELISSA 0.750AC 3799 FRIENDSHIP DR HILLIARD FL 32046 PT OF LOT 53 (S-10) IN OR 1298/1704 CORNWALL SURVEY ==================================== 588 17-3N-24-2020-0055-0020 1,209.71 WEST JAMIE L L/E 1.000AC 36433 PINE ST HILLIARD FL 32046 PT LOT 55 IN OR 2061/72 CORNWALL SURVEY OF SEC 17-3N-24E S/D PBK O/31 ==================================== 589 17-3N-24-2020-0057-0000 6,057.88 HILLIARD LLC 40.000AC 5639 COLDSTREAM CT JACKSONVILLE FL 32222 LOTS 57 58 59 & 60 OR 1240/367 & PT OR 1240/356 (EX R/W OR 78/549 & OR 78/551) ESMTS OR 354/254 & OR 451/327 CORNWALL SURVEY ==================================== 590 17-3N-24-2640-0002-0100 46.86 CHRISTENSEN EMMA MRS 0.070AC C/O MILDRED KLEBER 3350 LAKEVIEW DRIVE SUAMICO WI 54173 BLOCK 2 LOT 10 SOUTH HILLIARD TERRACE 3 PB 0/19 1/2 ==================================== 591 20-3N-24-0000-0007-0000 945.36 REWIS BILLY CHARLES 3.500AC 37263 TOM BROWN ROAD HILLIARD FL 32046 PT OF SE1/4 OF NE1/4 PARCELS 7 7-1 & 7-3 IN OR 1835/1644 R567578 & R567579 ==================================== 592 20-3N-24-0000-0007-0020 HX 766.23 REWIS BILLY CHARLES 4.000AC 37263 TOM BROWN ROAD HILLIARD FL 32046 PT OF SE1/4 OF NE1/4 OR 136/20 L/E & OR 726/1175 ==================================== 593 20-3N-24-2020-0023-0010 HX 1,003.60 HOBBS BENJAMIN FRANKLIN & 2.260AC HOBBS GORDON F & CONNIE(JT/RS) 15616 CR 108 HILLIARD FL 32046 IN OR 2102/145 CORNWALL SURVEY PB O/31 ==================================== 594 20-3N-24-2020-0046-0000 HX 488.08 HODGES WILL RANDALL & 10.000AC LISA K & HODGES ISOM ZANE 15595 COUNTY ROAD 108 HILLIARD FL 32046 LOT 46 IN OR 1195/801 1997 WEST SW/MH & 1985 SHOW SW/MH CORNWALL SURVEY ==================================== 595 20-3N-24-2020-0047-0000 HX 519.33 GILL TROY V SR & DONNA E H 10.000AC 15585 CR 108 HILLIARD FL 32046 LOT 47 IN OR 1392/775 R583352 & R583353 CORNWALL SURVEY ==================================== 596 21-3N-24-2020-0051-0010 HX 217.26 BELL WENDY MICHELLE 1.000AC 457648 OLD DIXIE HWY HILLIARD FL 32046 PT OF LOT 50 IN OR 1817/256 R378292 & R378291 CORNWALL SURVEY SEC 21-3N-24E PBK O/31 ==================================== 597 21-3N-24-2020-0063-0030 2,791.90 AACTION RECYCLING CORPORATION 3.150AC 1405 CR 210 W JACKSONVILLE FL 32259 PT OF LOTS 63 & 64 IN OR 2066/302 CORNWALL SURVEY PB 0/31 ==================================== 598 22-3N-24-2320-0006-0010 771.01 BEST CAROLINE EST 3.000AC 94070 WINTERBERRY AVE FERNANDINA BEACH FL 32034 PT LOTS 6,7 & 8 PAR 6-1 IN OR 411/100 DUNNS SURVEY DBK B-10/48 ==================================== 599 22-3N-24-2320-0010-0020 1,328.25 SCOTT JEANNE 0.000AC PO BOX 1199 HILLIARD FL 32046-1199 PT OF LOTS 10 & 11 PAR 10-2 IN OR 1502/260 DUNNS SURVEY DBK B-10/48 ==================================== 600 24-3N-24-0000-0002-00M0 42.91 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 SE1/4 NW1/4 OF NW1/4 PT OR 1313/689 1/3 INT 200 ACRES PARCELS 2 & PT OF 4 (53.33 INT) MINERAL RIGHTS ONLY ==================================== 601 26-3N-24-2300-0017-0040 491.95 HARTLEY JAMES F JR EST 1.260AC 37157 PINERIDGE RD HILLIARD FL 32046-6449 PT OF E 1/2 OF LOT 17 S-4 IN OR 796/1899 R277985 MAP OF TWNS 3 4 5 RG 23 & 24 ==================================== 602 26-3N-24-2300-0018-0010 HX 174.83 SEYMOUR HELEN 1.250AC 36001 LEAFY LANE CALLAHAN FL 32011 W1/2 OF LOT 18 IN OR 774 PG 716 R673568 & R673569 EX S-2 S-5 & S-6 MAP OF TWNS 3 4 5N R 23 24 ==================================== 603 26-3N-24-2300-0018-0030 HX 477.33 PERKINS SANDRA M & 2.500AC STOCKER MARY (D&M) 36624 PATSY LANE CALLAHAN FL 32011 E1/2 OF LOT 18 (S-3) IN 0R 1234/36 R359365 & R359366 ESMT OR 1621/1097 MAP OF TWNS 3 4 & 5 RG 23 & 24 ==================================== 604 26-3N-24-2300-0018-0050 542.76 SEYMOUR HELEN AGNES 1.250AC 36001 LEAFY LN CALLAHAN FL 32011 PT OF LOT 18 IN OR 774 PG 413 R106550 & R106551 MAP OF TWNS 3-5 RG 23 & 24 ==================================== 605 26-3N-24-2300-0019-0020 HX 79.34 REYNOLDS WALLACE T 2.500AC 36564 PATSY LANE CALLAHAN FL 32011 S 165 FT OF E1/2 OF LOT 19 IN OR 424/563 R407852 R407853 MAP OF TWNS 3 4 5N RGS 23 & 24 ==================================== 606 26-3N-24-2300-0022-0040 1,065.21 BOYLES GLEN E 1.000AC 36328 PATSY LN CALLAHAN FL 32011 S116 FT OF W375 FT OF N264 FT OF E1/2 OF LOT 22 IN OR 2081/1008 2001 WSTN SW/MH MAP OF TWNS 3-5N & RG 23 & 24 ==================================== 607 27-3N-24-0000-0001-0000 HX 662.29 MILLER DWAINE K 2.000AC 36144 PRATT SIDING ROAD CALLAHAN FL 32011 PT OF NW1/4 OF NE1/4 E OF ACL R/W IN OR 1535/1513 PARCELS 1 1-7 & 1-11 ==================================== 608 27-3N-24-0000-0001-0040 1,297.80 FIGUEIRA FELIPE & 10.000AC TRIMINO-MARTINEZ MAILET (H&W) 141 E 44TH ST JACKSONVILLE FL 32208 PT OF NW1/4 OF NE1/4 IN OR 1866/1289 ==================================== rf rfntb DEL. TAX LIST 2017.indd 4 4/30/18 12:20 PM

PAGE 65

609 27-3N-24-2020-0037-0010 HX 666.05 MANN ROBERT D 3.100AC 36748 WEDGEWOOD WAY CALLAHAN FL 32011 PT OF LOT 37 IN OR 1552/956 R673154 & R673155 ESMT PT OR 1861/825 CORNWALL SURVEY ==================================== 610 27-3N-24-2020-0057-0010 HX 406.27 WILKES PAUL B 6.870AC P O BOX 1415 HILLIARD FL 32046 PT OF LOT 57 (S-1) & PT OF LOT 40 IN OR 1358/1624 1997 WEST SW ESMT PT OR 1861/825 CORNWALL SURVEY ==================================== 611 27-3N-24-2020-0057-0040 HX 1,631.81 BROUGHTON RONALD D JR & 1.840AC BROUGHTON SHANNON Y 37060 PEANUT TRAIL CALLAHAN FL 32011 PT OF LOTS 57 & 40 IN OR 1407/1786 ==================================== 612 27-3N-24-2020-0061-0020 HX 816.98 HENRY ANNETTE A 15.000AC 36117 VICTORY LN CALLAHAN FL 32011 W1/2 OF LOTS 61 62 & 63 IN OR 576 PG 1218 R407712 R407710 R407711 & R622293 & R622294 CORNWALL SURVEY ==================================== 613 27-3N-24-2020-0062-0020 2,735.35 PORTER MATTHEW B & CONNIE FAYE 10.000AC 36001 ALDERWOOD STREET CALLAHAN FL 32011 PT OF LOTS 62 63 & 64 IN OR 583 PG 82 CORNWALL SURVEY PB 0/31 ==================================== 614 28-3N-24-0000-0001-0040 1,641.44 JOHNSON VERNON TRUSTEE OF 4.890AC 3658 BLUEBERRY LANE LAND TRUST 2657 SNAIL KITE COURT ST AUGUSTINE FL 32092 W1/2 OF NW1/4 OF NE1/4 OF SE1/4 PAR 1-4 IN OR 1763/1852 ESMT OR 562/734 ==================================== 615 28-3N-24-0000-0001-0100 538.03 CRANE THOMAS PAUL 1.890AC 618351 MARTIN LUTHER KING AVE CALLAHAN FL 32011 PT OF NE1/4 OF SE1/4 PT OR 998/172 ==================================== 616 28-3N-24-0000-0001-0200 422.52 CRANE THOMAS PAUL 1.000AC 618351 MARTIN LUTHER KING AVE CALLAHAN FL 32011 PT OF NE1/4 OF SE1/4 PT OR 998/172 ==================================== 617 28-3N-24-2020-0043-0020 420.93 SKELTON MARCUS E & KATIE MARIE 2.190AC 37191 S OAK STREET HILLIARD FL 32046-7776 E1/2 OF LOT 43 PT OR 1749/1421 EX S-3 & S-4 CORNWALL SURVEY ==================================== 618 28-3N-24-2020-0044-0010 857.39 SKELTON MARCUS E & KATIE MARIE 1.970AC 37191 S OAK STREET HILLIARD FL 32046 PT OF LOT 44 PT OR 1749/1421 & ESMT OR 1753/850 (EX PT IN OR 485/162,OR 1437/95 & OR 1879/645 & ESMT PT OR 664/389) CORNWALL SURVEY PBK O/31 ==================================== 619 29-3N-24-0000-0003-0060 1,198.18 CARTER KENNETH WYATT 1.380AC 26216 H A STOKES RD HILLIARD FL 32046 PT OF SE1/4 OF NW1/4 IN OR 2072/603 ==================================== 620 29-3N-24-2020-0012-0020 288.42 BROWN IDA E STOKES EST 0.000AC 11321 LANDING ESTATES DR JACKSONVILLE FL 32257 PT OF LOTS 12 & 13 (EX 12-4) IN OR 395 PG 1 RP 305 CORNWALL SURVEY ==================================== 621 29-3N-24-2020-0020-0000 2,957.17 CONFIDENTIAL 50.000AC CONFIDENTIAL ==================================== 622 29-3N-24-2020-0032-0030 HX 1,623.55 MCCULLOUGH DOUGLAS M 5.160AC 15561 CR 108 HILLIARD FL 32046 PT OF LOT 32 (S-3) IN OR 1113/865 EX S-4 CORNWALL SURVEY ==================================== 623 29-3N-24-2020-0032-0040 373.15 MCCULLOUGH DOUGLAS MARK 1.490AC 15561 CR 108 HILLIARD FL 32046 PT OF LOT 32 (S-4) IN OR 1913/1 CORNWALL SURVEY ==================================== 624 30-3N-24-0000-0007-0020 41.85 SPANN GARY H & ELIZABETH A 0.430AC 3131 COSBY HIGHWAY COSBY TN 37722 PT OF SE1/4 PT OR 337 PG 262 EX 7-7 7-17 7-18 7-19 & 7-20 ==================================== 625 36-3N-24-0000-0001-0000 2,248.60 JONES DOUGLAS Z 74.940AC 361293 M SIKES ROAD CALLAHAN FL 32011-3505 NE1/4 OF NE1/4 NW1/4 OF NE1/4 IN OR 1589/1073 ESMT OR 1601/115 EX 1-1 ==================================== 626 37-3N-24-0000-0003-0000 2,907.04 TANNER HENRY 1.600AC 545760 US HWY 1 CALLAHAN FL 32011 IN OR 1621/1092 & OR 1941/441 ESMT IN OR 374/2 ==================================== 627 37-3N-24-0000-0005-0000 221.93 HENDERSON CECIL R & BETTIE H 0.580AC CO-TRUSTEES OF CECIL HENDERSON 36363 PRATTSIDING ROAD CALLAHAN FL 32011 IN OR 787/1058 ESMT IN OR 374/3 EX 5-1 & 5-2 ==================================== 628 37-3N-24-0000-0005-0010 1,243.34 HENDERSON CECIL R & BETTIE H 1.020AC 36363 PRATT SIDING ROAD CALLAHAN FL 32011 IN OR 1361/728 ==================================== 629 37-3N-24-0000-0010-0030 HX 334.35 KELLY RANDY P & ROBIN 2.550AC 36001 RANMART WAY CALLAHAN FL 32011 PT WILLIAM SPARKMAN GRANT SEC 37-3N-24E IN OR 798/1082 {R613206 & R613207} ==================================== 630 37-3N-24-0000-0013-0020 845.26 BREWER DORIS L LIVING TRUST 3.210AC BREWER DORIS L TRUSTEE 36176 J W ELLIOTT DR CALLAHAN FL 32011 PT WILLIAM SPARKMAN GRANT SEC 37-3N-24E IN OR 1942/728 (EX PT IN OR 534/67, OR 935/10,OR 1303/916, OR 1363/1135 & EX TWR LEASE & ESMT IN OR 1579/1511) ==================================== 631 37-3N-24-0000-0016-0030 872.09 HOLLEY VIVIAN C (1/4 INT) & 1.000AC HOLLEY JOHN O EST (1/4 INT) & S TRANSPORTATION INC ETAL PO BOX 40 HILLIARD FL 32046-0040 IN OR 239/243 & OR 268/549 & IN OR 1342/236 ==================================== 632 37-3N-24-2710-0002-0000 HX 329.40 SAPP MELODY L 1.200AC 36341 HOLIDAY DRIVE CALLAHAN FL 32011 LOT 2 IN OR 804 PG 355 R583756 & R583757 HOLIDAY ACRES SUB PB 4/50 ==================================== 633 37-3N-24-2710-0003-0000 HX 1,209.00 SHAW DONALD GRAHAM & DAWN L 1.260AC 36315 HOLIDAY DR CALLAHAN FL 32011 LOT 3 IN OR 2018/1428 HOLIDAY ACRES SUB PB 4/50 ==================================== 634 37-3N-24-2710-0014-0000 325.57 BANNISTER ERNEST M & DENISE M 1.000AC 36031 HOLIDAY DR CALLAHAN FL 32011 LOT 14 R567598 IN OR 1197/1159 HOLIDAY ACRES SUB PB 4/50 ==================================== 635 37-3N-24-2710-0018-0000 671.52 NEVES RAYMOND H EST 3.620AC 36064 HOLIDAY DRIVE EAST CALLAHAN FL 32011 LOTS 18 & 19 R498297 IN OR 673/43 & OR 674/1921 HOLIDAY ACRES SUB PB 4/50 ==================================== 636 37-3N-24-2710-0027-0000 549.59 GATLIN LINDA 1.150AC PO BOX 715 HILLIARD FL 32046-0715 LOT 27 IN OR 1691/1297 R378190 & R378191 HOLIDAY ACRES SUB PB 4/50 ==================================== 637 37-3N-24-2720-0002-0000 561.63 PLEMMONS SHELBY JEAN PAUL EST C/O JEAN ARRINGTON 1.950AC 2841 GOLDENROD CIR W JACKSONVILLE FL 32245-4023 LOT 2 IN OR 1710/1483 ESMT IN OR 476/129 HOLIDAY TIME SUB PB 5/14 ==================================== 638 37-3N-24-2720-0005-0020 146.49 GILDNER AMY & 0.500AC MIXON KALA K & AMANDA D ET AL 45121 BROWN ST APT 103 CALLAHAN FL 32011 PT OF LOTS 5 & 6 (EX S-3) IN OR 1808/42 & OR 2061/1514 HOLIDAY TIME SUB PB 5/14 ==================================== 639 38-3N-24-0000-0004-0000 470.57 EVERLY JOHNNY & MAXINE 1.780AC 36583 DYAL RD CALLAHAN FL 32011 L/E IN OR 699/1685 EX OR 185/320 EX 4-1 & 4-2 ==================================== 640 38-3N-24-0000-0004-0010 HX 537.71 EVERLY JOHNNY & MAXINE 3.960AC 36583 DYAL RD CALLAHAN FL 32011 OR 188 PG 206 EX R/W IN OR 723/716 ==================================== 641 05-4N-24-0000-0001-0010 74.74 SCOTT JEANNE H & 9.000AC MILLIGAN RONALD G (W&H) PO BOX 1199 HILLIARD FL 32046-1199 PT OF SE1/4 OF NW1/4 OF SEC 5-4N-24E IN OR 1497/1479 BEING PARCEL ==================================== 642 05-4N-24-0000-0001-0040 199.00 THORNTON ARTHUR PAUL 0.680AC P O BOX 1199 HILLIARD FL 32046-1199 PT OF SW1/4 OF NE1/4 OF SEC 5-4N-24E IN OR 2061/1878 ==================================== 643 05-4N-24-0000-0006-0020 79.48 SCOTT JEANNE H & 10.000AC MILLIGAN RONALD G (W&H) PO BOX 1199 HILLIARD FL 32046-1199 PT OF SE1/4 OF NW/14 IN OR 1497/1474 ==================================== 644 05-4N-24-0000-0006-0030 532.06 SCOTT JEANNE 14.000AC PO BOX 1199 HILLIARD FL 32046-1199 PT OF SE1/4 OF NW1/4 IN OR 1448/1589 & OR 1448/1580 1988 NEWM SW/MH ==================================== 645 05-4N-24-1630-0009-0000 500.13 DAVIS MARK L EST 27.130AC 291395 PENNY HADDOCK ROAD HILLIARD FL 32046-7029 LOT 9 IN OR 679 PG 1529 PENNY HADDOCK ESTATES PB 5/338 ==================================== 646 05-4N-24-1630-0013-0000 780.01 HARRIS ELMO A 20.030AC PO BOX 1076 HILLIARD FL 32046-1076 LOT 13 (IN SEC 32-5N-24) IN OR 1245/1581 PENNY HADDOCK ESTATES PB 5/338 ==================================== 647 07-4N-24-0000-0006-0150 664.70 PURVIS WILLIAM B & SYBIL H 1.250AC 36002 DUSDEE WILLOWS LANE CALLAHAN FL 32011 PT GOVT LOT 4 OF SEC 7-4N-24E IN OR 1382/1828 {2001 NOBI-DW} ==================================== 648 07-4N-24-0000-0009-0000 346.15 KEENE HAL L JR 2.460AC 282131 LAKE HAMPTON ROAD HILLIARD FL 32046 IN OR 1498/1525 R/W IN OR 631/1041 EX 9-1 ==================================== 649 09-4N-24-0000-0002-0030 2,104.79 JORDAN THEODORE C & 10.000AC JORDAN AMANDA A (JT/RS) 39107 HIERS WAY HILLIARD FL 32046 NE1/4 OF NW1/4 OF SEC 9 PARCELS 2-3 & 2-17 SE1/4 OF SW1/4 OF SEC 40 PARCEL 2-3 IN OR 2008/966 R497952 & R497953 (1981 MH) 2000 PION DW/MH ==================================== 650 09-4N-24-0000-0002-0140 HX 521.00 EADY WILLIAM JR & LISA 2.480AC 39313 KOLARS FERRY ROAD HILLIARD FL 32046 PT OF NE1/4 OF NE1/4 IN OR 855/1179 2001 MERT DW/MH ==================================== 651 16-4N-24-0000-0007-0000 329.66 KELLEY ROBERT L 1.300AC 2347 WILMONT AVE JACKSONVILLE FL 32218-5166 IN OR 1351/1203 ==================================== 652 16-4N-24-0180-0004-0000 662.64 HOLSOMBACH HELEN A 1.650AC PO BOX 947 HILLIARD FL 32046-0947 TRACT 4 SEC 16-4N-24 IN OR 826/1767 R407663 BRANTLEY FARMS PB 5/97 ==================================== 653 16-4N-24-0180-0005-0000 644.07 HANNAH CLYDE C JR 1.650AC 55193 WHITE OAK PLACE CALLAHAN FL 32011 LOT 5 IN OR 837/581 R674034 & R674035 BRANTLEY FARMS PB 5/97 ==================================== 654 17-4N-24-0000-0001-0020 HX 954.82 SALIS JAMES & KAREN 4.000AC 274000 MURRHEE RD HILLIARD FL 32046 PT OF NE1/4 OF NE1/4 PARCELS 1-2 & 1-4 IN OR 2133/1337 EX R/W IN OR 634/68 EX 1-8 ==================================== 655 17-4N-24-0000-0008-0010 459.74 PARKER DOREEN EST 0.000AC 3846 COLLECTION PLACE HILLIARD FL 32046 PT SE1/4 OF SE1/4 OF SEC 17-4N-24E IN OR 579/1014 {R407788 & R497468} ==================================== 656 18-4N-24-0000-0004-0010 HX 1,026.73 WILCOX RICHARD T & 4.000AC CHURCH KAREN K 29946 PIGEON CREEK RD HILLIARD FL 32046 PARCELS 4-1 & 4 IN OR 1639/173 EX FPL ESMT OR 328/376 & OR 332 PG 156 EX ESMT PT OR 673/945 ESMT IN OR 875/1781 ESMT PT OR 1371/928 & ESMT PT OR 1370/1480 EX 4-3 & 4-4 ==================================== 657 19-4N-24-0000-0004-0030 HX 2,035.36 ANDREU ALAN A 25.000AC 554041 US HWY 1 NORTH HILLIARD FL 32046 PT GOVT LOTS 11 & 12 OF SEC 19-4N-24E IN OR 1112/1681 (EX UTIL ESMT IN OF 1321/1970) {1994 EAGL DW/MH} ==================================== 658 19-4N-24-1212-0013-0000 HX 272.24 BLANCHARD JAMES M 1.040AC 5785 NEWELL RD FOLKSTON GA 31537 LOT 13 IN OR 2104/1850 1999 OAKWO DW/MH LAKE HAMPTON HILLS PB 6/2 ==================================== 659 19-4N-24-1212-0015-0000 580.57 STUTSMAN KELLI ELAINE 1.040AC 553936 US HWY 1 HILLIARD FL 32046 LOT 15 IN OR 1687/402 2002 WFLD SW/MH LAKE HAMPTON HILLS PB 6/2 ==================================== 660 21-4N-24-0000-0005-0010 804.15 MCLENDON LUTHER SPAULDING III & ERIC PAUL MCLENDON 7.860AC 18401 CONNER RD HILLIARD FL 32046-5647 PARCELS 5-1 & 6-2 IN 21-4N-24 & PARCEL 2-1 IN SEC 39-4N-24 IN OR 887/389 ==================================== 661 21-4N-24-0000-0005-0020 102.41 KING SHAUN ALAN & AMBER NICOLE 0.410AC 680 SNOWDEN RD FOLKSTON GA 31537 PT GOVT LOT 5 IN OR 1979/259 ==================================== 662 24-4N-24-0000-0006-0010 1,213.27 BRADDOCK CLAUDINE P EST 10.000AC C/O DONALD G BRADDOCK 45134 BOOTH ST CALLAHAN FL 32011 PT GOVT LOT 3 IN OR 391/300 (BY WILL) ==================================== 663 25-4N-24-2020-0003-0010 947.84 FOLEY PETER BRUCE EST 6.640AC 38084 DAHOMA RD HILLIARD FL 32046 PT OF LOT 3 EX S-4 IN OR 653/869 R 107342 & 107343 ==================================== 664 28-4N-24-2020-0004-0030 641.05 PERMIS PASCAL & MICHELINE 6.200AC 15248 SW MYRTLE DR INDIAN TOWN FL 34956 LOTS 4 5 & 6 LYING WEST OF & ADJACENT TO CONNER MURRHEE RD IN OR 1325/388 CORNWALL SURVEY ==================================== 665 30-4N-24-0000-0004-0000 3,619.28 MUHEISEN NAJHY 9.000AC 4046 MISSION HILLS JACKSONVILLE FL 32225 IN OR 2010/1108 ==================================== 666 30-4N-24-0000-0008-0000 686.92 HOLOKA NAOMI EST 5.000AC C/O DAVID HOLOKA 1341 WOODRUFF AVE JACKSONVILLE FL 32205 PT GOVT LOT 3 OF SEC 30-4N-24E IN OR 405/243 (EX PT IN OR 58/341) ==================================== 667 30-4N-24-0000-0009-0000 1,371.39 HOLOKA NAOMI EST 2.720AC C/O DAVID HOLOKA 1341 WOODRUFF AVE JACKSONVILLE FL 32205 PT GOVT LOTS 3,6 SEC 30-4N-24E IN OR 58/341 ==================================== 668 30-4N-24-0000-0013-0010 981.23 HOGAN LARRY 1.010AC 28104 JACKSON TRAIL HILLIARD FL 32046 PT OF GOVT LOT 8 IN OR 2001/1706 2009 FLTWD DW/MH UTILITY ESMT IN OR 993/84 (EX 13-3) ==================================== 669 30-4N-24-2740-0001-0000 891.56 HOLLEY MARCUS W 3.000AC PO BOX 940 HILLIARD FL 32046-0940 LOTS 1 & 2 IN OR 2117/190 ST MARYS HEIGHTS SUB PB 3/36 ==================================== 670 30-4N-24-2740-0003-0000 667.41 SNIPES VELAR O EST 3.080AC C/O BARBARA A BAUGH 10222 WESTMAR RD JACKSONVILLE FL 32218 LOTS 3 & 4 IN OR 863/211 R672863 & R672864 ST MARYS HEIGHT SUB PB 3/36 ==================================== 671 30-4N-24-2740-0020-0010 1,312.50 HADDOCK BRANDI DALE & 14.220AC KITTRELL J B 27359 GEIGER ROAD HILLIARD FL 32046 PT OF LOT 20 & ALL LOTS 21 THRU 23 IN OR 2108/707 ST MARYS HEIGHT SUB PB 3/36 & PT IN DB 63/292 E OF US 1 & PT WILLIAM HOGAN GRANT IN SEC 38-4N-24E (EX OR 62/308 & EX 4-2 & 4-3) ==================================== 672 31-4N-24-0000-0002-0000 2,354.61 HADDOCK RODNEY D 1.940AC 27359 GEIGER RD HILLIARD FL 32046 PT OF NE1/4 IN OR 1597/904 EX 2-1 ==================================== 673 31-4N-24-2020-0062-0020 86.94 DEMAGGIO PETE 0.240AC 3760 HIGGINBOTHAM ROAD HILLIARD FL 32046 LOT 62 W OF US 1 (S-2) IN OR 1396/764 EX RR/RW & 62-3 ESMT PT OR 1861/825 CORNWALL SURVEY PB 0/31 ==================================== 674 32-4N-24-0000-0003-0020 263.25 ALDERMAN KENNETH W 1.010AC 27184 MURRHEE ROAD HILLIARD FL 32046 PT OF SW1/4 IN OR 1630/1903 ==================================== 675 32-4N-24-0000-0005-0010 1,886.20 TANNER HENRY 7.550AC 545760 US HWY 1 CALLAHAN FL 32011 IN OR 1988/773 ESMT PT OR 1861/825 ==================================== 676 32-4N-24-0000-0017-0040 689.72 LOWERY LEE D & DOROTHY O 2.000AC 37116 POWER DRIVE HILLIARD FL 32046 PT OF GOVT LOT 3 IN OR 799 PG 1174 EX 17-5 ESMT PT OR 1572/1791 ==================================== 677 32-4N-24-2020-0008-0020 887.97 MOWERY JOSEPH L 2.000AC 2550 PLOVER RD WISCONSIN RAPIDS WI 54494 N PT OF LOT 8 W OF HWY IN OR 1989/1683 CORNWALL SURVEY ==================================== 678 34-4N-24-2020-0005-0000 66.39 LSF9 MASTER PARTICIPATION TRST US BANK TRUST N A TRUSTEE 0.140AC 3701 REGENT BLVD IRVING TX 75063 PT OF TRACT 5 LYING SE OF SR 115A IN OR 2026/897 CORNWALL SURVEY ==================================== 679 34-4N-24-2020-0008-0020 1,669.80 JOHNSON VERNON 5.580AC 3658 BLUEBERRY LN HILLIARD FL 32046 PT OF LOTS 8 & 9 (S-2) IN OR 2021/1503 CORNWALL SURVEY 2000 CMH DW/MH ==================================== 680 34-4N-24-2020-0011-0010 107.04 REED FLAVIUS THOMAS 11.660AC 37028 TRACTOR LN HILLIARD FL 32046 E1/2 LOT 11,PT E1/2 OF LOT 12 OF CORNWALL SURVEY PBK O/31 & & PT SW1/4 OF SW1/4 OF SEC 34-4N-24E IN OR 1927/981 & ESMT IN OR 533/835 ==================================== 681 38-4N-24-0000-0001-0000 429.50 WALKER JEREMY LOUIS 1.000AC 28683 DAVIS RD HILLIARD FL 32046 PT WM HOGAN GRANT SEC 38 PAR 1 & PT THOMAS PREVALL GRANT IN OR 2021/269 & 2-2) 1987 WEST SW/MH ==================================== 682 28-5N-24-0000-0001-0020 1,068.60 POTURICH NICHOLAS J & TONI A 2.130AC 210 CAHOON ROAD JACKSONVILLE FL 32220 IN OR 1520/472 PARCEL 1-2 SECS 28 & 33-5N-24 PARCEL 2-11 SEC 33-5N-24 ==================================== 683 03-1N-25-0000-0001-0060 715.01 DAVIS BILLY WAYNE 1.000AC 12605 GILLESPIE RD JACKSONVILLE FL 32218 PT SE1/4 OF SW1/4 EX 1-43 IN OR 2008/1015 R378297 & R378298 ==================================== 684 03-1N-25-0000-0001-0270 271.07 BAKER SUSAN B 1.200AC PO BOX 343 CALLAHAN FL 32011-0343 IN OR 854/55 ==================================== 685 03-1N-25-0000-0001-0310 814.38 SHAW LEWIS 1.000AC 45349 5TH AVENUE CALLAHAN FL 32011 PT OF SW1/4 IN OR 1866/1819 1995 SKYL TW/MH ==================================== 686 03-1N-25-0000-0003-0060 556.79 HALL EUGENE & 1.000AC HALL VERNON W (JT/RS) 54123 CHURCH RD CALLAHAN FL 32011 IN OR 1077/853 1974 DPST DW/MH EX R/W OR 262/87 ESMT OR 287/74 ==================================== 687 03-1N-25-0620-0001-0000 373.48 MEEKS GARY L 1.000AC 54143 HONEYSUCKLE LANE CALLAHAN FL 32011 LOT 1 R497590 IN OR 729 PG 1557 GARDEN POINT PB 5/94 ==================================== 688 03-1N-25-0620-0006-0000 HX 478.45 MEEKS GARY L 1.000AC 54051 HONEYSUCKLE LANE CALLAHAN FL 32011 LOT 6 2001 FLEETWOOD DW IN OR 600/432 & 434 GARDEN POINT PB 5/94 ==================================== 689 03-1N-25-0621-0007-0000 HX 159.23 PHILLIPS STEPHEN 1.070AC 54203 HUCKLEBERRY LANE CALLAHAN FL 32011 LOT 7 IN OR 1232/897 R673466 & R673467 GARDEN POINT UNIT 2 PB 6/151 ==================================== 690 03-1N-25-1421-0004-0000 HX 452.30 JOHNSON TONY M & TONI D 1.160AC 54267 CHURCH RD CALLAHAN FL 32011 LOT 4 2001 FLTWD DW IN OR 732 PG 1310 NATURE TRAIL #2 PB 5/403 ==================================== 691 03-1N-25-2750-0003-0000 588.04 BROWN ROBYN L 1.000AC 85362 JOANN ROAD YULEE FL 32097 TRACT 3 (EX S-2) IN OR 1207/1153 1983 DUTCH DW/MH CRAVEY SUB UNR ==================================== 692 03-1N-25-2752-0017-0000 1,274.08 HELBERT SEAN 1.000AC 77089 PARKER RD YULEE FL 32097 LOT 17 2003 MERT DW IN OR 1993/1546 CASE NO 05-304-DR CRAVEY SUB 2 UNR ==================================== 693 03-1N-25-2752-0026-0000 HX 107.92 ROBERSON ALICE FAYE & 1.000AC AUSTIN TAMMY (JT/RS)(M&D) 54556 CHURCH ROAD CALLAHAN FL 32011 LOT 26 R224340 IN OR 1404/1677 CRAVEY SUB 2 UNR ==================================== 694 03-1N-25-2752-0027-0000 HX 1,405.42 MYERS CHARLES R & 1.000AC MYERS ANDRIA & ROBERT (JT/RS) 54572 CHURCH ROAD CALLAHAN FL 32011 LOT 27 IN OR 1175/1860 ESMT OR 416/635 CRAVEY SUB 2 UNR ==================================== 695 03-1N-25-2752-0030-0000 HX 64.96 DRURY DIANE LAVERNE 1.520AC 54561 CHURCH ROAD CALLAHAN FL 32011 LOT 30 R106805 IN OR 643 PG 974 CASE NO 91-22-CA CRAVEY SUB 2 UNR ==================================== 696 03-1N-25-2752-0042-0000 635.02 GORDEN MARY & BARRY 1.500AC 1101 W 1ST ST MIDWAY GA 31320 LOT 42 R106966 IN OR 1876/426 CRAVEY SUB 2 UNR ==================================== 697 04-1N-25-0000-0006-0000 HX 538.61 OWENS MICHAEL S 2.000AC 44062 ADA ELIZABETH LN CALLAHAN FL 32011 IN OR 2078/111 RP 259 ==================================== 698 04-1N-25-2755-0020-0000 896.47 MILLER BRIAN K & 1.140AC P O BOX 1144 CALLAHAN FL 32011-1144 TRACT 20 IN OR 941/1464 CHARWOOD ESTATES PB 4/65 ==================================== 699 04-1N-25-2755-0035-0000 349.37 PETERS CLINTON 1.080AC 482 15TH AVE SOUTH JACKSONVILLE BEACH FL 32250-4921 TRACT 35 IN OR 1167/160 CHARWOOD ESTATES PB 4/65 ==================================== 700 04-1N-25-2760-0008-0030 1,493.02 MCKENDREE JOSEPH WADE & 4.260AC BELLAMY MARY CATHERINE ETAL 35199 QUAIL RD CALLAHAN FL 32011 PT LOTS 8 & 9 IN OR 1932/64 (EX PT IN OR 679/297, OR 725/200) EAST GRAY GABLES SUB PBK 2/50 ==================================== 701 04-1N-25-2760-0009-0030 HX 781.82 MCBEE MICHAEL E & JANE M 1.300AC 44182 MCKENDREE DRIVE CALLAHAN FL 32011 PT OF LOTS 9 & 10 IN OR 679 PG 297 EAST GRAY GABLES SUB PB 2/50 ==================================== 702 04-1N-25-2760-0013-0020 5,601.10 GREEN JOSEPH BRIAN 0.000AC 541064 US HWY 1 CALLAHAN FL 32011 SW 313 FT OF LOT 13 EX R/W IN OR 1445/288 EAST GRAY GABLES SUB PB 2/50 ==================================== 703 04-1N-25-2760-0014-0040 HX 1,648.54 DENHAM PERRY P & JENNIFER L 2.410AC 44127 MCKENDREE DRIVE CALLAHAN FL 32011 PT OF LOT 14 (S-4) IN OR 962/43 EAST GRAY GABLES SUB PB 2/50 ==================================== 704 04-1N-25-276C-0010-0000 HX 676.84 LUKE KENNETH CARLTON 1.180AC 44839 PINE BREEZE CIR CALLAHAN FL 32011 LOT 10 R672991 & R672992 IN OR 883/1398 AMENDED CUSHING CREEK ESTATES PB 6/92-94 ==================================== 705 04-1N-25-276C-0018-0000 477.99 CROCCO BARTHOLOMEW L & 2.270AC CROCCO BRUCE V (JT/RS) 3518 LENCZYK DR W JACKSONVILLE FL 32277 LOT 18 SEC 5-1N-25 IN OR 1796/1087 AMENDED CUSHING CREEK ESTATES PB 6/92-94 ==================================== 706 04-1N-25-276C-0029-0000 1,790.10 MULLIGAN FRANK 1.000AC 4179 SANDHILL CRANE TERRACE MIDDLEBURG FL 32068 LOT 29 SEC 5-1N-25 IN OR 1886/150 AMENDED CUSHING CREEK ESTATES PB 6/92-94 ==================================== 707 04-1N-25-276C-0042-0000 HX 333.75 STRINE TRACEY H 1.780AC 44802 PINEBREEZE CIR CALLAHAN FL 32011-5651 LOT 42 R673579 IN OR 857/625 AMENDED CUSHING CREEK ESTATES PB 6/92-94 ==================================== 708 04-1N-25-2780-0002-0000 687.56 SWEAT CHARLES & 1.480AC SWEAT JENNIFER 44014 CUSHMAN RD CALLAHAN FL 32011 LOT 2 (EX S-1) R622389 R360157 IN OR 1792/1842 EX DRNAGE ESMT OR 199/658 GRAY GABLES SUB PB 0/52 ==================================== 709 04-1N-25-2780-0003-0010 403.95 SWEAT ROBYN M EST 1.000AC 45227 ROBINWOOD CIRCLE CALLAHAN FL 32011 N1/2 OF LOT 3 (S-1) IN OR 1317/1902 GRAY GABLES SUB PB 0/52 1988 PALM DWMH ==================================== 710 04-1N-25-2780-0004-0000 547.75 FENCIK KRISTIE LEEANN 2.000AC 44725 ARTESIAN BLVD CALLAHAN FL 32011 LOT 4 IN OR 587/852 GRAY GABLES SUB PB 0/52 ==================================== 711 04-1N-25-2786-0002-0000 408.62 BURTON SANDRA 1.380AC 44030 PINEBREEZE CIR CALLAHAN FL 32011 LOT 2 IN OR 789 PG 594 MEARES MEADOWS PB 6/17-18 ==================================== 712 04-1N-25-2786-0017-0000 1,106.68 POWELL TANYA NYE 1.520AC 44329 PINEBREEZE CIR CALLAHAN FL 32011 LOT 17 1998 FLEET DW/MH IN OR 1374/1037 MEARES MEADOWS PB 6/17-18 ==================================== 713 04-1N-25-2786-0024-0000 HX 536.05 OLDAKER KATHY W 1.340AC 44187 PINEBREEZE CIRCLE CALLAHAN FL 32011 LOT 24 IN OR 1269/348 1996 NOBI DW/MH MEARES MEADOWS PB 6/17-18 ==================================== 714 04-1N-25-2786-0026-0000 HX 444.82 MONCRIEF JULIE S 1.260AC 44145 PINEBREEZE CIRCLE CALLAHAN FL 32011 LOT 26 R673186 & R673187 IN OR 792 PG 1559 MEARES MEADOWS PB 6/17-18 ==================================== 715 04-1N-25-2800-0046-0000 468.47 HART JOHN D 0.000AC 55407 SHUG RD CALLAHAN FL 32011 LOTS 46 & 47 R 673131 IN OR 784 PG 944 PINE KNOLL SUB PB 4/5 ==================================== 716 04-1N-25-2800-0051-0000 HX 1,802.00 RODGERS ANN M 0.000AC 44257 LEE DRIVE CALLAHAN FL 32011 LOTS 51 52 & 53 IN OR 706 PG 1384 PINE KNOLL SUB PB 4/5 ==================================== 717 04-1N-25-2800-0063-0000 659.32 SELF ROBERT SEAN 0.000AC 44041 LEE DR CALLAHAN FL 32011 LOT 63 (EX S-1 & S-2) IN OR 2129/1620 1985 CONC DW/MH PINE KNOLL SUB PB 4/5 ==================================== 718 04-1N-25-2820-0013-0000 HX 823.71 FRAME CHARLES 0.000AC 44086 BECKER AVE CALLAHAN FL 32011 LOTS 13 14 & 15 IN OR 936/712 PINE KNOLL UNIT # 2 PB 5/17 ==================================== 719 06-1N-25-0973-0002-0000 HX 1,073.74 TALLMAN RANDY & TARRA 5.100AC 44170 DALES PLACE CALLAHAN FL 32011 LOT 2 IN OR 1229/1522 R673870 & R673871 JONESVILLE PB 6/57 ==================================== 720 06-1N-25-199S-0001-0230 1,514.39 JAN INVESTMENT GROUP INC 0.000AC PO BOX 455 CALLAHAN FL 32011-0455 BLOCK 1 LOT 23 IN OR 1603/845 SWALLOWFORK ESTATES PB 5/305 ==================================== 721 06-1N-25-199S-0049-0000 242.19 MARTIN BERNARD KYLE 0.000AC 44387 SWALLOWFORK AVE CALLAHAN FL 32011 LOT 49 PT OR 1645/1177 (EX OR 1932/513) SWALLOWFORK ESTATES PHASE 2 PB 5/345 ==================================== 722 06-1N-25-199S-0107-0000 1,036.24 WEAKLEY ANGELA 0.000AC 95135 RAINTREE LANE FERNANDINA BEACH FL 32034 LOTS 107 & 108 IN OR 1237/402 2005 FTWD DW/MH SWALLOWFORK ESTATES PHASE 5 PB 5/348 ==================================== 723 06-1N-25-199S-0117-0000 256.16 SLUDER RALPH L JR & LISA M 0.000AC 44079 MAYHAW LANE CALLAHAN FL 32011 LOT 117 PT OR 1144/1691 SWALLOWFORK ESTATES PHASE 5 PB 5/348 ==================================== 724 06-1N-25-199S-0118-0000 498.57 SLUDER RALPH L JR & LISA M 0.000AC 44079 MAYHAW LANE CALLAHAN FL 32011 LOT 118 PT OR 1144/1691 SWALLOWFORK ESTATES PHASE 5 PB 5/348 ==================================== 725 06-1N-25-199S-0149-0000 1,096.20 SIMPKINS CREGG A 0.000AC 6172 MILTONDALE RD MACCLENNY FL 32063 LOTS 149 & 150 2000 PALM HARBOR DW/MH IN OR 1964/49 SWALLOWFORK ESTATES PHASE 5 PB 5/348 ==================================== 726 06-1N-25-199S-0168-0000 1,578.69 DALTON SEAN ALLAN FLOYD & 0.000AC JARVIS CHRISTINE M(JT/RS)ET AL 44039 BAYBERRY CT CALAHAN FL 32011 LOTS 168 & 169 IN OR 2108/1948 2007 JACO DW/MH SWALLOWFORK ESTATES PHASE 3 PB 5/346 ==================================== 727 06-1N-25-199S-0187-0000 773.58 SHEARER MATTHEW A 0.000AC 4384 BATTLECREEK CT W JACKSONVILLE FL 32258 LOTS 187 & 188 IN OR 1666/1311 1993 MERI DW/MH SWALLOWFORK ESTATES PHASE 3 PB 5/346 ==================================== 728 06-1N-25-199S-0195-0000 721.02 GLOUNER GREGORY D 0.000AC 44059 RED OAK COURT CALLAHAN FL 32011 LOT 195 IN OR 1383/1511 R787665 & R787666 SWALLOWFORK ESTATES PHASE 3 PB 5/346 ==================================== 729 06-1N-25-199S-0211-0000 91.86 JONES GWEN W 0.000AC 44001 GWEN AVE CALLAHAN FL 32011 LOT 211 IN OR 1293/228 SWALLOWFORK ESTATES PHASE 3 PB 5/346 ==================================== 730 06-1N-25-199S-0216-0000 1,308.72 BRIGMOND WANELL K 0.000AC 44013 LITTLE LIVE OAK DRIVE CALLAHAN FL 32011 LOTS 216 & 217 IN OR 1746/1788 2006 FTWD DW/MH SWALLOWFORK ESTATES PHASE 3 PB 5/346 ==================================== 731 06-1N-25-199S-0238-0000 199.58 WOODARD RUSSELL & 0.000AC NELSON CLAUDIA A 1 RIDGEWAY CT WEST ORANGE NJ 07052 LOT 238 PT OR 1398/747 SWALLOWFORK ESTATES PHASE 2 PB 5/345 ==================================== 732 06-1N-25-199S-0239-0000 199.58 WOODARD RUSSELL & 0.000AC NELSON CLAUDIA A 1 RIDGEWAY CT WEST ORANGE NJ 07052 LOT 239 PT OR 1398/747 SWALLOWFORK ESTATES PHASE 2 PB 5/345 ==================================== 733 06-1N-25-199S-0240-0000 199.58 PARKER-CREIGHTON MILLICENT 0.000AC 14434 LAKE UNDERHILL ROAD ORLANDO FL 32828 LOT 240 PT OR 2040/1565 SWALLOWFORK ESTATES PHASE 2 PB 5/345 ==================================== 734 06-1N-25-199S-0241-0000 199.58 PARKER-CREIGHTON MILLICENT 0.000AC 14434 LAKE UNDERHILL ROAD ORLANDO FL 32828 LOT 241 PT OR 2040/1565 SWALLOWFORK ESTATES PHASE 2 PB 5/345 ==================================== 735 06-1N-25-199S-0277-0000 173.54 BAILEY LAUREL 0.000AC 143-43 110 AVENUE JAMAICA NY 11435 LOT 277 PT OR 1366/904 SWALLOWFORK ESTATES PHASE 2 PB 5/345 ==================================== 736 06-1N-25-2920-0001-0033 1,025.47 HARTMAN KATHRYN ANNE & 1.510AC MEEKS SUSIE (JT/RS) 44092 DALES PL CALLAHAN FL 32011 BLOCK 1 PT LOT 4 PAR S-3 IN OR 1798/525 (EX S-2 IN OR 1730/1751) NEWCOMB SUB SOUTH CALLAHAN PB 1/16 R672285 & R672286 ==================================== 737 06-1N-25-2920-0001-0092 HX 714.32 JONES DAVID HENRY 2.970AC 44001 GWEN AVE CALLAHAN FL 32011 BLOCK 1 PT OF LOT 9 IN OR 2119/1248 1997 FLEE DW/MH ESMTS OR 723/1446 & 1449 (EX OR 2122/555) NEWCOMB SUB OF SOUTH CALLAHAN PB 1/16 ==================================== 738 06-1N-25-2920-0002-0072 HX 515.09 WIGGINS JESSICA K 0.000AC 44055 SWALLOWFORK AVE CALLAHAN FL 32011 BLOCK 2 PT OF LOT 7 IN OR 917/561 R673374 & R673375 NEWCOMB SUB SOUTH CALLAHAN PB 1/16 ==================================== 739 06-1N-25-2920-0002-0092 285.80 JACKMAN CHRIS 1.000AC 258 EDMANDS ROAD FRAMINGHAM MA 01701-3007 BLOCK 2 PT OF S1/2 OF LOT 9 IN OR 1489/709 NEWCOMB SUB PB 1/16 ==================================== 740 09-1N-25-0670-0001-0010 HX 564.20 LOUDERMILK ROBERT W 0.000AC 44134 CATIES WAY CALLAHAN FL 32011 BLOCK 1 LOT 1 IN OR 860/1521 R673867 & R673868 & R673869 GREEN MEADOWS #1 PB 6/101 ==================================== 741 09-1N-25-0670-0002-0060 2,411.55 GROGAN CHAD E & SHELLY D & 0.000AC GROGAN FAYE E (R/O/S) 307 E OHIO AVE APT 702 MACCLENNY FL 32063-2262 BLOCK 2 LOT 6 IN OR 1483/442 GREEN MEADOWS #1 PB 6/101 ==================================== 742 09-1N-25-0670-0002-0130 HX 1,935.69 HENDRICKS DANIEL 0.000AC 44500 CATIES WAY CALLAHAN FL 32011 BLOCK 2 LOT 13 IN OR 972/892 GREEN MEADOWS #1 PB 6/101 ==================================== 743 09-1N-25-0672-0016-0000 HX 1,715.93 MCCOY MARC & KIMBERLY 0.000AC 44904 GREEN MEADOWS LANE CALLAHAN FL 32011 LOT 16 IN OR 1125/607 GREEN MEADOWS PHASE 3 PB 6/334 ==================================== 744 09-1N-25-0672-0030-0000 HX 2,832.50 GREENE KENNETH L JR 0.000AC 44959 GREEN MEADOWS LANE CALLAHAN FL 32011 LOT 30 IN OR 1665/1319 GREEN MEADOWS PHASE 3 PB 6/334 ==================================== 745 10-1N-25-0000-0012-0000 734.39 AL ABD AHMAD I 7.150AC 1544 NORTH MAIN ST JACKSONVILLE FL 32206 PT OR 2025/622 ==================================== 746 10-1N-25-022H-0003-0000 493.71 SMITH ALLISON & 2.350AC RICKY HARTSFIELD 54100 CHURCH RD CALLAHAN FL 32011 LOT 3 IN OR 2095/1430 CHURCH ROAD EST PB 7/301 ==================================== 747 10-1N-25-022H-0005-0000 2,549.53 SAWYER THOMAS L & 1.000AC SMITH ALLISON (JT/RS) 54100 CHURCH RD CALLAHAN FL 32011 LOT 5 IN OR 2031/738 CHURCH ROAD EST PB 7/301 ==================================== 748 10-1N-25-022H-0006-0000 277.60 SMITH ALLISON & 1.000AC RICKY HARTSFIELD 54100 CHURCH RD CALLAHAN FL 32011 LOT 6 IN OR 2086/734 CHURCH ROAD EST PB 7/301 ==================================== 749 10-1N-25-2880-0001-0130 539.47 HUTCHINSON KIMBAL & SHERRY 0.000AC 54397 LAWHON RD CALLAHAN FL 32011 BLOCK 1 LOT 13 R433810 & R433811 IN OR 1898/499 NASSAU PLANTATIONS UNR ==================================== 750 10-1N-25-2880-0002-0060 880.26 FINCH NINA 0.000AC 54162 HERON ROAD CALLAHAN FL 32011 BLOCK 2 LOT 6 IN OR 1616/1101 NASSAU PLANTATIONS UNR ==================================== 751 10-1N-25-2880-0003-0030 1,067.28 KEEFER RONALD L & SARAH B 0.000AC 54080 PELICAN ROAD CALLAHAN FL 32011 BLOCK 3 LOT 3 IN OR 1907/1562 2001 MILL-TW NASSAU PLANTATIONS UNR ==================================== 752 10-1N-25-2880-0003-0130 HX 2,333.73 MESSER LINDA C EST 0.000AC C/O RICHARD ALAN MESSER 54360 PELICAN RD CALLAHAN FL 32011 BLOCK 3 LOT 13 IN OR 800 PG 1585 NASSAU PLANTATIONS UNR ==================================== 753 10-1N-25-2880-0003-0140 HX 512.65 HARGROVE DAVID G & TERRY 0.000AC 54388 PELICAN ROAD CALLAHAN FL 32011 BLOCK 3 LOT 14 IN OR 588/115 NASSAU PLANTATIONS UNR ==================================== 754 10-1N-25-2880-0004-0030 684.42 GULBRANDSEN RICHARD 1.900AC 7651 OWL RD JACKSONVILLE FL 32219 BLOCK 4 LOT 3 & PT OF TRACT C IN OR 994/636 R108160 & R108161 NASSAU PLANTATIONS UNR ==================================== 755 10-1N-25-2880-0006-0040 HX 435.33 GANGER TAMMY LYNN 0.000AC 54203 PLANTATION RD CALLAHAN FL 32011-0534 BLOCK 6 LOT 4 IN OR 1051/1131 NASSAU PLANTATIONS UNR ==================================== 756 10-1N-25-2880-0006-0080 717.00 MILLER JOE W & EVA LEE 0.000AC 54083 PLANTATION ROAD CALLAHAN FL 32011 BLOCK 6 LOT 8 IN OR 192 PG 288 1996 FLEET SW/MH NASSAU PLANTATIONS UNR ==================================== 757 10-1N-25-2880-000C-0012 602.30 HUMPHRIES CHRISTINE 2.000AC 450671 STATE RD 200 CALLAHAN FL 32011 PT GOVT LOT 3 OF SEC 10-1N-25E IN OR 1677/636 BEING PARAGRAPH 1 OF EXHIBIT A {A/K/A PT OF TRACT C OF NASSAU PLANTATIONS UNR} ==================================== 758 10-1N-25-2882-0006-0000 438.29 SWAIN CYNTHIA 0.000AC 54115 SUNSHINE DRIVE CALLAHAN FL 32011 LOT 6 IN OR 1513/81 NASSAU PLANTATIONS #2 PB 5/109 ==================================== rf rfntb DEL. TAX LIST 2017.indd 5 4/30/18 12:20 PM

PAGE 66

759 10-1N-25-2882-0011-0000 HX 322.41 MATHIS GLORIA L & 0.000AC MATHIS JAMES H EST 54072 SUNSHINE DRIVE CALLAHAN FL 32011 LOT 11 IN OR 539 PG 378 R567984 & R567985 NASSAU PLANTATIONS #2 PB 5/109 ==================================== 760 10-1N-25-2882-0015-0000 601.24 FARMER DANIEL C SR 0.000AC 54180 SUNSHINE DR CALLAHAN FL 32011 LOT 15 IN OR 2144/972 R378163 & R378164 NASSAU PLANTATIONS #2 PB 5/109 ==================================== 761 16-1N-25-0000-0001-0220 360.20 CARROLL JODY LEE & SHELLEY B 1.000AC 45068 IRIS BLVD CALLAHAN FL 32011 IN OR 972/490 EX ESMT OR 623/1161 ==================================== 762 16-1N-25-0000-0001-0350 HX 978.21 WARREN WILLIAM 1.000AC 54366 HURST RD CALLAHAN FL 32011 IN OR 2109/1492 ==================================== 763 16-1N-25-0000-0001-0380 1,808.72 SHEPARD STEPHEN M & HEATHER L 1.000AC 44011 MCSWAIN CIRCLE CALLAHAN FL 32011-7298 IN OR 1762/965 ==================================== 764 16-1N-25-0000-0011-0040 HX 396.80 BRANSON KENNETH 2.200AC CALLAHAN FL 32011 IN OR 1721/875 R583243 ==================================== 765 16-1N-25-0000-0012-0010 HX 544.58 CREWS SHANNON M 12.780AC CALLAHAN FL 32011 IN OR 1292/580 EX PARS 12-3 12-4 12-5 12-6 13 2001/KING/DW/MH ==================================== 766 16-1N-25-0000-0012-0030 1,131.69 TYPHOON INTERNATIONAL DE LP 4.460AC 4656 AUGUSTA HWY GILBERT SC 29054 PT OF E1/2 IN OR 2024/1890 R278343 & R278344 ==================================== 767 16-1N-25-2900-0004-0020 899.77 BALOUTA RAFAT & ANGEL 2.570AC 43303 RATLIFF RD CALLAHAN FL 32011 IN OR 1864/950 R278181 & R278182 RATLIFF ACRES UNR ==================================== 768 16-1N-25-2900-0010-0000 HX 1,700.18 MOSER GRACE E & 4.190AC MOSER MICHAEL W (JT/RS) 43383 RATLIFF ROAD CALLAHAN FL 32011 LOT 10 (EX S-1) IN OR 1105/945 (SEC 20-1N-25) R787773 & R787774 & R787775 RATLIFF ACRES UNR ==================================== 769 16-1N-25-2900-0010-0010 HX 419.90 VICKERS JUDY K 1.010AC 43056 PINEWOOD COURT CALLAHAN FL 32011 PT OF LOT 10 IN OR 858/775 R673519 & R673520 RATLIFF ACRES UNR ==================================== 770 16-1N-25-2900-0013-0020 HX 2,694.63 AMOS CHRISTY L 4.620AC 43433 RATLIFF RD CALLAHAN FL 32011 PT OF LOT 13 IN OR 781/952 & OR 766/1625 RATLIFF ACRES UNR ==================================== 771 16-1N-25-2900-0017-0000 1,786.81 HUNT DEBORAH M 5.000AC PO BOX 1433 CALLHAN FL 32011 LOT 17 R106937 IN OR 1820/300 R672144 & R672145 & R672156 RATLIFF ACRES UNR ==================================== 772 16-1N-25-2900-0027-0010 984.34 BUSTION GERALD W & CYNTHIA A 2.010AC 7901 PODER PLACE BRYCEVILLE FL 32009 PT OF LOT 27 IN OR 1493/332 ESMT OR 1138/707 RATLIFF ACRES UNR ==================================== 773 16-1N-25-2900-0027-0030 646.32 HUMPHRIES CHRISTINE 1.680AC 450671 STATE RD 200 CALLAHAN FL 32011 S-3 OF LOT 27 IN OR 1677/639 RATLIFF ACRES UNR ==================================== 774 16-1N-25-2900-0028-0010 867.04 BUSTION GERALD W & CYNTHIA A 4.160AC 7901 PODER PLACE BRYCEVILLE FL 32009 PT OF LOT 28 (S-1) IN OR 1429/1537 1988 DERO SW/MH RATLIFF ACRES UNR ==================================== 775 16-1N-25-2910-0008-0000 627.25 SHRADER RORIE J & JACQUELINE A 3.940AC BAKER THOMAS ALAN 43765 FREEDOM DR CALLAHAN FL 32011 LOT 8 IN OR 1872/989 & OR 1885/430 1980 STAT/SW/MH ESMT OR 1650/1900 WOODLAND ESTATES #1 PB 4/29-30 ==================================== 776 16-1N-25-2910-0019-0000 HX 1,558.02 EVANS GLORIA 3.590AC 43111 FREEDOM DRIVE CALLAHAN FL 32011-7274 PT OF LOT 19 IN OR 558/1066 EX S-2 & S-3 WOODLAND ESTATES #1 PB 4/29-30 ==================================== 777 16-1N-25-2910-0019-0020 260.96 EVANS GLORIA JEAN 1.000AC 43111 FREEDOM DR CALLAHAN FL 32011 PT OF LOT 19 (S-2) IN OR 1874/1050 WOODLAND ESTATES #1 PB 4/29-30 ==================================== 778 16-1N-25-2910-0030-0000 629.86 OTRADOVEC LAUREN 7.160AC 2148 WATERFOOT LN JACKSONVILLE FL 32246 LOT 30 IN OR 1961/1719 WOODLAND ESTATES UNIT 1 PB 4/29 & 30 ==================================== 779 16-1N-25-2912-0003-0090 899.14 HARRISON THOMAS & CARRIE 0.000AC 44090 WOODLAND AVENUE CALLAHAN FL 32011 BLOCK 3 LOT 9 & S-1 OF LOT 8 IN OR 1482/833 EX ESMT OR 1271/1681 EX S-2 OF LOT 8 & S-3 OF LOT 9 LANDLAND ESTATES UNIT 2 PB 4/46 46A & 46B ==================================== 780 16-1N-25-2912-0004-0090 HX 299.49 NETTLES AL W & JANICE M 0.000AC 44752 WOODLAND CIR CALLAHAN FL 32011 BLOCK 4 LOT 9 IN OR 336 PG 397 R 223924 & R 223925 WOODLAND ESTATES UNIT 2 PB 4/46 46A & 46B ==================================== 781 16-1N-25-2912-0005-0070 HX 811.82 CONNOR KAREN H 0.000AC 44467 WOODRIDGE DR CALLAHAN FL 32011 BLOCK 5 LOT 7 IN OR 1334/580 WOODLAND ESTATES UNIT 2 PB 4/46 46A & 46B ==================================== 782 16-1N-25-2912-0006-0130 550.07 SIKES JACQUELINE 0.000AC 43111 HILLTOP LANE CALLAHAN FL 32011 BLOCK 6 LOT 13 IN OR 1081/314 WOODLAND ESTATES UNIT 2 PB 4/46 46A & 46B ==================================== 783 16-1N-25-2912-0007-0040 HX 337.05 BOWEN STEVEN & TIFFANY 0.000AC 44099 OAKWOOD LN CALLAHAN FL 32011 BLOCK 7 LOT 4 IN OR 2013/104 R672717 & R672718 WOODLAND ESTATES UNIT 2 PB 4/46 46A & 46B ==================================== 784 16-1N-25-2912-0008-0120 3,114.67 KOSTENSKI SUZANNE D 38.080AC 320 N 1ST STREET STE #702 JACKSONVILLE BEACH FL 32250-6943 BLOCK 8 LOTS 12 & 13 IN OR 717/285 R/W OR 1054/1072 ESMT OR 1065/1512 WOODLAND ESTATES UNIT 2 PB 4/46 46A & 46B ==================================== 785 20-1N-25-0000-0006-0010 HX 1,828.85 CROSBY JOHN B JR & KELLY ANN 2.500AC 43239 RATLIFF ROAD CALLAHAN FL 32011 IN OR 1503/392 EX RW IN OR 82/578 ==================================== 786 20-1N-25-0000-0006-0020 HX 1,018.75 LOVETT JOYCE F & 3.710AC LOVETT BOBBY C 43162 SMITTY RD CALLAHAN FL 32011 PT OF SW1/4 OF NW1/4 IN OR 1892/112 & OR 2122/922 2007 NOBI DW/MH 1999 HOME DW/MH PARCELS 6-2 6-3 & 6-4 ESMT IN OR 723/1523 ESMT PT OR 1825/754 ==================================== 787 29-1N-25-0000-0002-0000 HX 3,001.21 BARBER CAROLYN ELIZABETH 40.000AC 43624 LARSEN RD CALLAHAN FL 32011 NW1/4 OF NW1/4 IN OR 1275/698 1998 REGE TW/MH & 1994 CLAS TW/MH ESMT IN OR 824/980 ==================================== 788 31-1N-25-0000-0001-0000 925.16 HUMPHRIES CHRISTINE 4.670AC 450671 STATE RD 200 CALLAHAN FL 32011 PT NE1/4 OF NE1/4 OF SEC 31-1N-25E IN OR 1677/636 BEING PARAGRAPH 2 OF EXHIBIT A ==================================== 789 31-1N-25-0000-0002-0100 HX 518.51 HUTCHESON ALLISON 1.000AC 43009 DANSON LANE CALLAHAN FL 32011 PT OF NE1/4 OF NW1/4 IN OR 794 PG 1744 2002 FLEET DW/MH ==================================== 790 37-1N-25-0000-0004-0010 18,982.24 MIN JAMES BYUNG K & HELEN HYO 123.450AC 54002 DEERFIELD CTRY CLUB ROAD CALLAHAN FL 32011 PT OF SEC 37 IN OR 1044/1073 PAR 4-1 & 4-5 GREEN ACRES GOLF COURSE ==================================== 791 37-1N-25-0000-0004-0070 48.37 MULRAIN KATHRYN WOOD 0.000AC 1216 30TH ST NW WASHINGTON DC 20007-3401 IN OR 919/1854 EX 4-8 ==================================== 792 37-1N-25-0000-0005-0150 575.03 WINDHAM JOHN T EST 6.180AC 54152 FOUR ACRE CIRCLE CALLAHAN FL 32011 IN OR 1153 PG 1477 1989 SPEC SW/MH ==================================== 793 37-1N-25-0000-0010-0060 HX 793.29 HIGGINBOTHAM RAYMOND R & MARY 7.490AC 54212 ROY BOOTH ROAD CALLAHAN FL 32011 IN OR 519 PG 915 EX R/W OR 605/1193 ==================================== 794 37-1N-25-0000-0018-0000 285.77 CABELL JOHN & LORI 2.000AC 2801 RACHAEL AVE FERNANDINA BEACH FL 32034 IN OR 1545/681 EX 18-1 ==================================== 795 37-1N-25-0000-0019-0040 375.44 SHUMAN STACY SHANE 1.500AC 43757 RATLIFF ROAD CALLAHAN FL 32011 IN OR 1643/630 ==================================== 796 37-1N-25-2940-0005-0080 410.47 FAIN HAROLD DEAN 1.000AC 5395 DETTA COURT KEYSTONE HEIGHTS FL 32656 PT OF LOTS 5 & 15 IN OR 1760/1303 FLA LAND SYNDICATE PBK O/42 {R334468 & R334469} ==================================== 797 37-1N-25-2950-0001-0150 1,866.50 MIN JAMES BYUNG K & HELEN HYO 0.000AC 54049 DEERFIELD CTRY CLUB ROAD CALLAHAN FL 32011 BLOCK 1 LOT 15 IN OR 1044/1070 GREEN ACRES UNR ==================================== 798 37-1N-25-296A-0008-0000 HX 1,306.78 MCVEY CHRISTOPHER & 0.000AC MCVEY MICHAEL 540388 LEM TURNER ROAD CALLAHAN FL 32011 TRACT 8 IN OR 2147/1146 LEE STONER SHORES 1 UNR ==================================== 799 37-1N-25-296A-0054-0000 620.24 LEWIS JOHN E EST 0.000AC C/O LYNN GORDON 2842 BROWARD RD JACKSONVILLE FL 32218-5138 TRACT 54 L/E OR 1190/1633 LEE STONER SHORES 1 UNR ==================================== 800 37-1N-25-296A-0055-0000 HX 190.60 BARNES JOSHUA & CARMEN D 0.000AC 54118 LEE STONER RD CALLAHAN FL 32011 TRACT 55 IN OR 2092/1296 R787407 LEE STONER SHORES 1 UNR ==================================== 801 37-1N-25-296C-0019-0000 1,925.85 CLARK JULIAN W EST 0.000AC 54069 LISA DRIVE CALLAHAN FL 32011 TRACT 19 IN OR 150/369 LEE STONER SHORES 3 UNR ==================================== 802 37-1N-25-299A-0026-0000 HX 951.26 JENNINGS DAVID E JR & MELYNDA 0.000AC 54661 VONTZ CIRCLE CALLAHAN FL 32011 LOT 26 IN OR 832 PG 1578 NASSAU VILLAGE #1 UNR ==================================== 803 37-1N-25-299A-0032-0000 HX 352.88 SKIPPER DEBORAH S 0.000AC 54517 VONTZ CIRCLE CALLAHAN FL 32011 LOT 32 R672496 IN OR 762 PG 542 NASSAU VILLAGE #1 UNR ==================================== 804 37-1N-25-299A-0037-0000 359.45 SCOTT JEANNE HENDERSON 0.000AC P O BOX 1199 HILLIARD FL 32046 LOT 37 IN OR 819 PG 1980 NASSAU VILLAGE #1 UNR ==================================== 805 37-1N-25-299A-0041-0000 493.02 FISHER ROBERT E EST 0.000AC 54171 MARLEE RD CALLAHAN FL 32011 LOT 41 IN OR 323/552 & OR 1629/1917 R 107521 & R 107522 NASSAU VILLAGE # 1 UNR ==================================== 806 37-1N-25-299C-0014-0000 HX 589.75 MABRY NATHANIEL O 0.000AC 54291 MARLEE ROAD CALLAHAN FL 32011 LOT 14 IN OR 1328/1345 R673741 & R673742 NASSAU VILLAGE 3 UNR ==================================== 807 37-1N-25-299C-0037-0000 526.03 EBY TERRY & MARILYN 0.000AC 45113 SNICKERS TRAIL CALLAHAN FL 32011 LOT 37 IN OR 902/381 R787696 & R787697 NASSAU VILLAGE 3 UNR ==================================== 808 37-1N-25-299C-0046-0000 930.79 KAMINOWITZ MICHAEL J & NOEMI 0.000AC 54129 JONAS DR CALLAHAN FL 32011 LOT 46 NASSAU VILLAGE #3 UNR {R107636 & R107637} ==================================== 809 37-1N-25-299C-0048-0000 544.57 NEW KINGS ROAD ENTERPRISES LLC 0.000AC 613048 RIVER ROAD CALLAHAN FL 32011 LOT 48 R622058 IN OR 1996/1261 NASSAU VILLAGE #3 UNR ==================================== 810 37-1N-25-299D-0008-0000 590.72 BARRY RUBY B 0.000AC 54463 MARLEE ROAD CALLAHAN FL 32011-7705 LOT 8 IN OR 1522/943 MH/ID 60121682HA & 60121682HB NASSAU VILLAGE 4 UNR ==================================== 811 37-1N-25-299D-0009-0000 713.28 MCGINLEY GARY R SR 0.000AC 1739 CEDAR BAY ROAD JACKSONVILLE FL 32218 LOT 9 1984 CONC DW IN OR 1599/1069 NASSAU VILLAGE 4 UNR ==================================== 812 37-1N-25-299E-0025-0000 HX 745.52 GRIFFIN GERALD R JR 0.000AC 54613 MARLEE ROAD CALLAHAN FL 32011 LOT 25 IN OR 501 PG 1185 NASSAU VILLAGE 5 UNR ==================================== 813 37-1N-25-299E-0034-0000 HX 157.85 REID DAVID V & CORETTA P 0.000AC 54477 MARLEE ROAD CALLAHAN FL 32011 LOT 34 IN OR 525 PG 96 R334312 & R334313 NASSAU VILLAGE 5 UNR ==================================== 814 37-1N-25-299E-0035-0000 HX 282.59 BARRY RUBY BETSY 0.000AC 54463 MARLEE ROAD CALLAHAN FL 32011 LOT 35 R236010 & R236011 IN OR 1842/254 NASSAU VILLAGE # 5 UNR ==================================== 815 37-1N-25-299E-0039-0000 603.15 LOVE JOSEPH R & KRISTEN 0.000AC 54417 MARLEE ROAD CALLAHAN FL 32011 LOT 39 IN OR 1860/305 R497982 & R497983 NASSAU VILLAGE #5 UNR ==================================== 816 37-1N-25-299E-0040-0000 HX 66.22 BOND LINWOOD K & 0.000AC BARRY JEREMY R (JT/RS) 54405 MARLEE RD CALLAHAN FL 32011 LOT 40 RP 548 & 549 IN OR 1898/151 NASSAU VILLAGE 5 UNR ==================================== 817 37-1N-25-299E-0050-0000 HX 149.92 RIDGWAY TOBY MICHAEL 0.000AC 540864 LEM TURNER ROAD CALLAHAN FL 32011 LOT 50 IN OR 1653/1110 1970 TRU SW/MH NASSAU VILLAGE 5 UNR ==================================== 818 37-1N-25-299F-0003-0000 2,923.43 CASWELL DAVID & CRYSTAL SIRLES 0.000AC 7038 RIVER CREST DR JACKSONVILLE FL 32226 TRACT 3 IN OR 1952/68 NASSAU VILLAGE WEST PB 5/23 ==================================== 819 37-1N-25-299F-0013-0000 533.93 SHAW CHRISTOPHER W & PATRICIA 0.000AC 36365 DYAL RD CALLAHAN FL 32011 TRACT 13 IN OR 2009/1159 R567623 & R567624 NASSAU VILLAGE WEST PB 5/23 ==================================== 820 37-1N-25-299F-0017-0000 HX 546.40 HUTCHINSON KIMBAL P & SHERRY J 0.000AC 54397 LAWHON RD CALLAHAN FL 32011 TRACT 17 IN OR 738 PG 1414 NASSAU VILLAGE WEST PB 5/23 ==================================== 821 37-1N-25-299F-0033-0000 HX 1,111.76 SMITH WAYNE A & EDITH B 0.000AC 54438 LAWHON ROAD CALLAHAN FL 32011 TRACT 33 IN OR 368 PG 757 NASSAU VILLAGE WEST PB 5/23 ==================================== 822 37-1N-25-299F-0034-0000 HX 174.37 SMITH WAYNE A JR L/E 0.000AC SMITH WAYNE A & EDITH B 54412 LAWHON ROAD CALLAHAN FL 32011 TRACT 34 OR 368/753 & L/E OR 559/1207 R359499 & R359500 NASSAU VILLAGE WEST PB 5/23 ==================================== 823 37-1N-25-299F-0060-0000 HX 547.00 POWELL MATTHEW W 0.000AC 54046 SHEFFIELD ROAD CALLAHAN FL 32011 TRACT 60 IN OR 1809/1551 NASSAU VILLAGE WEST PB 5/23 ==================================== 824 37-1N-25-299F-0061-0000 772.17 3524 SW CYPRESS LAKE RD LAKE CITY FL 32024-4456 TRACT 61 R334407 L/E IN OR 905/1451 NASSAU VILLAGE WEST PB 5/23 ==================================== 825 37-1N-25-299F-0062-0000 572.59 GREEN DARLA J 0.000AC 112 BAY ST NEPTUNE BEACH FL 32266-6016 TRACT 62 1988 WEST SW/MH IN OR 1171/695 NASSAU VILLAGE WEST PB 5/23 ==================================== 826 37-1N-25-299F-0071-0000 488.16 RAULERSON BETTY JO & 0.000AC DANSEREAU KEITH H JR (W&H) 54251 OGILVIE RD CALLAHAN FL 32011 TRACT 71 R497845 IN OR 2013/1526 NASSAU VILLAGE WEST PB 5/23 ==================================== 827 37-1N-25-299F-0080-0000 HX 777.29 HUTCHINSON THOMAS W & BARBARA 0.000AC 54033 HOWARD ROAD CALLAHAN FL 32011 TRACT 80 IN OR 288 PG 21 NASSAU VILLAGE WEST PB 5/23 ==================================== 828 37-1N-25-299F-0083-0000 578.24 PEYTON ROBERT D EST 0.000AC 54034 CORNELIA COURT CALLAHAN FL 32011 TRACT 83 R567625 & R567626 IN OR 972/1854 NASSAU VILLAGE WEST PB 5/23 ==================================== 829 37-1N-25-299F-0084-0000 886.31 TURNER GEORGE & DEBRA 0.000AC 1038 JANELLS RIVER DR FOLKSTON GA 31537 TRACT 84 R497697 & R497698 IN OR 1951/565 NASSAU VILLAGE WEST PB 5/23 ==================================== 830 37-1N-25-299F-0095-0000 1,078.27 NETTLES JOE 0.000AC 54073 CORNELIA CT CALLAHAN FL 32011 TRACT 95 IN OR 2062/1894 R108220 & 108221 NASSAU VILLAGE WEST PB 5/23 ==================================== 831 37-1N-25-299F-0110-0000 500.68 BROWN ROBYN & 0.000AC HAMILTON GEORGE D (JT/RS) 85362 JOANN ROAD YULEE FL 32097 TRACT 110 IN OR 1245/1198 R106735 & R106736 NASSAU VILLAGE WEST PB 5/23 ==================================== 832 37-1N-25-299F-0117-0000 498.32 PITTMAN CHRISTOPHER JON 0.000AC 44127 CATIES WAY CALLAHAN FL 32011 TRACT 117 R360178 IN OR 1391/671 NASSAU VILLAGE WEST PB 5/23 ==================================== 833 37-1N-25-299F-0118-0000 520.31 MARTINEZ LEANNE M & 0.000AC NYE SHERRY A (JT/RS) 54908 CHURCH ROAD CALLAHAN FL 32011 TRACT 118 IN OR 2148/1448 NASSAU VILLAGE WEST PB 5/23 ==================================== 834 37-1N-25-299F-0124-0000 HX 598.51 NYE SHERRY A L/E 0.000AC 54908 CHURCH ROAD CALLAHAN FL 32011 TRACT 124 2000 MERIT TW IN OR 2101/1935 NASSAU VILLAGE WEST PB 5/23 ==================================== 835 37-1N-25-299F-0126-0000 HX 128.72 HAND WILLIAM D 0.000AC 54877 CHURCH ROAD CALLAHAN FL 32011 TRACT 126 IN OR 979 PG 200 MH/ID 16B34ES5111X & 16B34ES5111U NASSAU VILLAGE WEST PB 5/23 ==================================== 836 37-1N-25-299G-0008-0000 523.17 RAY RICHARD & DARA 0.000AC 44152 SWALLOWFORK AVE CALLAHAN FL 32011 TRACTS 8 & 9 IN OR 1102 PG 137 NASSAU VILLAGE #6 UNR ==================================== 837 37-1N-25-299L-0002-0020 527.95 ALLEN NORMAN ROBERT EST 0.000AC 54095 ROY BOOTH ROAD CALLAHAN FL 32011 BLOCK 2 LOT 2 IN OR 988/1539 R236004 & R236005 POINT SOUTH UNIT 1 PB 4/73 ==================================== 838 37-1N-25-299M-0001-0000 443.89 CONNER JACK C EST & 0.000AC CONNER CLARA G 5389 107TH ST JACKSONVILLE FL 32244-2251 LOT 1 R583725 & R583726 IN OR 618 PG 116 POINT SOUTH #2 PB 4/82 & 83 ==================================== 839 37-1N-25-299M-0003-0000 HX 240.03 DOYLE JEREMY SCOTT & 0.000AC MOORE BARBARA JEAN (JT/RS) 54005 CHARLOTTE DR CALLAHAN FL 32011 LOT 3 OR 2078/1231 R672786 & 672787 POINT SOUTH UNIT 2 PB4/82 & 83 ==================================== 840 37-1N-25-299M-0007-0000 HX 164.00 GILLIARD JESSE L & ROBIN R 0.000AC 54055 DEBRA LANE CALLAHAN FL 32011 LOTS 7 & 8 IN OR 327/737 1984 OAKS DW/MH POINT SOUTH 2 PB 4/82 & 83 ==================================== 841 37-1N-25-299M-0011-0000 899.04 CORDELL ZACHARY & 0.000AC ETHRIDGE PAUL 8100 DIVEN ARCH NORFOLK VA 23511 LOT 11 IN OR 2112/1729 POINT SOUTH #2 PB 4/82 & 83 1994 HARB DW ==================================== 842 37-1N-25-299N-0002-0050 618.17 HAYES KENNETH & STEPHANIE 0.000AC 54125 EVA COURT CALLAHAN FL 32011 BLOCK 2 LOT 5 IN OR 2118/735 1985 SHOW DW/MH POINT SOUTH #3 PB 4/98 & 99 ==================================== 843 37-1N-25-299N-0002-0080 919.82 FORBES TROY A & JESSICA A 0.000AC 54055 EVA CT CALLAHAN FL 32011 BLOCK 2 LOT 8 IN OR 2085/314 POINT SOUTH #3 PB 4/98 &99 ==================================== 844 37-1N-25-299O-0013-0000 850.33 SOLANA JUDY 0.000AC 16043 RESSIE DRIVE WEST JACKSONVILLE FL 32218-1120 LOT 13 IN OR 1673/1823 R583390 & R583391 POINT SOUTH #4 PB 4/111-112 ==================================== 845 37-1N-25-299O-0021-0000 569.36 HIXON NORMA M 0.000AC 54111 ROY BOOTH ROAD CALLAHAN FL 32011 LOT 21 R235764 IN OR 1725/1722 POINT SOUTH 4 PB 4/111 & 112 ==================================== 846 37-1N-25-299O-0022-0000 451.51 ROTHSTEIN SIMON D TRUSTEE 0.000AC OF RICHARD WYSE TESTAMENTARY 6041 WINDING BRIDGE DRIVE JACKSONVILLE FL 32227 LOT 22 IN OR 1237/790 POINT SOUTH #4 PB 4/111 & 112 ==================================== 847 37-1N-25-299R-0013-0000 724.84 BRADDOCK GRADY E JR & TAMMY J 3.780AC 54633 CHURCH ROAD CALLAHAN FL 32011 TRACT 13 IN OR 916/1133 R 108158 & 108159 REPLAT OF GOVT LOT 9 UNR ==================================== 848 37-1N-25-299R-0029-0000 802.72 BRADDOCK GRADY JR 2.540AC 54633 CHURCH ROAD CALLAHAN FL 32011 TRACTS 29 & 30 IN OR 937/633 REPLAT OF OGILVIE LOT 9 SUB UNR {R224041 & R224042} ==================================== 849 37-1N-25-299S-0001-0120 HX 468.70 GUYNN DEBORAH K & 0.000AC GUYNN GLEN L JR (JT/RS) 54711 DORNBUSH RD CALLAHAN FL 32011 BLOCK 1 LOT 12 IN OR 853/586 R673222 & R673223 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 850 37-1N-25-299S-0001-0190 HX 244.22 DUNN BETTY S 0.000AC 54561 DORNBUSH ROAD CALLAHAN FL 32011 BLOCK 1 LOT 19 IN OR 529 PG 46 R278081 & R278082 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 851 37-1N-25-299S-0001-0220 HX 621.70 WADE LINDA Y WILLARD 0.000AC 54345 HAZEL JONES RD CALLAHAN FL 32011 BLOCK 1 LOT 22 IN OR 1193/389 2003/MERT/DW/MH SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 852 37-1N-25-299S-0001-0280 HX 378.46 STONE PATRICK S 0.000AC 54171 HAZEL JONES RD CALLAHAN FL 32011 BLOCK 1 LOT 28 IN OR 1724/15 R622086 & R622087 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 853 37-1N-25-299S-0001-0400 HX 96.70 WILLIAMS MICHAEL R 0.000AC 54521 VIKKI ROAD CALLAHAN FL 32011 BLOCK 1 LOT 40 R277916 & R277917 IN OR 692 PG 1490 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 854 37-1N-25-299S-0001-0500 1,104.49 MULLIS KATISHA ANN 0.000AC 44332 WOODRIDGE DR CALLAHAN FL 32011 BLOCK 1 LOT 50 IN OR 1815/1601 1996 HIGH DW/MH SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 855 37-1N-25-299S-0001-0580 669.84 EDENFIELD BOBBIE E 0.000AC 54047 TROOPER COURT CALLAHAN FL 32011 BLOCK 1 LOTS 58 & PT OF 59 IN OR 1116/574 R278103 & R278104 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 856 37-1N-25-299S-0001-0740 633.34 GRIFFIN CAROLYN ANN & 0.000AC GEIGER LINDA S & 540511 US HWY 1 CALLAHAN FL 32011 BLOCK 1 LOT 74 IN OR 1599/864 R359909 & R359908 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 857 37-1N-25-299S-0002-0010 359.45 HICKEN DAVID WAYNE 0.000AC 540271 LEM TURNER ROAD CALLAHAN FL 32011 BLOCK 2 LOT 1 IN OR 1767/1301 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 858 37-1N-25-299S-0002-0090 HX 349.50 JONES PAUL L JR 0.000AC 54436 ARMSTRONG ROAD CALLAHAN FL 32011 BLOCK 2 LOT 9 R673792 IN OR 492 PG 462 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 859 37-1N-25-299S-0002-0130 887.42 WILLIAMS LAWTON & JEAN 0.000AC 375 W 65TH ST JACKSONVILLE FL 32208 BLOCK 2 LOT 13 IN OR 1461/1472 R434231 & R434232 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 860 37-1N-25-299S-0002-0180 HX 568.53 KENNISON RICHARD G & ZINA C & 0.000AC KENNISON ROBERT E (JT/RS) 54176 ARMSTRONG ROAD CALLAHAN FL 32011 BLOCK 2 LOT 18 IN OR 1284/295 MH/ID GAFLY35B17816HH21 & GAFLY35A17816HH21 & GAFLY35C17816HH21 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 861 37-1N-25-299S-0002-0210 359.45 CLARK JULIAN W EST 0.000AC 54069 LISA DR CALLAHAN FL 32011 BLOCK 2 LOT 21 IN OR 970/1712 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 862 37-1N-25-299S-0003-0110 HX 326.98 WALTERS LARRY J & TRACY D 0.000AC 54326 BEA ROAD CALLAHAN FL 32011 BLOCK 3 LOT 11 IN OR 584 PG 139 R378159 R378158 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 863 37-1N-25-299S-0003-0200 HX 450.48 EDWARDS RONNIE L JR 0.000AC 54048 BEA RD CALLAHAN FL 32011 BLOCK 3 LOT 20 CASE #2011-CA-111 OR 1772/69 R672169 & R672170 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 864 37-1N-25-299S-0003-0280 HX 51.69 DORAN WILLIAM H EST 0.000AC C/O MARTHA DORAN 54225 ARMSTRONG ROAD CALLAHAN FL 32011 BLOCK 3 LOT 28 IN OR 494 PG 1073 1970 HOME DW/MH SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 865 37-1N-25-299S-0003-0330 HX 451.71 WEAVER RHENDA S 0.000AC 54365 ARMSTRONG ROAD CALLAHAN FL 32011 BLOCK 3 LOT 33 IN OR 781 PG 755 R672711 & R672712 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 866 37-1N-25-299S-0004-0170 HX 614.34 LOVE STEVEN J 0.000AC 54200 DORNBUSH RD CALLAHAN FL 32011 BLOCK 4 LOT 17 IN OR 2100/1226 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 867 37-1N-25-299S-0004-0210 621.38 HUTCHINSON KIMBAL & SHERRY 0.000AC 450061 SR 200 #10 CALLAHAN FL 32011 BLOCK 4 LOT 21 IN OR 1784/727 R583784 & R583785 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 868 37-1N-25-299S-0004-0350 HX 149.31 SCHIRMER LAWRENCE W & 0.000AC JENNIFER L EDDLEMAN (JT/RS) 54361 BEA ROAD CALLAHAN FL 32011 BLOCK 4 LOT 35 1987 DW/MH IN OR 903/1171 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 869 37-1N-25-299S-0004-0380 749.99 DAUGHTRY JOSEPH JR 0.000AC 3479 SUGAR CANE CIR FAYETTEVILLE NC 28303-4635 BLOCK 4 LOT 38 IN OR 1457/85 R235632 & R235633 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 870 37-1N-25-299S-0006-0220 1,071.33 SHELFER CANDIE R 0.000AC 54185 HELLER ROAD CALLAHAN FL 32011 BLOCK 6 LOT 22 IN OR 2074/202 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 871 37-1N-25-299S-0007-0050 HX 469.16 MOSER MICHAEL W 0.000AC 54174 HELLER ROAD CALLAHAN FL 32011 BLOCK 7 LOT 5 IN OR 886/341 1996 MERI DW/MH SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 872 37-1N-25-299S-0007-0060 HX 116.92 EPPERLY FRANK A & KATHY A 0.000AC 54144 HELLER RD CALLAHAN FL 32011 BLOCK 7 LOT 6 OR 541/169 R359973 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 873 37-1N-25-299S-0007-0140 HX 331.12 WALKER RICHARD D 0.000AC 54107 JERRA ROAD CALLAHAN FL 32011 BLOCK 7 LOT 14 IN OR 503 PG 1045 R497868 & R497869 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 874 37-1N-25-299S-0008-0050 539.18 MCDOWELL JOHN L 0.000AC 54194 JEANNIE ROAD CALLAHAN FL 32011 BLOCK 8 LOT 5 IN OR 513 PG 1303 R407988 & R407989 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 875 37-1N-25-299S-0009-0080 695.75 NORRIS DONNA KAY 0.000AC 54042 VIKKI ROAD CALLAHAN FL 32011 BLOCK 9 LOT 8 (EX S-1) IN OR 1725/141 R360192 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 876 37-1N-25-299S-0009-0081 69.17 HMS AMELIA INC 0.170AC 1503 DUNN AVE JACKSONVILLE FL 32218 BLOCK 9 PT OF LOT 8 PT OR 532 PG 803 SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 877 37-1N-25-299S-0009-0090 HX 207.98 SULLIVAN RANDALL D 0.000AC 54025 SHERWOOD ROAD CALLAHAN FL 32011 BLOCK 9 LOT 9 IN OR 1796/394 1986 GOLD DW/MH SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 878 37-1N-25-299S-0009-0140 1,445.94 RYALS JEFF & 0.000AC CZINDER BARBARA 54115 JEANNIE ROAD CALLAHAN FL 32011 BLOCK 9 LOT 14 IN OR 1687/671 2007/JACO/DW/MH SHEFFIELD VILLAGE PB 5/28 & 29 ==================================== 879 03-2N-25-0000-0001-0080 HX 4,056.34 NETTLES AL W JR & MISTY A 11.760AC 45544 MUSSLEWHITE RD CALLAHAN FL 32011 PT SW1/4 SEC 3-2N-25E IN OR 1490/1119 ==================================== 880 03-2N-25-0000-0001-0170 4,298.93 BECKER MARVIN ROY 65.000AC 56585 DAVIS ROAD CALLAHAN FL 32011 IN OR 1804/133 ==================================== 881 03-2N-25-0000-0001-0200 686.92 WRIGHT JOSEPH M & ROLONDA 5.000AC 2543 LEWIS ST JACKSONVILLE FL 32204 IN OR 1894/765 ESMT OR 1894/768 ==================================== 882 03-2N-25-0000-0004-0010 1,310.11 EDWARDS EVAN W & ALISON D 2.050AC 45619 MUSSLEWHITE RD CALLAHAN FL 32011 PT W1/2 OF SW1/4 OF NW1/4 & PT W1/2 OF NW1/4 OF SW1/4 BWING ONLY PT LYING W OF MUSSLEWHITERD IN OR 2099/1450 PARCEL 4-1 ==================================== 883 03-2N-25-0000-0006-0010 HX 557.30 DAVIS JOEL L & KRISTY L 9.150AC 56695 DAVIS RD CALLAHAN FL 32011 IN OR 1792/1807 ESMT OR 1812/249 1981 SOUTHERN DW/MH ==================================== 884 07-2N-25-0000-0005-0000 331.26 BELL CAROL ANN 60.650AC 45348 ZIDELL ROAD CALLAHAN FL 32011 PT OR 1317/1646 ==================================== 885 07-2N-25-0000-0006-0000 288.99 BELL CAROL ANN 40.470AC 45348 ZIDELL ROAD CALLAHAN FL 32011 PT OR 1317/1646 ==================================== 886 07-2N-25-0000-0006-0010 503.25 BELL FRANKLIN AARON 79.530AC 45419 ZIDELL ROAD CALLAHAN FL 32011 S1/3 OF W1/2 PT OR 1303/899 ==================================== 887 07-2N-25-0000-0006-00M1 38.55 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 PT OF SEC 7 PARCEL 6 PT OR 1313/689 1/3 INT 120 ACRES MINERAL RIGHTS ONLY ==================================== 888 07-2N-25-0000-0007-0000 140.07 BELL FRANKLIN AARON 20.000AC 45419 ZIDELL ROAD CALLAHAN FL 32011 PT OR 1303/899 ==================================== 889 09-2N-25-0000-0003-0030 3,182.69 WALL TIMBER PRODUCTS INC 10.000AC 45282 MUSSLEWHITE RD CALLAHAN FL 32011 PT OF SW1/4 OF R/W IN OR 2006/1994 ==================================== 890 12-2N-25-0000-0002-0050 69.17 HALEY WILLIAM J & 0.170AC HALEY THOMAS J PO BOX 2756 LAKE CITY FL 32055-2756 PT OR 1279/1851 ==================================== 891 12-2N-25-2350-0004-0000 HX 1,539.41 HANNAH CLYDE CLAYTON JR & 0.000AC DEDMON EDDIE L ET AL 55193 WHITE OAKS PL CALLAHAN FL 32011 LOT 4 IN OR 1873/679 & OR 1983/700 WHITE OAK SUBS PB 5/230 ==================================== 892 14-2N-25-0000-0001-0020 HX 582.74 BROWN JEAN 2.000AC 55058 THOMAS ROAD CALLAHAN FL 32011 PT OR SW1/4 OF NW/14 & PT OF GOVT LOT 1 IN OR 576/1014 EX R/W OR 1077/1646 ==================================== 893 14-2N-25-0000-0001-0040 HX 1,394.23 THOMPSON GARY & MARY ANN 0.940AC 450769 SR 200 CALLAHAN FL 32011 PT OF SW1/4 OF NW1/4 IN OR 1420/1961 & OR 1549/13 EX R/W CASE #03-64-CA ==================================== 894 15-2N-25-0000-0001-0070 1,868.26 ARMSTRONG DORIS C EST 1.000AC 55126 THOMAS RD CALLAHAN FL 32011 OR 274 PG 678 ==================================== 895 15-2N-25-2980-0001-0010 845.70 WILLIAMS CATHY LOWE 1.140AC 36127 MATT DYLAN RD CALLAHAN FL 32011 PT OF LOT 1 (S-1) IN OR 2116/1857 R788153 & R788154 EX R/W OR 1049/1150 PITTMAN ACRES PB 4/8 ==================================== 896 15-2N-25-2980-0009-0030 3,274.73 CARRIGG DAVID 1.310AC 145 PINE TREE RD EAST PALATKA FL 32131 PT OF LOTS 9 10 & 11 (S-3) IN OR 1831/594 EX R/W OR 1114/426 PITTMAN ACRES PB 4/8 ==================================== 897 16-2N-25-0000-0003-0000 HX 722.40 BROWN JOHNNY L 2.990AC 45489 JONES WAY CALLAHAN FL 32011 IN OR 261 PG 385 & IN OR 286/58 & OR 319/737 (PAR 3 & 3-3 & 3-4) 1999 HICKORY TW/MH ==================================== 898 16-2N-25-0000-0005-0010 366.40 WALKER MICHAEL L 1.000AC 45082 RAINY LANE CALLAHAN FL 32011 IN OR 747/824 ==================================== 899 17-2N-25-0000-0003-00M1 38.68 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 PT OF PARCELS 3 3-1 3-2 7 & 7-1 & WOODGROVE AC PB4/59 PT OR 1313/689 1/3 INT 122.32 ACRES MINERAL RIGHTS ONLY ==================================== 900 17-2N-25-0000-0011-0130 322.80 FRISON HILDA JONES 1.270AC 100 BROOKLYN AVE APT 1T FREEPORT NY 11520-3093 PT OF LOT 4 IN OR 404/59 BEING PARCEL D ELIZA JONES ESTATE OR 148/454 ==================================== 901 17-2N-25-0000-0011-0160 73.22 MITCHELL GREGORY & LISA 0.180AC 1418 GUARDIAN DRIVE JACKSONVILLE FL 32221 PT OF LOT 4 IN OR 1301/328 ELIZA JONES ESTATE OR 148/454 ==================================== 902 17-2N-25-0000-0011-0170 HX 377.31 OLIVER BARRY & 1.010AC PADILLA DEBRA 45052 KEY LANE CALLAHAN FL 32011 PT OF LOT 9 IN OR 1443/1700 ELIZA JONES ESTATE OR 148/454 {R788007 R788008 & R788009} ==================================== 903 17-2N-25-0000-0012-0000 506.44 JONES WILFRED C EST 31.160AC C/O CECELIA JONES NORMAN 2/12 926 ASHTON COVE TERRACE JACKSONVILLE FL 32218 S1/2 OF GOVT LOT 1 OF SEC 17-2N-25E (EX PT IN OR 303/502,OR 809/1999, OR 1334/775,OR 1334/778, OR 1334/781 & EX ESMT IN OR 601/273) ==================================== 904 17-2N-25-3010-0017-0000 765.91 BRAY DILLON 0.000AC 45125 EULA B RD CALLAHAN FL 32011-0791 LOT 17 R673562 IN OR 1481/1720 WOODGROVE ACRES PB 4/59 ==================================== 905 18-2N-25-3000-0005-0110 340.08 BELL FRANKLIN AARON 46.560AC 45419 ZIDELL ROAD CALLAHAN FL 32011 LOTS 5 & 6 (EX S1/3) & LOT 7 IN OR 1336/421 CALLAHAN HEIGHTS PB 0/30 ==================================== 906 18-2N-25-3000-0008-0000 205.55 BELL FRANKLIN AARON 40.000AC 45419 ZIDELL ROAD CALLAHAN FL 32011 LOTS 8 & 10 IN OR 1303/897 CALLAHAN HEIGHTS PB 0/30 ==================================== 907 18-2N-25-3000-0009-0000 178.38 BELL FRANKLIN AARON & 20.000AC BELL ZACHARY AARON 45419 ZIDELL ROAD CALLAHAN FL 32011 LOT 9 IN OR 1303/898 CALLAHAN HEIGHTS PB 0/30 ==================================== 908 18-2N-25-3000-0011-0000 HX 500.87 BELL FRANKLIN AARON 18.950AC 45419 ZIDELL ROAD CALLAHAN FL 32011-3630 LOT 11 IN OR 818 PG 573 CALLAHAN HEIGHTS PB 0/30 ==================================== 909 18-2N-25-3000-0016-0240 827.71 WITT GARY C & JENNIFER C 9.000AC 5150 ALPHA AVE JACKSONVILLE FL 32205 N1/2 OF LOT 16 (S-24) IN OR 1793/321 CALLAHAN HEIGHTS PB 0/30 ==================================== 910 18-2N-25-3000-0022-0210 65.20 BELL CAROL ANN 5.160AC 45348 ZIDELL RD CALLAHAN FL 32011 PT E1/2 OF LOT 22 IN OR 818/574 BEING ONLY PT LYING S OF OR 1755/1930 CALLAHAN HEIGHTS PBK O/30 ==================================== rf rfntb DEL. TAX LIST 2017.indd 6 4/30/18 12:20 PM

PAGE 67

911 19-2N-25-0000-0001-0000 1,250.48 MITCHELL ARCHIE A JR 1.000AC 45560 HILL RD CALLAHAN FL 32011 IN OR 1784/1006 EX 1-1 3 1-2 & 1-3 ==================================== 912 19-2N-25-0000-0005-0010 HX 210.87 WILLIAMS CECIL DAVID JR & 1.000AC WILLIAMS KAYA & KAYLA (JT/RS) 45467 HILL RD CALLAHAN FL 32011 IN OR 2103/318 ==================================== 913 19-2N-25-0000-0017-0000 260.96 ELEBY DAVID EST 1.000AC PO BOX 657 CALLAHAN FL 32011-0657 IN SW1/4 OF SE1/4 OF NE1/4 OR 828/1575 EX 17-2 ==================================== 914 19-2N-25-0000-0017-0010 1,159.49 MITCHELL ARCHIE ANTHONY 2.530AC PO BOX 955 CALLAHAN FL 32011-0955 PT GOVT LOT 1 OF SEC 19-2N-25E IN OR 1735/88 ==================================== 915 19-2N-25-0000-0017-0030 519.04 WAY RONNIE L EST 1.000AC PO BOX 387 CALLAHAN FL 32011-0387 IN OR 1664/1823 ==================================== 916 19-2N-25-0000-0019-0000 862.29 SHEFFIELD EMILY EST 1.000AC 45005 COLSON ROAD CALLAHAN FL 32011 IN OR 726 PG 5 ==================================== 917 19-2N-25-0000-0019-0010 484.96 ALDERMAN BERNICE JONES W EST 1.000AC 58067 ALDERMAN LANE HILLIARD FL 32046 IN OR 35 PG 345 IN OR 18 PG 374 ==================================== 918 19-2N-25-0000-0026-0020 1,421.70 BLUME IDEE EST 25.000AC PO BOX 781 CALLAHAN FL 32011-0781 IN OR 95 PG 387 EX R/W OR 326 PG 298 ESMT PT OR 1861/825 ==================================== 919 19-2N-25-0000-0028-0010 1,219.24 DUTTON DONALD D 10.720AC 35808 QUAIL ROAD CALLAHAN FL 32011 PT OF SW1/4 OF NW1/4 R407833 L/E PT OR 754/726 EX R/W OR 247/154 EX 28-8 28-9 & 28-10 ==================================== 920 19-2N-25-0000-0033-0020 HX 713.05 WRIGHT GERALD A & 3.000AC WRIGHT CURTIS M & CAROLYN D & 45175 WORDLAW CIRCLE CALLAHAN FL 32011 IN OR 1509/1777 EX FPL R/W OR 281/530 EX ESMT OR 593/63 EX R/W OR 677/232 ==================================== 921 19-2N-25-0000-0033-0090 424.95 NELSON EDWARD ELLIS TRUST 3.000AC FOR CAROL LA RAE NELSON 15 MAGNOLIA DR OXFORD GA 30054 IN OR 379 PG 771 ==================================== 922 19-2N-25-0000-0033-0200 252.95 NELSON FREDEVA M (1/2 INT) & 1.930AC NELSON CAROL L (1/4 INT) & ELLIS RAY (1/4 INT) 15 MAGNOLIA DRIVE OXFORD GA 30054 PT OF W1/2 OF SW1/4 PT OR 1390/172 CASE#50-2006-CP-000548 XXXX MB ==================================== 923 19-2N-25-0000-0035-0010 1,277.44 HAMPTON KEVA & 0.800AC COOPER TERRIE ET AL 45136 DUTTON WAY CALLAHAN FL 32011 PT OF SE1/4 OF NE1/4 OF SW1/4 IN OR 1974/1193 ==================================== 924 19-2N-25-0000-0040-0000 817.89 MOON JEAN 10.000AC 1545 NORTH STIRLING AVENUE PONTIAC MI 48340-1335 NW1/4 OF NW1/4 OF SW1/4 *LESS 2A* PT OR 2030/1492 ==================================== 925 19-2N-25-0000-0042-0030 215.18 LAST FRANK JAMES III & MARY J 1.000AC 2019 ALACHUA ST FERNANDINA BEACH FL 32034-2519 PT OF SW1/4 IN OR 1578/1803 ==================================== 926 19-2N-25-0000-0051-0000 433.13 CRYSTAL I LLC 2.000AC 18305 BISCAYNE BLVD SUITE 400 AVENTURA FL 33160 IN OR 1646/782 ESMT IN OR 288/745 ==================================== 927 19-2N-25-0000-0052-0010 330.49 WILSON MALINDA E 1.000AC 45371 MORGAN CIRCLE CALLAHAN FL 32011 IN OR 1194/1817 EX R/W OR 677/228 ==================================== 928 19-2N-25-0000-0054-0000 846.05 THOMPSON A J 1.570AC 9220 CYPRESS GREEN DR JACKSONVILLE FL 32256 IN OR 2009/1688 EX R/W OR 673/1892 ==================================== 929 19-2N-25-0000-0055-0010 112.14 COAKLEY EMMITT D 0.350AC PO BOX 536 CALLAHAN FL 32011-0536 IN OR 74 PG 312 ==================================== 930 19-2N-25-0000-0075-0000 238.08 KILLINGS LENDFORD & EARTHIE 1.000AC PO BOX 329 CALLAHAN FL 32011 LOTS 36,37 & 38 IN OR 1747/1008 (EX ESMT IN OR 734/1027) W H BRANDIES SURVEY OR 15/357 ==================================== 931 19-2N-25-0000-0084-0000 1,164.83 WILLIAMS ANTHONY 1.940AC 2819 RIPLEY AVE JACKSONVILLE FL 32207 PT GOVT LOT 2 OF SEC 19-2N-25E IN OR 2097/1688(EX PT IN OR 289/715) ==================================== 932 19-2N-25-0000-0102-0010 215.18 MELTON CHAD 1.000AC 7923 BERRY AVE JACKSONVILLE FL 32211 IN OR 1890/825 PARCELS 102-1 & 102-3 EX 102-2 ==================================== 933 19-2N-25-0000-0102-0040 541.11 MELTON CHAD 1.000AC 7923 BERRY AVE JACKSONVILLE FL 32211 PT OF W1/2 OF NW1/4 OF SE1/4 IN OR 1890/827 1984 SANT DW/MH ==================================== 934 19-2N-25-0000-0102-0050 260.96 MELTON CHAD & MELTON BENIN 1.000AC & EBONY MELTON & PO BOX 386 CALLAHAN FL 32011-0386 IN OR 1710/602 ==================================== 935 19-2N-25-0000-0102-0080 HX 1,365.71 JANUSZKIEWICZ LEE & SHERRI L 1.560AC 45174 ARLINE ROAD CALLAHAN FL 32011 IN OR 1322/22 2006 PALM HARBOR DW/MH ==================================== 936 19-2N-25-0000-0108-0000 HX 448.06 KELLY JOANNE 1.000AC P O BOX 545 CALLAHAN FL 32011-0545 IN OR 453 PG 36 PARCELS 108 & 109 ==================================== 937 19-2N-25-0000-0110-0000 180.82 JONES LATHERN B 1.000AC 45772 JONES WAY CALLAHAN FL 32011 PT OR 1590/726 ==================================== 938 19-2N-25-0000-0111-0000 217.48 JONES LATHERN B 1.000AC 45772 JONES WAY CALLAHAN FL 32011 PT OR 1590/726 ==================================== 939 19-2N-25-0000-0118-0010 306.74 MITCHELL MARY J 1.200AC 450224 OLD DIXIE HWY CALLAHAN FL 32011 IN OR 1232/545 ==================================== 940 19-2N-25-0000-0132-0000 385.67 REED-WHITE BETTY (3/4 INT) & 1.000AC WRIGHT LLOYD EST (1/4 INT) 45092 WHITE ROAD CALLAHAN FL 32011 IN DB 135/184 & DB 172/375 & IN OR 1594/661 PARCELS 132 & 133 D/C OR 638/867 ==================================== 941 19-2N-25-0000-0135-0000 720.13 MAIN LINE TIMBER LLC 0.000AC PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PAR 135 PT OR 1385/762 ==================================== 942 19-2N-25-0000-0143-0000 1,424.77 HIGGINBOTHAM ALBERT L & 0.000AC GRAHAM SHARI T (H&W) PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PAR 143 PT OR 1747/1823 ==================================== 943 19-2N-25-0000-0143-0010 789.12 HIGGINBOTHAM ALBERT L & 0.000AC GRAHAM SHARI T (H&W) PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PAR 143-1 PT OR 1747/1823 ==================================== 944 19-2N-25-0000-0143-0020 1,022.32 MAIN LINE TIMBER LLC 0.000AC PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PAR 143-2 PT OR 1385/762 ==================================== 945 19-2N-25-0000-0144-0000 1,102.90 MAIN LINE TIMBER LLC 0.000AC PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PT OR 1385/758 PAR 144 ANNEXED CITY #13-0-2005 ==================================== 946 19-2N-25-0000-0145-0000 795.91 MAIN LINE TIMBER LLC 0.000AC PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PT OR 1385/758 PAR 145 ANNEXED CITY #13-0-2005 ==================================== 947 19-2N-25-0000-0147-0000 592.00 MAIN LINE TIMBER LLC 0.000AC PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PT OR 1385/758 PAR 147 ANNEXED CITY #13-0-2005 ==================================== 948 19-2N-25-0000-0147-0010 467.37 MAIN LINE TIMBER LLC 0.000AC PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PT OR 1385/758 PAR 147-1 ANNEXED CITY # 13-0-2005 ==================================== 949 19-2N-25-0000-0147-0020 2,356.62 MAIN LINE TIMBER LLC 0.000AC PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 2 PT OR 1385/758 PAR 147-2 ANNEXED #13-0-2005 ==================================== 950 19-2N-25-0000-0149-0030 HX 195.51 STEPHENS KAREN D JONES 1.000AC P O BOX 1854 CALLAHAN FL 32011-1854 IN OR 696/1294 94 S/W SKYLARK ==================================== 951 19-2N-25-0000-0149-0040 352.54 CRANDELL JOSEPH G 1.400AC 45014 MADISON LANE CALLAHAN FL 32011 PT OR 1733/323 CASE #11-CP-16 ==================================== 952 19-2N-25-3020-0018-0000 46.11 DUTTON DONALD D 2.500AC 35808 QUAIL ROAD CALLAHAN FL 32011 IN SW1/4 OF SE1/4 OF NW1/4 PT OF LOTS 18 19 30 31 32 WEST OF RD L/E PT OR 754/726 SUB OF SE1/4 OF NW1/4 ==================================== 953 19-2N-25-3020-0033-0000 HX 312.59 PATTERSON MARK SR & 1.500AC ROBERTS MAHALIA 450426 OLD DIXIE HWY CALLAHAN FL 32011 LOT 33 & PT LOT 32 E SR 115 IN OR 1596/1847 R497691 SUB OF SE1/4 OF NW1/4 ==================================== 954 20-2N-25-0000-0011-0000 371.69 SAMPSON JAMES L 1.000AC 45086 WHITFIELD ROAD CALLAHAN FL 32011 IN OR 791 PG 607 ==================================== 955 21-2N-25-0000-0005-0000 483.88 BYRD JEAN ANN & 3.450AC SMITH RUTH BYRD ET AL 45049 BENRAY LANE CALLAHAN FL 32011 PT OR 456/745 EX 5-2 ==================================== 956 21-2N-25-0000-0005-0020 611.54 WYNDAM MARISSA & 0.860AC SMITH RUTH BYRD ETAL 45049 BENRAY LANE CALLAHAN FL 32011 PT OR 946/1954 ==================================== 957 22-2N-25-1460-0003-0000 3,589.03 GUY THIAM 0.000AC 85372 CLAXTON ROAD YULEE FL 32097 LOT 3 IN OR 1519/406 NORTH DEERWOOD EST PB 6/173 ==================================== 958 22-2N-25-1460-0004-0000 HX 3,268.45 TOY GEORGETTE C 0.000AC 45176 AMERICAN DREAM DRIVE CALLAHAN FL 32011 LOT 4 IN OR 1280/1197 NORTH DEERWOOD EST PB 6/173 ==================================== 959 22-2N-25-1460-0005-0000 607.12 U Y PROPERTIES LLC 0.000AC 45176 AMERICAN DREAM DRIVE CALLAHAN FL 32011 LOT 5 PT OR 1634/724 NORTH DEERWOOD EST PB 6/173 ==================================== 960 22-2N-25-1460-0010-0000 632.53 TOY RYAN J 0.000AC 180 BOX TREE COURT JACKSONVILLE FL 32225 LOT 10 IN OR 1093/983 NORTH DEERWOOD EST PB 6/173 ==================================== 961 22-2N-25-1460-0020-0000 2,823.56 TOY CAROLYN GEORGETTE 0.000AC 45176 AMERICAN DREAM DRIVE CALLAHAN FL 32011 LOT 20 IN OR 1650/1877 NORTH DEERWOOD EST PB 6/173 ==================================== 962 25-2N-25-0000-0001-0100 HX 681.24 PIPPIN PERRY J & SHERYL S 2.100AC 45979 BISMARK ROAD CALLAHAN FL 32011 IN OR 1546/67 ==================================== 963 26-2N-25-0000-0001-0200 HX 2,605.32 JONES RICHARD A & GAYLA S 1.000AC 55798 BEAR RUN ROAD CALLAHAN FL 32011-8560 IN OR 1224/458 PARCEL 1-20 & TRACT A OF GREEN ACRES PB6/261 ==================================== 964 26-2N-25-0672-0001-0000 485.81 GREEN RANDALL B 0.000AC 54137 CHURCH ROAD CALLAHAN FL 32011 LOT 1 GREEN ACRES PB 6/261 ==================================== 965 27-2N-25-0000-0004-0120 HX 219.30 TSCHAPPAT MEGAN L 1.240AC 55092 OLLIFF ROAD CALLAHAN FL 32011 PT OF GOVT LOTS 4 & 5 IN OR 1978/869 R567537 & R567538 ==================================== 966 27-2N-25-0000-0004-0280 HX 639.57 WALKER GEORGE T SR & 1.710AC WALKER JOYCE E 54593 MARSH RD CALLAHAN FL 32011 IN OR 892/575 R673141 & R673142 ==================================== 967 27-2N-25-0000-0004-0300 590.52 RAY RICHARD C 1.220AC 44152 SWALLOWFORK AVE CALLAHAN FL 32011 IN OR 818/1013 & OR 1429/1966 R672485 & R672486 ==================================== 968 27-2N-25-0000-0005-0050 HX 466.78 SCARBOROUGH GLENDA L 2.880AC 54388 MARSH ROAD CALLAHAN FL 32011 PT OF GOVT LOTS 4 & 5 IN OR 1716/1322 EX 5-8 ESMT IN OR 409/25 R673282 & 1982/SHOW/SW/MH ==================================== 969 27-2N-25-8600-0003-0000 HX 1,850.29 PARKERSON RHETT P & TANYA D 0.000AC 55138 PEACEFUL TRAIL DRIVE CALLAHAN FL 32011 LOT 3 IN OR 1257/829 THE TRAILS PB 6/296 ==================================== 970 28-2N-25-0150-0005-0000 1,226.91 CONNER CHAD DANIEL 1.100AC 45229 BISMARK RD CALLAHAN FL 32011 LOT 5 IN OR 1840/537 1989 SAND SW/MH BISMARK ACRES PB 5/283 ==================================== 971 28-2N-25-3060-0002-0010 1,011.50 KILPATRICK JOEY ALLAN 1.010AC 45116 KILPATRICK RD CALLAHAN FL 32011 PT OF LOT 2 (S-1) IN OR 1996/1625 EAST CALLAHAN SUB PB 1/35 ==================================== 972 28-2N-25-3060-0003-0000 HX 1,776.09 EBY TERRY & MARILYN 20.310AC 45113 SNICKERS TRAIL CALLAHAN FL 32011 LOTS 3 4 & 63 & PT OF 61 & 62 & 30 FT OF ESMT IN OR 1069/1448 ESMT IN OR 508/701 EAST CALLAHAN SUB PB 1/35 ==================================== 973 28-2N-25-3060-0007-0010 1,184.48 DAVIS WALTER LEE & 1.010AC DAVIS ASHLEY ANN 1770 RIDGE RD CANTON GA 30114 PT OF LOT 7 (S-1) IN OR 2131/932 EAST CALLAHAN SUB PB 1/35 ==================================== 974 28-2N-25-3060-0010-0010 HX 432.29 HOLTON ERMA J & 4.000AC JACK HOLTON JR (M&S) 45228 BISMARK ROAD CALLAHAN FL 32011 PT OF LOT 10 & 27 S-1 IN OR 732 PG 626 EX S-9 OF LOT 10 EAST CALLAHAN SUB PB 1/35 ==================================== 975 28-2N-25-3060-0012-0010 536.23 FRALICK MARTHA A EST 1.180AC 45001 REVERE STREET CALLAHAN FL 32011 PT OF LOT 12 & 25 IN OR 758/1792 EAST CALLAHAN SUB PBK 1/2 & PBK 1/35 {1980 GUER DW/MH} ==================================== 976 28-2N-25-3060-0012-0050 196.85 CRAY PRIMULA H 0.720AC P O BOX 5031 CALLAHAN FL 32011 PT OF LOTS 12 & 13 IN OR 801/1939 EAST CALLAHAN SUB PBK 1/2 & PBK 1/35 ==================================== 977 28-2N-25-3060-0017-0000 HX 762.78 FOX J LEE EST 7.100AC C/O DAVID SEAN FOX 45018 HEMMINGWAY LN CALLAHAN FL 32011 S 939 FT OF LOT 17 IN OR 497 PG 411 R 107333 & R 107334 EAST CALLAHAN S/D ==================================== 978 28-2N-25-3060-0025-0020 1,835.23 FISHER MARGARET SUE 1.300AC 45030 REVERE STREET CALLAHAN FL 32011 PT OF LOT 25 IN OR 2049/1734 EAST CALLAHAN S/D PBK 1/35 ==================================== 979 28-2N-25-3060-0033-0050 460.17 ANDERSON KIMBERLY 1.870AC 872 S BRETT ST CRESTVIEW FL 32539-4226 PT OF LOT 33 IN OR 896/1570 EAST CALLAHAN PB 1/35 ==================================== 980 28-2N-25-3060-0047-0030 HX 2,396.22 HODGES ROGER L & ANGELA K 5.790AC 45164 STRATTON ROAD CALLAHAN FL 32011 S-3 & S-5 OF LOT 47 IN OR 1311/1386 EAST CALLAHAN SUB PB 1/35 ==================================== 981 29-2N-25-0000-0005-0000 HX 3,479.32 MIZELL WALTER S & CARRIE D 10.990AC 45200 DORMAN PLACE CALLAHAN FL 32011 PT GOVT LOT 1 SEC 29-2N-25E & PT PEDRO PONS GRANT SEC 47-2N-25E PAR 5 IN OR 800/1079 & 928/1829 (EX PT OR 713/112 & R/W OR 442/681) ==================================== 982 29-2N-25-0000-0008-0000 8,767.32 WEST NASSAU LAND DEV LLC 0.000AC C/O BURBRIDGE REALTY COMPANY 245 E ADAMS STREET JACKSONVILLE FL 32202 PT GOVT LOT 2 & PT NW1/4 OF SEC 29-2N-25E IN OR 1513/33, OR 1394/1521,OR 1494/1717 & ESMT OR 1540/1328 & OR 1540/1327 (EX PT IN R/W OR 988/1863) ==================================== 983 29-2N-25-0000-0010-0070 4,513.17 CALLAHAN DEVELOPMENT GROUP LLC 0.000AC C/O BURBRIDGE REALTY COMPANY 245 E ADAMS ST JACKSONVILLE FL 32202 IN OR 1309/1265 & OR 1212/1505 PARCELS 10-7 11 & 11-1 EX R/W CASE #99-1163-CA ESMT OR 1331/366 ==================================== 984 29-2N-25-0000-0012-0000 2,267.80 BENNETT JUDSON B 1/2 INT & 0.000AC BURNS ANDREW L 1/2 INT 10562 NEW KINGS RD JACKSONVILLE FL 32219 PT NW1/4 OF SEC 29-2N-25E IN OR 2119/1225 (EX R/W CASE# 99-1163-CA) ==================================== 985 29-2N-25-0000-0016-0010 231.52 SCOTT JEANNE 0.000AC PO BOX 1199 HILLIARD FL 32046-1199 PT OF NW1/4 OF SEC 29-2N-25E IN OR 1210/1075 {R278350} ==================================== 986 29-2N-25-0000-0016-0100 913.86 SCOTT JEANNE 0.000AC P O BOX 1199 HILLIARD FL 32046 PT OF NW1/4 OF SEC 29-2N-25E IN OR 958/15 ==================================== 987 29-2N-25-0000-0026-0000 HX 434.89 SIMMONS JACQUELINE EST & 0.000AC BROWN RUTHIE MAE (T/I/C) 618291 MARTIN LUTHER KING AVE CALLAHAN FL 32011 IN OR 1852/1193 ==================================== 988 29-2N-25-3120-0009-0000 1,652.38 G & H LAND DEVELOPMENT LLC 0.000AC PO BOX 1694 CALLAHAN FL 32011-1694 BLOCK 1 PT OF LOTS 4 & 5 S-9 IN OR 1327/201 BOOTH SURVEY PB 1/29 ==================================== 989 29-2N-25-3120-0012-0000 4,022.84 BRADDOCK DALE P & CAROL E 0.000AC PO BOX 511 CALLAHAN FL 32011-0511 BLK 1 PT LOT 5 IN OR 349/445 JEHU BOOTHE SURVEY PBK 1/29 ==================================== 990 29-2N-25-3120-0013-0000 1,309.02 MIZELL WALTER S & CARRIE D 0.000AC 45200 DORMAN PLACE CALLAHAN FL 32011 BLK 1 PT LOTS 5 & 6 IN OR 1516/1704 JEHU BOOTHE SURVEY PBK 1/29 ==================================== 991 29-2N-25-3120-0041-0000 1,862.22 HIGGINBOTHAM WAYNE A 0.000AC 2031 RED HILL RD JESUP GA 31545 BLK 4 PT LOTS 1 & 2 IN OR 930/494 (EX OR 1355/756) BOOTHS SURVEY PBK 1/29 ==================================== 992 29-2N-25-3120-0070-0000 1,200.09 JONES ALLEN LAMARR JR 0.000AC 619 CARRACK DRIVE ST MARYS GA 31558 BLOCK 23 PT OF LOTS 6 & 7 IN OR 1594/282 & OR 1594/284 J M DANCY SURVEY ==================================== 993 29-2N-25-3160-0002-0064 1,049.50 BRADDOCK CAROL E & 0.000AC EMMI NANCY E PO BOX 511 CALLAHAN FL 32011 BLK 2 PT OF LOT 6 IN OR 1879/856 E H BRADDOCKS ADDITION DB 39/362 ==================================== 994 29-2N-25-3200-0002-0010 1,111.80 JAN INVESTMENT GROUP INC 0.000AC PO BOX 455 CALLAHAN FL 32011 BLOCK 2 LOTS 1 2 PT OF 3 LOTS 7 & 8 IN OR 1831/272 R12474100 R498203 & 1998 GENE DW/MH R12397364 LAKESIDE PARK SUB PB 0/36 ==================================== 995 29-2N-25-3200-0003-0010 HX 2,453.03 BELL RONALD W & BRENDA D 0.000AC 45219 MICKLER STREET CALLAHAN FL 32011 BLOCK 3 LOTS 1 & 2 IN OR 477 PG 249 LAKESIDE PARK SUB PB 0/36 ==================================== 996 29-2N-25-3200-0003-0030 1,714.31 BRADDOCK CLAUDINE P EST 0.000AC C/O DONALD G BRADDOCK 45134 BOOTH ST CALLAHAN FL 32011 BLOCK 3 LOTS 3 & 6 PT OR 381 PG 500 (BY WILL) LAKESIDE PARK SUB PB 0/36 ==================================== 997 29-2N-25-3200-0003-0040 2,217.54 BRADDOCK CLAUDINE P EST 0.000AC C/O DONALD G BRADDOCK 45134 BOOTH ST CALLAHAN FL 32011 BLOCK 3 LOTS 4 & 5 IN OR 128 PG 392 LAKESIDE PARK SUB PB 0/36 ==================================== 998 29-2N-25-3220-0003-0021 2,983.32 MCGRATH DONNA 0.000AC 45127 BOOTH ST CALLAHAN FL 32011 BLOCK 3 PT OF LOT 2 (S-1) IN OR 1759/1552 WILSON & OGILVIE SUB DB B9/500 ==================================== 999 29-2N-25-3220-0003-0046 2,559.69 BUILDING BLOCKS ACADEMY LLC 0.000AC PO BOX 2221 CALLAHAN FL 32011 BLOCK 3 PT OF LOTS 4 & 5 IN OR 2103/1996 WILSON & OGILVIE SUB DB B9/500 ==================================== 1000 29-2N-25-3220-0003-0052 973.87 JAN INVESTMENT GROUP INC 0.000AC PO BOX 455 CALLAHAN FL 32011 BLOCK 3 PT OF LOT 5 IN OR 1450/1666 WILSON & OGILVIE SUB DB B9/500 ==================================== 1001 29-2N-25-3220-0003-0053 1,109.25 JAN INVESTMENT GROUP INC 0.000AC PO BOX 455 CALLAHAN FL 32011-0455 BLOCK 3 PT OF LOT 5 TOWNHOUSE IN OR 1503/1224 WILSON & OGILVIE SUB DB B9/500 ==================================== 1002 29-2N-25-3220-0003-0054 1,105.66 JAN INVESTMENT GROUP INC 0.000AC PO BOX 455 CALLAHAN FL 32011-0455 BLOCK 3 PT OF LOT 5 IN OR 1503/1215 WILSON & OGILVIE SUB DB B9/500 ==================================== 1003 30-2N-25-0000-0001-0020 4,527.07 MAIN LINE TIMBER LLC 16.790AC PO BOX 1694 CALLAHAN FL 32011-1694 PT E1/2 OF NE1/4 PT OR 1385/758 PAR 1-2 LYING EAST OF RR R/W ==================================== 1004 30-2N-25-0000-0001-0060 2,284.80 MAIN LINE TIMBER LLC 10.080AC PO BOX 1694 CALLAHAN FL 32011-1694 PT E1/2 OF NE1/4 PT OR 1385/758 PARCELS 1-6 & 37-1 ==================================== 1005 30-2N-25-0000-0003-0140 37.71 KELLY DAVID M & 1.600AC KELLY KERSTI G (JT/RS) 45200 OAK TRAIL CALLAHAN FL 32011 PT NE1/4 OF SEC 30-2N-25E IN OR 2135/1212 ==================================== 1006 30-2N-25-0000-0004-0070 HX 1,983.49 CARROLL MICHAEL E & SANDRA K 1.200AC 45320 OAK TRAIL CALLAHAN FL 32011 PT OF SW1/4 OF NE1/4 IN OR 521 PG 1019 ==================================== 1007 30-2N-25-0000-0009-0000 465.21 MCANINCH ELLIS L JR 2.200AC P O BOX 282 CALLAHAN FL 32011-0282 PT SE1/4 OF NE1/4 OF SEC 30-2N-25E & PT OF FRACL NW1/4 OF SEC 29-2N-25E IN OR 893/229 (EX PT IN R/W & EX PT IN OR 520/526) ==================================== 1008 30-2N-25-0000-0016-0000 4,635.20 MCANINCH ELLIS JR & CHARLOTTE & CALLAHAN FUNERAL HOME INC 0.000AC PO BOX 282 CALLAHAN FL 32011 PT OF NE1/4 OF SEC 30-2N-25E & PT LOTS 2,3,4,5,6 & 11 OF A E OGILVIE ADDN #2 PBK 1/19 IN OR 1595/1247 (EX PT IN R/W) ==================================== 1009 30-2N-25-0000-0017-0000 2,230.64 MORGAN RUBY A ESTATE 3.640AC C/O LEONARD MORGAN 45276 MORGAN CIRCLE CALLAHAN FL 32011 IN OR 83 PG 144 (EX PARCELS 17-1,17-2, 18 & 19) EX 17-3 1/6 HX INT ==================================== 1010 30-2N-25-0000-0019-0000 478.46 BOATWRIGHT THEODO & JENNIE VE 1.950AC 45136 DUTTON WAY CALLAHAN FL 32011 IN DB 130/526 & OR 428/30 EX R/W OR 673/1890 ==================================== 1011 30-2N-25-0000-0033-0010 656.44 WALTON DEBRA 1.030AC 45100 PONY TRAIL CALLAHAN FL 32011 PT OF SE1/4 OF SEC 30-2N-25E IN OR 2050/1729 ==================================== 1012 30-2N-25-0000-0037-0000 289.01 MAIN LINE TIMBER LLC 0.960AC PO BOX 1694 CALLAHAN FL 32011-1694 PT E1/2 OF NE1/4 PT OR 1385/758 PAR 37(EX 37-1) ==================================== 1013 32-2N-25-0000-0002-0020 HX 1,718.84 DELL DEBORAH H 5.340AC 44087 WOODSIDE LANE CALLAHAN FL 32011 PT GOVT LOT 1 IN OR 1567/869 (EX OR 18/139) ==================================== 1014 32-2N-25-0000-0007-0000 2,930.92 WHIDDEN LOREN G 0.000AC 541703 US HWY 1 CALLAHAN FL 32011 PT GOVT LOT 1 OF SEC 32-2N-25E IN OR 285/212 & ESMT IN OR 290/693 ==================================== 1015 32-2N-25-0000-0007-0010 1,337.97 DUEY-DODGE AMY LEGARE 0.000AC 940272 OLD NASSAUVILLE RD FERNANDINA BEACH FL 32034 PT GOVT LOT 1 OF SEC 32-2N-25E IN OR 1939/1231 ==================================== 1016 32-2N-25-0000-0009-0030 1,104.12 HOLLEY MARCUS W 0.000AC PO BOX 960 HILLIARD FL 32046 PT GOVT LOT 1 & PT OF SE1/4 OF SEC 32-2N-25E IN OR 1876/506 ==================================== 1017 32-2N-25-019B-0041-0000 2,276.03 ALLEN TRAVIS JOEL 0.000AC 44401 MARY SAULS CIRCLE CALLAHAN FL 32011 LOT 41 IN OR 1589/437 BRANCH CREEK PB 7/343 ==================================== 1018 32-2N-25-019B-0059-0000 268.82 GREENE KENNETH LEE JR 0.000AC 44959 GREEN MEADOWS LANE CALLAHAN FL 32011 LOT 59 PT OR 1739/377 BRANCH CREEK PB 7/343 ==================================== 1019 32-2N-25-019B-0060-0000 268.82 GREENE KENNETH L JR 0.000AC PO BOX 544 CALLAHAN FL 32011-0544 LOT 60 IN OR 1713/343 BRANCH CREEK PB 7/343 ==================================== 1020 32-2N-25-019B-0061-0000 271.94 GREENE KENNETH LEE JR 0.000AC 44959 GREEN MEADOWS LANE CALLAHAN FL 32011 LOT 61 PT OR 1739/377 BRANCH CREEK PB 7/343 ==================================== 1021 32-2N-25-2920-0002-0020 238.08 NEWCOMB ETHEL S 1.000AC C/O RICHARD T NEWCOMB 7590 N DESERT TREE DRIVE TUCSON AZ 85704 BLOCK 2 LOT 2 ESMT PT OR 1861/825 NEWCOMB SUB-SOUTH CALLAHAN PB1/16 ==================================== 1022 32-2N-25-2920-0002-0041 HX 163.52 ROCHAY LEON D 1.890AC 45354 PICKETT STREET CALLAHAN FL 32011 BLOCK 2 PT OF LOT 4 IN OR 457/299 EX S-3 OF LOTS 3 & 4 & EX S-4 & S-6 OF LOT 4 1974 EAGL SW/MH ESMT PT OR 1861/825 NEWCOMB SUB S CALLAHAN PB 1/16 ==================================== 1023 32-2N-25-2920-0002-0061 407.39 SHAW GLORIA & 1.000AC CARTER JERALD & 5287 OTTER LN MIDDLEBURG FL 32068-4421 BLOCK 2 LOT PT OF 6 (S-1) R278180 CASE #12-CP-184 OR 1860/173 NEWCOMB SUB SOUTH CALLAHAN PB 1/16 ==================================== 1024 32-2N-25-2920-0002-0067 313.97 WILLIAMS CAROLYN D (1/4 INT) & 1.000AC GODWIN DAVID ANTHONYJR(3/4 IN) 44427 COMMANCHEE RD CALLAHAN FL 32011 BLOCK 2 PT OF LOT 6 IN OR 1002/1186 & OR 2046/103 NEWCOMB SUB-SOUTH CALLAHAN PB 1/16 ==================================== 1025 32-2N-25-2920-0002-0610 469.62 SLAY RILEY JR 1.000AC P O BOX 369 CALLAHAN FL 32011 BLOCK 2 PT OF LOT 6 (S-10) IN OR 1506/1784 NEWCOMB SUB SOUTH CALLAHAN PB 1/16 ==================================== 1026 32-2N-25-2920-0003-0040 1,268.14 GRIFFIN GERALD R JR 11.000AC 54613 MARLEE RD CALLAHAN FL 32011 BLOCK 3 LOTS 4 & 5 & W 14 FT OF 3 & 6 PT OR 1883/289 NEWCOMB SUB-SOUTH CALLAHAN PB 1/16 ==================================== 1027 32-2N-25-2920-0003-0101 HX 842.75 BECK STANLEY R 4.190AC PICKETT ROAD 44121 LINSEY LANE CALLAHAN FL 32011 BLOCK 3 PT LOTS 10 & 11 OR 697/1473-1477 ESMT OR 357/497 & 498 ESMT PT OR 1861/825 NEWCOMB SUB SOUTH CALLAHAN PB 1/16 ==================================== 1028 32-2N-25-4020-0004-0000 852.27 KIMES DONDI CLINTON 8.350AC 44265 CATTLE BEND CALLAHAN FL 32011 PT LOT 4 PT OR 1407/1233 ESMT PT OR 887/844 PICKETT ESTATE PBK 2/27 ==================================== 1029 32-2N-25-4020-0004-0020 HX 1,642.61 ARNOLD JERRY RAY & PAULA ANN 1.030AC 44354 CATTLE BEND DR CALLAHAN FL 32011 PT LOT 4 PAR 4-2 PT OR 890/553 (EX IN OR 1748/1554 & EX LOT 4 OF ANTHONY BRYANT LAND SUB DBK 169/496 LYING N THEREOF) PICKETT ESTATES PBK 2/27 ==================================== 1030 32-2N-25-4020-0006-0040 HX 218.88 SUTTON DARIN ALAN 1.000AC 44107 MARY SAULS CIRCLE CALLAHAN FL 32011 PT OF LOT 6 (SEC 49) OR 669/1935 (EX S-6) R787664 PICKETT ESTATES PB 2/27 ==================================== 1031 32-2N-25-4020-0010-0020 938.61 NOBLES JOHN & MARY 2.870AC 45082 WEAVER CIRCLE CALLAHAN FL 32011 PT OF LOT 10 & LOTS 13 & 14 IN OR 2016/3 PICKETT ESTATES PB 2/27 ==================================== 1032 32-2N-25-5750-0008-0000 444.60 ARNOLD KEITH & TERESA 2.100AC PO BOX 84 CALLAHAN FL 32011-0084 LOT 8 IN OR 979/1958 RAILROAD ESTATES PB 6/118-119 ==================================== 1033 32-2N-25-5750-0009-0000 HX 551.50 ARNOLD KEITH 2.330AC P O BOX 84 CALLAHAN FL 32011-0084 LOT 9 IN OR 850/996 R787657 & R787658 RAILROAD ESTATES PB 6/118-119 ==================================== 1034 33-2N-25-0000-0002-0000 2,046.85 SCOTT JEANNE H 3.440AC P O BOX 1199 HILLIARD FL 32046 IN OR 851 PG 795 R787964 R787965 & 92 DEST SW ==================================== 1035 33-2N-25-0000-0015-0190 2,301.24 AGUILAR JOSE LUIS 12.640AC 541801 LEM TURNER RD CALLAHAN FL 32011 PT E1/2 OF SEC 33-2N-25E & PT SE1/4 OF SEC 32-2N-25E IN OR 2008/1128 BEING PARCELS 1,2 & 3 {R787687} ==================================== 1036 33-2N-25-0000-0015-0200 1,130.32 DON CARTER PLUMBING INC 0.000AC PO BOX 735 CALLAHAN FL 32011-0735 PT SW1/4 OF SEC 33-2N-25E IN OR 2012/1524 BEING EXHIBIT C ==================================== 1037 34-2N-25-0000-0001-0090 39.36 TURNING LEAF HOMEOWNERS ASSC 0.030AC (OF NASSAU COUNTY) INC 11555 CENTRAL PKWY STE 801 JACKSONVILLE FL 32224 IN OR 2040/1187 EX TURNING LEAF PB 7/275-279 ==================================== 1038 34-2N-25-0000-0008-0030 HX 379.50 POTZER CHRISTY LEE WHITLEY 1.000AC 54482 WILBUR JONES ROAD CALLAHAN FL 32011 IN OR 1354/1965 1998 REDMAN DW/MH ==================================== 1039 42-2N-25-0000-0001-00M1 64.29 ATLANTIC COAST BANK 0.000AC 10151 DEERWOOD PARK BLVD BLDG 200 JACKSONVILLE FL 32256-0566 PT OF SEC 42 PT OR 1694/1068 PT OF PARCELS 1-12 1/3 INT 591.45 ACRES MINERAL RIGHTS ONLY ==================================== 1040 42-2N-25-0000-0013-0010 2,447.38 G&H LAND & TIMBER INVESTMENTS 42.150AC LLC PO BOX 1694 CALLAHAN FL 32011 PT FRANCIS WOODS DONATION SEC 42-2N-25E IN OR 1959/1629 ==================================== 1041 42-2N-25-0000-0013-0020 2,324.81 BENT OAK FARMS OF CALLAHAN LLC 31.120AC PO BOX 1694 CALLAHAN FL 32011 PT FRANCIS WOODS DONATION SEC 42-2N-25E IN OR 1959/1632 (EX PT IN OR 2084/1982) ==================================== 1042 42-2N-25-0000-0015-0010 59.72 ARMSTRONG R H & MARILYN 1.210AC 450829 SR 200 CALLAHAN FL 32011 PT FRANCIS WOODS DONATION SEC 42 PT OF ABDN RR R/W PT OR 511/830 (EX PT IN OR 849/390 & OR 856/385) ==================================== 1043 42-2N-25-0000-0019-0010 424.95 RICKS JOEY 1.600AC 85535 KIRKLAND RD YULEE FL 32097 PT FRANCIS WOODS GRANT SEC 42-2N-25E IN OR 2057/1582 (EX DOT R/W IN OR 1001/1611 & OR 2026/1933) ==================================== 1044 42-2N-25-0000-0019-0030 2,044.06 PHILLIPS CLINT 1.600AC 23880 FLORA PARKE BLVD FERNANDINA BEACH FL 32034 PT FRANCIS WOODS GRANT SEC 42-2N-25E IN OR 2039/1004 ==================================== 1045 42-2N-25-0000-0021-0000 HX 444.09 HARTLEY JOSEPHINE M EST 1.450AC 55060 ZWEIFEL ROAD CALLAHAN FL 32011 S260 FT OF E223 FT R787334 & R787335 IN OR 844 PG 1480 ==================================== 1046 46-2N-25-0000-0002-0030 HX 613.62 HUNT GRACE DIANE 5.060AC 45958 BISMARK ROAD CALLAHAN FL 32011 IN OR 1035/834 1994 HOME DW ==================================== 1047 46-2N-25-0000-0014-0030 422.67 CARTER BRYANT STEVEN III 1.000AC 54131 OGILVIE ROAD CALLAHAN FL 32011 PT OF LOT 6 IN OR 803/1034 PARCELS 14-3 & 15-6 ==================================== 1048 46-2N-25-0000-0017-0010 365.29 STRAWN STEPHANIE C MUSGROVE 1.000AC 25815 GIFT SHOP ROAD OPP AL 36467 PT OF LOT 6 IN OR 800 PG 1498 ==================================== 1049 46-2N-25-0000-0020-0010 HX 2,402.95 BAKER BEVERLY J & 2.160AC MILEY DELVIN H JR 54720 OGILVIE ROAD CALLAHAN FL 32011 IN OR 552 PG 1071 ==================================== 1050 46-2N-25-0240-0022-0000 2,552.29 GORE RICHARD R & JUDY C 0.000AC 14590 DUVAL PLACE W JACKSONVILLE FL 32218 LOT 22 IN OR 2071/1441 CLEAR LAKE ESTATES #1 PB 7/346 ==================================== 1051 46-2N-25-197A-0003-0110 HX 1,857.78 BRACKETT EDWARD C & COZETTA T 0.000AC 55012 DEER RUN DR CALLAHAN FL 32011 BLOCK 3 LOT 11 IN OR 662 PG 1230 SPRING LAKE EST #1 PB 5/183 ==================================== 1052 46-2N-25-197B-0005-0050 4,106.50 LARSON GARY 0.000AC 2866 DICKIE ST JACKSONVILLE FL 32216 BLOCK 5 LOT 5 IN OR 1695/1158 & OR 1728/535 SPRING LAKE EST #2 PB 5/185 ==================================== 1053 46-2N-25-197B-0005-0060 HX 2,869.32 GREEN FERLANDIS F & CHARLENE Y 0.000AC 55690 YELLOW JACKET DRIVE CALLAHAN FL 32011 BLOCK 5 LOT 6 IN OR 1836/306 SPRING LAKE EST #2 PB 5/185 ==================================== 1054 46-2N-25-197D-0013-0020 HX 2,179.95 FORD THOMAS H JR & MICHELE B 0.000AC 54651 SPRING LAKE DRIVE CALLAHAN FL 32011 BLOCK 13 LOT 2 IN OR 1443/1267 CONSERV ESMT PT OR 929/824 SPRING LAKE EST 4 REPLAT PB 6/177 ==================================== 1055 46-2N-25-197D-0014-0170 3,292.50 WILLIAMS KATHALEEN D 0.000AC P O BOX 451878 KISSIMMEE FL 34745 BLOCK 14 LOT 17 IN OR 1460/1800 CONSERV ESMT PT OR 929/824 SPRING LAKE EST 4 REPLAT PB 6/177 ==================================== 1056 46-2N-25-197D-0014-0330 485.81 WASHINGTON GEORGE III & CHELSEY 0.000AC 2124 FAIRFAX STREET JACKSONVILLE FL 32209 BLOCK 14 LOT 33 PT OR 940/146 SPRING LAKE EST 4 REPLAT PB 6/177 ==================================== 1057 46-2N-25-197D-0014-0340 485.81 WASHINGTON GEORGE III & CHELSEY 0.000AC 2124 FAIRFAX STREET JACKSONVILLE FL 32209 BLOCK 14 LOT 34 PT OR 940/146 SPRING LAKE EST 4 REPLAT PB 6/177 ==================================== 1058 47-2N-25-0000-0004-0060 190.29 U Y PROPERTIES LLC 4.150AC 45176 AMERICAN DREAM DRIVE CALLAHAN FL 32011 PARCELS 4-6 & S-2 OF LOT 3 OF SHADY GROVE PB 6/13-14 PT OR 1634/724 EX PAR 4-7 4-11 & 4-14 ==================================== 1059 47-2N-25-0000-0005-0010 322.80 WYNDAM MARISSA & 1.270AC SMITH RUTH BYRD ETAL PO BOX 493 CALLAHAN FL 32011-0493 PT OR 946/1954 ==================================== 1060 47-2N-25-0000-0006-0010 HX 445.09 PETREE FAMILY TRUST 4.110AC LYNDA F PETREE TRUSTEE ET AL 45217 PETREE RD CALLAHAN FL 32011 PT OF PEDRO PONS GRANT IN SEC 47-2N-25E IN OR 2093/1044 ==================================== 1061 47-2N-25-4080-0008-0010 1,981.20 MILLIGAN RONALD G & 4.380AC JEANNE SCOTT (H&W) P O BOX 1199 HILLIARD FL 32046 LOT 8 R497874 IN OR 888/216 EX R/W OR 1031/451 BUNKER HILL SUB PB 0/17 ==================================== 1062 47-2N-25-4080-0011-0040 2,645.12 HUTSON JULIE WILDES 73.350AC 45249 MEADOWBROOK LN CALLAHAN FL 32011 PT OF LOTS 9 11 12 13 20 & 25 & ALL OF LOTS 21 THRU 24 EX R/W OR 1064/1538 EX DRAINAGE R/W & ESMT CASE #2012-CP-19 OR 1799/1759 EX CASE #03-64-CA BUNKER HILL SUB PB 0/17 ==================================== 1063 47-2N-25-4080-0014-0030 1,030.74 THOMAS LILLIAN EST 2.320AC P.O. BOX 1537 CALLAHAN FL 32011-1537 PT OF LOT 14 & LOT 15 (S-2 OF LOT 14 & S-3 OF LOT 14 & S-3 OF LOT 15) IN DB 248/125 & OR 24/460 IN OR 106/301 & OR 115/692 EX R/W OR 1078/1745 BUNKER HILL SUB PB 0/17 ==================================== 1064 47-2N-25-4080-0017-0040 HX 123.15 GODWIN PATRICIA 1.370AC 450383 STATE ROAD 200 CALLAHAN FL 32011 PT OF LOTS 16 & 17 A/K/A TRACT 3 BUNKER HILL SUB UNR IN OR 2001/981 1985 GOLD DW/MH EX R/W OR 999/953 BUNKER HILL SUB PB 0/17 ==================================== 1065 47-2N-25-720S-0005-0000 14,603.09 VICTORY VISION INC 96.590AC PO BOX 1459 CALLAHAN FL 32011 PT OF LOTS 3,4 & 5 OF SHADY GROVE S/D PBK 6/13 & TRACT A OF TRAILS #2 S/D PBK 7/47 IN IN OR 1318/958 & OR 1653/861 ==================================== 1066 49-2N-25-4100-0003-0010 1,732.58 HIGGINBOTHAM MARY ANN 0.000AC HIGGINBOTHAM DAVID A (JT/RS) 45366 5TH AVE CALLAHAN FL 32011 PT OF LOT 3 IN OR 1054/1860 EX S-4 S-7 & S-8 EX DB 268/260 & DB 258/66 SUB SEC 49 PB 2/15 ==================================== 1067 49-2N-25-4100-0003-0050 41.37 BROOKINS FRANK R 0.000AC PO BOX 1836 CALLAHAN FL 32011-1836 PT OF LOT 3 (EX S-6) IN OR 530 PG 1055 SUB OF 49 PB 2/15 ==================================== rf rfntb DEL. TAX LIST 2017.indd 7 4/30/18 12:20 PM

PAGE 68

1068 49-2N-25-4100-0008-0010 200.97 UNKNOWN 2.150AC FL PT OF LOTS 8 & 12 BEING A FRACL RESIDUE THEREOF SUB SEC 49 PBK 2/15 ==================================== 1069 49-2N-25-4100-0013-0010 1,729.57 MEDSKER TEDDY 1.000AC 45944 PICKETT STREET CALLAHAN FL 32011 PT OF LOT 13 IN OR 1193/284 EX R/W IN OR 205/504 SUB OF SEC 49 PB 2/15 ==================================== 1070 49-2N-25-4120-0007-0000 1,295.75 HACK SHANNON 0.000AC PO BOX 1151 CALLAHAN FL 32011 LOT 7 IN OR 1232/1281 PINEY POINT SUB PB 3/62 ==================================== 1071 49-2N-25-4140-0007-0000 821.12 JAN INVESTMENT INC 0.000AC PO BOX 455 CALLAHAN FL 32011-0455 LOT 7 PT OR 1101/1820 MCARTHURS SUB PB 3/16 ==================================== 1072 49-2N-25-4140-0008-0000 592.26 JAN INVESTMENT INC 0.000AC PO BOX 455 CALLAHAN FL 32011-0455 LOT 8 PT OR 1101/1820 R106876 & R106877 MCARTHURS SUB PB 3/16 ==================================== 1073 49-2N-25-4140-0016-0000 194.44 MURPHY RONALD JASON & 0.000AC MURPHY SHARON A (JT/RS) 54040 VONTZ CIRCLE CALLAHAN FL 32011 N1/2 OF LOT 16 PT OR 1943/1510 MCARTHUR SUB PB 3/16 ==================================== 1074 49-2N-25-4140-0016-0010 194.44 MURPHY RONALD JASON & 0.000AC MURPHY SHARON A (JT/RS) 54040 VONTZ CIRCLE CALLAHAN FL 32011 S1/2 OF LOT 16 PT OR 1943/1510 MCARTHUR SUB PB 3/16 ==================================== 1075 49-2N-25-4140-0017-0000 356.84 MURPHY RONALD JASON & 0.000AC MURPHY SHARON A (JT/RS) 54040 VONTZ CIRCLE CALLAHAN FL 32011 LOT 17 PT OR 1943/1510 MCARTHUR SUB PB 3/16 ==================================== 1076 49-2N-25-4140-0019-0000 850.51 TANNER KENNETH EDEE JR 0.000AC 45102 BROWN ST CALLAHAN FL 32011 LOTS 19 & 20 IN OR 1048/1262 2007 KING DW/MH MCARTHUR SUB PB 3/16 ==================================== 1077 49-2N-25-4150-000A-0070 HX 398.43 BAILEY BETTY FAYE EST 0.000AC PO BOX 775 CALLAHAN FL 32011-0775 BLOCK A LOT 7 IN OR 947/1696 ROBINWOOD ESTATES PB 5/333 ==================================== 1078 49-2N-25-4150-000B-0011 58.78 SIKES J F & A N 0.000AC 45290 ROBINWOOD CIRCLE CALLAHAN FL 32011 BLOCK B PT OF LOTS 1 & 3 IN OR 929/313 ROBINWOOD ESTATES PB 5/333 ==================================== 1079 49-2N-25-4150-000B-0140 165.85 5T WEALTH PARTNERS LP 0.000AC DEPARTMENT #6200 PO BOX 830539 BIRMINGHAM AL 35283 BLOCK B LOT 14 CONSERVATION ESMT PT 699/529 IN OR 2085/1557 ROBINWOOD ESTATES PB 5/333 ==================================== 1080 49-2N-25-4150-000B-0150 165.85 5T WEALTH PARTNERS LP 0.000AC DEPARTMENT 6200 PO BOX 830539 BIRMINGHAM AL 35283 BLOCK B LOT 15 CONSERVATION ESMT PT 699/529 IN OR 2085/1555 ROBINWOOD ESTATES PB 5/333 ==================================== 1081 49-2N-25-4150-000B-0160 165.85 5T WEALTH PARTNERS LP 0.000AC DEPARTMENT #6200 PO BOX 830539 BIRMINGHAM AL 35283 BLOCK B LOT 16 CONSERVATION ESMT PT 699/529 IN OR 2087/1026 ROBINWOOD ESTATES PB 5/333 ==================================== 1082 49-2N-25-4150-000B-0170 299.74 5T WEALTH PARTNERS LP 0.000AC DEPARTMENT #6200 PO BOX 830539 BIRMINGHAM AL 35283 BLOCK B LOT 17 CONSERVATION ESMT PT 699/529 IN OR 2087/1032 ROBINWOOD ESTATES PB 5/333 ==================================== 1083 49-2N-25-4150-000B-0180 165.85 5T WEALTH PARTNERS LP 0.000AC DEPARTMENT #6200 PO BOX 830539 BIRMINGHAM AL 35283 BLOCK B LOT 18 CONSERVATION ESMT PT 699/529 IN OR 2087/1041 ROBINWOOD ESTATES PB 5/333 ==================================== 1084 49-2N-25-4150-000B-0190 165.85 5T WEALTH PARTNERS LP 0.000AC DEPARTMENT #6200 PO BOX 830539 BIRMINGHAM AL 35283 BLOCK B LOT 19 CONSERVATION ESMT PT 699/529 IN OR 2088/1073 ROBINWOOD ESTATES PB 5/333 ==================================== 1085 49-2N-25-4160-0003-0010 287.95 ROHE ERIN PA 2.390AC 103 S 10TH ST FERNANDINA BEACH FL 32034 PT OF LOT 3 IN OR 1815/129 ANTHONY BRYANT LAND SUB DBK 169/496 ==================================== 1086 49-2N-25-4160-0003-0020 235.73 ROHE ERIN PA 1.640AC 103 S 10TH ST FERNANDINA BEACH FL 32034 PT OF LOT 3 IN OR 1815/130 ANTHONY BRYANT LAND SUB DBK 169/496 ==================================== 1087 49-2N-25-4160-0004-0010 800.90 ROHE ERIN PA 7.180AC 103 S 10TH ST FERNANDINA BEACH FL 32034 PT OF LOTS 4 & 5 & PT OF UNNUMBERED LOT IN NE/CORNER IN OR 1815/127 ANTHONY BRYANT LAND SUB DBK 169/496 ==================================== 1088 49-2N-25-4160-0004-0020 952.98 ROHE ERIN PA 8.600AC 103 S 10TH ST FERNANDINA BEACH FL 32034 LOT 6 & PT LOTS 4,5,8 & PT OF UNDEVELOPED 35 FT R/W STRIP IN OR 1815/128 ANTHONY BRYANT LAND SUB DBK 169/496 ==================================== 1089 50-2N-25-0000-0001-0030 HX 1,157.63 RIETESEL JERRY B 5.000AC 46137 RABO ROAD CALLAHAN FL 32011 PT F P SANSHEZ GRANT IN OR 806/1866 {R673406 & 2001 SKYO DW} ==================================== 1090 51-2N-25-0000-0001-0010 525.63 GRIFFIN GERALD R JR 16.750AC 54613 MARLEE RD CALLAHAN FL 32011 PT OR 1883/289 EX R/W CASE #01-417-CA ==================================== 1091 51-2N-25-0000-0011-0000 670.53 COLSON JOE L & 0.000AC COLSON JANETTE J & DELOURS & 45094 COLSON ROAD CALLAHAN FL 32011 IN OR 106/266 1/4 INT HX ==================================== 1092 51-2N-25-0000-0012-0000 1,991.03 GRIFFIN ANDREW & CONNIE 0.000AC 56209 GRIFFIN FARM RD CALLAHAN FL 32011-8806 IN OR 1281/427 ==================================== 1093 51-2N-25-0000-0015-0000 525.90 JONES ROBERT ESTATE 0.000AC C/O ELVA JONES P O BOX 405 CALLAHAN FL 32011-0405 PT F P SANCHEZ GRANT SEC 51-2N-25E BEING ONLY PT LYING E OF DBK 109/269 & S OF DBK 199/125 & N OF OR 704/1917 (EX PT IN US HY 301 & EX ESMT IN OR 493/473) ==================================== 1094 51-2N-25-0000-0016-0000 7,166.47 WEST NASSAU CHARITIES LLC 15.000AC 542830 US HWY 1 CALLAHAN FL 32011 IN OR 2098/394 EX RW IN OR 92/296 ==================================== 1095 51-2N-25-0000-0021-0000 1,515.46 MILLIGAN RONALD G & 2.100AC JEANNE H SCOTT (H&W) 392306 PROSPECT LANDING RD HILLIARD FL 32046 IN OR 879/305 ==================================== 1096 51-2N-25-0000-0023-0000 3,626.72 KEELCO INC 3.440AC 542752 US HWY 1 CALLAHAN FL 32011-6495 IN OR 1387/1250 PARCELS 23 & 23-1 ==================================== 1097 51-2N-25-0000-0024-0000 3,502.02 BELL RONALD WAYNE & 7.330AC BELL DONALD GARY 45219 MICKLER ST CALLAHAN FL 32011 PT OR 1028/1690 EX OR 99/94 ==================================== 1098 51-2N-25-0000-0027-0000 262.79 WILLIAMS ROBERT L ESTATE 0.000AC C/O IVEY BLOODSWORTH 542696 US HWY 1 CALLAHAN FL 32011 IN DB 220 PG 62 ==================================== 1099 51-2N-25-0000-0033-0020 HX 768.50 NELSON MARTHA EST 1.000AC C/O ROOSEVELT NELSON 45101 HOLLOWAY LN CALLAHAN FL 32011-0449 IN OR 19 PG 86 ==================================== 1100 51-2N-25-0000-0042-0000 260.96 LALLAMANT STEVEN R 1.000AC PO BOX 13023 ST PETERSBURG FL 33733-3023 PT F P SANCHEZ GRANT SEC 51-2N-28E IN OR 1402/1032 BEING PARCEL 3 ==================================== 1101 51-2N-25-0000-0044-0010 116.75 LALLAMANT STEVEN R 1.000AC PO BOX 13023 ST PETERSBURG FL 33733-3023 PT F P SANCHEZ GRANT SEC 51-2N-28E IN OR 1402/1032 BEING PARCEL 2 ==================================== 1102 51-2N-25-0000-0045-0000 180.82 LALLAMANT STEVEN R 1.000AC PO BOX 13023 ST PETERSBURG FL 33733-3023 PT F P SANCHEZ GRANT SEC 51-2N-28E IN OR 1402/1032 BEING PARCEL 1 ==================================== 1103 51-2N-25-0000-0046-0000 256.31 ADAMS RICHARD D 1.000AC 3260 SUNNYBROOK AVENUE N JACKSONVILLE FL 32254 IN OR 2082/1989 ==================================== 1104 51-2N-25-0000-0051-0000 426.70 MCGRIFF ROBERT 2.000AC 1107 TURTLE CREEK DR. N JACKSONVILLE FL 32218 CASE # 86-732-CA ==================================== 1105 51-2N-25-0000-0052-0000 HX 345.24 BROOKS MYRTLE H EST 1.000AC C/O GERTRUDE BROOKS P O BOX 452 CALLAHAN FL 32011-0452 IN OR 6 PG 461 ESMTS IN OR 640/177 & 178 1/5 HX INT ==================================== 1106 51-2N-25-0000-0053-0000 228.47 HUNTER DON & SYLVESTER & 2.000AC HUNTER CLIFTON EST & PO BOX 452 CALLAHAN FL 32011-0452 IN OR 640 PG 179 EX OR 6/461 PAR 53 & 54 ==================================== 1107 51-2N-25-0000-0059-0000 260.96 OLIVER JETROE M 1.000AC C/O MARY DAVIS 22 BEECHWOOD STREET #302 DORCHESTER MA 02121 IN DB 60 PG 86 ==================================== 1108 51-2N-25-0000-0060-0010 262.24 MCCOLLUM EDWARD 0.750AC 86014 BRITT LYNN LN YULEE FL 32097 PT SEC 51-2N-25E IN OR 2083/185 ==================================== 1109 51-2N-25-0000-0062-0000 1,110.38 AJP PROPERTIES LLC 10.070AC 10562 NEW KINGS ROAD JACKSONVILLE FL 32219 PT F P SANCHEZ GRANT IN OR 1680/1995 (EX R/W OR 907/1659) ESMT OR 1886/1113 ==================================== 1110 51-2N-25-0000-0068-0000 123.58 HENDRICKS DANIEL R 1.000AC 44500 CATIES WAY CALLAHAN FL 32011 IN OR 1519/664 ==================================== 1111 51-2N-25-4170-0006-0000 179.35 PATRICK ADRIAN LEE III 0.000AC PO BOX 813 CALLAHAN FL 32011-0813 LOTS 6 & 7 R567918 IN OR 1805/1737 EX R/W OR 1004/993 J P PAGE SUB PB 3/20 ==================================== 1112 51-2N-25-4170-0008-0000 130.23 PATRICK ADRIAN LEE III 0.000AC PO BOX 813 CALLAHAN FL 32011 LOT 8 PT OR 1838/1805 EX R/W CASE #01-417-CA J P PAGE SUB PB 3/20 ==================================== 1113 51-2N-25-4170-0009-0000 259.58 HOWELL MYRA GAIL 0.000AC 1459 STATE ROUTE 46 S JEFFERSON OH 44047-9505 LOT 9 (EX R/W OR 909/1233) PT OR 237/539 & OR 443/539 J P PAGE SUB PB 3/20 ==================================== 1114 51-2N-25-4170-0019-0000 HX 463.93 45040 JAMES ST CALLAHAN FL 32011 LOT 19 2002 FTWD TWMH IN OR 923/705 J P PAGE SUB PB 3/20 ==================================== 1115 51-2N-25-4170-0025-0000 494.47 PATRICK ADRIAN LEE III 0.000AC PO BOX 813 CALLAHAN FL 32011 LOT 25 R567520 PT OR 1838/1805 J P PAGE SUB PB 3/20 ==================================== 1116 51-2N-25-4170-0026-0000 760.02 PATRICK ADRIAN LEE III 0.000AC PO BOX 813 CALLAHAN FL 32011 LOT 26 PT OR 1838/1805 J P PAGE SUB PB 3/20 ==================================== 1117 51-2N-25-4170-0027-0000 736.37 MADDOX TROY ALEX EST 0.000AC 45168 JAMES ST CALLAHAN FL 32011-1573 LOT 27 IN OR 100 PG 302 J P PAGE SUB PB 3/20 ==================================== 1118 51-2N-25-4170-0036-0000 HX 311.02 FLAKE LARRY N & CLEO H 0.000AC 45089 JAMES STREET CALLAHAN FL 32011 LOT 36 IN OR 1558/1311 J P PAGE SUB PB 3/20 ==================================== 1119 51-2N-25-4170-0038-0000 154.80 HENDRICKS DANIEL R 0.000AC 44500 CATIES WAY CALLAHAN FL 32011 LOT 38 IN OR 1574/1502 J P PAGE SUB PB 3/20 ==================================== 1120 51-2N-25-4170-0039-0000 181.88 5T WEALTH PARTNERS LP 0.000AC PO BOX 830539 DEPT #6200 BIRMINGHAM AL 35283 LOT 39 IN OR 2083/1551 J P PAGE SUB PB 3/20 ==================================== 1121 51-2N-25-4170-0045-0000 253.04 HENDRICKS DANIEL R 0.000AC 44500 CATIES WAY CALLAHAN FL 32011 LOTS 45 46 & 47 IN OR 1522/199 J P PAGE SUB PB 3/20 ==================================== 1122 51-2N-25-4170-0049-0000 HX 301.15 TIMMONS LEONARD JR 0.000AC PO BOX 205 CALLAHAN FL 32011-0205 LOTS 49 & 50 IN OR 855/219 R674070 & R674071 J P PAGE SUB PB 3/20 ==================================== 1123 51-2N-25-4170-0057-0000 154.80 HAM KAROLINE 0.000AC 14464 AMELIA COVE DR JACKSONVILLE FL 32226 LOT 57 IN OR 2133/214 J P PAGE SUB PB 3/20 ==================================== 1124 51-2N-25-4170-0060-0000 378.45 WAPN FOR TC 13 SUBSIDIARY LLC 0.000AC PO BOX 173017 TAMPA FL 33672 LOT 60 IN OR 2041/61 J P PAGE SUB PB 3/20 ==================================== 1125 51-2N-25-4170-0061-0000 154.80 DAVIS L C EST 0.000AC C/O DORA LEE DAVIS WHITE EST 45053 LUTHER ST CALLAHAN FL 32011-3864 LOT 61 J P PAGE SUB PB 3/20 ==================================== 1126 51-2N-25-4170-0062-0000 HX 327.08 MELTON GEORGE L 0.000AC 45023 LUTHER ST CALLAHAN FL 32011 LOTS 62 & 63 R673301 R673302 IN OR 437 PG 186 J P PAGE SUB PB 3/20 ==================================== 1127 51-2N-25-4170-0065-0000 154.80 WOODS RUTH EST 0.000AC PO BOX 442 CALLAHAN FL 32011-0442 LOT 65 IN OR 888/665 J P PAGE SUB PB 3/20 ==================================== 1128 51-2N-25-4170-0066-0000 266.05 WOODS JOHN R & RUTH 0.000AC P O BOX 442 CALLAHAN FL 32011-0442 LOT 66 J P PAGE SUB PB 3/20 ==================================== 1129 51-2N-25-4170-0070-0000 924.44 JOURNEY INVESTMENTS LLC 0.000AC 8454 E TIMROD STREET TUSCON AZ 85710 LOTS 70 & 71 IN OR 2135/1767 2006 FLEET DW/MH J P PAGE SUB PB 3/20 ==================================== 1130 51-2N-25-4170-0077-0000 485.52 MELTON ALLEN EST 0.000AC C/O BETTY MELTON-WILLIAMS PO BOX 1232 CALLAHAN FL 32011-1232 LOT 77 J P PAGE SUB PB 3/20 ==================================== 1131 51-2N-25-4170-0079-0000 366.20 WILLIAMS WILLIE C JR EST 0.000AC 45041 MARVIN ST CALLAHAN FL 32011 LOT 79 IN OR 612 PG 456 J P PAGE SUB PB 3/20 ==================================== 1132 51-2N-25-4170-0080-0000 411.59 MELTON PATRICIA ANN & 0.000AC MELTON JAMES R LEE EST (S&B) PO BOX 474 CALLAHAN FL 32011-0474 LOT 80 PT OR 1559/350 J P PAGE SUB PB 3/20 ==================================== 1133 51-2N-25-4170-0081-0000 HX 330.10 MELTON PATRICIA ANN & 0.000AC MELTON JAMES R LEE EST (S&B) PO BOX 162 CALLAHAN FL 32011-0162 LOT 81 PT OR 1559/350 2006 NOBI DW/MH J P PAGE SUB PB 3/20 ==================================== 1134 51-2N-25-4180-0009-0000 2,809.06 PICKETT RYAN & 0.000AC PICKETT AUBREY ET AL 542588 US HWY 1 CALLAHAN FL 32011 LOTS 9 10 & 11 IN OR 2126/1177 EX R/W IN OR 88 PG 23 R498165 BRANDIES ADD TO CALLAHAN 1 PB 2/23 ==================================== 1135 51-2N-25-4180-0012-0000 592.31 PICKETT CHARLES A JR EST 0.000AC 542588 US HIGHWAY 1 CALLAHAN FL 32011 LOTS 12 & 13 R108157 IN OR 1039/968 BRANDIES ADD TO CALLAHAN PB 2/23 ==================================== 1136 51-2N-25-4190-0001-0000 2,619.89 JOSEPH WILLIAM G 0.000AC 3930 VILLA SAN JOSE DRIVE JACKSONVILLE FL 32217-4627 LOTS 1 & 3 THRU 6 IN OR 1619/1393 BRANDIES 2ND ADD TO CALLAHAN ==================================== 1137 51-2N-25-4240-0001-0000 HX 564.76 MCNIGHT RODNEY OHARA 0.000AC 45168 PAGE ST CALLAHAN FL 32011 LOTS 1 2 & 7 (EX PAR 7-1) IN OR 1513/689-694 & CASE #45-2011-DR-116 OR 1777/921 ARTHUR JONES SURVEY OR 75/281 ==================================== 1138 51-2N-25-4240-0011-0000 195.72 MLN MANAGEMENT COMPANY 0.000AC 731 DUVAL STATION ROAD SUITE 107-305 JACKSONVILLE FL 32218 LOT 11 IN OR 1502/460 ARTHUR JONES SURVEY OR 75/281 ==================================== 1139 51-2N-25-4240-0014-0000 346.93 GRIMAGE RUFUS EST 0.000AC C/O CATHERINE GRIMMAGE 10857 NATALIE DR E JACKSONVILLE FL 32218 LOT 14 IN OR 1467/15 ARTHUR JONES SURVEY OR 75/281 ==================================== 1140 51-2N-25-4240-0015-0000 195.72 GRIMMAGE RUFUS EST 0.000AC GRIMMAGE MAGGIE EST 10857 NATALIE DR E JACKSONVILLE FL 32218 LOT 15 IN OR 206 PG 34 (M & S) ARTHUR JONES SURVEY OR 75/281 ==================================== 1141 05-3N-25-0000-0001-0090 HX 296.25 JACKSON LARRY GENE JR & 1.500AC JACKSON SHERI 47450 JACKSON COVE RD HILLIARD FL 32046-3015 IN OR 686 PG 125 R498207 & R498208 ==================================== 1142 08-3N-25-0000-0003-0000 364.06 SHEPHERD ALAN D 68.160AC 8008 NEWTON ROAD JACKSONVILLE FL 32216 SW1/4 OF NE1/4 NW1/4 OF SE1/4 IN OR 1298/1130 EX 3-1 3-2 3-3 3-5 & 3-6 ==================================== 1143 08-3N-25-0000-0003-0030 HX 518.80 BRANTLEY SANDRA ELAINE DRAKE 5.000AC 151495 COUNTY ROAD 108 HILLIARD FL 32046 IN OR 702 PG 1723 ==================================== 1144 09-3N-25-0000-0002-0010 654.29 DELOACH ROBERT E JR & TINA K 21.000AC 47225 MIDDLE ROAD HILLIARD FL 32046 PT GOVT LOT 2 OF SEC 9-3N-25E IN OR 1569/259 (EX ROAD R/W) ==================================== 1145 09-3N-25-0000-0002-0030 HX 573.92 DELOACH ROBERT E JR & TINA K 1 .000AC 47225 MIDDLE RD HILLIARD FL 32046 PT GOVT LOT 2 OF SEC 9-3N-25E IN OR 643/741 (EX ROAD R/W) ==================================== 1146 12-3N-25-0000-0001-0010 458.15 CAMS DEMOLITION & DISPOSAL INC 1.000AC 8 JEWEL DR WILMINGTON MA 01887 PT GOVT LOT 6 OF SEC 12-3N-25E IN OR 1830/909 ==================================== 1147 16-3N-25-0000-0001-00M0 63.66 MANN SEAN D ET AL 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 {MINERAL RIGHTS ONLY ASMT} {600 ACRES+/-} S1/2, NE1/4, E1/2 OF NW1/4, NW1/4 OF NW1/4 OF SEC 16-3N-25E IN OR 1990/1090 ==================================== 1148 16-3N-25-0000-0002-0000 1,579.22 ALESSI ANTHONY & 20.000AC ALESSI MICHAEL (JT/RS) 27032 WEST 5TH STREET HILLIARD FL 32046 W1/2 OF NE1/4 OF NW1/4 IN OR 1557/785 EX ESMT OR 1516/312 ESMT PT OR 1517/1166 EX ESMT PT OR 1517/1171 ==================================== 1149 27-3N-25-0000-0003-0070 2,288.61 HOLTON JOHN CHRISTOPHER III & 29.170AC HOLTON ALAINA MICHELLE (H&W) 15223 LANDMARK CIR S JACKSONVILLE FL 32226 S1/2 OF NW1/4 & SW1/4 OF SEC 27-3N-25E IN OR 2033/161 LYING EAST OF LANDS DESCRIBED IN OR 1949/958 & OR 1936/979 OR 1839/1613,OR 1855/1491 & EX PT OR 1845/539,OR 1849/458, OR 1893/518,OR 1899/375, OR 1931/835,OR 1936/979, OR 1937/1445 & OR 1949/958 & OR 1976/227) ==================================== 1150 27-3N-25-0000-0004-0020 900.33 HIGGINBOTHAM ALBERT L & 2.750AC GRAHAM SHARI T (H&W) PO BOX 1694 CALLAHAN FL 32011-1694 PT GOVT LOT 3 OF SEC 27-3N-25E IN OR 1558/873 & ESMT IN OR 1839/1613 {2001 FTWD DW/MH} ==================================== 1151 27-3N-25-2345-0001-0000 HX 150.59 TROTT BRIDGETT 1.000AC 46641 MIDDLE ROAD CALLAHAN FL 32011 LOT 1 2001 CHAM DW/MH IN OR 1011/1368 WILDERNESS PLANTATION PB 6/267 ==================================== 1152 27-3N-25-2345-0002-0000 HX 467.00 WELLS RONNIE C & CLAIRE & 1.500AC BROWN MARY C (JT/RS) 46676 MIDDLE RD CALLAHAN FL 32011 LOT 2 IN OR 1033 PG 1456 2002 FTWD DW/MH WILDERNESS PLANTATION PB 6/267 ==================================== 1153 28-3N-25-0000-0002-0010 657.82 HIGGINBOTHAM ALBERT L & 86.110AC GRAHAM SHARI T (H&W) PO BOX 1694 CALLAHAN FL 32011-1694 PT OF NW1/4 OF SEC 28-3N-25E IN OR 1558/873 OR 1839/1613, OR 1855/1494 & EX PT IN 1723/1269, OR 1838/258, OR 1849/458 OR 1871/860, OR 1878/175 OR 1899/375, OR 1918/356 OR 1918/332, OR 1931/835 OR 1937/1017, OR 1937/1445 CONSV ESMT IN OR 1969/1292 & OR 2080/1860) ==================================== 1154 34-3N-25-0000-0003-0010 HX 229.35 BECK RHONDA RAE CRAWFORD 23.810AC 56098 RUSTY WAY CALLAHAN FL 32011 PT NW1/4 OF NE1/4 & PT NE1/4 OF NW1/4 OF SEC 34-3N-25E IN OR 1157/766 ==================================== 1155 34-3N-25-0000-0003-0020 2,452.66 CRAWFORD ROBERT L TRUSTEE 6.460AC OF ROBERT L CRAWFORD REVOC TRUST 56126 BOGGY TRAIL CALLAHAN FL 32011 L/E OR 1278/165 ESMT OR 580/80 ==================================== 1156 35-3N-25-1810-0006-0000 543.64 TAYLOR JAMES V 0.000AC 87543 CREEKSIDE DR YULEE FL 32097 LOT 6 IN OR 2109/227 RESERVE AT DEER RUN #1 PB 8/24 ==================================== 1157 35-3N-25-1810-0075-0000 398.36 JACKSON LARRY GENE JR & TREANA 0.000AC 55127 BARTRAM TRAIL CALLAHAN FL 32011 LOT 75 PT OR 2102/339 RESERVE AT DEER RUN #1 PB 8/24 ==================================== 1158 35-3N-25-1810-0076-0000 398.36 JACKSON LARRY GENE JR & TREANA 0.000AC 55127 BARTRAM TRAIL CALLAHAN FL 32011 LOT 76 PT OR 2102/339 RESERVE AT DEER RUN #1 PB 8/24 ==================================== 1159 35-3N-25-1810-0078-0000 441.32 ANDONISIO KENNETH II & SOPHIA 0.000AC 55295 BARTRAM TRAIL CALLAHAN FL 32011 LOT 78 IN OR 2071/187 RESERVE AT DEER RUN #1 PB 8/24 ==================================== 1160 35-3N-25-1810-0093-0000 398.36 JACKSON LARRY GENE JR & TREANA 0.000AC 55127 BARTRAM TRAIL CALLAHAN FL 32011 LOT 93 PT OR 2102/339 RESERVE AT DEER RUN #1 PB 8/24 ==================================== 1161 35-3N-25-1810-0094-0000 398.36 JACKSON LARRY GENE JR & TREANA 0.000AC 55127 BARTRAM TRAIL CALLAHAN FL 32011 LOT 94 PT OR 2102/339 RESERVE AT DEER RUN #1 PB 8/24 ==================================== 1162 40-3N-25-0000-0001-0110 286.67 ALBERTIE CORA EST 0.230AC C/O JACKIE LASHAWN HOOPER 86145 FORTUNE DR YULEE FL 32097 OR 514 PG 591 ==================================== 1163 40-3N-25-0000-0001-0160 266.32 HENDRIX MAX 1.000AC 5645 WANDERING TRL JACKSONVILLE FL 32219 IN OR 1864/1564 ==================================== 1164 40-3N-25-0000-0001-0210 266.32 MASON WADE & DANA 1.000AC 4338 MARSH HAWK DRIVE SOUTH JACKSONVILLE FL 32218 IN OR 1630/502 ==================================== 1165 48-3N-25-0000-0001-0040 HX 804.32 SHIVER LINDA H 7.500AC 56206 HICKOX LANE CALLAHAN FL 32011 IN OR 1542/144 PAR 1-4 IN SEC 48 & PAR 2-1 IN SEC 50 1989 MERI DW/MH ==================================== 1166 48-3N-25-4195-0001-0000 395.76 REA KODY LEE 0.000AC 56375 COLBY DR CALLAHAN FL 32011 LOT 1 IN OR 1981/569 NASSAU OAKS SEC 1 UNR ==================================== 1167 48-3N-25-4195-0002-0000 277.60 REA KIRKLAND LEE 0.000AC 56375 COLBY DR CALLAHAN FL 32011-8307 LOT 2 IN OR 983/917 NASSAU OAKS SEC 1 UNR ==================================== 1168 48-3N-25-4195-000H-0000 410.21 EARICK VIRGINIA L 0.000AC 56193 COLBY DRIVE CALLAHAN FL 32011-8304 LOT H RP 2309 IN OR 679 PG 630 NASSAU OAKS SEC 1 UNR ==================================== 1169 48-3N-25-4195-0025-0000 395.76 WATSON RICHARD A EST & 0.000AC WATSON RICHARD 56392 NASSAU OAKS DR CALLAHAN FL 32011 LOT 25 IN OR 253/652 & OR 1958/552 R360176 & R360177 NASSAU OAKS SEC 1 UNR ==================================== 1170 48-3N-25-4195-0027-0000 HX 1,513.91 CURRENT RICHARD K & TERRY L 0.000AC 56414 NASSAU OAKS DR CALLAHAN FL 32011 LOT 27 IN OR 781/631 NASSAU OAKS SEC 1 UNR ==================================== 1171 48-3N-25-4195-0037-0000 394.39 GLISSON SIDNEY R III & APRIL M 0.000AC 45244 KERI BLVD CALLAHAN FL 32011 LOT 37 IN OR 1280/1073 1975 MARIE SW/MH NASSAU OAKS SEC 1 UNR ==================================== 1172 48-3N-25-4196-000L-0000 399.25 MAYBERRY KENNETH R & ANGELA 0.000AC 56127 NASSAU OAKS DR CALLAHAN FL 32011 LOT L IN OR 1780/1663 R407624 & R407625 NASSAU OAKS SEC 2 UNR ==================================== 1173 48-3N-25-4196-000N-0000 HX 365.13 JONES CHARLES A & SARAH V 0.000AC 56178 NASSAU OAKS DRIVE CALLAHAN FL 32011 LOT N R622295 & R622296 IN OR 432 PG 747 NASSAU OAKS SEC 2 UNR ==================================== 1174 48-3N-25-4196-0104-0000 HX 768.04 CARROLL MARILYN J EST 0.000AC C/O MELISSA WATSON 56491 NASSAU OAKS DRIVE CALLAHAN FL 32011 LOT 104 IN OR 207 PG 435 NASSAU OAKS SEC 2 UNR 1/5 HX INT ==================================== 1175 48-3N-25-4196-0118-0000 508.78 THOMAS KENNETH J & LUCRETIA D 0.000AC 56151 NASSAU OAKS CIRCLE CALLAHAN FL 32011 LOT 118 IN OR 1897/942 R36005 & R360051 NASSAU OAKS SEC 2 UNR ==================================== 1176 48-3N-25-4196-0126-0000 813.20 JONASSEN HARRY C & 0.000AC JONASSEN JAMES R & 56023 NASSAU OAKS DR CALLAHAN FL 32011 LOT 126 IN OR 1788/1642 R672964 & R672965 NASSAU OAKS SEC 2 UNR ==================================== 1177 48-3N-25-4196-0132-0000 1,118.21 HERR CRAIG M & LAURA B 0.000AC 56204 COLBY DR CALLAHAN FL 32011 LOT 132 IN OR 1680/435 2010/CMMH/SWMH NASSAU OAKS SEC 2 UNR ==================================== 1178 48-3N-25-4196-0133-0000 HX 992.88 REYNOLDS KIMBERLY D 0.000AC 56234 COLBY DR CALLAHAN FL 32011 LOT 133 IN OR 1987/1951 2015 TOWN DW/MH NASSAU OAKS SEC 2 UNR ==================================== 1179 18-4N-25-0000-0005-0000 HX 1,063.15 WHITTAKER CHARLES E JR & 10.500AC PHILLIPS DEBORAH W (B&S) 4891 WHITAKER ROAD HILLIARD FL 32046 PT OF NE1/4 OF SW1/4 OF SEC 18-4N-25E IN OR 786/1054 & OR 818/1776 (EX PT IN OR 719/366) {1987/WINN/SW/MH} ==================================== 1180 18-4N-25-0000-0005-0040 970.61 HOGAN ROGER H & ROBIN A 4.500AC 48050 ROBINS NEST WAY HILLIARD FL 32046 PT OF NE1/4 OF SW1/4 IN OR 1199/571 R433611 & R433612 PARCELS 5-4 & 5-5 ==================================== 1181 18-4N-25-0000-0007-0080 HX 564.60 YOUNG VIRGINIA E & 2.980AC WILSON AUSTIN L 376175 KINGS FERRY RD HILLIARD FL 32046-1042 IN OR 1098/127 & OR 1943/894 R621559 & R621560 ==================================== 1182 19-4N-25-0000-0002-0070 1,087.60 HULS JAMES & 9.250AC HULS TONI S ET AL 156 SW CROSSBOW PL LAKE CITY FL 32024 IN OR 471/425 & OR 2006/451 R235911 EX R/W OR 611/1165 ==================================== 1183 19-4N-25-4200-0004-0010 449.75 TYLER KENNETH 1.620AC 375917 KINGS FERRY RD HILLIARD FL 32046 PT OF LOTS 4 & 5 IN OR 2044/1146 WATKINS ESTATE PBK O/65 ==================================== 1184 19-4N-25-4200-0004-0030 HX 94.64 TYLER KENNETH 1.000AC 375917 KINGS FERRY ROAD HILLIARD FL 32046 PT OF LOTS 4 & 5 A/K/A TRACT E IN OR 530 PG 677 R378268 & R378269 WATKINS ESTATE PB 0/65 ==================================== 1185 19-4N-25-4200-0004-0040 266.32 TYLER KENNETH M 1.000AC 375917 KINGS FERRY ROAD HILLIARD FL 32046 PT OF LOTS 4 & 5 A/K/A TRACT D IN OR 719 PG 209 WATKINS ESTATE PB 0/65 ==================================== 1186 19-4N-25-4200-0005-0010 289.86 TYLER KENNETH 1.000AC 375917 KINGS FERRY RD HILLIARD FL 32046 PT OF LOT 5 A/K/A TRACT B PT OF OR 2044/1146 WATKINS ESTATE PB 0/65 ==================================== 1187 20-4N-25-0000-0003-0030 515.79 BUTLER GRAYMOND E 1.360AC 3141 WATER ST JACKSONVILLE FL 32208 PARCEL 1-3 OF SEC 19 (EX 1-5) PARCEL 3-3 OF SEC 20 (EX 3-5) IN OR 1345/1432 ==================================== 1188 20-4N-25-0000-0006-0000 1,582.15 HADDOCK WINONA L/E 10.050AC SUMMERVILLE MARY C & 481209 HADDOCK ROAD HILLIARD FL 32046-6307 OR 242/28 L/E OR 587 PG 268 PARCELS 6 & 7 EX R/W IN OR 622/1113 ==================================== 1189 20-4N-25-0000-0009-0060 HX 1,150.02 REED JENNIFER L 6.000AC 48042 FROG PL HILLIARD FL 32046 OR 2140/602 ESMT IN OR 718/150 ==================================== 1190 20-4N-25-0000-0010-0080 HX 360.65 ROBERTS RICHARD E & TIA L 3.340AC 48303 CRAWFORD LANE HILLIARD FL 32046 IN OR 1559/1250 1972 ARLI SW ==================================== 1191 20-4N-25-4210-0001-0000 HX 443.29 KATO JOHN H 4.260AC 473951 MIDDLE RD HILLIARD FL 32046 TRACT 1 IN OR 1977/1323 KINGS FERRY FORREST PB 5/25 ==================================== 1192 21-4N-25-0000-0001-0010 HX 539.07 MALONE ERIC M & JENNIFER L 3.010AC 574715 LESSIE RD HILLIARD FL 32046 PT GOVT LOT 1 OF SEC 21-4N-25E IN OR 1568/918 (EX R/W OR 602/672) {1998 MERI DW/MH} ==================================== 1193 22-4N-25-0000-0004-0010 732.44 WILLIAMSON GERALD M EST 2.160AC 574154 LESSIE ROAD HILLIARD FL 32046 PT GOVT LOT 2 OF SEC 22-4N-25E IN OR 745/1295 (EX R/W OR 614/925) {R621630} ==================================== 1194 26-4N-25-0000-0007-0090 1,021.70 ARMSTRONG ROY L & MARGIE J 2.000AC 85091 CHRISTIAN WAY APT 311 YULEE FL 32097 PT OF NE1/4 OF SW1/4 IN OR 1258/1106 EX R/W OR 602/664 R433776 & R433777 ==================================== 1195 26-4N-25-0000-0007-0150 444.38 BOYNT WANDA SWILLEY 1.760AC HILLIARD FL 32046 PT OF W1/2 OF NE1/4 OF SW1/4 OF SEC 26-4N-25E IN OR 2002/438 ==================================== 1196 29-4N-25-0000-0003-0070 133.92 HOWARD CAROL 16.810AC 48158 NARROW WAY HILLIARD FL 32046 PT OF NE1/4 OF NW1/4 SEC 29 & PT OF SE1/4 OF SW1/4 SEC 20 PARCELS 3-7 & 3-6 IN OR 708/569 & PT OR 1290/1160 EX 3-4 ESMT OR 1517/37 ==================================== 1197 32-4N-25-0000-0001-0020 219.36 THOMAS ADRIAN RANDOLPH 1.050AC 12808 US HWY 301 BRYCEVILLE FL 32009 PT OF N1/2 OF NE1/4 PAR 1-2 PT OR 2079/609 (EX R/W) ==================================== 1198 32-4N-25-0000-0001-0030 276.57 THOMAS ADRIAN RANDOLPH 39.930AC 12808 US HWY 301 BRYCEVILLE FL 32009 PT OR 2079/609 ==================================== 1199 32-4N-25-0000-0001-00M0 45.10 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 NE1/4 S1/2 OF SW1/4 PT OF PARCEL 1 ALL OF PARCEL 3 1/3 INT 240 AC (40/24 INT) PT OR 1313/689 MINERAL RIGHTS ONLY ==================================== 1200 34-4N-25-0000-0001-0000 914.22 WANG PETER 110.670AC 58261 MELTON ROAD HILLIARD FL 32046 E1/2 OF NE1/4 OF SEC 34-4N-25E IN OR 1207/569 BEING PARAGRAPHS 2 & 3, & PT OF W1/2 OF NW1/4 OF SEC 35-4N-25E IN OR 1207/569 BEING PARAGRAPH 1 ==================================== 1201 35-4N-25-0000-0001-0010 560.22 FAVORS MICHAEL FLOYD 1.000AC 58871 COOPERS NECK ROAD HILLIARD FL 32046 PT NE1/4 OF NE1/4 OF SEC 35-4N-25E IN OR 1241/1158 {R672538} ==================================== 1202 35-4N-25-0000-0001-0030 HX 37.66 FAVORS MICHAEL F & WINIFRED J 1.000AC 58871 COOPERS NECK RD HILLIARD FL 32046 PT NE1/4 OF NE1/4 OF SEC 35-4N-25E IN OR 782/13 {R672127 & R672128} ==================================== 1203 35-4N-25-0000-0003-0000 266.32 MASON JOHN EST 1.000AC C/O TRACI R.JACOBS 50% INT AND MERIETTA ALDERMAN 50% INT 58108 MASON ROAD HILLIARD FL 32046 IN W1/2 OF NW1/4 IN OR 514/448 & OR 1636/1751 ==================================== 1204 35-4N-25-0000-0003-0010 HX 359.02 MASON CELESTINE & 1.000AC MASON LESTER JR 58109 MASON ROAD HILLIARD FL 32046 IN OR 757/1725 & OR 1402/1497 1/2 HX INT ==================================== 1205 35-4N-25-0000-0005-0000 444.60 COONER PHILLIP M & 5.000AC COONER LATASHIA L 58261 MELTON RD HILLIARD FL 32046 PT OF NW1/4 OF NW1/4 OF SEC 35-4N-25E IN OR 1911/1808 ==================================== 1206 35-4N-25-0000-0005-0050 HX 807.71 WANG PETER 13.550AC 58261 MELTON ROAD HILLIARD FL 32046 PT OF NW1/4 OF NW1/4 OF SEC 35-4N-25E IN OR 1207/569 BEING PARAGRAPH 4 (EX R/W ESMT) {2004 KING DW/MH} ==================================== 1207 35-4N-25-0000-0008-0080 1,793.44 JONES BELINDA M 1.000AC 58291 TIMMONS RD HILLIARD FL 32046 PT OF SW1/4 OF NW1/4 IN OR 1955/1513 ==================================== 1208 35-4N-25-0000-0009-0130 988.15 SCOTT VICTORIA M & 1.000AC MASON LESTER JR & JOYCE(JT/RS) 571639 LESSIE RD HILLIARD FL 32046 PT NW1/4 OF SE1/4 OF SEC 35-4N-25E IN OR 2087/1039 ==================================== 1209 35-4N-25-4220-0001-0020 1,069.94 WHITE KAVIN KEITH 7.950AC 58104 COOPERS NECK RD HILLIARD FL 32046 PT OF LOTS 1 3 & 5 L/E IN OR 385 PG 564 EX S-3 OF LOT 3 QUINCE HERRING ESTATE ==================================== 1210 35-4N-25-4220-0002-0020 852.02 CHEAVERS EVERETT ET AL 7.950AC 10 MANOR DR NEPTUNE NJ 07753 PT OF LOTS 2 4 & 6 OR 322 PG 610 & 337 PG 324 QUINCE HERRING EST ==================================== 1211 35-4N-25-4220-0003-0030 92.92 LAST FRANK JAMES III & MARY J 0.260AC 2019 ALACHUA ST FERNANDINA BEACH FL 32034-2519 E75 OF W308 OF S150 OF LOT 3 IN SW1/4 OF NE1/4 IN OR 1499/304 QUINCE HERRING EST ==================================== 1212 38-4N-25-0000-0012-0000 1,142.90 BREAKER MARY LOUISE 10.770AC 1235 W 12TH STREET JACKSONVILLE FL 32209 PT WILLIAM NELSON GRANT SEC 38-4N-25E IN OR 458/556 (EX R/W IN OR 621/901) ==================================== 1213 43-4N-25-0000-0002-0030 590.92 POHL LEE NORA JO WINGATE & 3.200AC WINGATE MONTA C 474694 MIDDLE ROAD HILLIARD FL 32046 CASE #04-24-CP OR 1315/116 R622047 & R622048 EX R/W OR 605/1176 EX 2-15 & 2-18 ==================================== 1214 43-4N-25-0000-0002-0080 740.62 HOOVER JOHN L JR 6.870AC 37360 BULFORD RD HILLIARD FL 32046 OR 689/1262 EX R/W OR 602/572 EX 2-21 & 2-22 ==================================== 1215 43-4N-25-0000-0002-0220 522.98 HOOVER WILLIAM L 5.100AC 481572 HADDOCK ROAD HILLIARD FL 32046 IN OR 1217/1826 EX 2-23 ==================================== 1216 43-4N-25-0000-0002-0230 444.60 HOOVER APRIL & WILLIAM L 3.000AC 481572 HADDOCK RD HILLIARD FL 32046 IN OR 1868/1114 ==================================== 1217 43-4N-25-0000-0002-0290 446.82 HOOVER JOHN L 1.260AC 37360 BULFORD RD HILLIARD FL 32046 PT JOSEPH HADDOCK DONATION IN OR 1939/1729 1985 CATA SW/MH ==================================== 1218 48-4N-25-0000-0001-0120 HX 1,185.72 JORDON JAMES E JR 6.110AC 377492 KINGS FERRY ROAD HILLIARD FL 32046-9786 IN OR 614 PG 652 ==================================== 1219 48-4N-25-0000-0001-0150 444.60 MATHENY SCOTT W 3.000AC 12651 CARSON DRIVE JACKSONVILLE FL 32258 PT ZACHARIAH HADDOCK GRANTS IN OR 411/57 ==================================== 1220 48-4N-25-0000-0001-0260 135.88 WADE JASON & 2.000AC OLIVER EMILY LYNN 394669 KOLARS FERRY RD HILLIARD FL 32046-6609 PT SEC 48-4N-25E IN OR 2129/1390 ==================================== 1221 49-4N-25-4260-0003-0012 HX 529.88 COLEMAN CAMPBELL TAMI S 1.850AC 49124 BILL JOHNSON ROAD HILLIARD FL 32046-0869 & ALL LOTS 3 & 4 IN OR 947 PG 1332 MH/ID AL2905R003391A & AL2905R003391B BOUNDARY AGRMT PT OR 628/261 TOWN OF KINGS FERRY PB O/64 ==================================== rf rfntb DEL. TAX LIST 2017.indd 8 4/30/18 12:20 PM

PAGE 69

1222 49-4N-25-4260-0004-0010 321.81 HIGGINBOTHAM TAMI SUE 1.180AC 49124 BILL JOHNSON RD HILLIARD FL 32046 BLOCK 4 LOTS 1 TO 3 INC PT OR 2118/294 TOWN OF KINGS FERRY PB 0/64 ==================================== 1223 49-4N-25-4260-0004-0040 277.60 HIGGINBOTHAM TAMI SUE 1.000AC 49124 BILL JOHNSON RD HILLIARD FL 32046 BLOCK 4 LOT 4 PT OR 2118/294 TOWN OF KINGS FERRY PB 0/64 ==================================== 1224 01-2N-26-0000-0007-0010 3,914.75 GARRETT FLOYD L & 5.270AC WILSON-GARRETT AVA A (H&W) 2010 OAK VIEW DRIVE SEVERVILLE TN 37876 IN OR 1427/1012 PT IN SEC 1 & SEC 12 EX R/W 01-351CA ==================================== 1225 02-2N-26-0000-0004-0100 552.91 JOHNSON BRENDA C & CHARLES R 3.440AC 76023 BILLS TRAIL YULEE FL 32097 IN OR 1967/3 ==================================== 1226 02-2N-26-0000-0004-0110 1,096.78 JOHNSON REBECCA M 1.790AC 77135 HALLMARK LN YULEE FL 32097 PT OF N1/2 OF S1/2 OF S1/2 OF NE1/4 OF NW1/4 OR 1571/1455 1998 MERI DW/MH ==================================== 1227 03-2N-26-0000-0001-0020 493.57 HIGGS JACK H JR & SHEILA F 8.340AC 66616 FRED MINER ESTATES YULEE FL 32097 IN OR 845/477 R787589 ESMT IN OR 287/83 ==================================== 1228 03-2N-26-0000-0001-0080 HX 307.75 CRIBB NANCIE S CARR 1.000AC 66040 IONA PL YULEE FL 32041 IN OR 727/1685 R672678 & R672679 ==================================== 1229 03-2N-26-0000-0001-0110 HX 386.89 BOYD BILLY L 2.530AC 66416 FRED MINER ESTATES DRIVE YULEE FL 32097 PT OF E1/2 OF NE1/4 IN OR 1061 PG 888 1983 NOTT DW ==================================== 1230 03-2N-26-0000-0001-0120 301.23 POLAND LOIS MINER EST 1.150AC PO BOX 6 YULEE FL 32041-0006 E1/2 OF NE1/4 IN OR 1094/1144 ==================================== 1231 05-2N-26-0000-0004-0090 196.03 GILL CHARLES B 0.700AC 66112 GUSSIE LANE CALLAHAN FL 32011-8804 IN OR 979/1651 RP 1316 EX R/W PT CASE# 01-418CA EX 4-12 THRU 4-15 ==================================== 1232 05-2N-26-0000-0004-0130 751.61 BROWN ROBERT CHARLES 1.000AC 66146 GUSSIE LN CALLAHAN FL 32011-2022 IN OR 1078/577 R497758 & R622393 ESMT OR 1434/442 ==================================== 1233 05-2N-26-0000-0004-0150 210.08 GILL CHARLES B 0.760AC 66112 GUSSIE LANE CALLAHAN FL 32011-8804 IN OR 586/539 & OR 633/214 EX R/W CASE #01-418CA ESMT OR 1434/440 ==================================== 1234 05-2N-26-1875-0001-0000 571.33 PREMIER HOMES OF N FLORIDA INC 0.000AC 55234 WHITE OAK PLACE CALLAHAN FL 32011 LOT 1 IN OR 2147/1846 ROCKING HORSE FARMS PB 7/104 ==================================== 1235 05-2N-26-1875-0002-0000 571.33 PREMIER HOMES OF N FLORIDA INC 0.000AC 55234 WHITE OAK PLACE CALLAHAN FL 32011 LOT 2 IN OR 2147/1846 ROCKING HORSE FARMS PB 7/104 ==================================== 1236 05-2N-26-1875-0003-0000 571.33 PREMIER HOMES OF N FLORIDA INC 0.000AC 55234 WHITE OAK PLACE CALLAHAN FL 32011 LOT 3 IN OR 2147/1846 ROCKING HORSE FARMS PB 7/104 ==================================== 1237 05-2N-26-1875-0004-0000 571.33 PREMIER HOMES OF N FLORIDA INC 0.000AC 55234 WHITE OAK PLACE CALLAHAN FL 32011 LOT 4 IN OR 2147/1846 ROCKING HORSE FARMS PB 7/104 ==================================== 1238 07-2N-26-0000-0002-0010 706.28 MORGAN PAMELA J 1.000AC 56124 DIXON TRAIL CALLAHAN FL 32011 PT OF NE1/4 OF NW1/4 IN OR 1881/1619 {1995 RICH SW/MH} ==================================== 1239 11-2N-26-1830-0122-0000 2,418.90 IWANIUSZ MICHAEL WILLIAM & 0.000AC IWANIUSZ SHELLY LYNN (H/W) 75102 FERN CREEK DRIVE YULEE FL 32097 LOT 122 IN OR 2109/1512 RIVER GLEN #1 PB 7/263 ==================================== 1240 11-2N-26-2050-0185-0000 HX 1,278.90 COLE HERMAN & CHRISTINE 0.000AC 76282 DEERWOOD DRIVE YULEE FL 32097 LOT 185 IN OR 1422/1395 TIMBER CREEK PLANTATION #1 PB 6/394 ==================================== 1241 12-2N-26-1603-0014-0000 80.28 DREAM FINDERS HOMES LLC 0.000AC 360 CORPORATE WAY ORANGE PARK FL 32073 LOT 14 PT OR 2115/680 PLUMMER CREEK PHASE TWO B PBK 8/170 ==================================== 1242 13-2N-26-4200-0023-0000 1,749.50 SMIT ROBIN & LAURA MARY 1.000AC 75028 EDWARDS ROAD YULEE FL 32097 LOT 23 IN OR 2115/722 NASSAU LANDING SUB PB 4/84-85 ==================================== 1243 14-2N-26-4280-0002-0000 HX 158.34 PIERSON JAMES A 0.000AC 75241 EDWARDS ROAD YULEE FL 32097-7256 LOTS 12,13,14 & 15-A IN OR 518/881 SUB OF GOVT LOT 9 IN SEC 14-2N-26E UNR {R359427 R 107842} ==================================== 1244 14-2N-26-4280-0002-0160 HX 281.34 WEINBERG DOUGLAS E & JUNE T 0.000AC 75135 RANDY ROAD YULEE FL 32097 PT OF UNNUMBERED TRACT IN OR 650/238 SUB OF GOVT LOT 9 IN SEC 14-2N-26E UNR {R568008 & R568009} ==================================== 1245 14-2N-26-4280-0002-0260 473.46 WEINBERG DAVID & AURIEL 3.210AC 75051 RANDY ROAD YULEE FL 32097 PT OF UNNUMBERED TRACT IN OR 1684/1813 SUB OF GOVT LOT 9 IN SEC 14-2N-26E UNR ==================================== 1246 14-2N-26-4280-0002-0270 473.46 WEINBERG DOUGLAS E & JUNE T 3.210AC 75135 RANDY ROAD YULEE FL 32097 PT OF UNNUMBERED TRACT IN OR 1684/1815 SUB OF GOVT LOT 9 IN SEC 14-2N-26E UNR ==================================== 1247 14-2N-26-4280-0011-0000 2,233.19 HIGGS JACK & SHEILA 0.000AC 66616 FRED MINER ESTATES DR YULEE FL 32097 SUB LOT 33 IN OR 1876/1057 SUB OF GOVT LOT 9 UNR ==================================== 1248 14-2N-26-4280-0023-0030 804.67 TESTON ELLA-JEAN EILEEN 0.000AC 95415 BARNWELL RD FERNANDINA BEACH FL 32034 LOTS 3 & 4 IN OR 2110/1179 N E FLA SPORTSMAN CLUB S/D OR 76/596 ==================================== 1249 14-2N-26-4280-0033-0100 HX 515.57 COATS THOMAS I & PAULA H 0.000AC 75115 TWISTED OAK DR YULEE FL 32097 IN OR 935/1855-1866 SUB OF GOVT LOT 9 UNR 2004 MERT DW/MH ==================================== 1250 01-3N-26-0000-0001-0010 894.14 HORNE ELWIN G & ANN C (JTROS) 90.520AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1573 EX 1-2 1-3 & 1-5 ==================================== 1251 01-3N-26-0000-0001-0020 847.07 HORNE ELWIN G & ANN C (JTROS) 1.000AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1567 PARS 1-2 SECTS 01 & 38-3N-26 ==================================== 1252 01-3N-26-0000-0001-0030 525.89 HORNE ELWIN G & ANN C (JTROS) 1.000AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1586 PARS 1-3 SECT 01 & 38-3N-26 ==================================== 1253 01-3N-26-0000-0001-0050 1,508.49 HORNE ELWIN G & HANCE-HORNE ANN CREWS TRUSTEES 20.040AC 174 GREENVILLE RD KINGSLAND GA 31548 IN OR 1876/171 PARS 1-5 & 2-1 SEC 1-3N-26 & PARCEL 1-14 SEC 2-3N-26 ==================================== 1254 02-3N-26-0000-0001-0030 41.01 17/95 RV PARK LLC 0.110AC 1610 SOUTH 8TH STREET FERNANDINA BEACH FL 32034 PT OF NE1/4 OF SEC 2-3N-26E IN OR 1593/116 BEING PARAGRAPH ==================================== 1255 02-3N-26-0000-0001-0060 59.86 HORNE ELWIN G & ANN C (JTROS) 5.870AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1573 EX 1-7 1-8 1-11 & 1-14 ==================================== 1256 02-3N-26-0000-0001-0090 9,018.38 PTRO INC 8.610AC 86595 HESTER DRIVE YULEE FL 32097 PT OF NE1/4 & PT OR NE1/4 OF SE1/4 PARS 1-9 1-11 6 7 8 9-1 10 12 IN OR 1373/1518 EX ESMT OR 532/249 & EX R/W OR 79/594 ==================================== 1257 02-3N-26-0000-0009-0000 210.30 HORNE ELWIN G & ANN C (JTROS) 0.000AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OF NE1/4 OF SE1/4 PT OR 1641/1573 EX 9-1 & ESMT OR 532/249 & EX R/W OR 79/594 ==================================== 1258 02-3N-26-0000-0013-0030 1,034.80 HORNE ELWIN G & ANN C (JTROS) 0.000AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1573 (EX 13) ==================================== 1259 02-3N-26-0000-0013-0040 847.37 HORNE ELWIN G & ANN C (JTROS) 0.000AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1573 ==================================== 1260 07-3N-26-0000-0002-0000 255.35 TOM FORD BUILDERS LLC 4.060AC 7790 FORD RD BRYCEVILLE FL 32009 PT OF LOT 7 S OF PUB RD & NE PT OF LOT 6 IN OR 1639/679 EX2-1 2-2 2-3 & 2-4 ==================================== 1261 07-3N-26-0000-0002-0030 766.41 JACOBS FRANSCENA EST 7.120AC C/O VERONA JACOBS-SAMS PO BOX 70 FERNANDINA BEACH FL 32035-0070 OR 243/308 ==================================== 1262 07-3N-26-0000-0003-0000 1,343.47 JACOBS VERONA & 7.790AC JACOBS FRANSCENA M EST & PO BOX 70 FERNANDINA BEACH FL 32035-0070 IN OR 459 PG 464 EX 3-1 3-5 & 3-4 ==================================== 1263 07-3N-26-0000-0006-0070 444.60 MURPHY ERIC & 3.000AC MURPHY BRENDA EST PO BOX 1384 YULEE FL 32041 PT GOVT LOT 1 OF SEC 7-3N-26E IN OR 614/1062,OR 716/870 & R/W AGMT IN OR 614/1069 ==================================== 1264 07-3N-26-0000-0007-0010 HX 528.93 RAINEY BRENDA & 1.000AC ALBERTIE LAWRENCE P O BOX 1566 YULEE FL 32041 PT GOVT LOT 1 OF SEC 7-3N-26E IN OR 676/306 ==================================== 1265 07-3N-26-0000-0011-0000 1,080.04 JONES ROBERT JR & 3.000AC JONES PAUL & PETER & HAROLD M PO BOX 1225 YULEE FL 32041 PT GOVT LOTS 5 & 6 PAR 11 IN OR 75/138 (EX PAR 11-4 & 11-5) CASE NO 97-44-CP 1/4 HX INT ==================================== 1266 07-3N-26-0000-0011-0010 540.58 JONES PETER & FLORINE 1.000AC 67014 JACOBS RD YULEE FL 32097 PT GOVT LOT 6 OF SEC 7-3N-26E IN OR 42/185 ==================================== 1267 08-3N-26-0000-0001-0020 HX 460.30 TEMPLES TIMOTHY SR 4.000AC 153359 COUNTY ROAD 108 YULEE FL 32097 PT OF NE1/4 OF SEC 8-3N-26E IN OR 904/1483 (EX ESMT IN OR 843/1507) {R224043 & R224044} ==================================== 1268 08-3N-26-0000-0001-0050 531.44 TEMPLES TIMOTHY SCOTT SR 1.860AC 153359 COUNTY ROAD 108 YULEE FL 32097 PT OF NE1/4 OF SEC 8-3N-26E IN OR 843/1504 & ESMT IN OR 843/1507 ==================================== 1269 08-3N-26-0000-0002-0080 HX 681.02 ALBERTIE VERNICE & SHERRIE 1.000AC 67027 ELNORA LN YULEE FL 32097 PT OF NW1/4 OF NE1/4 OF SW1/4 IN OR 1141/1648 ESMT OR 1557/1483 ==================================== 1270 08-3N-26-0000-0002-0100 268.66 ALBERTIE JANICE L 1.010AC 67286 JACOBS RD YULEE FL 32097 PT OF NE1/4 OF SW1/4 IN OR 1802/1896 ==================================== 1271 38-3N-26-0000-0001-0010 111.47 HORNE ELWIN G & ANN C (JTROS) 28.370AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1573 EX 1-2 1-3 & 1-4 ==================================== 1272 38-3N-26-0000-0001-0040 326.71 HORNE ELWIN G & ANN C (JTROS) 1.000AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1567 ==================================== 1273 41-3N-26-0000-0004-0000 1,819.12 SCOTT WILLIAM J & 4.240AC SCOTT JAMES V & FRANK N ET AL 77206 DAWSON RD YULEE FL 32097 IN OR 2071/559 EX 4-1 4-2 & 4-4 ==================================== 1274 35-4N-26-0000-0001-0050 203.92 GET & SAVE LLC 1.000AC 852426 US HWY 17 YULEE FL 32097 PT SEC 35-3N-26E IN OR 2093/1894 ==================================== 1275 35-4N-26-0000-0001-0100 79.15 GET & SAVE LLC 0.480AC 852426 NORTH HWY 17 YULEE FL 32097 PT OF SE1/4 OF SEC 35-4N-26E IN OR 1981/1586 ==================================== 1276 36-4N-26-0000-0001-0010 1,835.47 HORNE ELWIN G & ANN C (JTROS) 13.340AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1573 (EX 1-2) ==================================== 1277 38-4N-26-0000-0001-0010 77.90 HORNE ELWIN G & ANN C (JTROS) 9.670AC 174 GREENVILLE RD KINGSLAND GA 31548 PT OR 1641/1573 EX 1-2 ==================================== 1278 38-4N-26-0000-0001-0020 447.66 HORNE ELWIN G & ANN C (JTROS) 1.000AC 174 GREENVILLE RD KINGSLAND GA 31548 IN OR 1641/1593 ==================================== 1279 41-4N-26-0000-0003-0000 1,308.70 FERGUSON GLENDA S & 2.880AC FERGUSON LACEY M (JT/RS) 68117 CORNING CT YULEE FL 32097 PT NATHANIEL WILDER GRANT SEC 41-4N-26E IN OR 1884/510 & ESMT IN OR 748/555 1995 KING DW/MH ==================================== 1280 01-2N-27-0000-0003-0140 50.43 TREVETT FAMILY COMPANIES INC 0.090AC PO BOX 706 FERNANDINA BEACH FL 32035 PT OR 971/1311 & PT 963/1593 ESMT PT OR 1333/365 EX ESMT PT OR 1449/848 EX 3-25 & 3-26 ==================================== 1281 01-2N-27-0000-0003-0150 328.76 TREVETT FAMILY COMPANIES INC 1.450AC PO BOX 706 FERNANDINA BEACH FL 32035 PT OR 971/1311 & PT 963/1593 ==================================== 1282 01-2N-27-0000-0003-0160 160.95 LOFTON POINTE INC 0.210AC 11555 CENTRAL PARKWAY SUITE 801 JACKSONVILLE FL 32224 PT OR 971/1306 & PT 963/1590 EX 3-18 & 3-27 ESMT PT OR 1127/1783 ESMT PT OR 1333/365 EX ESMT PT OR 1449/848 ESMT OR 1508/1341 ==================================== 1283 04-2N-27-0000-0003-0100 1,025.57 ROBINSON JO ANN 3.030AC 10206 WASHEM POTS DRIVE CORNELIUS NC 28031 PT OF LOT 2 IN OR 684/1137 ==================================== 1284 04-2N-27-0000-0003-0180 236.68 ARMSTRONG ROY L & MARGIE J 0.500AC 85091 CHRISTIAN WAY #311 YULEE FL 32097 PT OR 318/337 ==================================== 1285 04-2N-27-0000-0003-0300 HX 1,535.65 PATTON SYLVIA A & 4.000AC PATTON DONALD R 86288 MACAW RD YULEE FL 32097 IN OR 822 PG 14 RP412272 & R278274 R567864 & R567865 ==================================== 1286 04-2N-27-0000-0003-0350 HX 2,465.75 KENNEDY DENNIS MARTIN 1.600AC 86521 CARDINAL RD YULEE FL 32097 IN OR 1715/322 ==================================== 1287 04-2N-27-0000-0003-0450 148.66 PATTON DONALD R & SYLVIA 1.140AC 86288 MACAW RD YULEE FL 32097 IN OR 644/359 EX 3-63 ==================================== 1288 04-2N-27-0000-0003-0640 608.25 PATTON RANDALL C 1.000AC 86374 MACAW ROAD YULEE FL 32097 PT OR 496 PG 1237 R278266 & R278267 ==================================== 1289 04-2N-27-0000-0004-0010 HX 1,940.78 DUNMAN MARSHALL WILBUR 7.000AC 85765 NORTH HARTS ROAD YULEE FL 32097 IN OR 923/1491 ==================================== 1290 04-2N-27-0000-0004-0050 HX 1,717.15 LEE GEORGE D G 3.000AC 86122 WHIPPOORWILL PLACE YULEE FL 32097 IN OR 617/901 EX 4-16 ==================================== 1291 04-2N-27-4290-000A-0020 1,703.15 DUNMAN MARSHALL W 3.380AC 85765 NORTH HARTS RD YULEE FL 32097 PT OF TRACT A IN OR 935/325 (EX ESMT IN OR 390/469 & OR 463/137) FLOOD ACRES UNIT 1 PBK 4/20 {1981 CONC DW/MH} ==================================== 1292 04-2N-27-4290-000A-0040 420.86 WHISENANT WILLIAM TIMOTHY 1.000AC 8135 KENWOOD DR E JACKSONVILLE FL 32207 PT OF TRACT A IN OR 2134/300 FLOOD ACRES #1 PBK 4/20 ==================================== 1293 04-2N-27-4290-0016-0000 350.22 VERONA V LLC 3.110AC 18305 BISCAYNE BLVD SUITE 400 AVENTURA FL 33160 LOT 16 IN OR 1651/1130 EX ESMT OR 120/624 EX FPL R/W 278/610 EX PT OR 398/362 & OR 533/613 FLOOD ACRES UNIT 1 PB 4/20 ==================================== 1294 04-2N-27-4290-0018-0000 HX 273.08 MCKENDREE ROY V JR 2.000AC 86318 CARDINAL ROAD YULEE FL 32097 LOT 18 R 107971 & 107972 IN OR 379 PG 722 FLOOD ACRES UNIT 1 PB 4/20 ==================================== 1295 04-2N-27-4290-0027-0000 579.26 JOHNSON RICHARD FRANCIS III 2.000AC 136 OAK TERRACE DRIVE CRESTVIEW FL 32539 LOT 27 IN OR 1331/409 FLOOD ACRES UNIT 1 PB 4/20 ==================================== 1296 04-2N-27-4290-0046-0000 HX 917.71 NEAL GEORGE G 1.000AC 86499 CARDINAL RD YULEE FL 32097 LOT 46 (EX S-1) IN OR 1381/1044 FLOOD ACRES UNIT 1 PB 4/20 ==================================== 1297 04-2N-27-4290-0046-0010 736.11 NEAL GEORGE G 1.000AC P O BOX 413 YULEE FL 32041 W1/2 OF LOT 46 IN OR 693 PG 1706 R567875 & R567876 FLOOD ACRES UNIT 1 PB 4/20 ==================================== 1298 04-2N-27-4300-0014-0000 HX 1,170.88 KRAUSS ANNIE RUTH 1.650AC 86723 CARDINAL RD YULEE FL 32097 BLOCK 14 IN OR 1504/1875 TOWN OF YULEE-SNOWBALL ADDITION PB 1/15 ==================================== 1299 04-2N-27-4300-0015-0010 630.83 ROE C LARRY & PENNY L 1.540AC 1721 ANNISTON RD #1025 JACKSONVILLE FL 32246 PT OF BLOCK 15 IN OR 1242/689 TOWN OF YULEE-SNOWBALL ADDITION PB 1/15 ==================================== 1300 04-2N-27-4300-0019-0062 429.62 MOSLEY JOYCE MICHELLE EST 0.000AC 86050 OAK TREE LANE YULEE FL 32097 BLOCK 19 S20 FT OF LOT 6 & ALL OF LOT 7 IN OR 1350/1540 TOWN OF YULEE-SNOWBALL ADDITION PB 1/15 ==================================== 1301 05-2N-27-0000-0001-0060 867.02 DURRANCE JOLENE JONES 1.000AC P O BOX 866 YULEE FL 32041 PT SW1/4 OF SW1/4 OF FRAC SEC 5-2N-27E IN OR 1990/915 ==================================== 1302 05-2N-27-4292-0021-0000 268.65 LEONARD CHARLES 1.000AC 3900 SKIPPER RD MIDDLEBURG FL 32068 LOT 21 EX S-1 IN OR 1511/802 FLOOD ACRES NO 2 UNR ==================================== 1303 05-2N-27-4292-0056-0000 HX 933.74 MOORE DON RANDOLPH & HELEN J 4.000AC 76260 DOVE ROAD YULEE FL 32097 LOTS 56 & 57 IN OR 359 PG 435 R407685 & R407686 & 1994 GRAN DW/MH FLOOD ACRES #2 UNR ==================================== 1304 05-2N-27-4292-0058-0000 HX 460.21 KENNISON RONNIE & LEANNE 4.000AC 76230 DOVE ROAD YULEE FL 32097 LOTS 58 & 59 IN OR 259 PG 346 R235909 & R235910 FLOOD ACRES # 2 UNR ==================================== 1305 05-2N-27-4292-0075-0000 3,425.18 TESTA ANTHONY MICHAEL 6.470AC 76461 DOVE RD YULEE FL 32097 LOTS 75 83 84 & S-2 OF 76 IN OR 2059/109 R583305 & R359545 ESMT OR 749/987 FLOOD ACRES #3 UNR ==================================== 1306 05-2N-27-4292-0077-0000 HX 834.36 TESTA ANTHONY MICHAEL 12.090AC 76461 DOVE ROAD YULEE FL 32097 LOTS 77 THRU 82 IN OR 1673/248 R334147 & MH/ID 4546 ESMT IN OR 434/470 FLOOD ACRES # 2 UNR ==================================== 1307 06-2N-27-0000-0005-0020 395.76 BRYANT GWENDOLYN D & DARRYL J 1.000AC 813 TORTOISE WAY JACKSONVILLE FL 32218 PT GOVT LOT 4 OF SEC 6-2N-27E IN OR 1019/1021 BEING EXHIBIT A ==================================== 1308 06-2N-27-0000-0005-0090 397.93 BRYANT GWENDOLYN D & DARRYL J 1.490AC 813 TORTOISE WAY JACKSONVILLE FL 32218 PT GOVT LOT 4 OF SEC 6-2N-27E IN OR 1019/1021 BEING EXHIBIT B ==================================== 1309 07-2N-27-0000-0002-0060 534.07 DINKINS CLIFFORD N 1.000AC 76120 HARPER CHAPEL ROAD YULEE FL 32097 PT NW1/4 OF NW1/4 OF NE1/4 PAR 2-6 IN OR 798/1890 ==================================== 1310 08-2N-27-0000-0005-0340 1,136.22 SCOTT JANICE C 1.000AC 75294 CLYDE HIGGINBOTHAM ROAD YULEE FL 32097 IN OR 1484/1629 PT OR 810/1210 & 1212 & PT OR 818/1140 & OR 622/404 PARCEL 5-34 SEC 8-2N-27 & PARCEL 4 SEC 9-2N-27 & PARCEL 2-2 SEC 17-2N-27 ESMT OR 918/204 EX 2-3 SEC 17-2N-27 ==================================== 1311 09-2N-27-0230-0027-0000 HX 1,297.48 THERRIAULT LISA B 0.000AC 86050 ALISON COURT YULEE FL 32097 LOT 27 IN OR 1735/1114 CARTESIAN POINTE #1 PB 6/345 ==================================== 1312 09-2N-27-0230-0063-0000 1,950.97 CHAPMAN FUNERAL CHAPEL INC 0.000AC 10141 COLERAIN ROAD ST MARYS GA 31558 LOT 63 IN OR 1250/1925 CARTESIAN POINTE #1 PB 6/345 ==================================== 1313 09-2N-27-0230-0073-0000 HX 1,164.10 WALLACE JUDY 0.000AC 86081 JORDAN COURT YULEE FL 32097 LOT 73 IN OR 1222/1435 CARTESIAN POINTE #1 PB 6/345 ==================================== 1314 12-2N-27-1460-0040-0000 HX 1,972.05 ANDERSON KELLIN & JOCELYN 0.000AC 86152 MONTAUK DRIVE FERNANDINA BEACH FL 32034 LOT 40 IN OR 1016/1767 NORTH HAMPTON PHASE 1 PB 6/215 ==================================== 1315 12-2N-27-1460-0358-0000 1,259.95 GLEASON MARK & LISA 0.000AC 86142 EASTPORT DR FERNANDINA BEACH FL 32034 LOT 358 IN OR 2079/408 NORTH HAMPTON PHASE 3 PB 7/16 ==================================== 1316 12-2N-27-1460-0385-0000 1,003.86 HAM MICHAEL & KAROLINE 0.000AC 2357 CANEY OAKS DR JACKSONVILLE FL 32218 LOT 385 IN OR 2001/1833 NORTH HAMPTON PHASE 3 PB 7/16 ==================================== 1317 18-2N-27-4315-0010-0000 779.95 GRESHAM ELBERT THOMAS 0.000AC 75586 JOHNSON LAKE ROAD YULEE FL 32097 LOT 10 IN OR 1602/938 1986 BIRGADAI DW/MH JOHNSONS LAKE EST UNR ==================================== 1318 18-2N-27-4315-0040-0000 1,267.17 LEE MATTHEW & LACY 0.000AC 75820 JOHNSON LAKE RD YULEE FL 32097 LOT 40 IN OR 2066/837 (EX PT IN OR 2014/1817) JOHNSONS LAKE ESTATES SUB UNR ==================================== 1319 18-2N-27-4315-0050-0000 72.94 ZELL DONALD D 0.000AC 8604 SAN SERVERA DR W JACKSONVILLE FL 32217 LOT 50 PT OR 800 PG 411 JOHNSONS LAKE EST UNR ==================================== 1320 18-2N-27-4315-0051-0000 72.94 ZELL DONALD D 0.000AC 8604 SAN SERVERA DR W JACKSONVILLE FL 32217 LOT 51 PT OR 800 PG 411 JOHNSONS LAKE EST UNR ==================================== 1321 18-2N-27-4315-0052-0000 72.94 ZELL DONALD D 0.000AC 8604 SAN SERVERA DR W JACKSONVILLE FL 32217 LOT 52 PT OR 800 PG 411 JOHNSONS LAKE EST UNR ==================================== 1322 18-2N-27-4315-0053-0000 87.25 ZELL DONALD D 0.000AC 8604 SAN SERVERA DR W JACKSONVILLE FL 32217 LOT 53 PT OR 800 PG 411 JOHNSONS LAKE EST UNR ==================================== 1323 18-2N-27-4315-0054-0000 87.25 ZELL DONALD D 0.000AC 8604 SAN SERVERA DR W JACKSONVILLE FL 32217 LOT 54 PT OR 800 PG 411 JOHNSONS LAKE EST UNR ==================================== 1324 18-2N-27-4315-0055-0000 76.63 ZELL DONALD D 0.000AC 8604 SAN SERVERA DR W JACKSONVILLE FL 32217 LOT 55 PT OR 800 PG 411 JOHNSONS LAKE EST UNR ==================================== 1325 18-2N-27-4315-0056-0000 64.74 ZELL DONALD D 0.000AC 8604 SAN SERVERA DR W JACKSONVILLE FL 32217 LOT 56 (EX S-1) PT OR 800 PG 411 JOHNSONS LAKE EST UNR ==================================== 1326 18-2N-27-4315-0061-0000 605.05 YOUNG JAMES M & PATRICIA S 0.000AC 86058 JEAN ROAD YULEE FL 32097 LOT 61 IN OR 1744/1823 JOHNSONS LAKE EST UNR ==================================== 1327 18-2N-27-4316-0012-0000 HX 437.24 MEADOWS MELISSA 0.000AC 75229 JOHNSON LAKE RD YULEE FL 32097 LOT 12 2001 SCHT DW IN OR 2061/1967 FPL ESMT PT OR 943/796 JOHNSON LAKE EST #2 PB 5/168 ==================================== 1328 18-2N-27-4316-0016-0000 978.56 ROWICKI STANLEY D 0.000AC 75285 JOHNSON LAKE RD YULEE FL 32097 LOT 16 IN OR 2009/902 1999 MERIT DW/MH JOHNSON LAKE EST #2 PB 5/168 ==================================== 1329 18-2N-27-4316-0021-0000 1,509.33 MILES MATTHEW S 0.000AC 75343 JOHNSON LAKE RD YULEE FL 32097 LOT 21 IN OR 1158/785 & OR 1988/31 R621644 & R621645 JOHNSON LAKE EST #3 PB 5/168 ==================================== 1330 18-2N-27-4316-0022-0000 HX 291.62 BULLOCK DARYL D & MISTY D 0.000AC BULLOCK RETTA R EST 75353 JOHNSON LAKE ROAD YULEE FL 32097 LOT 22 R583802 IN OR 1247/334 JOHNSON LAKE EST #2 PB 5/168 ==================================== 1331 18-2N-27-4316-0024-0000 HX 450.44 WILLIAMSON KENNETH & JANICE F 0.000AC 75389 JOHNSON LAKE ROAD YULEE FL 32097 LOT 24 IN OR 843/1435 R672993 & R672994 JOHNSON LAKE EST #2 PB 5/168 ==================================== 1332 18-2N-27-4316-0030-0000 796.25 KNAUSS DENNIS M & JUDITH A 0.000AC 75014 SEMPERFI DRIVE YULEE FL 32097 LOT 30 IN OR 697 PG 272 JOHNSON LAKE EST #2 PB 5/168 ==================================== 1333 18-2N-27-4316-0031-0000 1,234.10 WESLEY ALFRED L & MELANIE S 0.000AC 75523 JOHNSON LAKE ROAD EAST YULEE FL 32097 LOT 31 IN OR 800 PG 413 JOHNSON LAKE EST #2 PB 5/168 ==================================== 1334 18-2N-27-431A-000C-0000 777.46 HALL LINDA LEIGH & 0.000AC GRESHAM TOM PO BOX 1132 INTERLACHEN FL 32148-1132 LOT C IN OR 1043/683 1984 CHAM DW/MH JOHNSON LAKE EST # 1A PB 6/63 ==================================== 1335 18-2N-27-431A-000D-0000 492.25 COKER TAMMIE 0.000AC 75586 JOHNSON LAKE ROAD YULEE FL 32097-1649 LOT D IN OR 1253/1957 1972 FTWD SW/MH JOHNSON LAKE EST # 1A PB 6/63 ==================================== 1336 21-2N-27-0000-0001-0020 166.56 BRYAN FREDERICK SR & CATHERINE 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 IN OR 643 PG 1113 ==================================== 1337 21-2N-27-0000-0001-0030 196.55 BRYAN F A & CATHERINE B 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 IN OR 749/1192 & OR 1295/473 PARCELS 1-3 & 1-4 ==================================== 1338 21-2N-27-0000-0001-0050 155.21 BRYAN F A 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 IN OR 1407/1811 ==================================== 1339 21-2N-27-0000-0001-0070 114.28 BRYAN F A & CATHERINE B 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 IN OR 1466/329 ==================================== 1340 21-2N-27-0000-0001-0080 114.28 BRYAN F A & CATHERINE B 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 IN OR 1466/327 ==================================== 1341 21-2N-27-0000-0001-0090 114.28 BRYAN F A & CATHERINE B 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 PT OR 1460/362 ==================================== 1342 21-2N-27-0000-0001-00M0 52.76 MANN SEAN D 0.000AC 4230 DUVAL DRIVE JACKSONVILLE BEACH FL 32250 ALL OF SEC PARCEL 1 PT OR 1313/689 1/3 INT 380 ACRES (63.33 INT) MINERAL RIGHTS ONLY ==================================== 1343 21-2N-27-0000-0001-0100 155.21 BRYAN F A & CATHERINE B 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 PT OR 1460/362 ==================================== 1344 21-2N-27-0000-0001-0110 126.06 BRYAN F A & CATHERINE B 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 PT OR 1460/362 ==================================== 1345 21-2N-27-0000-0001-0120 126.06 BRYAN F A & CATHERINE B 0.000AC 2003 FAYE ROAD JACKSONVILLE FL 32218 IN OR 1466/325 ==================================== 1346 21-2N-27-0000-0001-0130 126.06 HAIR TONY RAY 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 PT OR 1477/936 ==================================== 1347 21-2N-27-0000-0001-0140 126.06 HAIR TONY RAY 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 PT OR 1477/936 ==================================== 1348 21-2N-27-0000-0001-0150 126.06 HAIR TONY RAY 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 PT OR 1477/936 ==================================== 1349 21-2N-27-0000-0001-0160 162.99 HAIR TONY RAY 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 PT OR 1477/936 ==================================== 1350 21-2N-27-0000-0001-0170 326.71 HAIR TONY RAY 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 IN OR 1487/75 ==================================== 1351 21-2N-27-0000-0001-0180 114.28 HAIR TONY RAY 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 PT OR 1527/1286 ==================================== 1352 21-2N-27-0000-0001-0190 228.47 HAIR TONY RAY 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 PT OR 1527/1286 ==================================== 1353 25-2N-27-1475-0001-0100 HX 485.87 MENTER DOROTHY J EST 0.000AC C/O GARY CARAWAY 85324 LIL WILLIAM RD FERNANDINA BEACH FL 32034 BLOCK 1 LOT 10 IN OR 908/225 R787442 & R787443 NASSAUVILLE WOODS PB 5/126 ==================================== 1354 25-2N-27-1475-0001-0310 HX 273.82 TAYLOR OSCAR VINCE 0.000AC 85257 BURMEISTER ROAD FERNANDINA BEACH FL 32034 BLOCK 1 LOT 31 PT OR 1361/1011 1992 HORT DW/MH NASSAUVILLE WOODS PB 5/126 ==================================== 1355 25-2N-27-1475-0001-0320 413.60 TAYLOR OSCAR VINCE 0.000AC 85257 BURMEISTER ROAD FERNANDINA BEACH FL 32034 BLOCK 1 LOT 32 PT OR 1361/1011 EX ESMT PT OR 556/654 NASSAUVILLE WOODS PB 5/126 ==================================== 1356 25-2N-27-1475-0001-0340 HX 383.77 BALLARD JOHN M 0.000AC 85129 BURMEISTER RD FERNANDINA BEACH FL 32034 BLOCK 1 LOT 34 IN OR 632 PG 820 R621759 & R621760 DRAINAGE ESMT IN OR 744/1139 NASSAUVILLE WOODS PB 5/126 ==================================== 1357 25-2N-27-1475-0001-0640 1,185.34 WALKER STACEY R & THERESA C 0.000AC 85132 LINA RD FERNANDINA BEACH FL 32035 BLOCK 1 LOT 64 IN OR 790 PG 236 R673679 & R673680 NASSAUVILLE WOODS PB 5/126 ==================================== 1358 25-2N-27-1475-0001-0690 594.46 DUBBERLY WILLIAM O & CYNTHIA J 0.000AC 85288 LINA ROAD FERNANDINA BEACH FL 32034 BLOCK 1 LOT 69 IN OR 791 PG 1107 NASSAUVILLE WOODS PB 5/126 ==================================== 1359 25-2N-27-1475-0002-0210 415.34 LUCAS DALE A 0.000AC 86723 CARDINAL RD YULEE FL 32097 BLOCK 2 LOT 21 IN OR 677 PG 183 NASSAUVILLE WOODS PB 5/126 ==================================== 1360 25-2N-27-1475-0002-0220 HX 839.07 PAULK PATRICIA & DORSEY 0.000AC 85244 BURMESITER RD FERNANDINA BEACH FL 32034 BLOCK 2 LOT 22 IN OR 1524/262 2008 JACO DW/MH NASSAUVILLE WOODS PB 5/126 ==================================== 1361 36-2N-27-525N-0005-0000 HX 655.01 JESSE JEAN 0.000AC 85336 SCHUBERT RD FERNANDINA BEACH FL 32034 LOT 5 L/E OR 1643/1813 1984 PARK DW/MH HOLLY POINT NORTH UNR ==================================== 1362 36-2N-27-525N-0015-0000 1,765.75 THEOBALD THOMAS ANDREW 0.000AC 96568 CALHOUN RD FERNANDINA BEACH FL 32034 LOTS 15 & 16 IN OR 543/190 & OR 543/193 HOLLY POINT NORTH UNR ==================================== 1363 36-2N-27-525N-0019-0000 1,057.20 THEOBALD THOMAS A 0.000AC 96568 CALHOUN RD FERNANDINA BEACH FL 32034 LOT 19 IN OR 654 PG 775 HOLLY POINT NORTH UNR ==================================== 1364 36-2N-27-525N-0041-0000 1,373.67 DUNCUM BRIAN E & FELICIA W 0.000AC 95221 GERALD CIR FERNANDINA BEACH FL 32034 LOT 41 IN OR 581/888 HOLLY POINT NORTH UNR ==================================== 1365 36-2N-27-525N-0045-0000 HX 283.77 KOHLENBERGER GLENDA 0.000AC 85034 ADMIRAL AV FERNANDINA BEACH FL 32034 LOT 45 PT OR 735/853 R621701 & R621702 HOLLY POINT NORTH UNR ==================================== 1366 36-2N-27-525N-0046-0000 413.60 KOHLENBERGER ALAN 0.000AC 85034 ADMIRAL AV FERNANDINA BEACH FL 32034 LOT 46 IN OR 1079/905 HOLLY POINT NORTH UNR ==================================== 1367 36-2N-27-525P-0001-0070 HX 462.85 NUNEZ JEFFREY L 0.000AC PO BOX 15016 FERNANDINA BEACH FL 32035 BLOCK 1 LOTS 7 & 8 PT OR 1356/1808 HOLLY POINT NORTH 2 PB 4/80 ==================================== 1368 36-2N-27-525P-0002-0030 HX 540.66 MANN RANDALL W 0.000AC 85423 LINDA HALL ROAD FERNANDINA BEACH FL 32034 BLOCK 2 LOT 3 1999 SPRING HILL DW IN OR 835 PG 2001 HOLLY POINT NORTH 2 PB 4/80 ==================================== 1369 36-2N-27-525P-0002-0050 HX 503.03 MCKINNEY JAMES A 0.000AC 85363 LINDA HALL ROAD FERNANDINA BEACH FL 32034 BLOCK 2 LOT 5 IN OR 1964/1345 R673783 & R673784 HOLLY POINT NORTH 2 PB 4/80 ==================================== 1370 36-2N-27-525P-0004-0020 1,078.86 WAY ELIPHUS JEROME 0.000AC 85182 LONNIE CREWS RD FERNANDINA BEACH FL 32034 BLOCK 4 LOT 2 IN OR 804 PG 368 R672483 & R672484 HOLLY POINT NORTH 2 PB 4/80 ==================================== 1371 36-2N-27-525Q-0002-0050 HX 290.57 NIX CLAUDE EDWARD 0.000AC 85355 LONNIE CREWS ROAD FERNANDINA BEACH FL 32034 BLOCK 2 LOT 5 R497460 IN OR 2142/1199 HOLLY POINT NORTH #3 PB 5/24 ==================================== 1372 36-2N-27-525Q-0002-0110 902.53 PARKER ALMA JEAN 0.000AC PO BOX 2034 YULEE FL 32041-2034 BLOCK 2 LOT 11 IN OR 1479/1534 1998 JAGU DW/MH ESMT OR 1488/382 HOLLY POINT NORTH 3 PB 5/24 ==================================== 1373 36-2N-27-525Q-0003-0020 HX 546.56 CRAWFORD STEVE M & DEBBIE M 0.000AC 85505 LONNIE CREWS ROAD FERNANDINA BEACH FL 32034 BLOCK 3 LOT 2 R359755 EX FPL ESMT OR 385/127 IN OR 568 PG 794 HOLLY POINT NORTH 3 PB 5/24 ==================================== 1374 36-2N-27-525Q-0004-0010 909.78 ALLISON VENTURES LLC 0.000AC 96034 SANDY POINTE CR FERNANDINA BEACH FL 32034 BLOCK 4 LOT 1 IN OR 1779/1862 R434348 & R434349 HOLLY POINT NORTH #3 PB 5/24 ==================================== 1375 36-2N-27-525Q-0004-0050 356.37 GRIFFIN ROBERT B III 0.000AC 97175 LAFFITES WAY YULEE FL 32097 BLOCK 4 LOT 5 PT OR 1876/1244 HOLLY POINT NORTH #3 PB 5/24 ==================================== 1376 37-2N-27-0000-0001-0220 40.32 KIMCO NASSAU LLC 20.290AC 3333 NEW HYDE PARK RD STE 100 NEW HYDE PARK NY 11042 PT JOHN LOWE MILL GRANTS SEC 37-2N-27E & 51-3N-27E IN OR 1196/1796 BEING PARCEL F (EX PT IN OR 2050/272 & EX ESMT IN OR 1196/1811 & EX CNSVTN ESMT IN OR 1355/1195 & EX R/W IN OR 2108/1050) ==================================== 1377 38-2N-27-0000-0008-0020 3,477.43 HILLIARD TRUCK & AUTO INC 0.000AC 15928 CR 108 HILLIARD FL 32046 IN OR 1812/1516 ESMT OR 1457/915 ==================================== 1378 38-2N-27-0000-0008-0040 761.05 DICHARIA ANNA MARIE 1.870AC 86128 DI CHARIA ST YULEE FL 32097-3305 IN OR 1550/32 ==================================== 1379 38-2N-27-0000-0011-0010 2,317.55 THOMAS ANDREW EST 0.000AC C/O GLORIA THOMAS PO BOX 24 YULEE FL 32041-0024 OR 729/1670 & PT OR 749/1649 EX R/W IN OR 203/470 ==================================== 1380 38-2N-27-0000-0011-0030 2,487.89 THOMAS ANDREW EST 2.000AC C/O GLORIA THOMAS PO BOX 24 YULEE FL 32041-0024 OR 677/441 & PT OR 749/1649 ==================================== 1381 38-2N-27-0000-0014-0060 1,905.17 HAYWOOD FRED 2.000AC 1790 FREDERICA RD ST SIMONS ISLAND GA 31522-2542 IN OR 137/612 & OR 329/781 ==================================== 1382 38-2N-27-0000-0014-0170 9,444.13 CASTLE USED CARS INC 0.960AC 463493 STATE ROAD 200 YULEE FL 32097 IN OR 2038/608 R568144 & R568145 & R622392 PARCELS 14-17 14-18 & 14-19 EX ESMT OR 1016/4 ESMT OR 1457/903 ==================================== rf rfntb DEL. TAX LIST 2017.indd 9 4/30/18 12:20 PM

PAGE 70

1383 38-2N-27-0000-0017-0000 1,114.94 TUMMIRE JOHN & 2.600AC TUMMIRE LESLIE 75143 RAVENWOOD DR YULEE FL 32097 PT JOHN VAUGHN GRANT SEC 38-2N-27E IN OR 2106/817 ==================================== 1384 38-2N-27-0000-0018-0030 HX 763.75 PAINTER PAMELA G & 1.470AC MINER STEVEN M 86187 APPALOOSA AVE YULEE FL 32097 IN OR 1922/30 R583888 & R583889 ==================================== 1385 38-2N-27-0580-0006-0000 HX 1,922.78 WESLEY JACQUELINE 10.160AC 85386 MINER RD YULEE FL 32097 LOT 6 & PAR 19-1 IN OR 644 PG 465 EX ESMT OR 673/592 ESMT & RD MAINT IN OR 852/1627 FUGATES LANDING PB 5/108 ==================================== 1386 38-2N-27-1270-000D-0010 100.75 GOTCH JOHN JR 0.000AC C/O KATHERINE L GRONAGER 94182 RIVER MARSH DRIVE FERNANDINA BEACH FL 32034 SW1/2 OF TRACT D IN OR 1326/608 LOFTON OAKS @ YULEE HOME PARK #1 PBK 5/323 ==================================== 1387 38-2N-27-127C-0071-0000 HX 913.10 HOLZENDORF DWAYNE K 0.000AC 83151 ST MARK TRAIL YULEE FL 32097 LOT 71 IN OR 812/609 LOFTON CREEK PB 6/33-36 ==================================== 1388 38-2N-27-1330-0028-0000 2,397.83 BARNARD DENISE R 0.000AC 762 GEIGER ROAD FERNANDINA BEACH FL 32034-7821 LOT 28 IN OR 726 PG 426 MEADOWFIELD BLUFFS PB 5/105 ==================================== 1389 38-2N-27-1331-0031-0000 787.04 STRICKLAND ARLENE L 0.000AC P O BOX 458 WAYCROSS GA 31502 LOT 31 IN OR 1863/200 MEADOWFIELD UNIT 1B PB 6/203 ==================================== 1390 38-2N-27-1525-0010-0000 773.26 KUCHES CHRISTOPHER E EST 0.000AC 85642 MINER ROAD YULEE FL 32097 LOT 10 PT OR 1546/1141 OAK WOODS PB 5/370 ==================================== 1391 42-2N-27-0000-0001-0230 1,286.83 HOLLAND AARON W JR 1.000AC PO BOX 106 YULEE FL 32041-0106 IN OR 1100/748 ==================================== 1392 42-2N-27-0000-0001-0310 1,927.02 DAVIS BRETT L 2.790AC 85115 HADDOCK RD YULEE FL 32097 IN OR 1877/1264 ==================================== 1393 42-2N-27-0000-0001-0350 311.99 PIKULA BYRON KYLE & JENNIFER B 1.710AC 85538 MINER RD YULEE FL 32097 PT JOHN LOW MILL GRANT SEC 42-2N-27E IN OR 2029/567 ==================================== 1394 42-2N-27-0000-0002-0220 3,774.02 MIRSCHEL JO D & 2.940AC MIRSCHEL JOHN H III (JT/RS) 1224 HARRISON POINT TRAIL FERNANDINA BEACH FL 32034 IN OR 973/813 & OR 1683/716 ==================================== 1395 42-2N-27-0000-0002-0310 2,709.65 PEARCE CAROLEE J & 4.000AC DANIEL MACARTHUR H PO BOX 876 FERNANDINA BEACH FL 32035 IN OR 1341/1231 ESMT OR 1226/654 ESMT OR 1463/789 ==================================== 1396 42-2N-27-0000-0009-0010 221.85 GILBERT BESSIE LEE EST 0.000AC C/O LILLIE MARIE FAVORS JONES 86153 KUTANA DRIVE YULEE FL 32097 PT JOHN LOW MILL GRANT SEC 42-2N-27E IN OR 958/1673 ==================================== 1397 42-2N-27-0000-0018-0000 413.48 COLLINS FRANK ETAL 0.000AC COLLINS GLENISE A/K/A 86013 KUTANA DRIVE YULEE FL 32097 PT JOHN LOW MILL GRANT SEC 42-2N-27E IN OR 1380/468 ==================================== 1398 42-2N-27-0000-0019-0010 966.86 THOMAS ANDREW C 2.050AC 1204 EAST 14TH STREET PANAMA CITY FL 32401-4136 PT JOHN LOW MILL GRANT SEC 42-2N-27E IN OR 1496/729 ==================================== 1399 42-2N-27-0000-0023-0000 3,736.83 KERR BETTY JEAN 1.470AC 86258 PINEWOOD DRIVE YULEE FL 32097 PT OR 952/1738 EX 23-1 THRU 23-5 EX OR 85/398 & OR 5/98 ==================================== 1400 42-2N-27-0000-0023-0010 236.68 ALBERT LILLIE MAE EST 0.000AC ALBERT LEONARD L/E C/O 86220 PINEWOOD DR YULEE FL 32097 IN OR 20/358 L/E BY WILL ==================================== 1401 42-2N-27-0000-0023-0030 478.65 SIMMONS EDDIE & 0.000AC SIMMONS CHARMAINE 86220 PINEWOOD DR YULEE FL 32097 IN OR 1946/407 R408037 & R408038 ==================================== 1402 42-2N-27-0000-0026-0000 413.07 WOODBURY MARIE G EST 0.000AC C/O PRINCE WOODBURY III 916 STRAWBERRY COURT ELLENWOOD GA 30294 IN OR 100 PG 97 ==================================== 1403 42-2N-27-0000-0026-0030 293.96 GILYARD ELIZABETH EST 0.000AC C/O CLAUDETTE BROWN 462974 SR 200 YULEE FL 32097 IN OR 67 PG 667 ==================================== 1404 42-2N-27-0000-0031-0000 332.87 MOBLEY MARGARET EST 0.000AC C/O GRANDVILLE MOBLEY PO BOX 51 YULEE FL 32041-0051 PT JOHN LOW GRANTS IN OR 133/639 (EX R/W ESMT IN OR 1856/483) ==================================== 1405 42-2N-27-0000-0032-0000 208.99 MOBLEY GRANDVILLE EST 0.000AC C/O GAIL MOBLEY PO BOX 51 YULEE FL 32041-0051 PT JOHN LOW GRANTS IN DBK 182/482 ==================================== 1406 42-2N-27-0000-0033-0000 322.67 JACKSON FRANCENA EST 0.000AC C/O PETREACE NICOLE PONDER 86129 PALM TREE DRIVE YULEE FL 32097 PT JOHN LOW GRANTS IN DBK 167/154 ==================================== 1407 42-2N-27-0000-0039-0000 1,639.91 MOBLEY GAIL & 0.000AC MOBLEY MAGGIE EST PO BOX 51 YULEE FL 32041-0051 PT JOHN LOWE GRANTS IN OR 187/316 (EX R/W IN OR 1856/483) ==================================== 1408 42-2N-27-0000-0043-0000 153.78 PRINCE G A EST 0.000AC C/O MICHAEL COLLYMORE P O BOX 2097 YULEE FL 32041-2097 PT JOHN LOWE GRANTS IN DBK 180/360 (EX PT IN OR 1554/87) ==================================== 1409 42-2N-27-0000-0044-0020 61.22 COLLYMORE MICHAEL EST 0.000AC PO BOX 2097 YULEE FL 32041-2097 PT JOHN LOWE GRANTS IN OR 569/1133 ==================================== 1410 42-2N-27-0000-0056-0010 352.39 EVANS JOSEPH 0.000AC PO BOX 81 YULEE FL 32041-0081 IN OR 253 PG 289 ==================================== 1411 42-2N-27-0000-0058-0020 HX 135.81 CRAWFORD WILLIAM & ROBIN 0.000AC 86028 CROSBY AVE YULEE FL 32097 IN OR 1296/1288 1980 GOVE DWMH ==================================== 1412 42-2N-27-0000-0065-0000 274.70 KIRKLAND PATRICIA A 0.000AC 85428 TRINITY CIRCLE YULEE FL 32097 IN OR 1739/1020 ==================================== 1413 42-2N-27-0000-0066-0000 1,294.52 YULEE REPO HOME CENTER 1.860AC PO BOX 1748 YULEE FL 32041-1748 OR 879/1195 PARCELS 66 & 66-1 ==================================== 1414 42-2N-27-0000-0079-0010 1,759.64 CLAXTON JOHN L 0.000AC 85127 HARTS ROAD YULEE FL 32097 IN OR 2128/946 RP 434356 ==================================== 1415 42-2N-27-0000-0084-0000 3,507.27 CARTER IVEY J TRUSTEE F/B/O 3.000AC TRAE NORMAN 85558 WILSON NECK RD YULEE FL 32097 IN OR 2017/1050 & OR 2017/1070 ==================================== 1416 42-2N-27-0000-0085-0010 HX 1,147.32 WILSON DAVID GLEN 1.000AC 85011 HARTS ROAD YULEE FL 32097 IN OR 1461/727 PARCELS 85-1 & 85-2 ==================================== 1417 42-2N-27-0000-0086-0000 1,220.78 JOHNNY L DUDLEY LLC 0.000AC 11478 PINE ST JACKSONVILLE FL 32258-1665 PT OR 1732/1480 (EX 86-1 & 86-3 & OR 2116/1726 EX R/W PT OR 1006/1213) RECIPRICAL ESMT PT 1010/302 ==================================== 1418 42-2N-27-0000-0086-0020 1,260.69 ANDREWS KIMBER L 0.000AC 11478 PINE ST JACKSONVILLE FL 32258 IN OR 2110/105 RECIPRICAL ESMT PT 1010/302 EX 86-4 EX R/W PT OR 1006/1213 ==================================== 1419 42-2N-27-0000-0091-0010 522.40 WARREN SHIRLEY ANN HALL 0.000AC 85020 HALLS LANE YULEE FL 32097 IN OR 2071/1905 ESMT PT OR 852/1653 ==================================== 1420 42-2N-27-0000-0095-0000 HX 456.18 WARREN RICKY LAMAR 0.000AC 85020 HALLS LN YULEE FL 32097 PT JOHN LOW MILL GRANT SEC 42-2N-27E IN OR 1830/362 {1997 MERI DW/MH} ==================================== 1421 42-2N-27-0000-0096-0000 HX 367.17 TUCKER MATTHEW D & 1.360AC WARREN RICKY LAMAR 85042 HALLS LN YULEE FL 32097 PT JOHN LOW MILL GRANT SEC 42-2N-27E IN OR 1970/112 (EX PT IN OR 1353/1406) {RP 2503} ==================================== 1422 42-2N-27-0000-0096-0010 130.23 WARREN SHIRLEY ANN HALL 0.000AC 85020 HALLS LANE YULEE FL 32097 PT JOHN LOW MILL GRANT SEC 42-2N-27E IN OR 909/1148 ==================================== 1423 42-2N-27-1330-0004-0000 26,813.95 RLW PROPERTIES LLC 0.000AC 1028 HWY 80 WEST GARDEN CITY GA 31408 PARCEL 4 IN OR 2078/1984 UTIL ESMTS PT OR 1769/492-513 MINER CORNERS SUB PB 8/56 ==================================== 1424 42-2N-27-430C-0003-0000 1,496.73 WHICKER SOLO 401 K TRUST 0.000AC DANA WHICKER TRUSTEE 2018 VILLAGE LN FERNANDINA BEACH FL 32034 LOT 3 IN OR 2034/631 CLAXTON ACRES PB 5/257 ==================================== 1425 42-2N-27-430C-0017-0000 HX 350.17 ROSE JOHN C 0.000AC 85285 LINDSEY KAY COURT YULEE FL 32097 LOT 17 IN OR 662 PG 1146 R498073 & R498074 CLAXTON ACRES PB 5/257 ==================================== 1426 42-2N-27-430C-0022-0000 HX 416.38 FRANCIS JAMES G & 0.000AC FRANCIS VELMA J EST (M&S) 85373 LINDSEY KAY CT YULEE FL 32097 LOT 22 IN OR 670 PG 1116 R434250 & R434251 CLAXTON ACRES PB 5/257 ==================================== 1427 42-2N-27-430C-0031-0000 HX 927.21 KEMP DANIEL JR & MERLE M 0.000AC 85184 EADY LANE YULEE FL 32097 LOT 31 2004 SKYO DW/MH IN OR 1285/1926 CLAXTON ACRES PB 5/257 ==================================== 1428 42-2N-27-4310-0008-0000 275.55 BOLDEN SAMUEL SR & CARLEENE 0.000AC 1752 DAYTONA LANE JACKSONVILLE FL 32218 LOT 8 DAVIS ESTATE HEIGHTS PB 5/15 ==================================== 1429 42-2N-27-4310-0009-0000 372.97 BOLDEN SAMUEL SR & CARLEENE 0.000AC 1752 DAYTONA LANE JACKSONVILLE FL 32218 LOT 9 DAVIS ESTATE HEIGHTS PB 5/15 ==================================== 1430 42-2N-27-4320-0005-0030 509.76 THOMAS ANDREW EST 0.000AC C/O GLORIA THOMAS PO BOX 24 YULEE FL 32041-0024 PT OF LOT 5 IN OR 595/431 WM DAVIS ESTATE DB 245/475 ==================================== 1431 42-2N-27-4340-0003-0020 HX 613.83 REEVES ANGELA E 0.000AC 85938 NORTH HARTS RD YULEE FL 32097 PT BLKS 3 & 4 PAR 3-2 IN OR 2116/705 ESMT PT OR 1881/975 E J JOHNSONS ADD TO YULEE UNR ==================================== 1432 42-2N-27-4340-0011-0000 465.67 DANIEL ROBERT K III 1.630AC 86150 HAYLEY PL YULEE FL 32097 PT BLKS 11,12,13 & PT ABND R/W OR 454/85 & OR 456/382 (EX ESMT IN OR 454/85) E J JOHNSON ADDN TO YULEE UNR ==================================== 1433 42-2N-27-4340-0011-0030 787.00 DANIEL ROBERT K III 1.670AC 86150 HAYLEY PL YULEE FL 32097 PT BLKS 11,12,PT ABND R/W & PT JOHN LOW GRANT SEC 42-2N 27E PT OR 1669/572 & ESMT IN OR 454/85 (EX PT IN OR 454/85 & OR 1881/975) E J JOHNSON ADDN TO YULEE UNR {R334254} ==================================== 1434 42-2N-27-4340-0014-0000 917.76 MORGAN RUSSELL JR 0.000AC 463106 STATE ROAD 200 YULEE FL 32097 BLOCK 14 IN OR 811 PG 1383 E J JOHNSON ADD TO YULEE UNR ==================================== 1435 42-2N-27-4350-0008-0000 1,367.48 LITTLES JEANIE M 0.000AC 410 JACKSON AVE PALATKA FL 32177 LOTS 8 & 15 IN OR 1489/1888 JAMES D CARR SUB UNR ==================================== 1436 42-2N-27-4350-0010-0000 HX 544.87 LEGGETT REGINA DIANE 0.000AC P O BOX 368 YULEE FL 32041-0368 LOTS 10 & 13 & PT OF LOT 14 (F/K/A 57-13) IN OR 2091/1407 JAMES D CARR SUB UNR ==================================== 1437 42-2N-27-4350-0011-0000 HX 110.54 YOUNG ROBERT B 0.000AC 86124 SOWELL ROAD YULEE FL 32097 LOT 11 & 12 F/K/A 57-6 & 57-7 1980 NOBI DW/MH IN OR 1219/1278 JAMES D CARR SUB UNR ==================================== 1438 42-2N-27-4350-0017-0000 286.99 DAVIS MARVIN R EST 0.000AC C/O WESLEY R POOLE 303 CENTRE ST STE 200 FERNANDINA BEACH FL 32034 LOT 17 PT OF OR 456 PG 203 JAMES D CARR SUB UNR ==================================== 1439 42-2N-27-4350-0018-0000 286.99 DAVIS MARVIN R EST 0.000AC C/O WESLEY R POOLE 303 CENTRE ST STE 200 FERNANDINA BEACH FL 32034 LOT 18 PT OF OR 456 PG 203 JAMES D CARR SUB UNR ==================================== 1440 42-2N-27-4350-0019-0000 376.73 DAVIS MARVIN R EST 0.000AC C/O WESLEY R POOLE 303 CENTRE ST STE 200 FERNANDINA BEACH FL 32034 LOT 19 PT OF OR 456 PG 203 JAMES D CARR SUB UNR ==================================== 1441 42-2N-27-4350-0020-0000 458.43 TURNER REBECCA A & 0.000AC BALBASIRO RAYMOND J (JT/RS) 86058 SOWELL RD YULEE FL 32097-3900 LOT 20 (F/K/A PAR 57-3) IN OR 2130/172 JAMES D CARR SUB UNR ==================================== 1442 42-2N-27-4350-0021-0000 668.79 DAVIS MARVIN R EST 0.000AC C/O WESLEY R POOLE 303 CENTRE ST STE 200 FERNANDINA BEACH FL 32034 LOT 21 PT OF OR 456 PG 203 JAMES D CARR SUB UNR ==================================== 1443 42-2N-27-4350-0022-0000 918.22 DAVIS MARVIN R EST 0.000AC C/O WESLEY R POOLE 303 CENTRE ST STE 200 FERNANDINA BEACH FL 32034 LOT 22 PT OF OR 456 PG 203 JAMES D CARR SUB UNR ==================================== 1444 42-2N-27-435H-0231-0000 HX 2,331.35 GUINN PATRICIA M 0.000AC P O BOX 1193 YULEE FL 32041 LOT 231 IN OR 1529/749 HICKORY VILLAGE #4 PB 7/122 ==================================== 1445 42-2N-27-4360-0010-0000 HX 545.91 MYERS BONNIE FAYE 0.000AC 85129 WINONA BAYVIEW RD YULEE FL 32097 PT OR 703 PG 240 COUNCIL PARK SUB PB 3/42 ==================================== 1446 42-2N-27-437S-0007-0000 HX 482.01 DONALDSON CAROLYN R 0.000AC 85205 WINONA BAYVIEW RD YULEE FL 32097 LOT 7 IN OR 940/1022 32620145LA & 326201452B STEVENS LANDING SUB PB 6/116 ==================================== 1447 42-2N-27-4380-0001-0010 3,667.37 LASSERRE CURTISS H TRUSTEE OF 0.000AC CURTISS H LASSERRE REVOCABLE PO BOX 653 FERNANDINA BEACH FL 32035-0653 BLOCK 1 LOTS 1 THRU 10 INC PT OR 2004/377 BEING PARCEL 16 TRINITY CIRCLE SUB PB 3/34 ==================================== 1448 42-2N-27-4380-0002-0100 637.55 GRAHAM SHELVIA J EST 0.000AC 85186 TRINITY CIRCLE YULEE FL 32097 BLOCK 2 LOT 10 IN OR 495 PG 948 R235893 & R235892 TRINITY CIRCLE SUB PB 3/34 ==================================== 1449 42-2N-27-438U-0006-0000 1,321.79 HOLLAND DEBBIE 0.000AC 64 N 15TH STREET FERNANDINA BEACH FL 32034 LOT 6 IN OR 1779/316 ESMT OR 1201/1143 US 17 COMMERICAL PARK PB 6/259 ==================================== 1450 42-2N-27-438U-0007-0000 6,645.89 SECOND AMENDMENT INC 0.000AC 2410 SAFE HARBOR LANE FERNANDINA BEACH FL 32034 LOT 7 IN OR 1639/749-754 ESMT OR 1201/1144 US 17 COMMERICAL PARK PB 6/259 ==================================== 1451 42-2N-27-438U-0009-0000 6,211.03 STEVENSON COLLISION CENTER INC 0.000AC 85049 COMMERICIAL PARK DRIVE YULEE FL 32097 LOT 9 IN OR 1086/65 US 17 COMMERICAL PARK PB 6/259 ==================================== 1452 42-2N-27-438U-0010-0000 1,859.25 STEVENSON COLLISION CENTER INC 0.000AC 85049 COMMERCIAL PARK DRIVE YULEE FL 32097 LOT 10 IN OR 1191/219 EX 15X15 FT ESMT IN NE CORNER US 17 COMMERICAL PARK PB 6/259 ==================================== 1453 42-2N-27-4400-0003-0200 HX 384.99 STRUBLE RONALD JOE & DEBORAH L 0.000AC P O BOX 1403 YULEE FL 32041-1403 BLOCK 3 LOT 20 IN OR 360 PG 372 YULEE HEIGHTS SUB PB 3/47A ==================================== 1454 42-2N-27-4400-0004-0010 1,858.04 MCNULTY MATTHEW J & AMANDA R 0.000AC 232 LAKE FOREST SOUTH DR KINGSLAND GA 31548-5635 BLOCK 4 LOTS 1 & 21 EX S56.2 FT OF LOT 21 IN OR 1322/1057 YULEE HEIGHTS SUB PB 3/47A ==================================== 1455 42-2N-27-4460-0001-0000 HX 2,270.56 CRUMP LESLIE L 0.000AC 85125 RADIO AVE YULEE FL 32097 LOTS 1 & 2 IN OR 1906/1473 TERMINAL HEIGHTS SUB PB 5/9 ==================================== 1456 42-2N-27-4460-0027-0000 HX 595.50 MOORE LINDA M & DAVID C 0.000AC P O BOX 1063 YULEE FL 32041-1063 LOT 27 IN OR 736 PG 541 1/2 HX INT TERMINAL HEIGHTS SUB PB 5/9 ==================================== 1457 42-2N-27-4460-0028-0000 253.76 MOORE DAVID C & LINDA (JT/RS) 0.000AC P O BOX 1063 YULEE FL 32041-1063 LOT 28 IN OR 954/193 TERMINAL HEIGHTS SUB PB5/9 ==================================== 1458 42-2N-27-4480-0002-0000 HX 129.47 WINGATE BARBARA J 0.000AC 85507 WINONA BAYVIEW RD YULEE FL 32097 IN OR 78 PG 335 (EX OR 2014/542) R 106972 & R 106973 SUB OF CHARLOTTE STEVENS LAND OR 9/521 ==================================== 1459 42-2N-27-4487-0004-0000 805.88 MUHS KENNETH M & FLORENCE L 1.010AC 85537 NORTH HARTS RD YULEE FL 32097 LOT 4 IN OR 745/223 WIDE ROAD ACRES PB 5/404-406 ==================================== 1460 42-2N-27-4487-0013-0000 674.05 HESSENAUER BRIAN T & PHYLLIS 1.140AC PO BOX 1748 YULEE FL 32041-1748 LOT 13 (EX S-1 & S-2) IN OR 754/1932 & OR 1815/469 ESMT OR 993/1156 WIDE ROAD ACRES PB 5/404-406 ==================================== 1461 42-2N-27-4487-0032-0000 1,144.40 PETERSON CLAYTON R & KIMBERLY 1.510AC 85488 HARTS RD YULEE FL 32097 LOT 32 (EX S-1) IN OR 1924/629 1995 SKYL DW/MH ESMT IN OR 756/1345 WIDE ROAD ACRES PB 5/404-406 ==================================== 1462 42-2N-27-4487-0033-0000 HX 598.27 HOWARD CONNIE C STEVENS & 2.060AC HOWARD MICHAEL A SR 85494 NORTH HARTS ROAD YULEE FL 32097 LOT 33 (EX S-1) IN OR 751 PG 1856 R672881 & R672882 WIDE ROAD ACRES PB 5/404-406 ==================================== 1463 42-2N-27-4487-0033-0010 604.82 HOWARD LORRAINE R EST 1.000AC P O BOX 1737 YULEE FL 32041-1737 PT OF LOT 33 (S-1) IN OR 976/1049 WIDE ROAD ACRES PB 5/404-406 1986 EDGE SW/MH ==================================== 1464 42-2N-27-4490-0004-0000 HX 844.26 HESSENAUER JAMES P & 0.000AC HESSENAUER BRIAN & P L (JT/RS) 85101 WINDY OAKS LANE YULEE FL 32097 LOT 4 IN OR 1282/1511 WINDY OAK SUB PB 4/101 ==================================== 1465 42-2N-27-4500-0006-0020 HX 123.64 ROYAL DAVID R & DAWN J 0.000AC 85089 SUTTON PL YULEE FL 32097 PT OF LOT 6 IN OR 1892/1416 1988 OMNI DW/MH YULEE FARMS #1 PB 2/37 ==================================== 1466 42-2N-27-4500-0007-0090 HX 210.03 WALKER LARRY & PAMELA 0.000AC 85108 SUTTON PL YULEE FL 32097 PT OF LOT 7 IN OR 786 PG 62 YULEE FARMS SUB 1 PB 2/37 ==================================== 1467 42-2N-27-4500-0008-0030 960.88 LAYDEN HARRIETT LORRAINE 0.000AC 606 VENGEANCE CREEK RD MARBLE NC 28905 PT OF LOT 8 (S-3 & S-4) L/E IN OR 502/508 & 509 IN OR 515 PG 527 YULEE FARMS 1 PB 2/37 ==================================== 1468 42-2N-27-4500-0009-0060 HX 746.62 CRAWFORD ALVIN ODEN L/E 0.000AC STEVEN M CRAWFORD 85102 AIRPLANE RD YULEE FL 32097 PT OF LOT 9 IN OR 1946/113 YULEE FARM SUB 1 PB 2/37 ==================================== 1469 42-2N-27-4500-0010-0010 HX 800.53 ROBERTS JASON DARRELL 0.679AC 85208 HARTS RD YULEE FL 32097 PT OF LOT 10 IN OR 1970/1361 YULEE FARMS SUB 1 PB 2/37 ==================================== 1470 42-2N-27-4500-0010-0030 1,442.03 CHANCEY DANIEL JR 0.000AC 85202 HARTS RD YULEE FL 32097 PT OF LOT 10 IN OR 1841/27 YULEE FARM SUB 1 PB 2/37 ==================================== 1471 42-2N-27-4500-0022-0040 1,385.52 SHAVERS JAMES DOUGLAS EST 9.060AC 85050 MYRTICE RD YULEE FL 32097 PT OF LOTS 22 & 23 (S-4 & S-5) IN OR 1233/1374 2002 MERT DW YULEE FARMS SUB 1 PB 2/37 ==================================== 1472 42-2N-27-4540-0011-0010 3,511.73 MELISSA ACRES LLC 6.440AC 3416 SEA MARSH RD FERNANDINA BEACH FL 32034 N1/2 OF LOTS 11 12 & 13 IN OR 2054/1968 R433772 R433766 & R433767 R433768 R583935 R787947 & 1985 OAKL DW/MH (EX S-2 THRU S-5) EX S-1 & S-2 OF LOT 13 PT OF ABND R/W OR 200/653 YULEE FARMS 2 SUB PB 3/23 ==================================== 1473 42-2N-27-4540-0014-0020 3,031.05 STEPHENS TIMOTHY & LEE ANNE 6.960AC 85123 TELEPHONE LN YULEE FL 32097 PT OF LOTS 14 & 15 (S-2 & S-4) IN OR 1915/78 YULEE FARMS 2 SUB PB 3/23 ==================================== 1474 42-2N-27-4540-0015-0010 1,121.15 VERA KEVIN 3.200AC 6122 HECKSCHER DRIVE JACKSONVILLE FL 32226 PT OF LOT 15 (S-1) IN OR 1396/22 YULEE FARMS #2 PB 3/23 ==================================== 1475 42-2N-27-4600-0007-0010 968.04 MCCORMICK CHRISTOPHER W & 1.070AC MCCORMICK CATHALEEN N (H&W) 86071 DORSEY LANE YULEE FL 32097 PT OF LOT 7 IN OR 1514/1306 YULEE FARMS UNIT 4 PBK 3/32 {R498126 & R498127} ==================================== 1476 42-2N-27-4607-0011-0010 4,114.28 MANNING MARK V & 0.000AC HARBIN CARLTON D(T/I/C) 1342 GERBING ROAD FERNANDINA BEACH FL 32034 W295 FT OF LOT 11 IN OR 1748/629 YULEE SOUTH PB 5/224 ==================================== 1477 42-2N-27-4607-0012-0000 2,386.08 MANNING MARK V & 2.980AC HARBIN CARLTON D (T/I/C) 1342 GERBING ROAD FERNANDINA BEACH FL 32034 TRACT 12 IN OR 1761/1018 YULEE SOUTH PB 5/224 ==================================== 1478 42-2N-27-4610-0002-0000 HX 78.60 WINGATE JAMES E & TAMMY S 0.000AC 85239 HADDOCK ROAD YULEE FL 32097 LOT 2 R378383 IN OR 734 PG 1567 YULEE WOODS PB 5/56 ==================================== 1479 42-2N-27-4610-0016-0000 1,003.26 CHANCEY DANIEL B SR 0.000AC 85528 HADDOCK ROAD YULEE FL 32097 LOT 16 IN OR 2130/1130 R224183 & R224184 YULEE WOODS PB 5/56 ==================================== 1480 42-2N-27-4612-0002-0170 HX 302.65 YARBROUGH JAMES C 0.000AC 85134 THERESA RD YULEE FL 32097 BLOCK 2 LOT 17 IN OR 1170/1744 H54657G YULEE WOODS #2 PB 5/83 & 84 ==================================== 1481 42-2N-27-4612-0002-0230 642.71 WILLIAMS JEREMIAH P & CARRIE 0.000AC 85052 THERESA ROAD YULEE FL 32097 BLOCK 2 LOT 23 IN OR 893/475 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1482 42-2N-27-4612-0002-0320 HX 364.12 HERRERA GENEVA M 0.000AC 85161 JOANN ROAD YULEE FL 32097 BLOCK 2 LOT 32 IN OR 1910/1461 1986 CONC DW/MH YULEE WOODS #2 PB 5/83 & 84 ==================================== 1483 42-2N-27-4612-0004-0260 HX 590.36 CREWS MICHAEL E EST 0.000AC C/O TRACY WILDER 5910 SILKCREST TRAIL ARLINGTON TX 76017 BLOCK 4 LOT 26 IN OR 508/737 & OR 1858/1566 2000 PIONEER DW/MH YULEE WOODS #2 PB 5/83 & 84 ==================================== 1484 42-2N-27-4612-0004-0300 1,103.81 NEVES LACINDA 0.000AC 2564 E US RT 36 PIQUA OH 45356 BLOCK 4 LOT 30 IN OR 2043/1882 R334304 & R334305 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1485 42-2N-27-4612-0004-0320 641.86 HARRIS LAWTON T SR EST 0.000AC C/O CYNTHIA SMART 3475 SWAMP RD WAYCROSS GA 31503 BLOCK 4 LOT 32 IN OR 712 PG 466 R583404 & R583405 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1486 42-2N-27-4612-0005-0070 602.72 ROMAN WILLIARD DARDEN EST & 0.000AC DEDMON CHARLES GENE ET AL 85161 MADELINE ROAD YULEE FL 32097 BLOCK 5 LOT 7 IN OR 494/1028 & OR 1983/1975 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1487 42-2N-27-4612-0006-0110 1,999.33 BROWN ROBYN L 0.000AC 85362 JOANN ROAD YULEE FL 32097 BLOCK 6 LOT 11 IN OR 1100/1372 2001 MERIT QUAD/WIDE YULEE WOODS #2 PB 5/83 & 84 ==================================== 1488 42-2N-27-4612-0007-0110 HX 508.58 SHEFFIELD CHARLES & GWENDOLYN 0.000AC 85534 KIRKLAND RD YULEE FL 32097 BLOCK 7 LOT 11 IN OR 519 PG 17 R621742 & R621743 & R621744 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1489 42-2N-27-4612-0007-0200 596.87 COFFEY KELLY J & 0.000AC STROUD SHERREE D 85228 KIRKLAND ROAD YULEE FL 32097 BLOCK 7 LOT 20 IN OR 659 PG 1146 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1490 42-2N-27-4612-0007-0280 HX 174.91 DOUGLAS MARK K & ANDREA L 0.000AC 3 PACISICO NORTHTIP SANTA RITA GU 96915 BLOCK 7 LOT 28 R672680 IN OR 1717/1127 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1491 42-2N-27-4612-0007-0310 HX 118.91 CLIFTON DAVID A 0.000AC 85103 MINER RD YULEE FL 32097 BLOCK 7 LOT 31 R334204 IN OR 724 PG 1094 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1492 42-2N-27-4612-0007-0370 HX 370.49 HUNTER ROBERT H & WENDY L 0.000AC 85163 MINER RD YULEE FL 32097-7256 BLOCK 7 LOT 37 IN OR 1916/1303 R583382 & R583383 YULEE WOODS #2 PB 5/83 & 84 ==================================== 1493 42-2N-27-4613-0001-0110 683.68 HODGSON GARY LEE 0.000AC 726 KENNETH COURT FERNANDINA BEACH FL 32034 BLOCK 1 LOT 11 R498131 OR 1619/1869 CASE #2009-CP-52 YULEE WOODS #3 PB 5/239 ==================================== 1494 42-2N-27-4613-0003-0170 HX 318.63 ROWELL CHRISTOPHER K & 0.000AC ROWELL EVA M 85233 RENIA ST YULEE FL 32097 BLOCK 3 LOT 17 R378414 IN OR 639 PG 228 YULEE WOODS #3 PB 5/239 ==================================== 1495 42-2N-27-4613-0004-0020 1,632.33 DERAWAY JASON L & LORNA J 0.000AC 85352 DUANE RD YULEE FL 32097 BLOCK 4 LOT 2 IN OR 2072/1625 R378399 & R378400 & R433701 YULEE WOODS #3 PB 5/239 ==================================== 1496 42-2N-27-4613-0004-0110 HX 89.56 CARTER ROBERT E JR & 0.000AC CARTER EMILY D (JT/RS) (S&M) 85157 MEGAN STREET YULEE FL 32097 BLOCK 4 LOT 11 R433741 IN OR 1286/1167 YULEE WOODS #3 PB 5/239 ==================================== 1497 42-2N-27-4613-0005-0070 HX 514.98 ALSPAUGH SCOTT A & TINA H 0.000AC 85123 DUANE RD YULEE FL 32097 BLK 5 PT LOTS 7 & 8 IN OR 767/981 YULEE WOODS #3 PBK 5/239 {R673687 & R673688} ==================================== 1498 42-2N-27-4613-0005-0100 609.83 LOVE JIMMIE JO 0.000AC C/O RON RING 490 KEVIN DR ORANGE PARK FL 32073 BLOCK 5 LOT 10 R621636 IN OR 746 PG 1468 YULEE WOODS #4 PB 5/301-302 YULEE WOODS #3 PB 5/239 ==================================== 1499 42-2N-27-4613-0007-0050 660.68 SCOATES GEORGE R 0.000AC 85615 RADIO AVENUE YULEE FL 32097 BLOCK 7 LOT 5 IN OR 684 PG 984 YULEE WOODS #3 PB 5/239 ==================================== 1500 42-2N-27-4613-0007-0090 1,157.18 DIPPY NATHAN A 0.000AC 7701 BAY MEADOWS CIR W #1156 JACKSONVILLE FL 32256 BLOCK 7 LOT 9 IN OR 2044/436 1997 MERI DW/MH YULEE WOODS #3 PB 5/239 ==================================== 1501 42-2N-27-4613-0008-0090 HX 122.90 GARCIA ALEX 0.000AC 85524 RADIO DRIVE YULEE FL 32097 BLOCK 8 LOT 9 1989 HORT SW IN OR 1054/1434 YULEE WOODS #3 PB 5/239 ==================================== 1502 42-2N-27-4613-0008-0190 HX 281.57 HIGHSMITH DANIEL M IV & KAREN 0.000AC 85165 ASHLEY AVENUE YULEE FL 32097 BLOCK 8 LOT 19 R621842 IN OR 739 PG 771 YULEE WOODS #3 PB 5/239 ==================================== 1503 42-2N-27-4613-0008-0220 2,180.52 JONES LARRY K 0.000AC 235 TROUT RIVER DRIVE JACKSONVILLE FL 32208 BLOCK 8 LOT 22 IN OR 1413/782 YULEE WOODS #3 PB 5/239 ==================================== 1504 42-2N-27-4613-0008-0270 649.47 BROWN BRIAN D & DIANIA L 0.000AC 85389 ASHLEY AVE YULEE FL 32097 BLOCK 8 LOT 27 IN OR 1223/1414 HMLCP24091904208A & HMLCP24091904208B YULEE WOODS #3 PB 5/239 ==================================== 1505 42-2N-27-4613-0009-0070 965.33 DAVIS MITCHELL W 0.000AC 409 FIR ST FERNANDINA BEACH FL 32034 BLOCK 9 L0T 7 IN OR 1970/470 R568029 & R568030 YULEE WOODS #3 PB 5/239 ==================================== 1506 42-2N-27-4613-0009-0080 598.54 LYNCH-ORTIZ REBEKAH DIANE & 0.000AC ORTIZ SALVADOR (W&H) 85222 ASHLEY AV YULEE FL 32097 BLOCK 9 LOT 8 IN OR 1912/239 YULEE WOODS #3 PB 5/239 ==================================== 1507 42-2N-27-4613-0009-0090 796.48 YOUMANS JUDITH M BLOUNT EST 0.000AC 85184 ASHLEY AVE YULEE FL 32097 BLOCK 9 LOT 9 1988 OMNI DW/MH IN OR 723 PG 211 YULEE WOODS #3 PB 5/239 ==================================== 1508 42-2N-27-4613-0009-0150 1,267.90 LIVINGSTON JENNIFER T 0.000AC 85024 ASHLEY AVE YULEE FL 32037 BLOCK 9 LOT 15 IN OR 2036/690 & OR 2036/692 R621764 & R621765 YULEE WOODS #3 PB 5/239 ==================================== 1509 42-2N-27-4613-0010-0020 HX 88.00 MATHERS TAMMY L 0.000AC 85376 ROSE MARIE ROAD YULEE FL 32097 BLOCK 10 LOT 2 IN OR 898/666 R583914 & R583915 YULEE WOODS #3 PB 5/239 ==================================== 1510 42-2N-27-4613-0010-0040 827.51 BLAKE RHONDA MOBLEY 0.000AC 97289 PIRATES POINT ROAD YULEE FL 32097 BLOCK 10 LOT 4 R433468 IN OR 1121/648 YULEE WOODS #3 PB 5/239 ==================================== 1511 42-2N-27-4613-0010-0190 HX 441.42 VARGO DAVID JOSEPH & CAROL S 0.000AC 85221 TINYA ROAD YULEE FL 32097 BLOCK 10 LOT 19 IN OR 2018/1424 32620424AX & 32620424BX YULEE WOODS #3 PB 5/239 ==================================== 1512 42-2N-27-4613-0011-0010 764.77 BRUSSELL DON S 0.000AC 86378 CALLAWAY ROAD YULEE FL 32097 BLOCK 11 LOT 1 IN OR 1609/519 1989 SPRI DW/MH YULEE WOODS #3 PB 5/239 ==================================== 1513 42-2N-27-4613-0011-0070 HX 348.55 HUTCHERSON DONALD R & CHERRY L 0.000AC 85200 TINYA ROAD YULEE FL 32097 BLOCK 11 LOT 7 IN OR 920/1904 R433514 & R433515 YULEE WOODS #3 PB 5/239 ==================================== 1514 42-2N-27-4613-0012-0030 HX 681.65 MABE FRANCES J 0.000AC 85449 BROOKE ST YULEE FL 32097 BLOCK 12 LOT 3 IN OR 906/520 R787585 & R787586 YULEE WOODS #3 PB 5/239 ==================================== 1515 42-2N-27-4614-0001-0030 HX 43.80 BUSH TONY R & 0.000AC SIKES DAWN (H&W) 85307 DUANE RD YULEE FL 32097 BLOCK 1 LOT 3 R622383 IN OR 757 PG 877 YULEE WOODS #4 PB 5/301 & 302 ==================================== 1516 42-2N-27-4614-0001-0040 692.07 GROVE NANCY ANN TRUSTEE OF THE 0.000AC NANCY ANN GROVE LIVING TRUST 96082 PARK PLACE FERNANDINA BEACH FL 32034 BLOCK 1 LOT 4 IN OR 2045/1853 R787587 & R787588 YULEE WOODS #4 PB 5/301 & 302 ==================================== 1517 42-2N-27-4614-0001-0060 HX 342.85 OLIVER RUBY E 0.000AC 85247 DUANE ROAD YULEE FL 32097 BLOCK 1 LOT 6 IN OR 1266 PG 1403 1991 HORT TW/MH YULEE WOODS #4 PB 5/301 & 302 ==================================== 1518 42-2N-27-4614-0001-0110 HX 511.62 DAVIS SANDRA A 0.000AC 85513 ASHLEY AV YULEE FL 32097 BLOCK 1 LOT 11 IN OR 1657/1739 & OR 1957/552 2000 FTWD DW YULEE WOODS #4 PB 5/301 & 302 ==================================== 1519 42-2N-27-4614-0001-0120 751.68 DAVIS WILLIAM R EST 0.000AC 85487 ASHLEY AVE YULEE FL 32097 BLOCK 1 LOT 12 IN OR 673 PG 144 R583328/583329 YULEE WOODS #4 PB 5/301-302 ==================================== 1520 42-2N-27-4614-0001-0140 1,956.50 BENDER JOHN A & CYNTHIA J 0.000AC 85726 RADIO AVE YULEE FL 32097 BLOCK 1 LOT 14 IN OR 1931/328 1994 MERIT TW/MH YULEE WOODS #4 PB 5/301 & 302 ==================================== 1521 42-2N-27-4614-0001-0150 HX 472.60 WHITMAN BEVERLY A & 0.000AC WHITMAN DONALD III 85756 RADIO AV YULEE FL 32097-4125 BLOCK 1 LOT 15 IN OR 1528/981 R621625 & R621626 YULEE WOODS #4 PB 5/301 & 302 ==================================== 1522 42-2N-27-4614-0001-0200 HX 447.97 CHRISTMAS CHRISTOPHER & DARLA 0.000AC 85809 RADIO AVE YULEE FL 32097 BLOCK 1 LOT 20 IN OR 1218/392 R672606 & R672607 YULEE WOODS #4 PB 5/301 & 302 ==================================== 1523 42-2N-27-4614-0002-0050 1,574.50 HOOVER TODD S 0.000AC 85220 TERRY ROAD YULEE FL 32097 BLOCK 2 LOT 5 & S20 FT LOT 4 EX S8.08 FT OF LOT 5 DW/MH 2001 HOME OF MERIT IN OR 1723/22 YULEE WOODS #4 PB 5/301 & 302 ==================================== 1524 42-2N-27-4614-0002-0072 48.37 SHEFFIELD WILLIAM F & 0.000AC PHILIPS ELISE & BLACKMON HARRY PO BOX 551669 JACKSONVILLE FL 32255-1669 BLOCK 2 PT LOTS 7 & 6 STORM WATER DRAIN YULEE WOODS #4 PB 5/301 & 302 ==================================== 1525 42-2N-27-4614-0003-0070 592.45 RITTER ELIZABETH ANN 0.000AC PO BOX 611 YULEE FL 32041-0611 BLOCK 3 LOT 7 IN OR 676 PG 190 YULEE WOODS #4 PB 5/301 & 302 ==================================== 1526 42-2N-27-461A-0006-0000 HX 480.07 TAYLOR GREGORY L 0.000AC PO BOX 1266 YULEE FL 32041 TRACT 6 IN OR 899/1343 R672599 & R672600 YULEE WOODS #2-A PB 5/206 ==================================== 1527 43-2N-27-4620-0006-0000 1,409.05 KRZEMINSKI MICHAEL M TRUSTEE 0.000AC OF MEDARD M & ADGELE P 751 PARROT CT KISSIMMEE FL 34759-4536 TRACT 6 IN OR 1385/12 1973 DENMARK DW/MH LOFTON BLUFF SUB PB 4/57 ==================================== 1528 43-2N-27-4620-0022-0000 HX 971.84 HOLLOWAY JESSE & VELEDA 0.000AC 85188 BLACKMON RD YULEE FL 32097 TRACT 22 IN OR 654 PG 86 R672871 & R672873 & R672874 LOFTON BLUFF SUB PB 4/57 ==================================== 1529 43-2N-27-4621-0002-0100 HX 759.00 FRANKLIN W J SR & EMILY D 0.000AC 85370 STEPHEN ROAD YULEE FL 32097 BLOCK 2 LOT 10 IN OR 1096/1750 LOFTON BLUFF 2 PB 4/92 & 93 2003 MERT DW/MH ==================================== 1530 43-2N-27-4621-0002-0150 HX 534.22 SAPP CHARLES L & 0.000AC THOMPSON HEATHER L (JTR0S) 85237 DAVID ROAD YULEE FL 32097 BLOCK 2 LOT 15 IN OR 984 PG 1919 2001 SKYLINE DW/MH LOFTON BLUFF 2 PB 4/92 & 93 ==================================== 1531 43-2N-27-4621-0002-0160 1,136.58 CARPENTER JOHN JR & 0.000AC CARPENTER JENNIFER (JT/RS) 357 NW 87 TERR #457 PLANTATION FL 33324 BLOCK 2 LOT 16 IN OR 2018/592 R621496 & R621497 LOFTON BLUFF 2 PB 4/92 & 93 ==================================== 1532 43-2N-27-4621-0002-0290 798.22 VAN WERT JANE ANN 0.000AC 85128 ANGIE RD YULEE FL 32097 BLOCK 2 LOT 29 IN OR 2116/1561 R359734 & R359735 LOFTON BLUFF 2 PB 4/92 & 93 ==================================== 1533 43-2N-27-4621-0002-0380 592.45 REEVES PROPERTIES INC 0.000AC 86197 CARTESIAN PT DRIVE YULEE FL 32097 BLOCK 2 LOT 38 IN OR 447 PG 722 LOFTON BLUFF 2 PB 4/92 & 93 ==================================== rf rfntb DEL. TAX LIST 2017.indd 10 4/30/18 12:20 PM

PAGE 71

1534 43-2N-27-4621-0003-0080 613.50 MARCUMM MERRI & 0.000AC VANWEY ROBERT LEE & JOHN H & 86040 CLYDE ST YULEE FL 32097 BLOCK 3 LOT 8 R359791 IN OR 1614/236 LOFTON BLUFF #2 PB 4/92 & 93 ==================================== 1535 43-2N-27-4621-0004-0060 1,869.99 STANFIELD LISA & GARY 0.000AC 85375 ANGIE RD YULEE FL 32097 BLOCK 4 LOT 6 IN OR 1992/1442 LOFTON BLUFF 2 PB 4/92 & 93 ==================================== 1536 43-2N-27-4621-0004-0080 694.29 ROBERTSON LOUELLA EST 0.000AC C/O JUDY HORNE 500 TEMPLE CHURCH ROAD KINGSLAND GA 31548 BLOCK 4 LOT 8 R498250 OR 549/40 & OR 733/394 LOFTON BLUFF 2 PB 4/92 & 93 ==================================== 1537 43-2N-27-4621-0005-0040 751.27 BUFORD BOBBY SHEA SHERIDAN & 0.000AC SHERIDAN-BRINKMAN DEBRA J 85669 BLACKMON RD YULEE FL 32097 BLOCK 5 LOT 4 CASE #45-2011-CP-000256 R235953 & R235954 LOFTON BLUFF 2 PB 4/92 & 93 ==================================== 1538 43-2N-27-4621-0005-0050 HX 464.94 GODBOLD CELESTA JEANNINE DAVIS 0.000AC 85635 PHILLIPS ROAD YULEE FL 32097 BLOCK 5 LOT 5 96 CHAD DW/MH IN OR 932/74 LOFTON BLUFF 2 PB 4/92 & 93 ==================================== 1539 43-2N-27-4622-0007-0200 HX 496.04 SHAW ZACHERY K & LINDA V 0.000AC 85357 DICK KING RD YULEE FL 32097 BLOCK 7 LOT 20 IN OR 2057/1535 R108079 & R108078 LOFTON BLUFF 3 PB 4/108 ==================================== 1540 43-2N-27-4622-0007-0400 HX 605.12 SILLS JOHN F JR & ANGELA 0.000AC 85444 HADDOCK ROAD YULEE FL 32097 BLOCK 7 LOT 40 IN OR 929/1417 MH/ID FLHML3B127323265A & FLHML3B127323265B LOFTON BLUFF #3 PB 4/108 ==================================== 1541 43-2N-27-4622-0007-0430 HX 321.85 CHANCEY DANIEL B SR 0.000AC 85528 HADDOCK ROAD YULEE FL 32097 BLOCK 7 LOTS 43 & 44 IN OR 1039/698 & OR 1958/87 R498157 & R498158 LOFTON BLUFF 3 PB 4/108 ==================================== 1542 43-2N-27-4622-0007-0590 724.59 BARRY JAMES K 0.000AC 85581 CLAXTON ROAD YULEE FL 32097 BLOCK 7 LOT 59 R378384 IN OR 940/1789 LOFTON BLUFF 3 PB 4/108 ==================================== 1543 43-2N-27-4622-0008-0140 HX 188.81 WHEELDON CARLTON H & 0.000AC WHEELDON JESSICA D (JT/RS) 85391 PHILLIPS ROAD YULEE FL 32097 BLOCK 8 LOT 14 IN OR 1687/804 R107713 & R107714 LOFTON BLUFF # 3 PB 4/108 ==================================== 1544 43-2N-27-4622-0008-0280 954.90 JONES DWAYNE G & 0.000AC SCOTT JANICE H (JT/RS) 85276 DAVID ROAD YULEE FL 32097 BLOCK 8 LOT 28 IN OR 1540/239 1997 MERI SW/MH LOFTON BLUFF #3 PB 4/108 ==================================== 1545 43-2N-27-4622-0008-0290 HX 390.39 BRANCH WILLIAM E 0.000AC 85030 DICK KING ROAD YULEE FL 32097 BLOCK 8 LOT 29 OR 379/646 EX FPL ESMT OR 401/73 R378484 & R378485 LOFTON BLUFF 3 PB 4/108 ==================================== 1546 43-2N-27-4622-0008-0500 HX 458.47 SAWYER HOYET E & SANDRA R 0.000AC 85644 DICK KING RD YULEE FL 32097 BLOCK 8 LOT 50 R673637 & R673638 IN OR 796 PG 113 LOFTON BLUFF 3 PB 4/108 ==================================== 1547 43-2N-27-4622-0008-0520 1,999.93 LAIRSEY CASEY C & LESLIE A 0.000AC 6941 TONGA DR JACKSONVILLE FL 32216 BLOCK 8 LOT 52 IN OR 1919/504 LOFTON BLUFF 3 PB 4/108 ==================================== 1548 43-2N-27-4622-0009-0240 1,038.29 CARTER CARLTON LEE SR 0.000AC 85172 PHILIPS RD YULEE FL 32097 BLOCK 9 LOT 24 IN OR 1866/900 R359329 & R359330 LOFTON BLUFF #3 PB 4/108 ==================================== 1549 43-2N-27-4622-0009-0280 585.58 TURLINGTON RALPH T & JUDY D 0.000AC 85276 PHILLIPS ROAD YULEE FL 32097 BLOCK 9 LOT 28 R 107774 IN OR 634 PG 1162 LOFTON BLUFF #3 PB 4/108 ==================================== 1550 43-2N-27-4622-0009-0300 1,520.45 HYERS STEVE 0.000AC 85338 PHILLIPS RD YULEE FL 32097 BLOCK 9 LOT 30 IN OR 756 PG 80 R672589 & R672590 & R672591 LOFTON BLUFF 3 PB 4/108 ==================================== 1551 43-2N-27-4622-0009-0340 HX 364.35 JOHNSON WILLIAM M & 0.000AC MEYLE KELLY S 85496 PHILLIPS ROAD YULEE FL 32097 BLOCK 9 LOT 34 93 FLEE SW/MH IN OR 993/204 1/2 HX INT LOFTON BLUFF # 3 PB 4/108 ==================================== 1552 43-2N-27-4640-0035-0000 HX 2,353.32 APPLEWHITE MICHAEL K 0.000AC P O BOX 6177 FERNANDINA BEACH FL 32034 LOT 35 IN OR 960/726 WILSON NECK SUB PB 4/2 ==================================== 1553 43-2N-27-4640-0038-0000 HX 4,744.85 HALL RONALD D & REBECCA D 0.000AC 85712 AVANT ROAD YULEE FL 32097 LOT 38 RP 489 IN OR 679 PG 1900 WILSON NECK SUB PB 4/2 ==================================== 1554 43-2N-27-4640-0046-0000 HX 2,090.95 BELL JAMES GREGORY 0.000AC 85880 AVANT ROAD YULEE FL 32097 LOT 46 IN OR 1263/1972 WILSON NECK SUB PB 4/2 ==================================== 1555 43-2N-27-4641-0001-0150 HX 974.39 WILLIAMS FAMILY LIVING TRUST 0.000AC C/O KATHERINE WILLIAMS 85008 WILSON NECK RD YULEE FL 32097 BLOCK 1 LOT 15 IN OR 1353/1828 WILSON NECK UNIT 2 PB 5/98-101 ==================================== 1556 43-2N-27-4642-0002-0000 2,143.48 MILLER LUTHER M & JANN W 0.000AC 85316 ELISE RD YULEE FL 32097 LOT 2 IN OR 2018/547 WILSON NECK HILLS PB 4/62 ==================================== 1557 43-2N-27-4642-0007-0000 HX 876.34 BROWNING REDDING L/E 0.000AC 85315 WESLEY ROAD YULEE FL 32097 LOTS 7 & 8 IN OR 1999/1515 R673036 & R673037 WILSON NECK HILLS PB 4/62 ==================================== 1558 43-2N-27-4642-0027-0000 HX 84.57 YOUNG MARGERY A & 0.000AC RABER JAMIE M (JTROS) 85208 CUNO CREEK DRIVE YULEE FL 32097 LOT 27 IN OR 960 PG 941 1989 PINE DW/MH WILSON NECK HILLS PB 4/62 ==================================== 1559 43-2N-27-4642-0041-0000 HX 1,045.53 EDWARDS DEBRA L 0.000AC 85262 LINDA RD YULEE FL 32097 LOT 41 IN OR 2044/1289 WILSON NECK HILLS PB 4/62 ==================================== 1560 43-2N-27-4642-0046-0000 620.66 MELVIN KENNETH J III 0.000AC 85126 LINDA RD YULEE FL 32097 LOT 46 R583913 IN OR 1928/783 WILSON NECK HILLS PB 4/62 ==================================== 1561 43-2N-27-4643-0030-0000 HX 489.01 MULLIN HENRY J SR & CLARA L 0.000AC 85344 LANA ROAD YULEE FL 32097 TRACT 30 IN OR 703 PG 102 8D610261NA & 8D610261NB WILSON NECK HILLS 2 UNR ==================================== 1562 43-2N-27-4643-0040-0000 HX 607.31 NELSON BARBARA 0.000AC 85592 LANA ROAD YULEE FL 32097 TRACT 40 IN OR 840/884 & OR 1652/1006 R673919 & R673920 WILSON NECK HILLS 2 UNR ==================================== 1563 43-2N-27-4643-0042-0000 HX 702.03 MOORE JON M 0.000AC 85642 LANA ROAD YULEE FL 32097-8817 TRACT 42 IN OR 702/609 R673030 & R673031 & R673032 WILSON NECK HILLS 2 UNR ==================================== 1564 43-2N-27-4645-0003-0000 715.29 WILSON DAVID GLEN 0.000AC 85011 HARTS RAOD YULEE FL 32097 LOT 3 R568135 IN OR 1729/135 ESMT IN OR 454/178 WILSON NECK PROPERTIES PB 4/60 ==================================== 1565 43-2N-27-4645-0026-0000 HX 466.70 JOHNSON WILLIAM PRESTON 0.000AC 85393 BLACKMON ROAD YULEE FL 32097 LOT 26 IN OR 773 PG 1310 R673929 & R673930 WILSON NECK PROPERTIES PB 4/60 ==================================== 1566 43-2N-27-4647-0006-0130 HX 974.97 CHAIRES TRAVIS & CHRISTINA 0.000AC 85007 CLAXTON RD YULEE FL 32097 BLOCK 6 LOT 13 IN OR 2092/700 1994 FTWD DWMH WILSON NECK LANDING PB 4/71 ==================================== 1567 43-2N-27-4647-0006-0160 HX 633.39 DAVIDSON MELISSA A 0.000AC 85071 CLAXTON ROAD YULEE FL 32097 BLOCK 6 LOT 16 IN OR 776/1977 1993 SKYL DW/MH WILSON NECK LANDING PB 4/71 ==================================== 1568 43-2N-27-4648-0001-0010 HX 604.36 JOHNSON MICHAEL L & JUANITA L 0.000AC 85737 LANA RD YULEE FL 32097 BLOCK 1 LOT 1 IN OR 700 PG 2000 R788205 & R788206 WILSON NECK LANDING 2 PB 4/72 ==================================== 1569 43-2N-27-4648-0001-0070 862.19 HARPE CONNIE D 0.000AC 85074 JESSIE LANE YULEE FL 32097 BLOCK 1 LOT 7 IN OR 721 PG 1909 R408026 & R408027 WILSON NECK LANDING 2 PB 4/72 ==================================== 1570 43-2N-27-4648-0001-0140 HX 282.14 COMPANION ROBERT A & ANA M 0.000AC 85164 SARA ROAD YULEE FL 32097 BLOCK 1 LOT 14 IN OR 453 PG 396 R621659 & R621660 WILSON NECK LANDING 2 PB 4/72 ==================================== 1571 43-2N-27-4648-0001-0160 803.81 JOHNSON MICHAEL & JUANITA 0.000AC 85737 LANA ROAD YULEE FL 32097 BLOCK 1 LOT 16 IN OR 1176/621 R673619 & R673620 WILSON NECK LANDING 2 PB 4/72 ==================================== 1572 43-2N-27-4648-0002-0050 HX 613.81 GRAVES JEFFREY LEE & 0.000AC GRAVES DEBRA M (H&W)(JT/RS) 85113 SARA ROAD YULEE FL 32097-9450 BLOCK 2 LOT 5 IN OR 1460/297 WILSON NECK LANDING 2 PB 4/72 ==================================== 1573 43-2N-27-4648-0002-0060 HX 1,313.20 ADAMS JOHN & LISA & 0.000AC WOODS RUTH EST 85089 SARA ROAD YULEE FL 32097 BLOCK 2 LOT 6 IN OR 1598/1264 1/2 HX INT 2007 TOWN HOME DW/MH ESMT IN OR 448/323 WILSON NECK LANDING 2 PB 4/72 ==================================== 1574 43-2N-27-4648-0002-0070 HX 50.19 WHITEHURST DONNA J 0.000AC 85047 SARA RD YULEE FL 32097 BLOCK 2 LOT 7 IN OR 1510/861 2002 CLAY SW/MH & WILSON NECK LANDING 2 PB 4/72 ==================================== 1575 43-2N-27-4648-0003-0080 836.01 HOFFMAN STEPHEN W & 0.000AC CHERYL A HARPER (JTROS) P O BOX 977 YULEE FL 32041 BLOCK 3 LOT 8 IN OR 816/279 R108115 & 108116 WILSON NECK LANDING 2 PB 4/72 ==================================== 1576 43-2N-27-4648-0003-0140 HX 451.09 MURRAY TAMMY M 0.000AC 85396 CLAXTON RD YULEE FL 32097 BLOCK 3 LOT 14 IN OR 1433/1154 1998 CYPR DW/MH WILSON NECK LANDING 2 PB 4/72 ==================================== 1577 43-2N-27-4648-0005-0060 HX 546.46 GILES JAMES R L/E 0.000AC AMANDA GILES 85162 ALGER ROAD YULEE FL 32097 BLOCK 5 LOT 6 R672689 & R672690 L/E IN OR 836 PG 21 WILSON NECK LANDING 2 PB 4/72 ==================================== 1578 43-2N-27-4648-0005-0190 735.36 MUSFELDT DONALD E & VICTORIA 0.000AC PO BOX 781 YULEE FL 32097 BLOCK 5 LOT 19 IN OR 2075/1752 WILSON NECK LANDING 2 PB 4/72 {R 106779 & R 106780} ==================================== 1579 43-2N-27-4648-0005-0240 620.89 DOSSENBACK MICHAEL L & DEBORAH 0.000AC 116 KIRK RD JACKSONVILLE FL 32218 BLOCK 5 LOT 24 IN OR 1999/1653 WILSON NECK LANDING 2 PB 4/72 ==================================== 1580 43-2N-27-4651-0008-0000 634.41 FOUNTAIN HUBERT RAYMOND 0.000AC 43193 WINDING LANE CALLAHAN FL 32011 TRACT 8 IN OR 483 PG 251 1993 CLAY SW/MH WILSON NECK ROAD UNIT 1 UNR ==================================== 1581 43-2N-27-4651-0014-0000 HX 176.91 SAPP ELLIS JEFFREY 0.000AC 85445 WILSON NECK ROAD YULEE FL 32097 TRACT 14 R378225 & R378226 IN OR 954/1866 WILSON NECK ROAD UNIT 1 UNR ==================================== 1582 43-2N-27-4651-0024-0000 HX 1,281.59 HESSENAUER PHYLLIS & BRIAN 0.000AC 85735 WILSON NECK RD YULEE FL 32097 TRACT 24 IN OR 2062/1728 WILSON NECK ROAD UNIT #1 UNR ==================================== 1583 43-2N-27-4651-0030-0000 HX 363.66 TAYLOR JEFFREY L & KAREN M 0.000AC 85614 WILSON NECK RD YULEE FL 32097 TRACT 30 R378351 & R378352 IN OR 1039/619 WILSON NECK ROAD UNIT 1 UNR ==================================== 1584 43-2N-27-4651-0043-0000 HX 457.76 ANDERSON MICHAEL A & HELEN C 0.000AC 85250 WILSON NECK ROAD YULEE FL 32097 TRACT 43 IN OR 757/776 R672611 & R672612 WILSON NECK ROAD #1 UNR ==================================== 1585 43-2N-27-4651-0046-0000 HX 278.30 TALBOT KAREN E 0.000AC P O BOX 28337 JACKSONVILLE FL 32226 TRACT 46 IN OR 685 PG 1418 R567884 & R567885 WILSON NECK ROAD #1 UNR ==================================== 1586 43-2N-27-4653-0010-0000 548.84 CAMPBELL LISA V 0.000AC PO BOX 212 YULEE FL 32041-0212 LOT 10 IN OR 1099/1537 WILSON NECK ROAD #3 UNR ==================================== 1587 44-2N-27-0000-0001-0090 15,436.82 HARPER CHAPEL LLC 25.960AC PO BOX 1694 CALLAHAN FL 32011 PT HEIRS E WATERMAN MILL GRANT SEC 44-2N-27E IN OR 2092/639 (EX UTIL ESMT IN OR 944/25 & DOT ESMT IN OR 1915/1803) ==================================== 1588 44-2N-27-0000-0001-0200 175.25 STRICKLAND JOHN D & LINDA L 0.350AC 2830 COLERAIN ROAD KINGSLAND GA 31548 PT E WATERMAN MILL GRANT SEC 44-2N-27E IN OR 826/1117 (EX PT IN OR 1205/1158 & PT IN OR 1932/23) ==================================== 1589 44-2N-27-0000-0010-0000 890.33 GILYARD ELIZABETH EST 0.000AC C/O ELIZABETH P DENNISON 462974 SR 200 YULEE FL 32097 PT OF HEIRS OF E WATERMAN GRANT SEC 44-2N-27E IN OR 10/206 (EX R/W IN OR 138/46) FRANK C POWELL JR PLAT UNR ==================================== 1590 37-3N-27-0135-0007-0000 195.72 BELLS RIVER SIX LLC 0.000AC 2712 W JETTON AVE TAMPA FL 33629 LOT 7 IN OR 2110/630 BELLS RIVER EST #2 PB 7/31 ==================================== 1591 37-3N-27-0135-0008-0000 195.72 BELLS RIVER SIX LLC 0.000AC 2712 W JETTON AVE TAMPA FL 33629 LOT 8 IN OR 2110/632 BELLS RIVER EST #2 PB 7/31 ==================================== 1592 37-3N-27-0135-0009-0000 195.72 BELLS RIVER SIX LLC 0.000AC 2712 W JETTON AVE TAMPA FL 33629 LOT 9 IN OR 2110/634 BELLS RIVER EST #2 PB 7/31 ==================================== 1593 37-3N-27-0135-0010-0000 195.72 BELLS RIVER SIX LLC 0.000AC 2712 W JETTON AVE TAMPA FL 33629 LOT 10 IN OR 2110/636 BELLS RIVER EST #2 PB 7/31 ==================================== 1594 37-3N-27-0135-0011-0000 195.72 BELLS RIVER SIX LLC 0.000AC 2712 W JETTON AVE TAMPA FL 33629 LOT 11 IN OR 2110/638 BELLS RIVER EST #2 PB 7/31 ==================================== 1595 37-3N-27-0135-0012-0000 195.72 BELLS RIVER SIX LLC 0.000AC 2712 W JETTON AVE TAMPA FL 33629 LOT 12 IN OR 2110/640 BELLS RIVER EST #2 PB 7/31 ==================================== 1596 37-3N-27-0136-0032-0000 441.32 CLAYTON BUCHANAN BUILDERS INC 0.000AC 914 ATLANTIC AVE STE 1D FERNANDINA BEACH FL 32034-3600 LOT 32 IN OR 1392/1123 BELLS RIVER ESTATES #3 PB 7/116 ==================================== 1597 37-3N-27-4680-0004-0110 727.03 WAREH F 2.830AC 3660 PIZARRO ROAD JACKSONVILLE FL 32217 PT OF LOT 4 IN OR 1932/802 SUB OF HM THIGPEN DB 39/356 ==================================== 1598 37-3N-27-4680-0004-0150 1,236.50 AMERICAN RECOVERY CORPORATION 1.500AC INC OF USA 2200 BAYVIEW ROAD JACKSONVILLE FL 32210 PT OF LOT 4 IN OR 1965/879 1994 SKLY TW/MH SUB OF HM THIGPEN DB 39/356 ==================================== 1599 38-3N-27-4690-0010-0000 HX 494.27 LAWRENCE LYNDA JEAN & 1.520AC BONNIE LOU TOLBERT LITEBORN & 87509 HAVEN ROAD YULEE FL 32097 LOT 10 OR 612/464 & OR 819/365 MH/ID GAFLW75A34279WT21 HAVEN FOREST UNR ==================================== 1600 38-3N-27-4690-0029-0000 HX 517.67 BATTLES TOMMY D III & PAMELA J 1.520AC 87465 ROSES BLUFF ROAD YULEE FL 32097 LOT 29 R583350 & R583351 IN OR 691 PG 660 HAVEN FOREST UNR ==================================== 1601 38-3N-27-4690-0044-0000 891.51 BROWN JUSTIN HEATH 1.500AC 96496 BLACKROCK RD YULEE FL 32097 IN OR 1871/1184 HAVEN FOREST UNR ==================================== 1602 38-3N-27-4690-0053-0010 HX 1,010.23 WILLIAMS LARRY SHELTON 0.000AC 87596 HAVEN ROAD YULEE FL 32097 PT OF LOT 53 IN OR 1541/813 HAVEN FOREST UNR ==================================== 1603 39-3N-27-0000-0001-0030 HX 448.54 DUBBERLY TERRY R & SUSAN H 1.400AC 87118 BROOKER ROAD YULEE FL 32097 IN OR 562/1055 R378284 & R378285 ==================================== 1604 39-3N-27-0000-0001-0060 1,923.54 COVER ALAN B 7.000AC 87667 HAVEN RD YULEE FL 32097 IN 1074/1722 & L/E OR 1852/493 EX 1-31 1975 CHAMP SW ==================================== 1605 39-3N-27-0000-0001-0120 624.69 DONNA LYNNE CUSTOM HOMES INC & YULEE HOME CENTER LLC 1.640AC 474423 STATE ROAD 200 STE 1 FERNANDINA BEACH FL 32034 IN OR 1277/1410 ==================================== 1606 39-3N-27-0000-0001-0300 HX 103.38 MOODY BETTY JO 1.000AC P O BOX 801 YULEE FL 32041 IN OR 1435/45 1988 MANA DWMH EX 1-35 ==================================== 1607 50-3N-27-0000-0001-0050 3,306.52 AZOR PATRICK G & PATRICIA J 10.000AC 86485 PAGES DAIRY RD YULEE FL 32097 PT SEC 50-3N-27E IN OR 2094/1115 ==================================== 1608 50-3N-27-0000-0001-0060 1,669.27 85712 AVANT ROAD YULEE FL 32097 PT E WATERMAN MILL GRANT SEC 50-3N-27E IN OR 1834/1286 ==================================== 1609 50-3N-27-0000-0012-0000 HX 981.35 MOSES WILLIAM HAROLD & KAREN 1.130AC PO BOX 8 YULEE FL 32041 PT E WATERMAN GRANT SEC 50-3N-27E IN OR 1910/1533 BEING PARCELS 1 & 2 ==================================== 1610 50-3N-27-0000-0016-0000 HX 1,607.53 WOODWARD SPALDING & GENEVA 1.880AC 86033 MCKENDREE DR YULEE FL 32097 IN OR 717 PG 851 ==================================== 1611 50-3N-27-0000-0023-0000 2,319.72 ARGOS READY MIX LLC 4.070AC 3015 WINDWARD PKWY STE 300 ALPHARETTA GA 30005 IN OR 1907/1315 ==================================== 1612 50-3N-27-4720-0077-0000 1,985.87 GIBSON ELVA DARLENE L/E 0.000AC 2651 S JUNIPER ST APT 101 FOLEY AL 36535 LOTS 77 & 78 IN OR 2022/1205 NORTH YULEE PB 2/26 ==================================== 1613 50-3N-27-4720-0081-0000 2,904.33 REBELROAMER LLC 0.000AC 851026 US HWY 17 N YULEE FL 32097-2854 LOTS 81 & 82 IN OR 1533/194 NORTH YULEE PB 2/26 ==================================== 1614 50-3N-27-4720-0084-0010 4,574.23 85712 AVANT ROAD YULEE FL 32097 LOTS 83 84 85 & PT LOT 90 IN OR 1834/1286 (EX OR 2006/1546) ESMT OR 491/1087 & OR 492/196 NORTH YULEE PB 2/26 ==================================== 1615 50-3N-27-4720-0106-0010 751.81 STEWART TERRELL L SR & 1.000AC CRAVENER CHRISTINA J (JT/RS) 1624 STEWART AVE FERNANDINA BEACH FL 32034 PT OF LOT 106 IN OR 2046/1071 NORTH YULEE PB 2/26 ==================================== 1616 50-3N-27-4781-0018-0000 441.32 85712 AVANT ROAD YULEE FL 32097 LOT 18 PT OR 1834/1286 YULEE PARK #2 PB 5/60 ==================================== 1617 51-3N-27-0000-0001-0040 HX 378.13 WILKINS RONALD C 1.000AC PO BOX 1752 YULEE FL 32041-1752 IN OR 2087/65 ESMT PT OR 473/322 ESMT IN OR 474/691 EX 1-12 1-16 1-17 & 1-20 R673475 ==================================== 1618 51-3N-27-0000-0001-0200 HX 470.08 KENNEDY MICHAEL & TERESA J 1.000AC 86055 EZELL LANE YULEE FL 32097 IN OR 1071 PG 1939 1995 LIBE SW/MH ==================================== 1619 51-3N-27-0000-0008-0010 2,151.90 PAGE JOHN E & BOBBIE SUE 5.000AC 2633 AMELIA ROAD FERNANDINA BEACH FL 32034 IN OR 1127/877 PARCELS 8-1 & 58 ==================================== 1620 51-3N-27-0000-0013-0100 111.87 MORGAN RUSSELL H JR 0.000AC 463106 SR 200 YULEE FL 32097 IN OR 1409/626 ==================================== 1621 51-3N-27-0000-0017-0000 3,251.84 PORCH SWING PROPERTIES LLC 0.000AC 1832 WOODROW ST AUGUSTA GA 30904 IN OR 1302/1490 RESOLUTION #2012-06 PT OR 1780/1948 ==================================== 1622 51-3N-27-0000-0030-0030 647.60 HICKOX LOIS P EST 1.000AC P O BOX 40 YULEE FL 32041-0040 IN OR 51 PG 75 R334035 & 334036 ==================================== 1623 51-3N-27-0000-0037-0060 HX 755.08 GRAVES CHARLOTTE 2.830AC 86190 PAGES DAIRY ROAD YULEE FL 32097 PT JOHN LOWE MILL GRANT SEC 51-3N-27E IN OR 1515/281 {1998 JACO TW/MH) ==================================== 1624 51-3N-27-0000-0044-0030 547.95 RAINEY LUCILLE ESTATE 0.000AC C/O CAMEIL S JOHNSON 86013 CHARMED WAY YULEE FL 32097 PT JOHN LOWE MILL GRANT SEC 51-3N-27E IN OR 284/570 (EX PT IN OR 729/184) ==================================== 1625 51-3N-27-0000-0053-0010 1,490.23 BLAKE CHRIS & RHONDA 1.000AC 97289 PIRATES POINT ROAD YULEE FL 32097 IN OR 1439/1004 ESMT OR 200/633 ==================================== 1626 51-3N-27-0000-0053-0020 568.76 BLAKE CHRIS & RHONDA 1.000AC 97289 PIRATES POINT ROAD YULEE FL 32097 PT OR 1492/133 R498009 ==================================== 1627 51-3N-27-0000-0053-0040 154.80 BLAKE CHRIS & RHONDA 0.300AC 97289 PIRATES POINT ROAD YULEE FL 32097 PT OR 1492/133 ==================================== 1628 51-3N-27-0000-0060-0040 953.28 BROWN KIMBERLY S & 0.000AC SHEALEY RICHARD N JR & 737 GEIGER ROAD FERNANDINA BEACH FL 32034 IN OR 1716/920 ==================================== 1629 51-3N-27-0000-0066-0010 166.66 KEPNER FRANK & LAURIE P 0.470AC PO BOX 96 YULEE FL 32041-0096 IN OR 1645/180 ==================================== 1630 51-3N-27-0000-0067-0010 HX 899.02 KEPNER FRANK A & LAURIE P 1.700AC PO BOX 96 YULEE FL 32041-0096 IN OR 616 PG 1053 ==================================== 1631 51-3N-27-0000-0067-0020 891.56 KEPNER FRANK & LAURIE B 2.800AC PO BOX 96 YULEE FL 32041-0096 IN OR 734 PG 1563 ==================================== 1632 51-3N-27-0497-0003-0000 HX 601.82 ETHRIDGE LILLIAN B 1.010AC PO BOX 1044 YULEE FL 32041-1044 LOT 3 2002 LEX DW IN OR 786 PG 1163 EZELL ACRES PB 5/326 ==================================== 1633 51-3N-27-0497-0005-0000 510.89 SEWELL ROBERT B & AMY E 1.170AC 1507 SUNNYMEADE DR JACKSONVILLE FL 32211 LOT 5 IN OR 1253/1859 EZELL ACRES PB 5/326 ==================================== 1634 51-3N-27-0497-0006-0000 1,504.78 GROVE NANCY ANN TRUSTEE OF THE NANCY ANN GROVE LIVING TRUST 1.310AC 96082 PARK PLACE FERNANDINA BEACH FL 32034 LOT 6 IN OR 2045/1859 2002 JACO DW/MH EZELL ACRES PB 5/326 ==================================== 1635 51-3N-27-1626-0002-0000 566.74 HALLMARK HOMES INC 0.000AC 8130 BAYMEADOWS CIRCLE W #107 JACKSONVILLE FL 32256 LOT 2 IN OR 1106/1070 ESMT PT OR 1117/1699 PAGE HILL #2 PB 6/318 ==================================== 1636 51-3N-27-1627-0009-0000 3,474.41 STEPHENSON DANIEL M & DAINA H 0.000AC 86961 WORTHINGTON DRIVE YULEE FL 32097 LOT 9 IN OR 2045/1603 PAGE HILL #3 PB 6/341 ==================================== 1637 51-3N-27-1627-0084-0000 HX 1,177.38 BREELAND DONNA R 0.000AC 86842 WORTHINGTON DRIVE YULEE FL 32097 LOT 84 IN OR 1285/590 PAGE HILL #3 PB 6/341 ==================================== 1638 51-3N-27-4800-0006-0000 HX 377.22 PRITCHARD KENNETH C SR & 0.000AC PRITCHARD GLENDA F PO BOX 686 YULEE FL 32041-0686 LOT 6 IN OR 124/149 NASSAU ACRES SUB PB 3/48 ==================================== 1639 51-3N-27-4820-0030-0000 438.67 STUART LOUIS 0.000AC 203 OCEAN FRONT NEPTUNE BEACH FL 32266 LOT 30 PT OR 973/519 NASSAU ACRES 2 PB 3/61 ==================================== 1640 51-3N-27-4820-0031-0000 301.82 STUART LOUIS 0.000AC 203 OCEAN FRONT NEPTUNE BEACH FL 32266 LOT 31 PT OR 973/519 NASSAU ACRES #2 PB 3/61 ==================================== 1641 51-3N-27-4820-0032-0000 318.68 STUART LOUIS 0.000AC 203 OCEAN FRONT NEPTUNE BEACH FL 32266 LOT 32 PT OR 973/519 NASSAU ACRES 2 PB 3/61 ==================================== 1642 51-3N-27-4820-0038-0000 HX 549.05 WILLIAMS EVA M 0.000AC 86054 OAK STREET YULEE FL 32097 LOTS 38 & 39 IN OR 1343/136 2002 CYPRE DW NASSAU ACRES 2 PB 3/61 ==================================== 1643 51-3N-27-4820-0044-0000 HX 365.61 POWELL JOYCE E 0.000AC PO BOX 402 YULEE FL 32041-0402 LOT 44 IN OR 672/1633 NASSAU ACRES #2 PB 3/61 ==================================== 1644 51-3N-27-4840-0017-0000 14,813.11 ALL AMERICAN OIL LLC 0.000AC 380 COMMERCE PKWY ROCKLEDGE FL 32955 LOTS 17 18 & 19 & PARCEL 35 IN OR 2087/516 ESMT IN OR 917/772 EAST YULEE PB 2/29 ==================================== 1645 51-3N-27-4860-000A-0040 526.84 DANIEL MUTT J & 0.000AC BARLOW RICHARD (T/I/C) PO BOX 15321 FERNANDINA BEACH FL 32035 BLOCK A LOT 4 IN OR 1893/300 R433474 FELMORE PARK SUB PB 3/41 ==================================== 1646 51-3N-27-4860-000A-0100 482.25 WINDER VI LLC 0.000AC 18305 BISCAYNE BLVD SUITE 400 AVENTURA FL 33160 BLOCK A LOT 10 IN OR 1643/1510 FELMORE PARK SUB PB 3/41 ==================================== 1647 51-3N-27-4881-0017-0000 509.29 HARRIS CALVIN JR 0.000AC 86237 HILL VALLEY AV YULEE FL 32097 TRACT 17 R433740 IN OR 1913/1631 YULEE HILLS PB 4/31 ==================================== 1648 51-3N-27-4881-0018-0000 565.49 ROYAL DAVID R 0.000AC 85089 SUTTON PL YULEE FL 32097 TRACT 18 IN OR 1935/1386 R433994 & R433995 YULEE HILLS PB 4/31 ==================================== 1649 51-3N-27-4881-0023-0000 689.59 POPE JOHN R JR 0.000AC 86063 HILL VALLEY AVE YULEE FL 32097 TRACT 23 1993 LIBE SW/MH IN OR 1995/160 YULEE HILLS PB 4/31 ==================================== 1650 51-3N-27-4881-0028-0000 1,016.90 TRUJILLO KIMBERLY BELL 0.000AC 86112 HILL VALLEY AVENUE YULEE FL 32097 TRACT 28 IN OR 1677/440 1978 VOGUE/PINE DW/MH YULEE HILLS PB 4/31 ==================================== 1651 51-3N-27-4881-0035-0000 HX 253.83 MIXON DARRELL G & JUDITH A 0.000AC 86326 HILL VALLEY AVE YULEE FL 32097 TRACT 35 IN OR 814/745 MH/ID 10644L & 10644R YULEE HILLS PB 4/31 ==================================== 1652 51-3N-27-4881-0051-0000 943.00 ALLEN MARION J 0.000AC 913 JESS ALLEN RD NAHUNTA GA 31553 TRACT 51 IN OR 420 PG 589 R621593 & R621594 YULEE HILLS PB 4/31 ==================================== 1653 51-3N-27-4881-0055-0000 HX 585.20 MUSIC STEVE 0.000AC 86313 JEAN ROAD YULEE FL 32097 TRACT 55 IN OR 577 PG 544 R672466 & R672467 YULEE HILLS PB 4/31 ==================================== 1654 51-3N-27-4881-0056-0000 HX 486.32 FREEMAN SIDNEY A JR & 0.000AC DOYLE BARBARA & JAMES (JT/RS) 86279 JEAN RD YULEE FL 32097 TRACT 56 1971 GRNDR SW & 2000 HOMD DW IN OR 1777/83 YULEE HILLS PB 4/31 ==================================== 1655 51-3N-27-4881-0072-0000 HX 431.06 OSBORNE GERALDINE 0.000AC 86204 JEAN ROAD YULEE FL 32097 TRACT 72 IN OR 534/82 8D610194N YULEE HILLS PB 4/31 ==================================== 1656 51-3N-27-4881-0075-0000 635.27 HANIFEE JASON & MEGAN 0.000AC 86294 JEAN ROAD YULEE FL 32097 TRACT 75 IN OR 2148/371 R224263 & R224264 YULEE HILLS PB 4/31 ==================================== 1657 51-3N-27-4881-0096-0000 568.56 GUEST VERNON WAYNE EST 0.000AC 86258 TIMBER RIDGE ST YULEE FL 32097-5931 TRACT 96 IN OR 1662/848-853 1977 CHAMP SW/MH YULEE HILLS PB 4/31 ==================================== 1658 51-3N-27-4881-0107-0000 HX 225.13 BELLAR LEAH 0.000AC 86374 YULEE HILLS ROAD YULEE FL 32097 TRACT 107 IN OR 603 PG 41 & CASE #09-DR-567 OR 1631/1233 R360300 & R434001 YULEE HILLS PB 4/31 ==================================== 1659 51-3N-27-4881-0129-0000 HX 236.45 LEE DANIEL FLETCHER & 0.000AC LEE CAITLIN & BRITTANY (JT/RS) 86272 YULEE HILLS RD YULEE FL 32097 TRACT 129 1994 SW/MH GENE IN OR 1925/1222 YULEE HILLS PB 4/31 ==================================== 1660 51-3N-27-4881-0130-0000 564.12 POTTS HERBERT MICHAEL 0.000AC 86262 YULEE HILLS RD YULEE FL 32097 TRACT 130 IN OR 732/794 YULEE HILLS PB 4/31 ==================================== 1661 51-3N-27-4881-0151-0000 HX 125.95 MILLAN ERNEST H JR & GWEN 0.000AC 86445 TIMBER RIDGE RD YULEE FL 32097 PT TRACT A IN OR 692/371 YULEE HILLS PBK 4/31 {A/K/A UNR TRACT 151 OF TRACT A} ==================================== 1662 51-3N-27-4881-0152-0000 HX 341.96 HALE DENNIS MICHAEL 0.000AC 86419 TIMBER RIDGE RD YULEE FL 32097 PT TRACT A IN OR 501/739 YULEE HILLS PBK 4/31 {A/K/A UNR TRACT 152 OF TRACT A} ==================================== 1663 51-3N-27-4881-0156-0000 666.44 WHITE THERESA 0.000AC 86299 TIMBER RIDGE STREET YULEE FL 32097 PT TRACT A IN OR 758/270 YULEE HILLS PBK 4/31 {A/K/A UNR TRACT 156 OF TRACT A} ==================================== 1664 51-3N-27-4881-0179-0000 543.64 RUSS LISA VALERIE & 0.000AC KINDT CHARLES & DALE S (T/I/C) 85057 MINER RD YULEE FL 32097 PT TRACT A PT OR 966/500 YULEE HILLS PBK 4/31 {A/K/A UNR TRACT 179 OF TRACT A} ==================================== 1665 52-3N-27-0000-0002-0150 1,490.95 THEOBALD THOMAS A & MONA R 0.000AC 96568 CALHOUN RD FERNANDINA BEACH FL 32034 IN OR 1408/232 R360206 & R360207 ==================================== 1666 52-3N-27-0000-0002-0330 2,747.18 GREEN HARRY E JR 1.230AC 86456 HARRY GREEN RD YULEE FL 32097 PT OF JOHN VAUGHAN GRANT SEC 52-3N-27E IN OR 960/317 & OR 1943/899 ==================================== 1667 52-3N-27-0000-0002-0360 1,937.93 MAYHAN SHANNON M 1.170AC 86015 RON NELSON LN YULEE FL 32097 IN OR 1902/1516 R434307 & R434308 ==================================== 1668 52-3N-27-0000-0002-0650 480.05 677 FERN ST JACKSONVILLE FL 32206 IN OR 2135/289 ==================================== 1669 52-3N-27-4890-0002-0000 HX 517.35 WILLIAMSON MARY J 0.000AC 86126 HARRY GREEN ROAD YULEE FL 32097 LOT 2 IN OR 703 PG 1945 R816016 & R816017 & R816018 W H FLOOD SURVEY UNR ==================================== 1670 52-3N-27-4890-0017-0000 1,009.21 LIGHTSEY MICHAEL & 0.000AC TRUMAN LAURINDA & JAMES 86402 HARRY GREEN ROAD YULEE FL 32097 LOT 17 R498163 IN OR 1532/1765 ESMT OR 1035/1362 W H FLOOD SURVEY UNR ==================================== 1671 52-3N-27-4890-0018-0000 791.97 CRUMP LESLIE LANDRUM 1.710AC 85125 RADIO AVE YULEE FL 32097 LOT 18 (EX 18-1) IN OR 791/1057 RP 1572 & 1573 FLOOD SURVEY UNR SUB ==================================== 1672 52-3N-27-4890-0026-0010 HX 100.50 WILLIAMS MARK J & 0.000AC DURAN DEBORAH C (JT/RS) 86086 BLADON ROAD YULEE FL 32097 N1/2 OF LOT 26 IN OR 1298/389 FLOOD SURVEY UNR 1977 PINE SWMH ==================================== 1673 13-2N-28-0000-0002-0080 53.32 CLARINET I LLC 1.280AC 18305 BISCAYNE BLVD SUITE 400 AVENTURA FL 33160 OPEN SPACE & PT ABANDONED SANCHEZ RD RESOLUTION PER OR 106/668 IN OR 1696/738 EX 2-17 ==================================== 1674 14-2N-28-0000-0005-0000 HX 3,680.78 HOLLIDAY JOHN F 5.000AC 5162 FIRST COAST HIGHWAY FERNANDINA BEACH FL 32034 IN OR 1654/1419 ==================================== 1675 14-2N-28-0000-0007-0000 215.09 FOSTER MARY & PAMELIA 0.000AC 816 VERNON ST FERNANDINA BEACH FL 32034 LOT 3 IN OR 123/111 WILLIE B WILLIAMS SUB OR 77/122 ==================================== 1676 14-2N-28-0000-0007-0050 561.68 EMORY EUGENE K 0.000AC 5576 GREEG ST FERNANDINA BEACH FL 32034 PT GOVT LOT 2 OF SEC 14-2N-28E IN OR 1097/333 ==================================== 1677 14-2N-28-0000-0007-0060 640.07 EMORY EUGENE K 0.000AC 5576 GREEG ST FERNANDINA BEACH FL 32034 PT GOVT LOT 2 OF SEC 14-2N-28E IN OR 1079/39 BEING ONLY ELY 62.5 FT LYING N OF LANDS PLATTED IN OR 77/122 ==================================== 1678 14-2N-28-0000-0007-0110 215.09 EMORY EUGENE K 0.000AC 5576 GREEG ST FERNANDINA BEACH FL 32034 PT GOVT LOT 2 OF SEC 14-2N-28E IN OR 1092/215 ==================================== 1679 14-2N-28-0000-0007-0170 215.09 TINER JAMES P 0.000AC 1448 IAN DR FERNANDINA BEACH FL 32034 LOT 9 IN OR 1791/1341 WILLIE B WILLIAMS SUB OR 77/122 ==================================== 1680 14-2N-28-0000-0007-0190 215.09 TINER JAMES P 0.000AC 1436 IAN DR FERNANDINA BEACH FL 32034 LOT 8 IN OR 1977/1161 WILLIE B WILLIAMS SUB OR 77/122 ==================================== 1681 14-2N-28-0000-0008-0000 232.08 EMORY EUGENE K 0.000AC 5576 GREEG ST FERNANDINA BEACH FL 32034 PT GOVT LOT 2 OF SEC 14-2N-28E IN OR 1079/39 BEING ONLY WLY 75 FT LYING N OF LANDS PLATTED IN OR 77/122 ==================================== 1682 24-2N-28-0000-0002-0020 200.58 HUGHES PATRICIA A 1.000AC 445 WEBS RD KINGSTREE SC 29556-7632 IN OR 1703/701 CASE #10-CP-185 R107809 ==================================== 1683 24-2N-28-0000-0005-0000 947.81 ALDERMAN ANTHONY & 1.130AC HOLZENDORF MAMIE LOU 96157 NORTH PRINCE DR YULEE FL 32097 IN OR 1737/890 R497752 ==================================== 1684 24-2N-28-0000-0006-0000 HX 285.46 ALDERMAN ANTHONY 1.000AC 96157 NORTH PRINCE DRIVE YULEE FL 32097 PT GOVT LOT 3 OF SEC 24-2N-28E IN OR 1723/549 ==================================== 1685 24-2N-28-0000-0007-0000 175.25 ALBERTIE DOLPHUS SR EST 0.000AC C/O ALDOLPHUS ALBERTIE JR 8309 DALESFORD ROAD PARKVILLE MD 21234 PT GOVT LOT 3 OF SEC 24-2N-28E IN OR 680/448 ==================================== 1686 24-2N-28-0000-0007-0010 HX 614.68 ALBERTIE THELMA W 0.000AC C/O BERTHA FLEMMING 2040 SOUTEL DRIVE JACKSONVILLE FL 32208 PT GOVT LOT 3 OF SEC 24-2N-28E IN OR 670/846 ==================================== 1687 24-2N-28-0000-0011-0000 1,093.77 BAKER SYDNEY & ANGELA (JT/RS) & BAKER STEVE ET AL 0.000AC 96079 NORTH PRINCE DR YULEE FL 32097 PT GOVT LOT 3 OF SEC 24-2N-28E IN OR 1032/45 (EX UTIL ESMT IN OR 863/1524) ==================================== 1688 24-2N-28-0000-0017-0010 1,177.78 HOLZENDORF QUINN EST 0.000AC C/O ANTHONY ALDERMAN 96157 NORTH PRINCE DR YULEE FL 32097 PT GOVT LOT 3 OF SEC 24-2N-28E IN OR 90/534 (EX DOT R/W IN OR 206/59) ==================================== 1689 24-2N-28-0000-0020-0000 HX 3,394.53 SOLOMON CLAUDIA H EST 0.000AC C/O JAMES THOMAS P O BOX 24 YULEE FL 32041-0024 PT GOVT LOT 3 OF SEC 24-2N-28E IN OR 144/514 & OR 244/314 & OR 244/317 (EX R/W OR 201/583) ==================================== rf rfntb DEL. TAX LIST 2017.indd 11 4/30/18 12:20 PM

PAGE 72

1690 24-2N-28-0000-0037-0000 280.86 WATSON FRANK EST 0.000AC C/O THELMA ALBERTIE 2040 SOUTEL DRIVE JACKSONVILLE FL 32208 PT GOVT LOT 3 PAR 37 IN DB 122/29 (EX R/W OR 199/540) ==================================== 1691 24-2N-28-0000-0038-0050 253.32 GOLPHIN ESTELLA B 0.000AC C/O VIVIEN E YOUNG 11730 TORTOISE WAY NORTH JACKSONVILLE FL 32218 PT GOVT LOT 3 PAR 38-5 IN OR 1323/1768 ==================================== 1692 24-2N-28-4940-0005-0000 HX 436.83 GILYARD TORRIE & 0.000AC GILYARD ALLEAN D (JT/RS) 96025 ZION CT YULEE FL 32097 LOT 5 PT OR 1605/1768 G A PRINCE SURVEY OR 15/534 ==================================== 1693 24-2N-28-4940-0013-0000 175.25 DEMPS OSTEEN JR & MILDRED 0.000AC 225 S 13TH STREET FERNANDINA BEACH FL 32034 LOT 13 PT OR 585/355 G A PRINCE SURVEY OR 15/534 ==================================== 1694 24-2N-28-4940-0014-0000 175.25 DEMPS OSTEEN JR & MILDRED 0.000AC 225 S 13TH STREET FERNANDINA BEACH FL 32034 LOT 14 PT OR 585/355 GA PRINCE SURVEY OR 15/534 ==================================== 1695 24-2N-28-4940-0015-0000 670.53 DEMPS OSTEEN JR & MILDRED 0.000AC 225 S 13TH STREET FERNANDINA BEACH FL 32034 LOT 15 PT OR 585/355 EX R/W OR 207 PG 325 G A PRINCE SURVEY OR 15/534 ==================================== 1696 24-2N-28-4940-0016-0000 620.88 DEMPS OSTEEN JR & MILDRED 0.000AC 225 S 13TH STREET FERNANDINA BEACH FL 32034 LOT 16 PT OR 585/355 EX R/W OR 207 PG 325 G A PRINCE SURVEY OR 15/534 ==================================== 1697 25-2N-28-0000-0001-0050 3,538.03 HARTLEY JAMES E 11.420AC 9140 BON AIR DR JACKSONVILLE FL 32218 IN OR 1834/653 PARCELS 1-5 1-12 & 1-13 ==================================== 1698 25-2N-28-0000-0002-0030 87.55 BRASWELL ENTERPRISES II INC 17.490AC PO BOX 735 FERNANDINA BEACH FL 32035-0735 IN OR 1254/1682 EX BLACKROCK ESTATES PB 5/57 ==================================== 1699 25-2N-28-0000-0002-0280 403.26 LOFTON POINTE INC 9.070AC 11555 CENTRAL PARKWAY SUITE 801 JACKSONVILLE FL 32224 PT OR 963/1580 & PT 963/1590 EX 2-78 ESMT PT OR 1127/1783 ESMT PT OR 1333/365 EX ESMT PT OR 1449/848 ==================================== 1700 25-2N-28-0000-0002-0400 5,717.26 HARRISON GEORGE WAYNE 0.000AC 3000 NORTH ATLANTIC AVE #14 DAYTONA BEACH FL 32118 IN OR 802 PG 783 RECIPROCAL ESMT PT OR 803/1773 ESMT OR 1457/909 ==================================== 1701 25-2N-28-0000-0002-0720 471.12 TREVETT FAMILY COMPANIES INC 4.470AC PO BOX 706 FERNANDINA BEACH FL 32035 PT OR 971/1311 & PT 963/1593 ==================================== 1702 25-2N-28-0000-0002-0730 800.20 TREVETT FAMILY COMPANIES INC 7.820AC PO BOX 706 FERNANDINA BEACH FL 32035 PT OR 971/1311 & PT 963/1593 ESMT PT OR 1127/1783 EX ESMT PT OR 1449/848 ==================================== 1703 25-2N-28-027C-0808-0000 2,127.70 CAMPO RICHARD & ANGELA 0.000AC 9202 STONEY MOUNTAIN DRIVE CHATTANOOGA TN 37421 UNIT 808 IN OR 1697/809 THE COTTAGES AT STONEY CREEK CONDO OR 1518/1834 ==================================== 1704 25-2N-28-027C-1101-0000 2,127.70 DEAVER RAYMON T LIVING TRUST 0.000AC JEANETTE LANGEVIN CO-TRUSTEE 2365 LAKE AVENUE THORTON CO 80241 UNIT 1101 IN OR 2011/1809 THE COTTAGES AT STONEY CREEK OR 1518/1834 ==================================== 1705 25-2N-28-027C-1307-0000 2,078.59 DEAVER RAYMON T LIVING TRUST 0.000AC JEANETTE LANGEVIN CO-TRUSTEE 2365 LAKE AVENUE THORTON CO 80241 UNIT 1307 IN OR 2011/1809 THE COTTAGES AT STONEY CREEK OR 1518/1834 ==================================== 1706 25-2N-28-027C-1404-0000 2,127.70 LATZA SABINE DOROTHEE 0.000AC 2402 S WINONA COURT DENVER CO 80219 UNIT 1404 IN OR 2148/347 THE COTTAGES AT STONEY CREEK OR 1518/1834 ==================================== 1707 25-2N-28-027C-2607-0000 2,078.59 DEAVER RAYMON T LIVING TRUST 0.000AC JEANETTE LANGEVIN CO-TRUSTEE 2365 LAKE AVENUE THORNTON CO 80241 UNIT 2607 IN OR 2011/1809 THE COTTAGES AT STONEY CREEK OR 1518/1834 ==================================== 1708 25-2N-28-027C-2702-0000 2,078.59 CAMPO RICHARD & ANGELA 0.000AC 9202 STONEY MOUNTAIN DRIVE CHATTANOOGA TN 37421 UNIT 2702 IN OR 1710/1261 THE COTTAGES AT STONEY CREEK OR 1518/1834 ==================================== 1709 25-2N-28-0551-0067-0000 4,178.96 ROSS WILLIAM L 0.000AC 33119 SUNNY PARKE CIRCLE FERNANDINA BEACH FL 32034 LOT 67 IN OR 2018/204 FLORA PARKE #3 PB 6/402 ==================================== 1710 26-2N-28-006A-0068-0000 2,720.65 WEEKLEY HOMES LP 0.000AC 1235 NORTH LOOP WEST STE 205 HOUSTON TX 77008 LOT 68 IN OR 2003/1820 AMELIA NATIONAL #1 PB 7/48 ==================================== 1711 26-2N-28-006A-0127-0000 2,761.59 WEEKLEY HOMES LP 0.000AC 1235 NORTH LOOP WEST STE 205 HOUSTON TX 77008 LOT 127 IN OR 2003/1820 AMELIA NATIONAL #1 PB 7/48 ==================================== 1712 26-2N-28-006A-0145-0000 HX 4,156.35 GOWER JAMES N & VALENCIA D 0.000AC 95012 SUNFLOWER COURT FERNANDINA BEACH FL 32034 LOT 145 IN OR 1855/208 AMELIA NATIONAL #1 PB 7/48 ==================================== 1713 26-2N-28-006A-0223-0000 6,814.52 HEIDER JEANETTE D 0.000AC 604 OCEAN CLUB CT FERNANDINA BEACH FL 32034 LOT 223 IN OR 1600/216 AMELIA NATIONAL #1B PB 7/191 ==================================== 1714 26-2N-28-006A-0262-0000 2,570.05 WEEKLEY HOMES LP 0.000AC 1235 NORTH LOOP WEST STE 205 HOUSTON TX 77008 LOT 262 PT OR 1421/1082 AMELIA NATIONAL #1B PB 7/191 ==================================== 1715 26-2N-28-168P-0003-0000 2,475.07 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 3 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1716 26-2N-28-168P-0004-0000 2,475.07 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 4 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1717 26-2N-28-168P-0005-0000 2,475.07 ADVANTAGE HOMEBUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 5 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1718 26-2N-28-168P-0006-0000 2,475.07 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 6 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1719 26-2N-28-168P-0007-0000 2,475.07 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 7 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1720 26-2N-28-168P-0008-0000 2,475.07 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 8 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1721 26-2N-28-168P-0011-0000 2,802.52 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 11 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1722 26-2N-28-168P-0012-0000 2,802.52 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 12 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1723 26-2N-28-168P-0013-0000 2,475.07 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 13 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1724 26-2N-28-168P-0014-0000 2,475.07 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 14 IN OR 1976/675 DECL COV & RESTR OR 1458/887 PRIVATE QUARTERS PB 7/175 ==================================== 1725 27-2N-28-0000-0004-0000 5,406.24 BRADDOCK DALE P & CAROL E 0.000AC PO BOX 511 CALLAHAN FL 32011 IN OR 710 PG 160 EX R/W IN OR 674/1035 EX 4-1 ESMT OR 1457/945 ==================================== 1726 27-2N-28-004L-0127-0000 1,192.17 RBF TRUST 0.000AC FLEISCHER RICHARD TRUSTEE ETAL 3350 S FLETCHER AV #10 FERNANDINA BEACH FL 32034 UNIT 127 IN OR 1955/1210 AMELIA LAKES @ FDNA BEACH CONDO OR 1344/1628 ==================================== 1727 27-2N-28-004L-0G22-0000 113.87 AMELIA INVEST LLC 0.000AC 201 E MCBEE AVE SUITE 202 GREENVILLE SC 29601-2886 GARAGE UNIT G-22 AMELIA LAKES @ FDNA BEACH CONDO OR 1344/1628 ==================================== 1728 27-2N-28-004L-0G30-0000 113.87 AMELIA INVEST LLC 0.000AC 201 E MCBEE AVE SUITE 202 GREENVILLE SC 29601-2886 GARAGE UNIT G-30 AMELIA LAKES @ FDNA BEACH CONDO OR 1344/1628 ==================================== 1729 27-2N-28-004L-1222-0000 1,278.65 ANDREWS WALTER F & VIRGINIA J 0.000AC 95366 ARBOR LANE FERNANDINA BEACH FL 32034 UNIT 1222 IN OR 1382/220 AMELIA LAKES @ FDNA BEACH CONDO OR 1344/1628 ==================================== 1730 27-2N-28-004L-1524-0000 1,423.67 LINDSAY DEBORAH L 0.000AC 24 WATER STREET LUBEE ME 04652 UNIT 1524 IN OR 2070/251 AMELIA LAKES @ FDNA BEACH CONDO OR 1344/1628 ==================================== 1731 27-2N-28-014A-0006-0000 HX 350.34 ERICKSON KATHY L & 0.000AC SOWELL NOLAN C (JT/RS) 23722 ARRIGO BLVD FERNANDINA BEACH FL 32034 LOT 6 IN OR 1765/803 BEACHWAY @ NASSAU LAKE 1-A PB 6/199 ==================================== 1732 27-2N-28-014A-000A-0000 59.02 W R HOWELL COMPANY 1.650AC 4545 ORTEGA BLVD JACKSONVILLE FL 32210 FOR INFO ONLY COMMON ELEMENT PROPERTY HB1721 TRACT A PT OR 1623/505 (EX CNSVTN ESMT OR 971/282) BEACHWAY @ NASSAU LAKE 1-A PBK 6/199 ==================================== 1733 27-2N-28-014A-000B-0000 74.08 W R HOWELL COMPANY 2.570AC 4545 ORTEGA BLVD JACKSONVILLE FL 32210 FOR INFO ONLY COMMON ELEMENT PROPERTY HB1721 TRACT B PT OR 1623/505 BEACHWAY @ NASSAU LAKE 1-A PBK 6/199 ==================================== 1734 27-2N-28-141A-0004-0010 HX 1,383.13 CARTRETTE GARY & JENNIFER L 0.000AC 96029 PARLIAMENT DRIVE FERNANDINA BEACH FL 32034 BLOCK 4 LOT 1 IN OR 1309/1560 & OR 1424/1650 NASSAU LAKES PB 5/70 ==================================== 1735 28-2N-28-0000-0002-0000 HX 1,410.99 HEAPE BARBARA L 3.500AC 95139 RANCH WAY FERNANDINA BEACH FL 32034 PT FRAC SEC 28-2N-28E PT OR 696/574 ESMT PT OR 518/810 {1985 DUTCH DW/MH} ==================================== 1736 29-2N-28-0000-0002-0040 1,341.80 D R HORTON INC-JACKSONVILLE 4.000AC 4220 RACE TRACK RD STE 100 ST JOHNS FL 32259 PT SEC 30-2N-28E PT OR 2010/1594 BEING PARCEL B ==================================== 1737 29-2N-28-4950-0020-0000 HX 686.07 BOONE DANIEL LEE & SHIRLEY ANN 2.080AC 95199 MARC ANTHONY ROAD FERNANDINA BEACH FL 32034 LOTS 20 & 21 IN OR 703 PG 1353 R788167 & R788168 ESMT IN OR 361 PG 543 EX R/W OR 400/807 SUB OF GOV LOT 2 UNR ==================================== 1738 30-2N-28-0150-0095-0000 HX 4,351.11 HICKOX EPHRIAM 0.000AC 85352 AMARYLLIS CT FERNANIDNA BEACH FL 32034 LOT 95 IN OR 1897/187 AMELIA CONCOURSE SUB #1 PB 7/183 ==================================== 1739 31-2N-28-0000-0003-0090 HX 736.40 WORTMAN VICKIE 1.860AC 95274 CATALINA DRIVE FERNANDINA BEACH FL 32034 IN OR 1583/1318 2000 FLEE DW/MH 1986 ARLI DW/MH FPL ESMT OR 333 PG 769 EX R/W IN OR 375/651 ==================================== 1740 31-2N-28-0000-0003-0170 658.17 COLLINS MARYANN 1.360AC P O BOX 1762 YULEE FL 32041 PT OF SW1/4 OF SW1/4 IN OR 1602/1264 1997 OAKK DW/MH FPL ESMT OR 333/768 EX R/W IN OR 375/651 ==================================== 1741 31-2N-28-0000-0003-0190 HX 130.71 THOMAS MARIANNE 1.230AC 95393 KAREN WALK FERNANDINA BEACH FL 32035 IN OR 1933/165 1997 GNRL SW/MH ==================================== 1742 31-2N-28-0235-0004-0000 HX 508.85 DEJESUS LUIS & LINDA 1.000AC 95232 BARBARAS PLACE FERNANDINA BEACH FL 32034 LOT 4 R673359 & R673360 IN OR 842/1332 CEDAR RIDGE #1 PB 6/95 ==================================== 1743 31-2N-28-0235-0005-0000 HX 875.86 HAYS ANN M 2.000AC 95260 BARBARAS PL FERNANDINA BEACH FL 32034 LOT 5 & PT GOVT LOT 2 OF SEC 35-2N-28E IN OR 1740/1277 CEDAR RIDGE #1 PBK 6/95 {1999 FTWD DW/MH} ==================================== 1744 31-2N-28-0235-0012-0000 1,140.98 SANDERS LUANN L 1.000AC 95466 BARBARAS PL FERNANDINA BEACH FL 32034 LOT 12 IN OR 1365/999 R673080 & R673081 CEDAR RIDGE #1 PB 6/95 ==================================== 1745 31-2N-28-1400-0007-0010 677.59 WEAVER RICHARD D & AMANDA 1.000AC 811 GA HWY 247 SOUTH KATHLEEN GA 31047 IN OR 1485/1057 1985 CHAL DW/MH MOBLEY HEIGHTS NORTH PB 5/146 ==================================== 1746 31-2N-28-1600-0001-0000 HX 208.03 WRIGHT MARY 1.020AC 95056 GENTRY LANE FERNANDINA BEACH FL 32034 LOT 1 IN OR 1499/1763 1996 COUG DW/MH OAK HILL EST #1 PB 5/90 & 91 ==================================== 1747 31-2N-28-1600-0002-0000 HX 149.13 HOETZLEIN TIMOTHY J & SUSAN C 1.020AC 95030 GENTRY LANE FERNANDINA BEACH FL 32034 LOT 2 IN OR 699 PG 756 R788155 & R788156 OAK HILL EST #1 PB 5/90 & 91 ==================================== 1748 31-2N-28-1600-0003-0000 772.99 ROLSTON KRISTIN P & 1.620AC HILL TAWANNA MARIE (JT/RS) 95587 LEO DRIVE FERNANDINA BEACH FL 32034 LOT 3 IN OR 1081/567 OAK HILL EST #1 PB 5/90 & 91 ==================================== 1749 31-2N-28-1600-0015-0000 HX 606.07 HALL JESSIE LEE & BRENDA S 1.020AC 95304 LEO DR FERNANDINA BEACH FL 32034 LOT 15 IN OR 689 PG 529 R787515 R787516 & R787517 OAK HILL EST #1 PB 5/90 & 91 ==================================== 1750 31-2N-28-1600-0020-0000 516.11 MAXELL DANNY L 1.020AC 95055 JUSTIN CT FERNANDINA BEACH FL 32034 LOT 20 IN OR 935/1078 OAK HILL EST #1 PB 5/90 & 91 ==================================== 1751 31-2N-28-1600-0027-0000 HX 120.95 LANE SANDRA L 1.040AC 95547 KAREN WALK FERNANDINA BEACH FL 32034 LOT 27 IN OR 2098/1331 R433592 & R433593 OAK HILL EST #1 PB 5/90 & 91 ==================================== 1752 31-2N-28-1600-0036-0000 HX 201.48 CAPALLIA RALPH F 1.010AC 95171 LEO DRIVE FERNANDINA BEACH FL 32034 LOT 36 IN OR 758 PG 722 1980 FIES DW/MH OAK HILL EST #1 PB 5/90 & 91 ==================================== 1753 31-2N-28-1600-0045-0000 HX 66.95 WADE ELEANOR MAUREEN & 1.010AC WADE MICHAEL DAVID (M&S) 95443 LEO DRIVE FERNANDINA BEACH FL 32034 LOT 45 R359788 IN OR 1030/1472 OAK HILL EST #1 PB 5/90 & 91 ==================================== 1754 31-2N-28-1601-0031-0000 556.04 JENKINS DEAH LYNN 1.010AC P O BOX 15774 FERNANDINA BEACH FL 32035 LOT 31 R408011 & R408012 IN OR 1864/153 OAK HILL ESTATES #2 PB 5/134 ==================================== 1755 31-2N-28-1601-0057-0000 HX 103.00 GRIFFIN TIMOTHY M 1.280AC 95068 HENDRICKS RD FERNANDINA BEACH FL 32034 LOT 57 IN OR 747/519 R359840 & R359841 OAK HILL ESTATES #2 PB 5/134 ==================================== 1756 31-2N-28-1875-0001-0060 HX 1,123.46 OAKES MICHAEL A & BARBARA J 0.000AC 95135 WILDWOOD CIRCLE FERNANDINA BEACH FL 32034 BLOCK 1 LOT 6 IN OR 904/43 ROSEWOOD MEADOWS #1 PB 5/314 ==================================== 1757 31-2N-28-1875-0004-0010 HX 1,182.37 EVANS WILLIAM P JR & JENNIFER 0.000AC 95025 GREENBERRY RD FERNANDINA BEACH FL 32034 BLOCK 4 LOT 1 IN OR 1825/977 ROSEWOOD MEADOWS #1 PB 5/314 ==================================== 1758 31-2N-28-4955-0001-0020 HX 258.13 KNOX MATTHEW 0.000AC 95066 JUSTIN COURT FERNANDINA BEACH FL 32034 BLOCK 1 LOT 2 IN OR 1585/243 1977 SATI DW/MH WILLOW BRANCH ACRES PB 4/58 ==================================== 1759 31-2N-28-4955-0001-0090 638.56 MAXWELL DANNY L & ELIZABETH 0.000AC 95055 JUSTIN CT FERNANDINA BEACH FL 32034 BLOCK 1 LOT 9 R621465 & R621466 IN OR 998/1289 WILLOW BRANCH ACRES PB 4/58 ==================================== 1760 31-2N-28-4955-0003-0060 658.42 HOETZLEIN SUSAN C & 0.000AC WELSH BARBARA & LINDA S CUDA & 95030 GENTRY LANE FERNANDINA BEACH FL 32034 BLOCK 3 LOT 6 IN OR 1211/196 R673911 & R673912 WILLOW BRANCH ACRES PB 4/58 ==================================== 1761 31-2N-28-4955-0003-0080 HX 398.82 JOHNSON MATTHEW BRANDON 0.000AC 95398 PLUM LOOP FERNANDINA BEACH FL 32034 BLOCK 3 LOT 8 IN OR 1966/1875 R236053 & R236052 WILLOW BRANCH ACRES PB 4/58 ==================================== 1762 31-2N-28-4955-0004-0020 HX 216.66 HULS CHARLES T & 0.000AC NEW SHIRLEY(JT/RS) 95161 GENTRY LN FERNANDINA BEACH FL 32034 BLOCK 4 LOT 2 R236099 IN OR 2027/1240 WILLOW BRANCH ACRES PB 4/58 ==================================== 1763 32-2N-28-0000-0009-0000 HX 543.76 BOATRIGHT CYNTHIA K & JOHNNY P 1.340AC 95083 BLUE LANE FERNANDINA BEACH FL 32034 PT S1/2 OF NE1/4 OF SE1/4 OF NW1/4 IN OR 833/72 R673380 & R673381 ==================================== 1764 32-2N-28-0000-0012-0100 HX 417.33 DELILLE DERRICK ANDREW 1.470AC 95054 ORIOLE STREET FERNANDINA BEACH FL 32034 IN OR 942 PG 1962 12-10 & 12-2 1985 SCOT DW ==================================== 1765 32-2N-28-0000-0015-0000 326.75 BRIGHT LIGHT SOCIETY 0.000AC C/O ROBERT E BLUE SR PO BOX 371 FERNANDINA BEACH FL 32035-0371 PT GOVT LOT 3 OF SEC 32-2N-28E IN DBK 36-197 ==================================== 1766 32-2N-28-0000-0022-0070 HX 248.31 GRAHAM JAMES R 1.130AC 95037 DIRT ROAD FERNANDINA BEACH FL 32034 PT OF GOVT LOT 3 IN OR 1260/1393 R278285 & R278286 ==================================== 1767 32-2N-28-0000-0025-0080 795.21 BLUE JAMES C JR 2.000AC PO BOX 4661 ATLANTA GA 30301-4661 PT NW1/4 OF SW1/4 OF SEC 32-2N-28E IN OR 1423/1484 ==================================== 1768 32-2N-28-0000-0026-0020 2,306.55 BLUE JAMES C JR & 9.170AC BLUE ROBERT E SR & BENJAMIN J PO BOX 4661 ATLANTA GA 30302 PT GOVT LOT 5 OF SEC 32-2N-28E IN OR 1613/914 ==================================== 1769 32-2N-28-005A-0023-0000 359.13 STEWART KYLE W & ARLETTA D 0.000AC 86350 MEADOWWOOD DR YULEE FL 32097 LOT 23 IN OR 1894/1721 AMELIA BAY ESTATES PB 7/4 ESMT PT OR 1397/1057 ==================================== 1770 32-2N-28-005A-0031-0000 768.77 HOLLAND MICHAEL & 0.000AC DEBBIE HOLLAND 96191 RIDGEWOOD CIR FERNANDINA BEACH FL 32034 LOT 31 IN OR 2103/531 AMELIA BAY ESTATES PB 7/4 ESMT PT OR 1397/1057 ==================================== 1771 32-2N-28-0150-0001-0050 HX 506.67 LANDRUM CARL J 0.000AC 95129 BIG OAK AVE FERNANDINA BEACH FL 32034 BLOCK 1 LOT 5 IN OR 782/201 R673708 & R673709 BIG OAK PB 5/357 ==================================== 1772 32-2N-28-0150-0001-0060 413.60 LANDRUM ANNIE C 0.000AC 95129 BIG OAK AVE FERNANDINA BEACH FL 32034 BLOCK 1 LOT 6 IN OR 879/1910 BIG OAK PB 5/357 ==================================== 1773 32-2N-28-0150-0001-0150 553.04 BEDELL HARRIET RUSHAWN 0.000AC 95003 PETUNIA COURT FERNANDINA BEACH FL 32034 BLOCK 1 LOT 15 R583983 OR 1549/1876 CASE # 07-DR-1177 BIG OAK PB 5/357 ==================================== 1774 32-2N-28-0150-0001-0160 1,135.38 BEDELL HARRIET RUSHAWN 0.000AC 95003 PETUNIA CT FERNANDINA BEACH FL 32034 BLOCK 1 LOT 16 OR 679/1440 & CASE #07-DR 1177 R673461 & R673462 BIG OAK PB 5/357 ==================================== 1775 32-2N-28-0150-0002-0030 HX 579.66 KRUPAR MICHAEL A JR & KATRINA 0.000AC 95184 BIG OAK AVE FERNANDINA BEACH FL 32034 BLOCK 2 LOT 3 IN OR 709 PG 453 R672473 & R672474 BIG OAK PB 5/357 ==================================== 1776 34-2N-28-0000-0001-0070 696.42 SMITH ERNEST L L/E 0.000AC SMITH VERNITHA G (JT/RS)(S&M) 95024 DENISE STREET FERNANDINA BEACH FL 32034 PT SAMUEL HARRISON GRANT SEC 44-2N-28E IN OR 1548/1483 ==================================== 1777 34-2N-28-0000-0002-0010 HX 51.07 GRACE JOHN 2.950AC 95571 DOUGLAS RD FERNANDINA BEACH FL 32034 PT GOVT LOT 1 OF SEC 34-2N-28E IN OR 498/1297 & 492/181 (EX UTIL ESMT IN OR 423/637) {R359471} ==================================== 1778 34-2N-28-0000-0007-0030 HX 912.07 WILDER JOHN A & PEGGY A 1.000AC 95177 WILDER BLVD FERNANDINA BEACH FL 32034 PT GOVT LOT 2 OF SEC 34-2N-28E IN OR 588/933 ==================================== 1779 34-2N-28-0000-0009-0000 1,451.42 BARBER JESSICA & 3.990AC BARBER ERICA & 1725 PHEASANT LN FERNANDINA BEACH FL 32034 PT GOVT LOTS 1 & 2 OF SEC 34-2N-28E IN OR 1871/1886 ==================================== 1780 34-2N-28-0000-0010-0000 628.41 WARD BRUCE & JETTA K 1.000AC 95395 WILDER BLVD FERNANDINA BEACH FL 32034 IN OR 744/1943 (EX 10-1 10-2 & 10-3) ==================================== 1781 34-2N-28-4980-0041-0000 2,575.81 BURNSED GARY CLAYTON & APRIL L 0.000AC 95085 WILDER BV FERNANDINA BEACH FL 32034 LOT 41 & PT LOT 42 IN OR 2066/1905 (EX SOVEREIGN SUBMERGED LANDS LYING OUTSIDE OF DREDGED CANAL) DUROC FARMS S/D OR 21/524 ==================================== 1782 34-2N-28-5132-0009-0000 HX 137.92 WELSH JOHN A JR 0.000AC PO BOX 15556 FERNANDINA BEACH FL 32035 LOT 9, PT LOT 10 & PT OF GOVT LOT 2 OF SEC 34-2N-28E IN OR 1499/1539 (EX R/W IN OR 673/1975) ELLIS LANDING SEC 2 UNR {1973 CHICK SWMH R106419} ==================================== 1783 34-2N-28-5132-0011-0000 1,963.66 GIBSON JUDY C & 0.000AC CLARK FRITZ H (JT/RS) 95133 WILDER BLVD FERNANDINA BEACH FL 32034 LOT 11 IN OR 1340/1676 ELLIS LANDING SEC 2 UNR ==================================== 1784 34-2N-28-5132-0012-0000 617.42 GIBSON JUDY L 0.000AC 95133 WILDER BLVD FERNANDINA BEACH FL 32034 LOT 12 IN OR 1801/93 ELLIS LANDING SEC 2 UNR ==================================== 1785 35-2N-28-0000-0001-0020 1,359.81 JUSTICE JENNIFER 2.710AC 85581 LONNIE CREWS ROAD FERNANDINA BEACH FL 32034 PT FRAC SEC 35-2N-28E PAR 1-20 IN OR 1471/1801 (EX R/W OR 154/123) ==================================== 1786 35-2N-28-0000-0001-0100 HX 1,684.29 SPAULDING TERRY G & PATTY 2.000AC 95379 DOUGLAS RD FERNANDINA BEACH FL 32034 IN OR 835 PG 1492 AKA LOT 22 MOBLEY HEIGHTS UNR ==================================== 1787 35-2N-28-0000-0001-0220 HX 1,335.33 PICKETT MATT S & MYRA JANE 2.750AC 85044 CREWS ROAD FERNANDINA BEACH FL 32034 IN OR 1597/877 EX R/W OR 619/1263 EX 1-112 ==================================== 1788 35-2N-28-0000-0001-0250 HX 1,487.81 THOMAS BRENDA Z 1.500AC 95525 DOUGLAS ROAD FERNANDINA BEACH FL 32034 PT GOVT LOT 1 OF SEC 35-2N-28E IN OR 1973/1866 MOBLEY HEIGHTS UNR {A/K/A PT OF LOT 26} ==================================== 1789 35-2N-28-0000-0001-0270 HX 561.58 HESTER JODI L & 3.000AC TIPPETTE DAVID GLEN (JTROS) 95003 ACORN LANE FERNANDINA BEACH FL 32034 IN OR 1642/1271 R433580 & R433581 ==================================== 1790 35-2N-28-0000-0001-0300 884.44 JACKSON JEFFREY B 1.000AC 6818 S COURT DR TAMPA FL 33611-5418 PT GOVT LOT 3 OF SEC 35-2N-28E IN OR 1633/883 BEING PARCEL B OR 1017/738 {1994 DEST DWMH} ==================================== 1791 35-2N-28-0000-0001-0320 1,476.88 PICKETT JOHN T SR L/E 3.550AC MATT S JR & ANGELA L PICKETT 85142 CREWS ROAD NORTH FERNANDINA BEACH FL 32034 PT GOVT LOT 3 & PT NW1/4 OF SEC 35-2N-28E IN OR 1597/879 BEING PARCELS #2 & #3 (EX PARCEL #1 OF OR 1597/879 & EX R/W IN OR 611/1184 & OR 611/1186 & EX ESMT IN OR 292/379) ==================================== 1792 35-2N-28-0000-0001-0500 1,681.99 MORTIMER MALVIN & 2.000AC HATHAWAY MICHELLE (H&W) 85388 CREWS RD FERNANDINA BEACH FL 32034 PT GOVT LOT 3 & PT NW1/4 OF SEC 35-2N-28E IN OR 2060/1521 (EX R/W IN OR 616/1001) ==================================== 1793 35-2N-28-0000-0001-0690 HX 848.20 PICKETT JOHN T SR L/E 0.950AC MATT S & ANGELA L PICKETT 85142 CREWS ROAD NORTH FERNANDINA BEACH FL 32034 PT OF NW1/4 OF SEC 35-2N-28E IN OR 1597/879 BEING PARCEL #1 (EX R/W OR 611/1186) ==================================== 1794 35-2N-28-0000-0001-0810 HX 156.96 QUINN LINDA ANNE 1.250AC 95474 MOBLEY HEIGHTS ROAD FERNANDINA BEACH FL 32034 IN OR 1727/94 R787565 ==================================== 1795 35-2N-28-0000-0001-0860 195.72 MILLS JAMES E 1.000AC 85127 PATRICIA CT FERNANDINA BEACH FL 32034 PT GOVT LOT 3 OF SEC 35-2N-28E IN OR 2027/944 BEING PARCEL A OR 951/708,OR 951/808 & OR 955/1156) ==================================== 1796 35-2N-28-0000-0001-0920 857.48 HOERLE-DAVIS LOVE 1.320AC 85551 LONNIE CREWS RD FERNANDINA BEACH FL 32034 IN OR 1307/877 1974 SHER SW/MH ==================================== 1797 35-2N-28-0000-0001-1020 1,351.52 JACKSON JEFFREY B 2.220AC 6818 S COURT DR TAMPA FL 33611-5418 PT GOVT LOT 3 OF SEC 35-2N-28E IN OR 1633/883 BEING PARCEL A & ESMT IN OR 951/708 ==================================== 1798 35-2N-28-0000-0001-1030 649.75 JACKSON JEFFREY B 1.200AC 6818 S COURT DR TAMPA FL 33611-5418 PT GOVT LOT 3 OF SEC 35-2N-28E IN OR 1633/883 BEING PARCEL C {1984 TOWN SW} ==================================== 1799 35-2N-28-0000-0001-1120 3,349.24 PICKETT MATT STEVEN & MYRA J 1.020AC 85072 CREWS RD FERNANDINA BEACH FL 32034 IN OR 1782/1398 ==================================== 1800 35-2N-28-1401-0001-0000 HX 442.12 MIXON THOMAS V JR 1.800AC 95236 KAREN WALK FERNANDINA BEACH FL 32034 PT OF LOT 1 IN OR 1518/612 & OR 1864/1544 (EX OR 1297/263) INCL ESMT OR 1145/277 MOBLEY HEIGHTS NORTH 3 PB 6/39 {R672468 & R672469} ==================================== 1801 35-2N-28-1401-0002-0000 1,022.90 DOUGLAS A B & BARBARA M 2.000AC 940538 OLD NASSAUVILLE RD FERNANDINA BEACH FL 32034 LOT 2 IN OR 1831/1636 MH/ID GMHGA208914468 MOBLEY HEIGHTS NORTH 3 PB 6/39 ==================================== 1802 35-2N-28-1401-0003-0000 HX 582.40 FRITTS ANTHONY CHRISTOPHER 2.000AC & ZIMMERMAN JILL ELIZABETH 95180 KAREN WALK FERNANDINA BEACH FL 32034 LOT 3 MH/ID GBHMM52642 IN OR 853/1771 MOBLEY HEIGHTS NORTH 3 PB 6/39 ==================================== 1803 35-2N-28-1401-0004-0010 HX 528.46 WEBB MATTHEW 1.000AC 95154 KAREN WALK FERNANDINA BEACH FL 32034 E217.75 FT OF LOT 4 & N30 FT OF W363 FT OF LOT 4 1997 CHAD DW/MH IN OR 2017/168 MOBLEY HEIGHTS NORTH 3 PB 6/39 ==================================== 1804 37-2N-28-0000-0001-0000 1,252.79 PINEY ISLAND PARTNERSHIP 0.000AC 437 E MONROE ST SUITE 100 JACKSONVILLE FL 32202 ALL S OF SAL R/W PT OR 236/535 & OR 921/542 & PT OR 921/542 & OR 1429/1157 EX 1-1 & 1-2 ==================================== 1805 37-2N-28-1320-0031-0000 7,376.40 MATTHEWS BRIAN & JENNIFER 0.000AC 2997 GREEN OAKS CIRCLE ATLANTA GA 30345 LOT 31 IN OR 968/31 MARSH LAKES PB 5/159-167 ==================================== 1806 37-2N-28-209T-0121-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 121 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1807 37-2N-28-209T-0122-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 122 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1808 37-2N-28-209T-0123-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 123 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1809 37-2N-28-209T-0124-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 124 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1810 37-2N-28-209T-0131-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 131 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1811 37-2N-28-209T-0132-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 132 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1812 37-2N-28-209T-0133-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 133 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1813 37-2N-28-209T-0134-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 134 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1814 37-2N-28-209T-0141-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 141 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1815 37-2N-28-209T-0142-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 142 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1816 37-2N-28-209T-0143-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 143 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1817 37-2N-28-209T-0144-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 144 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1818 37-2N-28-209T-0221-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 221 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1819 37-2N-28-209T-0222-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 222 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1820 37-2N-28-209T-0223-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 223 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1821 37-2N-28-209T-0224-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 224 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1822 37-2N-28-209T-0231-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 231 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1823 37-2N-28-209T-0232-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 232 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1824 37-2N-28-209T-0233-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 233 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1825 37-2N-28-209T-0234-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 234 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1826 37-2N-28-209T-0241-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 241 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1827 37-2N-28-209T-0242-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 242 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1828 37-2N-28-209T-0243-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 243 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1829 37-2N-28-209T-0244-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 244 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1830 37-2N-28-209T-0321-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 321 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1831 37-2N-28-209T-0322-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 322 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1832 37-2N-28-209T-0323-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 323 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1833 37-2N-28-209T-0324-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 324 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1834 37-2N-28-209T-0331-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 331 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1835 37-2N-28-209T-0332-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 332 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1836 37-2N-28-209T-0333-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 333 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1837 37-2N-28-209T-0334-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 334 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1838 37-2N-28-209T-0341-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 341 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1839 37-2N-28-209T-0342-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 342 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== rf rfntb DEL. TAX LIST 2017.indd 12 4/30/18 12:20 PM

PAGE 73

1840 37-2N-28-209T-0343-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 343 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1841 37-2N-28-209T-0344-0000 310.55 TUSCANY PRESERVE LLC 0.000AC 665 SIMONDS RD WILLIAMSTOWN MA 01267 UNIT 344 PT OR 1881/181 NOT DEVELOPED/VACANT THE TUSCANY CONDO OR 1398/1500 ==================================== 1842 37-2N-28-227V-005A-0000 2,677.07 ROWE CAROLYN G 0.000AC 85272 AMARYLLIS CT FERNANDINA BEACH FL 32034 LOT 5A IN OR 1983/820 THE VILLAGE @ MARSH LAKES PB 5/355 ==================================== 1843 37-2N-28-227W-0016-0000 3,490.37 TRAVER STEVEN & 0.000AC TRAVER MICHAEL D (50%) 95332 VILLAGE DRIVE FERNANDINA BEACH FL 32034 LOT 16 IN OR 1610/94 THE VILLAGES OF MARSH LAKES #2 PB 6/97-98 ==================================== 1844 37-2N-28-5000-000A-0000 17,008.10 PINEY ISLAND PARTNERSHIP 42.780AC 437 E MONROE STREET SUITE 100 JACKSONVILLE FL 32202 PT OF TRACT B PT OR 236/535 & OR 1253/1846 & PT OR 1201/1678 & OR 1429/1157 PINEY ISLAND PB 4/63 & 64 ==================================== 1845 37-2N-28-5000-0022-0000 1,065.41 HILL MAHLON HUBERT SR TRUSTEE 0.000AC OF MAHLONO HUBERT HILL SR 1201 TRIBBLE WOODS CT LAWRENCEVILLE GA 30045-3479 LOT 22 IN OR 1752/687 PINEY ISLAND II PB 4/97 ==================================== 1846 37-2N-28-5000-0046-0000 1,266.09 BEAN WARREN C 0.000AC 96295 PINEY ISLAND DRIVE FERNANDINA BEACH FL 32034 LOT 46 PT OF OR 492/1076 PINEY ISLAND II PB 4/97 ==================================== 1847 37-2N-28-5000-0074-0000 HX 2,238.81 DYE AMY L 0.000AC 96044 PINEY ISLAND DR FERNANDINA BEACH FL 32034 LOT 74 PT OF TRACT B IN OR 1710/901 PINEY ISLAND PB 4/63 & 64 ==================================== 1848 37-2N-28-5000-0076-0000 HX 2,611.66 HERNANDEZ TAMARA A V WATKIVS 0.000AC 96034 PINEY ISLAND DR FERNANDINA BEACH FL 32034 LOT 76 PT OF TRACT B IN OR 863/1496 & OR 1705/930 PINEY ISLAND PB 4/63 & 64 ==================================== 1849 37-2N-28-5000-0203-0000 2,196.41 TILLY VERDIE M 0.000AC 91006 FIDDLER DR FERNANDINA BEACH FL 32034 LOT 203 (EX S-1) IN OR 2139/384 PINEY ISLAND 1 PB 4/69 ==================================== 1850 37-2N-28-5000-0212-0000 1,354.74 ROWE JONATHAN M & SUSAN L 0.000AC 3058 RIVERSIDE DRIVE FERNANDINA BEACH FL 32034 PT OF LOT 212 IN OR 1371/544 PINEY ISLAND I PB 4/69 ==================================== 1851 37-2N-28-5000-0212-0010 1,487.03 ROWE JONATHAN M & SUSAN L 0.000AC 3058 RIVERSIDE DRIVE FERNANDINA BEACH FL 32034 PT OF LOT 212 (S-1) IN OR 1371/547 PINEY ISLAND I PB 4/69 ==================================== 1852 38-2N-28-0180-0044-0000 1,594.11 SALCICCIOLI JOHN & JANET E 0.000AC 42 TWIN RIDGE RD RIDGEFIELD CT 06877 LOT 44 IN OR 2100/366 BRADY POINT PRESERVE PB 7/76 ==================================== 1853 38-2N-28-0180-0045-0000 1,594.11 KRYSIAK ALICE (30.96%) & 0.000AC SIEGEL RUTH L TRUSTEE (46.92)& EQUITY TRT CO CUSTODIAN(23.12) 2625 BLACKBEARD PLACE FERNANDINA BEACH FL 32034 LOT 45 IN OR 1329/812 & OR 1502/1112 BRADY POINT PRESERVE PB 7/76 ==================================== 1854 38-2N-28-0180-0050-0000 1,471.94 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 50 IN OR 1989/1211 BRADY POINT PRESERVE PB 7/76 ==================================== 1855 39-2N-28-0000-0002-0030 212.51 JONES CHARLIE C 0.000AC FERNANDINA BEACH FL 32034 IN OR 788/1299 EX R/W OR 302/35 ==================================== 1856 39-2N-28-0000-0002-0080 1,800.25 BROWN JESSE V JR & CHARENE S 3.000AC 87362 HAVEN RD YULEE FL 32097 IN OR 499 PG 1411 EX OR 375 PG 735 ==================================== 1857 39-2N-28-0000-0002-0110 1,652.89 BROWN JESSE V & CHARENE S 2.750AC 87362 HAVEN RD YULEE FL 32097 IN OR 321/26 ==================================== 1858 39-2N-28-0000-0010-0000 HX 501.85 SCOTT LOIS B & 0.500AC SCOTT ELBERT O JR (JT/RS) 96060 JASON WAY FERNANDINA BEACH FL 32034 IN OR 1655/441 ESMT OR 1108/50 ==================================== 1859 39-2N-28-0000-0012-0100 97.50 SCOTT STANLEY V TRUSTEE 0.400AC OF GLADYS T SCOTT REV TRUST 10624 NW HIGHWAY 225A OCALA FL 34482 PT OR 1718/1885 ==================================== 1860 39-2N-28-0000-0013-0010 370.14 CRIBB PATRICIA A & 0.000AC WAY ELIPHUS J & REGINALD & 8735 FREE AVE JACKSONVILLE FL 32211-8087 IN OR 1376/1897 EX R/W IN OR 229/419 ==================================== 1861 39-2N-28-0000-0013-0030 497.42 JONES JOSHUA A & 0.000AC JONES OSCAR & 96072 LONNIE LANE FERNANDINA BEACH FL 32034 IN OR 1376/1898 ==================================== 1862 39-2N-28-0000-0013-0040 979.96 BENJAMIN MARY L EST 0.000AC C/O LILLIE MELTON 96384 MT ZION LOOP YULEE FL 32097 IN OR 354 PG 664 R622304 & R622310 EX R/W OR 302/50 ==================================== 1863 39-2N-28-0000-0014-0000 521.23 GREEN SYLVIA & 0.000AC FORD LILLY ET AL FERNANDINA BEACH FL 32034 IN OR 2087/1610 EX R/W OR 302 PG 32 R567690 ==================================== 1864 39-2N-28-0000-0015-0000 563.05 FRENCH MARGIE C 0.000AC 4398 LORI LOOP ROAD KEYSTONE HEIGHTS FL 32656 PAR 15 IN OR 1680/1174 (EX R/W OR 302/38) ==================================== 1865 39-2N-28-0000-0016-0000 517.48 FRENCH MARGIE C 0.000AC 4398 LORI LOOP ROAD KEYSTONE HEIGHTS FL 32656 PAR 16 PT OR 1648/1956 ==================================== 1866 39-2N-28-0000-0016-0010 260.94 FRENCH MARGIE C 0.000AC 4398 LORI LOOP ROAD KEYSTONE HEIGHTS FL 32656 PAR 16-1 PT OR 1648/1956 ==================================== 1867 39-2N-28-011B-0002-0000 72.94 TOLLISON HUGH K SR EST & 0.000AC H KENNETH JR & LAWTON TOLLISON PO BOX 937 FERNANDINA BEACH FL 32035-0937 LOT 2 EX PT OR 745/1523 PT OR 740/357 BARNWELL ESTATES PB 5/226 ==================================== 1868 39-2N-28-5020-0007-0000 727.85 WATKINS THOMAS & GWENDOLYN P 0.000AC 2224 S DUNSMUIR AVE LOS ANGELES CA 90016 LOT 7 OR 508/52 LENWORTH S MORRISON S/D DBK 258/27-51 ==================================== 1869 39-2N-28-5020-000C-0000 3,430.94 L S & ELIZABETH MORRISON 3.460AC MANAGEMENT SERVICES PO BOX 3298 TAMPA FL 33601-3298 LOT C IN OR 1641/858 LENWORTH S MORRISON S/D DBK 258/27-51 ==================================== 1870 39-2N-28-5020-0012-0000 325.56 WATKINS THOMAS & GWENDOLYN P 0.000AC 2224 S DUNSMUIR AVE LOS ANGELES CA 90016 LOT 12 (EX R/W IN OR 384/81) LENWORTH S MORRISON S/D DBK 258/27-51 ==================================== 1871 40-2N-28-0000-0020-0000 2,468.05 BROWN JESSE V JR & CHARENE S 0.000AC 87362 HAVEN RD YULEE FL 32097 IN OR 520 PG 1011 ==================================== 1872 40-2N-28-0000-0027-0000 3,140.12 STEPHENS JAMES EST 0.000AC C/O MRS MARY CRANKSHAW EST P O BOX 952 FERNANDINA BEACH FL 32035-0952 IN DB 229 PG 477 CO REC (EX R/W IN CASE 76-51-CA ==================================== 1873 40-2N-28-0000-0049-0140 786.28 MCCORMISK FRANCIS WAYNE 1.000AC 85017 WAYNES PLACE YULEE FL 32097 IN OR 1318/628 R568060 & R568061 ==================================== 1874 40-2N-28-1590-0102-0000 HX 1,660.53 NORMANDIN MELINDA K 0.000AC 95096 PALMETTO TRL FERNANDINA BEACH FL 32034 LOT 102 IN OR 1514/1308 OTTER RUN PB 5/156 ==================================== 1875 40-2N-28-159O-0001-0000 HX 5,052.38 THEOBALD THOMAS A & REMONA R 4.000AC 96568 CALHOUN ROAD FERNANDINA BEACH FL 32034 LOT 1 OR 676/1920 & OR 700/332 OYSTERVILLE PB 5/358-359 ==================================== 1876 41-2N-28-0000-0003-0080 545.12 ESB INVESTMENTS LLC 19.650AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 PT SEC 41-2N-28E IN OR 1989/1212 ==================================== 1877 41-2N-28-0000-0006-0000 565.74 BATCHELOR JAMES E EST 0.000AC 2178 JEKYLL COURT FERNANDINA BEACH FL 32034 PT D FERNANDEZ GRANTS OR 781/267 & OR 1730/526 & ESMT IN OR 267/167 {R621823} ==================================== 1878 43-2N-28-0000-0001-0090 560.02 JENKINS JOHN A JR 1.290AC 95098 FRANK WARD RD FERNANDINA BEACH FL 32034 IN OR 324 PG 867 EX 1-12 & EX R/W OR 978/303 L/E PT OR 815/494 PARCELS 1-9 & 1-16 ==================================== 1879 43-2N-28-0000-0001-0120 623.94 JENKINS JOHN A JR 1.290AC 95098 FRANK WARD RD FERNANDINA BEACH FL 32034 IN OR 764 PG 1455 L/E PT OR 815/494 EX R/W OR 978/303 PARCELS 1-12 & 1-17 ==================================== 1880 43-2N-28-0000-0001-0140 79.07 THRIFT GEORGE H SR 0.230AC 474379 E SR 200 FERNANDINA BEACH FL 32034 PT D FERNANDEZ GRANT SEC 43-2N-28E IN OR 879/580 ==================================== 1881 43-2N-28-0000-0003-0000 HX 2,539.44 JENKINS JOHN A JR 6.080AC 95098 FRANK WARD RD FERNANDINA BEACH FL 32034 IN OR 1770/1907 EX R/W OR 978/297 & EX R/W OR 1015/1600 EX 3-1 3-2 3-3 3-4 3-5 3-6 & EX 3-7 ESMT OR 1149/749 ==================================== 1882 43-2N-28-0000-0003-0040 366.38 MCCARROLL MICHAEL ORY & ASHLEY 15.400AC 95184 FLATWOODS TRAIL FERNANDINA BEACH FL 32034 IN OR 1903/834 ==================================== 1883 43-2N-28-0000-0003-0050 HX 618.80 MCCARROLL MICHAEL ORY & ASHLEY 3.400AC 95184 FLATWOODS TRAIL FERNANDINA BEACH FL 32034 IN OR 1903/837 ==================================== 1884 43-2N-28-0000-0003-0060 62.27 MCCARROLL MICHAEL ORY & ASHLEY 5.520AC 95184 FLATWOODS TRAIL FERNANDINA BEACH FL 32034 IN OR 1903/840 ==================================== 1885 44-2N-28-0000-0023-0010 HX 2,811.65 ANDREWS VIRGINIA J & WALTER F 1.000AC 95366 ARBOR LANE FERNANDINA BEACH FL 32034 PT SAMUEL HARRISON GRANT SEC 44-2N-28E IN OR 410/33 (EX PT IN OR 849/63, OR 1873/1193 & EX WELL ESMT IN OR 1873/1188) ==================================== 1886 44-2N-28-0000-0029-0030 1,233.70 CUMMING WILLIE CARL 1.980AC 941490 OLD NASSAUVILLE RD FERNANDINA BEACH FL 32034 PT SAMUEL HARRISON GRANT SEC 44-2N-28E IN OR 1745/179 ==================================== 1887 44-2N-28-5120-000A-0160 3,566.41 MANCIL LARRY E & JUDITH E 0.000AC 95083 STINGRAY LANE FERNANDINA BEACH FL 32034 PT OF TRACT A IN OR 943/723 1993 JACO DW/MH ALLIGATOR CREEK ADDITION TO SEYMORE POINT PB 2/73 ==================================== 1888 44-2N-28-5130-0013-0000 HX 511.83 LITTLE JOSEPH C & L C 0.000AC 95143 ELLIS LANDING FERNANDINA BEACH FL 32034 LOT 13 OR 155 PG 244 ELLIS LANDING UNR ==================================== 1889 44-2N-28-5130-0032-0000 588.85 MARSH DENNIS LEE 0.000AC 95084 GERALD CIR FERNANDINA BEACH FL 32034 LOT 32 R787542 IN OR 1939/1916 ELLIS LANDING UNR ==================================== 1890 44-2N-28-5130-0054-0000 HX 1,095.97 DUNCUM BRIAN E SR & 0.000AC DUNCUM FELICIA W (JT/RS) 95221 GERALD CIRCLE FERNANDINA BEACH FL 32034 LOTS 54 & 55 IN OR 1977/545 ELLIS LANDING UNR ==================================== 1891 44-2N-28-5130-0063-0000 287.72 TAYLOR HOWARD L & YOLANDA D 0.000AC 95124 ELLIS LANDING ROAD FERNANDINA BEACH FL 32034 LOT 63 IN OR 1010/395 ELLIS LANDING UNR ==================================== 1892 44-2N-28-5136-0002-0000 HX 200.70 BURNSED JODI P 1.100AC 95490 ALLIGATOR CREEK RD FERNANDINA BEACH FL 32034 LOT 2 IN OR 1360/517 & OR 1859/636 R498379 & R498380 HOLLY OAK SUB PB 5/309 ==================================== 1893 44-2N-28-5136-0003-0000 1,352.54 BURNSED JODI P 1.390AC 95490 ALLIGATOR CREEK RD FERNANDINA BEACH FL 32034 LOT 3 IN OR 2086/1331 HOLLY OAK SUB PB 5/309 2004 FTWD DW/MH ==================================== 1894 44-2N-28-5160-000A-0140 HX 778.92 THOMAS DAVID R JR & KIMBERLY R 0.000AC 95145 ARBOR LANE FERNANDINA BEACH FL 32034 PT OF TRACT A IN OR 537/545 SEYMORE POINT ADDN #1 PBK 2/62 ==================================== 1895 44-2N-28-5180-0005-0020 HX 869.09 BOUDROW REANNA A 0.000AC 95020 LADYFISH LANE FERNANDINA BEACH FL 32034 BLK A {K/A PARCEL A} PT OF LOT 5 IN OR 1717/980 WILDERS SUB OF NASSAU RIVER FRONTAGE PBK 2/67 ==================================== 1896 44-2N-28-5210-0006-0000 1,090.34 WILSON AVA A 2.500AC 2010 OAKVIEW DRIVE SEVERVILLE TN 37876 LOT 6 IN OR 248 PG 579 RAINBOW ACRES SUB UNR PLAT ==================================== 1897 44-2N-28-5210-0010-0000 2,135.24 CORBITT RONALD & 4.260AC CORBITT MAXINE (JT/RS) 95149 RAINBOW ACRES RD FERNANDINA BEACH FL 32034 LOTS 10 & 11 RP 1781 & R788209 & R788210 MH/ID GAFL1AD34074405 IN OR 1815/163 RAINBOW ACRES SUB UNR PLAT ==================================== 1898 44-2N-28-5210-0013-0010 HX 460.91 CARTER EDWARD M 1.000AC 95231 RAINBOW ACRES ROAD FERNANDINA BEACH FL 32034 PT OF LOT 13 OR 835/627 & CASE #01-151-DR R787504 & R787505 RAINBOW ACRES SUB UNR PLAT ==================================== 1899 44-2N-28-5210-0047-0020 1,036.99 SEVILLA CHRISTOPHER J & ASHLEY 2.000AC 95379 ALLIGATOR CREEK RD FERNANDINA BEACH FL 32034 PT OF LOTS 47 & 48 IN OR 2055/717 & WELL ESMT IN OR 691/1260 RAINBOW ACRES SUB UNR PLAT {1988 OMNI DW/MH} ==================================== 1900 44-2N-28-5210-0054-0010 804.64 DENMARK GARY 1.250AC 95002 CANOE LN FERNANDINA BEACH FL 32034 PT LOT 54 IN OR 1970/1639 RAINBOW ACRES SUB UNR ==================================== 1901 45-2N-28-0000-0003-0000 72.94 PRINCE CHAPEL AME CHURCH 0.000AC OF NASSAUVILLE PO BOX 15997 FERNANDINA BEACH FL 32035 IN OR 463 PG 29 ==================================== 1902 45-2N-28-0000-0007-0020 HX 4,267.23 WALL BRIAN A & ANGELA 2.870AC 940261 OLD NASSAUVILLE RD FERNANDINA BEACH FL 32034 IN OR 1641/575 ==================================== 1903 45-2N-28-0000-0011-0000 8,558.22 ALBERT EUGENE TRUSTEE 5.000AC OF ALBERT FAMILY IRREVOCABLE 6323 ARDLEIGH ST PHILADELPHIA PA 19138 PT JOHN CHRISTOPHER GRANT SEC 45-2N-28E IN OR 1267/944 (EX PT IN OR 1530/506) ==================================== 1904 45-2N-28-0000-0012-0010 13,114.51 DUEY-DODGE AMY LEGARE 8.000AC 940272 OLD NASSAUVILLE RD FERNANDINA BEACH FL 32034 PT JOHN CHISTOPHER GRANT SEC 45-2N-28E L/E OR 1939/1228 (EX FPL UTIL ESMT OR 333/771) ==================================== 1905 45-2N-28-0000-0015-0010 2,689.24 MANGE JOE W & MARIE R 0.000AC 3761 CEDAR CREST DR JACKSONVILLE FL 32210 IN OR 92 PG 527 & OR 122/73 (EX OR 122/74) & OR 122 PG 76 ==================================== 1906 45-2N-28-5220-000E-0000 662.06 MAREADY EARLY R 0.000AC 95002 JASPER WAY FERNANDINA BEACH FL 32034 SUB LOT E R407601 & R407602 IN OR 1915/1343 D A COOK REPLAT OR 23/58 ==================================== 1907 45-2N-28-5220-000H-0000 HX 795.02 MAREADY EARLY R & 0.000AC THORP SHANNON & 95002 JASPER WAY FERNANDINA BEACH FL 32034 SUB LOT H D A COOK REPLAT IN OR 1792/764 ESMT OR 585/812 ==================================== 1908 45-2N-28-5240-0011-0000 HX 4,760.95 PANKE RUSSELL E & BRENDA 0.000AC 940496 OLD NASSAUVILLE ROAD FERNANDINA BEACH FL 32034-7436 S 150 FT OF LOT 11 IN OR 728/633 CHRISTOPHER CREEK ESTATES PB 3/12 ==================================== 1909 45-2N-28-525A-0047-0000 HX 226.89 DRAKUS NICHOLAS L 0.000AC 94140 MERLIN DR FERNANDINA BEACH FL 32034 TRACT 47 IN OR 1571/1216 & OR 1897/1238 1984 CONC DW/MH HOLLY POINT UNIT 1 UNR ==================================== 1910 45-2N-28-525B-0001-0000 678.47 DAVIS SUSAN M 0.000AC 94035 MERLIN DR FERNANDINA BEACH FL 32034 TRACT 1 & 2 R672541 & R672542 IN OR 2023/1791 HOLLY POINT UNIT 2 UR ==================================== 1911 45-2N-28-525B-0011-0000 1,114.12 ALLISON VENTURES LLC 0.480AC 96034 SANDY POINTE CR FERNANDINA BEACH FL 32034 TRACT 11 & PAR 4-1 IN OR 1788/1473 1993 HOMETTE TW/MH PT OF LIVE OAK DR OR 425/187 HOLLY POINT UNIT 2 UNR ==================================== 1912 45-2N-28-525B-0017-0000 611.24 DAVIS MARK D 0.000AC 85217 JOHNSON LN YULEE FL 32097 TRACT 17 R567717 IN OR 1780/944 HOLLY POINT UNIT 2 UNR ==================================== 1913 45-2N-28-525B-0031-0000 1,149.25 DAVIS SUSAN M 0.000AC 94035 MERLIN DR FERNANDINA BEACH FL 32034 TRACT 31 & 32 R359520 IN OR 2004/1651 HOLLY POINT UNIT 2 UNR ==================================== 1914 45-2N-28-525B-0034-0000 277.60 NICHOLS LINDA R & PAUL E 0.000AC 94634 DUCK LAKE DRIVE FERNANDINA BEACH FL 32034 TRACT 34 IN OR 1076/928 HOLLY POINT UNIT 2 UNR ==================================== 1915 45-2N-28-525B-0039-0000 277.60 SCOTT-CHUNG MEIBECK LEE TRSTEE OF SCOTT-CHUNG FAMILY TRUST 0.000AC 1717 16TH AVENUE OAKLAND CA 94606 TRACT 39 IN OR 1491/1082 HOLLY POINT UNIT 2 UNR ==================================== 1916 45-2N-28-525C-0005-0000 HX 966.38 BEST ALVIN E III & MABEL J 0.000AC 94070 WINTERBERRY AV FERNANDINA BEACH FL 32034 TRACTS 5 6 & 10 IN OR 1779/588 & 765/1183 HOLLY POINT UNIT 3 UNR {1996 MERI DW/MH} {R672557 & R672558} ==================================== 1917 45-2N-28-525C-0008-0000 HX 178.25 WRIGHT STEPHEN P & MARY I 0.000AC 94195 CHRISTOPHER LANE FERNANDINA BEACH FL 32034 TRACT 8 R360260 IN OR 600 PG 5 HOLLY POINT UNIT 3 UNR ==================================== 1918 45-2N-28-525C-0028-0000 312.85 LOVELL CHESTER R 0.000AC 4001 SAN JOSE BLVD JACKSONVILLE FL 32207 LOTS 28 29 & 30 PT OR 780/1528 HOLLY POINT UNIT 3 UNR ==================================== 1919 45-2N-28-525C-0034-0000 850.63 PARKER JAMES O 0.000AC 1812 CR 340 MAYO FL 32066 LOT 34 IN OR 2070/1661 HOLLY POINT UNIT 3 UNR ==================================== 1920 45-2N-28-525C-0044-0000 978.33 LOVELL CHESTER R 0.000AC 4001 SAN JOSE BLVD JACKSONVILLE FL 32207 LOTS 44 & 45 PT OR 780/1528 HOLLY POINT UNIT 3 UNR ==================================== 1921 45-2N-28-525C-0046-0000 888.29 LOVELL CHESTER R 0.000AC 4001 SAN JOSE BLVD JACKSONVILLE FL 32207 LOT 46 IN OR 807/453 HOLLY POINT #3 UNR ==================================== 1922 45-2N-28-525C-0048-0000 530.62 RICHARDSON MICHAEL 0.000AC P O BOX 483 FERNANDINA BEACH FL 32035 TRACT 48 L/E IN OR 1085/55 HOLLY POINT #3 UNR ==================================== 1923 45-2N-28-525C-0049-0000 651.71 LOVELL CHESTER R 0.000AC 4001 SAN JOSE BLVD JACKSONVILLE FL 32207 TRACT 49 IN OR 900/6 HOLLY POINT UNIT 3 UNR ==================================== 1924 45-2N-28-525D-0001-0000 1,548.29 LOVELL CHESTER R 0.000AC 4001 SAN JOSE BLVD JACKSONVILLE FL 32207 LOT 1 IN OR 822/23 HOLLY POINT UNIT 4 UNR ==================================== 1925 45-2N-28-525D-0003-0000 970.45 NYREN GERALD PAUL & MARY M 0.000AC 3911 PARK ST JACKSONVILLE FL 32205 LOT 3 IN OR 1916/681 HOLLY POINT UNIT 4 UNR ==================================== 1926 45-2N-28-525D-0018-0000 HX 1,255.43 PEGG R KEVIN 0.000AC 94245 PALM CIRCLE FERNANDINA BEACH FL 32034 LOT 18 PT OR 2016/9 (EX THE TOGETHER WITH PARCEL) HOLLY POINT UNIT 4 UNR R497402 ==================================== 1927 45-2N-28-525F-0010-0000 494.57 ZIMMERMAN JILL E & 0.000AC FRITTS ANTHONY C (JT/RS) 95180 KAREN WALK FERNANDINA BEACH FL 32034 LOT 10 IN OR 1903/1079 GAFL1AD36074513 HOLLY POINT EAST PB 6/160 ==================================== 1928 45-2N-28-525F-0013-0000 1,045.69 AMERICAN RECOVERY CORPORATION 0.000AC INC OF USA 2200 BAYVIEW ROAD JACKSONVILLE FL 32210 LOT 13 2005 DW/MH FTWD IN OR 1965/878 HOLLY POINT EAST PB 6/160 ==================================== 1929 45-2N-28-545K-0002-0000 HX 428.46 TRANTHAM NANCY R 0.000AC 940732 OLD NASSAUVILLE RD FERNANDINA BEACH FL 32034 LOT 2 IN OR 1751/810 & OR 1847/1834 KASIE HILL SUB PB 6/102 F/K/A 45-2N-28-0000-0004-0070 ==================================== 1930 45-2N-28-550A-0001-0020 495.95 BAKER SHANNON L 0.000AC 95297 SANTA JUANA ROAD FERNANDINA BEACH FL 32034 BLOCK 1 LOT 2 R360276 IN OR 1689/566 SPRING HILL SUB PB 5/32 ==================================== 1931 45-2N-28-550A-0001-0050 857.56 BLACK CREEK CUSTOM HOMES INC 0.000AC 2372 BLANDING BLVD MIDDLEBURG FL 32068 BLOCK 1 LOT 5 IN OR 2141/170 1998 REDMAN SWMH SPRING HILL SUB PB 5/32 ==================================== 1932 45-2N-28-550A-0001-0320 HX 137.84 JOHNSON KRISTOPHER J & 0.000AC TODD GORDON H & PAULA (JT/RS) 95143 CLEARWATER ROAD FERNANDINA BEACH FL 32034 BLOCK 1 LOT 32 IN OR 1729/492 R107989 & R107990 SPRING HILL SUB PB 5/32 ==================================== 1933 45-2N-28-550B-0002-0120 HX 279.72 OVERLY TERRY L & LINDA G 0.000AC 95364 CLEARWATER ROAD FERNANDINA BEACH FL 32034 BLOCK 2 LOT 12 IN OR 860/474 1993 HORT DW/MH SPRING HILL SUB #2 PB 5/35 ==================================== 1934 45-2N-28-550B-0002-0180 HX 812.61 WILLIAMS OLVAN E JR 0.000AC 95190 CLEARWATER RD FERNANDINA BEACH FL 32034 BLOCK 2 LOT 18 IN OR 896/518 2005 ANNIVERS DW/MH SPRING HILL SUB 2 PB 5/35 ==================================== 1935 45-2N-28-550B-0002-0281 HX 618.94 DELAPP JULIA B 0.000AC 95096 MOBLEY HEIGHTS RD FERNANDINA BEACH FL 32034 BLOCK 2 NWLY 100 FT OF TRACT 28 IN OR 1805/412 1998 MERI DW/MH SPRING HILL #2 PB 5/35 ==================================== 1936 45-2N-28-550B-0002-0460 662.47 DEONAS NICK D & HELEN D 0.000AC 96208 LIGHTWIND DR FERNANDINA BEACH FL 32034-6170 BLOCK 2 LOT 46 IN OR 934/1105 R498258 & R498259 SPRING HILL SUB UNIT 2 PB 5/35 ==================================== 1937 45-2N-28-550B-0003-0460 583.49 YAKUNOVICH IVAN & BRANDY 0.000AC 940847 OLD NASSAUVILLE RD FERNANDINA BEACH FL 32034 BLOCK 3 LOT 46 R433472 IN OR 2063/903 SPRING HILL SUB UNIT 2 PB 5/35 ==================================== 1938 45-2N-28-550B-0003-0510 667.62 PERALTA ELIAZAR FIGUEROA 0.000AC 96012 SUNFISH LANE YULEE FL 32097 BLOCK 3 LOT 51 IN OR 1416/120 MH/ID GDWGA308218682A & GDWGA308218682B EX R/W OR 677/1198 SPRING HILL SUB #2 PB 5/35 ==================================== 1939 45-2N-28-550C-0006-0000 HX 527.25 KING JEREMY A 0.000AC 95282 SANTA JUANA RD FERNANDINA BEACH FL 32034 LOT 6 IN OR 1933/1947 1999 MERT DW/MH SPRING HILL #3 PB 5/52 ==================================== 1940 45-2N-28-550D-0004-0000 HX 526.11 THORNTON BILLY J & 0.000AC THORNTON JENNIFER L 85735 LONNIE CREWS RD FERNANDINA BEACH FL 32034 LOT 4 IN OR 873/1577 1999 MERIT DW/MH SPRING HILL #4 PB 6/43 ==================================== 1941 45-2N-28-550D-0009-0000 556.09 BROWN JAMES SR 0.000AC 97001 RICHO LANE YULEE FL 32097 LOT 9 IN OR 1183/835 SPRING HILL #4 PB 6/43 ==================================== 1942 45-2N-28-550D-0013-0000 HX 503.32 HATCH DAVID J & JAIME E 0.000AC 95147 MOBLEY HEIGHTS ROAD FERNANDINA BEACH FL 32034 LOT 13 IN OR 798 PG 321 R788105 & R788106 SPRING HILL #4 PB 6/43 ==================================== 1943 45-2N-28-550D-0016-0000 860.86 JOHNS DONNA M 0.000AC 95187 MOBLEY HEIGHTS ROAD FERNANDINA BEACH FL 32034 LOT 16 IN OR 842/1219 R788133 & R788134 SPRING HILL #4 PB 6/43 ==================================== 1944 45-2N-28-550E-0016-0010 HX 628.97 MADDOX DAWN 3.280AC 95077 CAROLINE WAY FERNANDINA BEACH FL 32034 PT OF LOT 16 (S-1) IN OR 1941/260 ESMT PT OR 1043/798 ESMT OR 1074/1211 SPRING HILL #5 PB 6/85 2000 FTWD DWMH ==================================== 1945 45-2N-28-550E-0016-0020 1,162.49 JS JACKSON PROPERTIES LLC 2.490AC 6818 SOUTH COURT DRIVE TAMPA FL 33611 PT OF LOT 16 IN OR 1658/1048 1989 SOUT DW/MH ESMT PT OR 1043/798 ESMT OR 1187/159 SPRING HILL #5 PB 6/85 ==================================== 1946 45-2N-28-550E-0024-0000 HX 572.66 THORNTON KENNETH D & LEONA R 5.950AC 95195 BOBCAT LN FERNANDINA BEACH FL 32034 LOT 24 1998 SW/MH REDM IN OR 1180/1764 ESMT IN OR 849/803 SPRING HILL #5 PB 6/85 ==================================== 1947 46-2N-28-0000-0009-0000 7,195.87 TESTON EILEEN 1.640AC 95415 BARNWELL RD FERNANDINA BEACH FL 32034 IN OR 2127/553 (EX ST RD) MARSH LAND ==================================== 1948 50-2N-28-0000-0004-0000 63.22 KLARER MRS JOHN J 75.000AC C/O CRISP DANIEL T 1301 CHARTER CT EAST JACKSONVILLE BEACH FL 32225-2659 PT SW1/4 OF SEC 50-2N-28E IN DBK 119/340 (EX PT IN SOVEREIGN LANDS & PT IN OR 275/173) ==================================== 1949 51-2N-28-0000-0002-0000 49.60 KLARER JOHN J MRS 43.000AC C/O CRISP DANIEL T 4278 RAPALLO RD JACKSONVILLE FL 32244 PT E1/2 OF SEC 51-2N-28E IN DBK 119/340 (EX SOVEREIGN LANDS) ==================================== 1950 27-3N-28-1192-0009-0000 1,282.19 ROBINSON CREEK 34 LLC 0.000AC PO BOX 706 FERNANDINA BEACH FL 32035 LOT 9 SHELL COVE PBK 8/150 ==================================== 1951 27-3N-28-1192-0018-0000 1,407.21 ROBINSON CREEK 34 LLC 0.000AC PO BOX 706 FERNANDINA BEACH FL 32035 LOT 18 SHELL COVE PBK 8/150 ==================================== 1952 27-3N-28-1192-0019-0000 1,282.19 ROBINSON CREEK 34 LLC 0.000AC PO BOX 706 FERNANDINA BEACH FL 32035 LOT 19 SHELL COVE PBK 8/150 ==================================== 1953 27-3N-28-1192-0026-0000 1,282.19 MAGNOLIA HOMES INC 0.000AC 12543 HERBLORE DR JACKSONVILLE FL 32225 LOT 26 IN OR 2039/773 SHELL COVE PBK 8/150 ==================================== 1954 27-3N-28-1192-0027-0000 1,282.19 MAGNOLIA HOMES INC 0.000AC 12543 HERBLORE DR JACKSONVILLE FL 32225 LOT 27 IN OR 2039/843 SHELL COVE PBK 8/150 ==================================== 1955 27-3N-28-1192-0028-0000 1,282.19 MAGNOLIA HOMES INC 0.000AC 12543 HERBLORE DR JACKSONVILLE FL 32225 LOT 28 IN OR 2039/914 SHELL COVE PBK 8/150 ==================================== 1956 27-3N-28-1192-0029-0000 1,282.19 MAGNOLIA HOMES INC 0.000AC 12543 HERBLORE DR JACKSONVILLE FL 32225 LOT 29 IN OR 2039/877 SHELL COVE PBK 8/150 ==================================== 1957 27-3N-28-1192-0035-0000 1,282.19 ROBINSON CREEK 34 LLC 0.000AC PO BOX 706 FERNANDINA BEACH FL 32035 LOT 35 SHELL COVE PBK 8/150 ==================================== 1958 37-3N-28-0740-0184-0000 2,982.44 BRECKENRIDGE PROPERTY FUND 0.000AC 2016 LLC 2015 MANHATTAN BEACH BLVD #100 REDONDO BEACH CA 90278 LOT 184 IN OR 2134/145 HERON ISLES PHASE 1 REPLAT PB 7/152 ==================================== 1959 37-3N-28-0740-0212-0000 2,708.01 SAPIKOWSKI SANDRA KAYE 0.000AC 96080 STONEY GLEN CT YULEE FL 32097 LOT 212 IN OR 1927/1579 HERON ISLES PHASE 1 REPLAT PB 7/152 ==================================== 1960 37-3N-28-0741-0542-0000 1,420.31 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 542 IN OR 1984/781 HERON ISLES PHASE TWO C-1 PBK 8/77 ==================================== 1961 37-3N-28-0741-0543-0000 1,420.31 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 543 IN OR 1984/781 HERON ISLES PHASE TWO C-1 PBK 8/77 ==================================== 1962 37-3N-28-0741-0544-0000 1,420.31 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 544 IN OR 1984/781 HERON ISLES PHASE TWO C-1 PBK 8/77 ==================================== 1963 37-3N-28-0741-0570-0000 1,420.31 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 570 IN OR 1940/85 HERON ISLES PHASE TWO C-1 PBK 8/77 ==================================== 1964 37-3N-28-0743-0479-0000 1,443.40 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 479 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1965 37-3N-28-0743-0486-0000 1,443.40 ESB INVSTEMENTS LLC 0.000AC 95540 CLEMENTS ROAD FERNANDINA BEACH FL 32034 LOT 486 IN OR 2147/844 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1966 37-3N-28-0743-0487-0000 1,443.40 HERON ISLES JOINT VENTURE LLP 0.000AC 2955 HARTLEY RD STE 108 JACKSONVILLE FL 32257 LOT 487 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1967 37-3N-28-0743-0489-0000 1,443.40 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 489 IN OR 2139/1827 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1968 37-3N-28-0743-0494-0000 1,443.40 SEAWARD HOMES INC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 494 IN OR 2088/215 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1969 37-3N-28-0743-0495-0000 1,443.40 HERON ISLES JOINT VENTURE LLP 0.000AC 2955 HARTLEY RD STE 108 JACKSONVILLE FL 32257 LOT 495 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1970 37-3N-28-0743-0503-0000 1,443.40 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 503 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1971 37-3N-28-0743-0515-0000 1,443.40 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 515 IN OR 2139/1816 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1972 37-3N-28-0743-0519-0000 1,443.40 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 519 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1973 37-3N-28-0743-0520-0000 1,443.40 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 520 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1974 37-3N-28-0743-0521-0000 1,443.40 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 521 IN OR 2139/1816 HERON ISLES PHASE TWO C-2 PBK 8/132 ==================================== 1975 37-3N-28-0745-0727-0000 1,001.35 HERON ISLES JOINT VENTURE LLP 0.000AC 2955 HARTLEY RD STE 108 JACKSONVILLE FL 32257 LOT 727 HERON ISLES PHASE THREE C PBK 8/177 ==================================== 1976 37-3N-28-0745-0735-0000 1,001.35 HERON ISLES JOINT VENTURE LLP 0.000AC 2955 HARTLEY RD STE 108 JACKSONVILLE FL 32257 LOT 735 HERON ISLES PHASE THREE C PBK 8/177 ==================================== 1977 37-3N-28-0745-0736-0000 1,001.35 HERON ISLES JOINT VENTURE LLP 0.000AC 2955 HARTLEY RD STE 108 JACKSONVILLE FL 32257 LOT 736 HERON ISLES PHASE THREE C PBK 8/177 ==================================== 1978 37-3N-28-0745-0739-0000 1,001.35 HERON ISLES JOINT VENTURE LLP 0.000AC 2955 HARTLEY RD STE 108 JACKSONVILLE FL 32257 LOT 739 HERON ISLES PHASE THREE C PBK 8/177 ==================================== 1979 38-3N-28-0000-0001-0000 HX 5,423.76 BOWDEN DONNA M 0.000AC 96275 YAHTZEE LN YULEE FL 32097 IN OR 2112/1536 FPL ESMT IN OR 1635/1814 ==================================== 1980 38-3N-28-0000-0002-0000 745.85 OLIVER MARIA 2.180AC PO BOX 748 YULEE FL 32041-0748 PT FRAC SEC 38 PT OR 1508/386 & IN OR 1591/953 (EX 2-2 THRU 2-7 & 2-10) ==================================== 1981 38-3N-28-0000-0002-0010 HX 594.51 OLIVER MARIA 1.200AC P O BOX 748 YULEE FL 32041 PT OR 1508/386 EX 2-7 ESMT IN OR 232/597 ==================================== 1982 38-3N-28-0000-0002-0040 494.42 RUSS DONALD 0.000AC 46 WHIPORWILL RD NICHOLLS GA 31554 IN OR 317 PG 221 R 106948 ==================================== 1983 38-3N-28-0000-0003-0000 404.35 FOURTEENTH STREET PROPERTIES 0.000AC LLC 20 S 4TH ST FERNANDINA BEACH FL 32034 IN OR 2084/1007 R621699 ==================================== 1984 38-3N-28-0000-0012-0070 HX 393.67 LEIBMAN MARILYN C 0.000AC PO BOX 150 SOUND BEACH NY 11789 PT GOVT LOTS 1 & 2 OF SEC 38-3N-28E IN OR 2095/1659 {R567790 & 567991} ==================================== 1985 38-3N-28-0000-0012-0090 698.49 CINTRON EDDIE 0.000AC 4012 CHERRYBROOK LOOP FT MYERS FL 33966 IN OR 2131/1527 R568163 ==================================== 1986 38-3N-28-0000-0012-0120 532.26 JOHNS LISA L 0.000AC 85213 CUNO CREEK DRIVE YULEE FL 32097 PT GOVT LOT 2 OF SEC 38-3N-28E IN OR 2141/1483 {1978 REDMOND SW} ==================================== 1987 38-3N-28-0000-0012-0130 HX 2,235.69 FOWLER F ROGER 4.000AC 96166 PIRATES BLUFF ROAD YULEE FL 32097 PT GOVT LOT 2 OF SEC 38-3N-28E IN OR 648/1165 {1999 SPRINGWO DW/MH} ==================================== 1988 38-3N-28-0000-0012-0230 HX 162.22 CROSS DONALD W 0.000AC 96075 PIRATES BLUFF ROAD YULEE FL 32097 IN OR 737/1413 RP 107291 & 107292 ==================================== 1989 41-3N-28-0000-0002-0000 6,894.12 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 PT OF E WATERMAN GRANT SEC 41-3N-28E IN OR 1938/1054 BEING THEISLAND & SOVEREIGN LAND LEASE PT OF SEC 41-3N-28E & PT SEC 55-3N-28E IN OR 1987/1284 (EX UTIL ESMT PT OR 1528/682) {K/A ISLAND PARCEL} ==================================== 1990 41-3N-28-1250-000B-0000 677.07 LIGHTHOUSE POINTE DEV LLC 1.576AC PO BOX 17833 JACKSONVILLE FL 32245 PARCEL B IN OR 1938/1054 BEING TRACT B ESMT PT OR 1528/682 LIGHTHOUSE POINTE #1 PBK 6/157 ==================================== 1991 41-3N-28-1250-0020-0000 4,125.15 7849 JAMES ISLAND WAY JACKSONVILLE FL 32256 LOT 20 IN OR 2076/597 ESMT PT OR 1258/1035 LIGHTHOUSE POINTE PB 6/157 ==================================== 1992 41-3N-28-1250-0043-0000 626.00 TREVETT BUILDING SYSTEMS OF 0.000AC FLORIDA LLC PO BOX 17833 JACKSONVILLE FL 32245 LOT 43 IN OR 1950/1356 LIGHTHOUSE POINTE PB 6/157 ==================================== 1993 41-3N-28-1250-0052-0000 2,221.45 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 52 PT OR 1938/1054 ESMT PT OR 1701/837 ASSIGN OF ESMT PT OR 1796/300 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== rf rfntb DEL. TAX LIST 2017.indd 13 4/30/18 12:20 PM

PAGE 74

1994 41-3N-28-1250-0053-0000 1,086.85 TREVETT BUILDING SYSTEMS OF 0.000AC FLORIDA LLC PO BOX 17833 JACKSONVILLE FL 32245 LOT 53 IN OR 1950/1356 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 1995 41-3N-28-1250-0054-0000 1,086.85 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 54 IN OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 1996 41-3N-28-1250-0056-0000 1,086.85 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 56 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 1997 41-3N-28-1250-0057-0000 1,086.85 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 57 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 1998 41-3N-28-1250-0065-0000 944.14 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 65 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 1999 41-3N-28-1250-0070-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 70 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2000 41-3N-28-1250-0072-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 72 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2001 41-3N-28-1250-0073-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 73 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2002 41-3N-28-1250-0074-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 74 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2003 41-3N-28-1250-0075-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 75 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2004 41-3N-28-1250-0076-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 76 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2005 41-3N-28-1250-0085-0000 411.23 DJOKOTO EMMANUEL 0.000AC 13277 OCEAN MIST DR JACKSONVILLE FL 32258 LOT 85 IN OR 1804/1702 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2006 41-3N-28-1250-0091-0000 411.23 DJOKOTO EMMANUEL 0.000AC 13277 OCEAN MIST DR JACKSONVILLE FL 32258 LOT 91 IN OR 1907/24 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2007 41-3N-28-1250-0092-0000 411.23 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 92 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2008 41-3N-28-1250-0093-0000 411.23 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 93 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2009 41-3N-28-1250-0096-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 96 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2010 41-3N-28-1250-0098-0000 525.40 FRENES TOMAS & 0.000AC GROSSMAN RONALD & PO BOX 6 CHESTER SPRING PA 19425-0006 LOT 98 IN OR 1375/1480 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2011 41-3N-28-1250-0099-0000 525.40 GROSSMAN RONALD & 0.000AC FRENES TOMAS & PO BOX 6 CHESTER SPRING PA 19425-0006 LOT 99 IN OR 1375/1496 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2012 41-3N-28-1250-0102-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 102 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2013 41-3N-28-1250-0104-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 104 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2014 41-3N-28-1250-0106-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 106 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2015 41-3N-28-1250-0110-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 110 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2016 41-3N-28-1250-0111-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 111 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2017 41-3N-28-1250-0115-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 115 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2018 41-3N-28-1250-0117-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 117 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2019 41-3N-28-1250-0119-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 119 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2020 41-3N-28-1250-0120-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 120 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2021 41-3N-28-1250-0123-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 123 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2022 41-3N-28-1250-0124-0000 525.40 DJOKOTO EMMANUEL 0.000AC 13277 OCEAN MIST DR JACKSONVILLE FL 32258 LOT 124 IN OR 1870/35 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2023 41-3N-28-1250-0130-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 130 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2024 41-3N-28-1250-0131-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 131 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2025 41-3N-28-1250-0132-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 132 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2026 41-3N-28-1250-0133-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 133 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2027 41-3N-28-1250-0135-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 135 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2028 41-3N-28-1250-0136-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 136 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2029 41-3N-28-1250-0137-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 137 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2030 41-3N-28-1250-0138-0000 611.84 TREVETT BUILDING SYSTEMS OF 0.000AC FLORIDA LLC PO BOX 17833 JACKSONVILLE FL 32245 LOT 138 IN OR 1950/1356 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2031 41-3N-28-1250-0139-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 139 PT OR 1938/1061 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2032 41-3N-28-1250-0140-0000 611.84 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 140 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2033 41-3N-28-1250-0143-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 143 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2034 41-3N-28-1250-0144-0000 525.40 LIGHTHOUSE POINTE DEV LLC 0.000AC PO BOX 17833 JACKSONVILLE FL 32245 LOT 144 PT OR 1938/1054 LIGHTHOUSE POINTE #2 PB 7/145 ==================================== 2035 42-3N-28-0000-0001-0000 940.69 BLUE POTATO PROPERTIES LLC 0.000AC 4 SE 1ST STREET 2ND FLOOR MIAMI FL 33131 IN OR 1921/1762 IN SEC 42 & 43 ==================================== 2036 42-3N-28-0000-0003-0010 10,024.87 BARBER JAMES DANIEL 0.000AC 97573 CHESTER RIVER RD YULEE FL 32097 PT OF SEC 42-3N-28E &43-3N-28E IN OR 1982/374 BEING PARCELS 1 & 2 ==================================== 2037 42-3N-28-0000-0009-0020 417.38 LEVY KATHERINE I METZ (50%) & 0.650AC LEVY WAYNE M (25%) & LEVY KENNETH A (25%) 96014 BRIGHTON PLACE YULEE FL 32097 IN OR 1575/466 CASE #08-CP-83 ==================================== 2038 42-3N-28-0000-0012-0000 441.32 HARRIS LEONARD I JR EST 0.000AC 97304 WATER OAK RD YULEE FL 32097 PT OF LOT 12 IN OR 642/166 EX 12-5 & 12-6 ==================================== 2039 42-3N-28-0000-0013-0000 726.21 GROVE NANCY ANN TRUSTEE OF THE NANCY ANN GROVE LIVING TRUST 0.000AC 96082 PARK PLACE FERNANDINA BEACH FL 32034 LOT 19 (LESS S 85 FT) IN OR 2045/1849 R334387/R334388 1976 CENTAUR ==================================== 2040 42-3N-28-0000-0014-0010 441.32 BARBER LORI MICHELE 1.000AC 96845 CHESTER RD YULEE FL 32097 PT SEC 42-3N-28E RECD IN OR 1967/1891 ==================================== 2041 42-3N-28-0000-0014-0020 HX 1,357.73 BARBER JAMES D SR L/E 1.000AC JAMES DANIEL BARBER SR & 97573 CHESTER RIVER RD YULEE FL 32097 L/E IN OR 747/832 & OR 1815/21 ==================================== 2042 42-3N-28-0000-0015-0000 494.54 BARBER JAMES DANIEL 1.130AC 97573 CHESTER RIVER RD YULEE FL 32097 PT JOHN LOWE GRANT SEC 42-3N-28E IN OR 1982/374 BEING PARCEL 3 ==================================== 2043 42-3N-28-5080-0007-0010 3,117.52 PIRATES TRADING POST INC 0.000AC 96837 BLACKROCK ROAD YULEE FL 32097 PT OF LOT 7 (SEC 48) IN OR 752 PG 812 THIGPEN SURVEY DB 39/356 ==================================== 2044 42-3N-28-5080-0015-0090 284.84 ELLIS KRISTEN D & 1.000AC ELLIS KEITH DUANE 96797 BLACKROCK ROAD YULEE FL 32097 PT OF LOT 15 W OF R/W IN OR 1500/1681 ESMT OR 1608/165 EX ESMT PT OR 1610/226 THIGPEN SURVEY DB 39/356 ==================================== 2045 42-3N-28-5080-0015-0160 838.49 RAWLS EDWIN E 1.840AC 96785 BLACKROCK RD YULEE FL 32041 PT LOT 15 (EX S-17) IN OR 1781/793 THIGPEN SURVEY DB 39/356 ==================================== 2046 42-3N-28-5080-0030-0030 969.57 AUTRY VANZOLA & 1.130AC ROBERTSON GLOIRA & 87684 ROSES BLUFF ROAD YULEE FL 32097 PT OF LOT 30 IN SEC 43 IN OR 878/1909 1978 CULL SW/MH EX R/W OR 317/563 ESMT IN OR 637/721 THIGPEN SURVEY DB 39/356 ==================================== 2047 42-3N-28-5080-0037-0020 359.45 STEWART WILLIAM ELSWORTH 2.000AC PO BOX 1151 CALLAHAN FL 32011-1151 PT LOT 37 IN OR 1341/1988 THIGPEN SURVEY DBK 39/356 ==================================== 2048 43-3N-28-0000-0012-0000 298.06 MITCHELL KENNETH L 0.000AC 96798 CHESTER ROAD YULEE FL 32097 PT JOHN LOWE GRANT SEC 43-3N-28E IN OR 1819/548 ==================================== 2049 43-3N-28-0000-0016-0060 978.00 WILLIAMS VERNON SR 1.770AC 540 YEW CT ALTAMONTE SPRINGS FL 32714 IN OR 879/1272 & ESMT (16-6 & 16-8) R235648 & R235649 & R235650 ==================================== 2050 43-3N-28-0000-0017-0110 1,004.08 GIORDANO ROBERT & BARBARA 2.540AC 76309 LONG LEAF LOOP YULEE FL 32097 PT OR 1262/719 ==================================== 2051 43-3N-28-1510-0014-0000 605.05 ADAMS HOMES OF NORTHWEST 0.000AC FLORIDA INC 3000 GULF BREEZE PKWY GULF BREEZE FL 32563 LOT 14 PT OR 2027/444 OAKS AT BRISTOL PB 8/4 ==================================== 2052 43-3N-28-509B-0012-0000 HX 2,097.48 TAUSCHER LILLIAN G EST 0.000AC C/O JODI A TAUSCHER-ROBINSON 97081 MORGANS WAY YULEE FL 32097 LOTS 12 & 13 IN OR 795/430 PIRATES WOOD 2 UNR ==================================== 2053 43-3N-28-509C-0012-0000 490.44 MCFADDEN KYLE E 0.000AC 310 COMMONS WY GOOSE CREEK SC 29445 LOT 12 PIRATES WOOD #3 S/D UNR ==================================== 2054 43-3N-28-509C-0015-0000 HX 1,612.27 GRIFFIN PATRICK R & 0.000AC DANIELS LACEY L (JT/RS) 97434 LAFFITES WAY YULEE FL 32097 LOT 15 IN OR 1858/1337 PIRATES WOOD 3 UNR ==================================== 2055 43-3N-28-509C-0019-0000 HX 1,262.86 SOUTHWELL DWIGHT L & MARLA D 0.000AC 97441 PIRATES POINT ROAD YULEE FL 32097 LOT 19 IN OR 928/1456 PIRATES WOOD 3 UNR ==================================== 2056 43-3N-28-509C-0031-0000 HX 913.43 THOMPSON SHAWN D & LAURA C 0.000AC 97253 PIRATES POINT RD YULEE FL 32097 LOT 31 IN OR 1940/553 PIRATES WOOD 3 UNR ==================================== 2057 43-3N-28-509D-0009-0000 3,327.99 WILSON ADAM & HILARY 0.000AC 96105 DOLPHIN WAY YULEE FL 32097 LOT 9 IN OR 2066/313 PIRATES WOOD 4 UNR ==================================== 2058 43-3N-28-509D-0010-0000 3,301.66 FRASER DAVID K TRUSTEE 0.000AC OF DAVID K FRASER REV TRUST 97552 PIRATES POINT ROAD YULEE FL 32097 LOT 10 IN OR 1611/665 PIRATES WOOD # 4 UNR ==================================== 2059 43-3N-28-509D-0012-0000 2,752.85 DOBBINS JOHN 0.000AC 24 SAPALO DR ST MARYS GA 31558 LOT 12 IN OR 1887/879 PIRATES WOOD # 4 UNR ==================================== 2060 43-3N-28-509D-0022-0000 HX 2,181.50 HOLDER CRAIG T & MAROLYN K 0.000AC 97352 PIRATES POINT ROAD YULEE FL 32097 LOT 22 IN OR 821 PG 1736 PIRATES WOOD 4 UNR ==================================== 2061 43-3N-28-509D-0029-0000 1,447.56 BLAKE CHRISTOPHER T & RHONDA L 0.000AC 97289 PIRATES POINT ROAD YULEE FL 32097 LOT 29 IN OR 855/612 PIRATES WOOD 4 UNR ==================================== 2062 43-3N-28-509D-0056-0000 HX 1,414.47 BRANAN CHARLES R 0.000AC 97528 PIRATES WAY YULEE FL 32097 LOT 56 IN OR 599 PG 436 PIRATES WOOD 4 UNR ==================================== 2063 43-3N-28-509D-0067-0000 2,140.43 BERRYHILL ALMA F EST & 0.000AC HUGH D & BONNIE B ARNOLD P O BOX 524 NAHUNTA GA 31553 LOT 67 IN OR 299 PG 358 PIRATES WOOD 4 UNR 1/2 HX INT ==================================== 2064 43-3N-28-509D-0068-0000 HX 2,946.21 POTEAT SHIRLEY A 0.000AC 97358 PIRATES WAY YULEE FL 32097 LOT 68 & E1/2 OF LOT 69 IN OR 802/408 FPL ESMT IN OR 966/425 PIRATES WOOD 4 UNR ==================================== 2065 43-3N-28-509E-0009-0000 HX 763.45 CARTWRIGHT JAMES E & LINDA K 0.000AC 97253 CARAVEL TRAIL YULEE FL 32097 LOT 9 OR 347/509 & 348/457 PIRATES WOOD 5 UNR ==================================== 2066 43-3N-28-509F-0008-0000 HX 1,884.24 KIDD KELLEY 0.000AC P O BOX 7 YULEE FL 32041-0007 LOT 8 IN OR 913/1627 PIRATES WOOD #6 UNR ==================================== 2067 43-3N-28-5100-0008-0000 1,662.99 SHEARIN JAMES G EST 1.000AC C/O MARY SHEARIN 96650 CHESTER RD YULEE FL 32097 LOT 8 IN OR 1581/1949 CHESTER MEADOWS UNIT 1 UNR AKA LOT 8-E LOFTON CHESTER TRACT ==================================== 2068 43-3N-28-5110-0013-0010 1,405.95 MITCHELL JARELL DASHAWN 1.000AC 96633 CHESTER RD YULEE FL 32097 PT OF LOT 11 THIGPEN SURV A/K/A TRACT 13 (S-1) LOFTON CHESTER ROAD IN OR 2082/690 TRUSTY HULSLANDER SUB UNR ==================================== 2069 44-3N-28-0000-0001-0020 1,515.48 DAVIS RHONDA J 0.000AC 145 RICHMOND DR ST JOHNS FL 32259 IN OR 2041/780 A/K/A LOT 2 UNR SUB ==================================== 2070 44-3N-28-5300-0011-0000 HX 240.10 WHITLEY ROBERT T 1.020AC 97317 AMY DR YULEE FL 32097 LOT 11 IN OR 1395/750 R408041 & R408042 PINE RIDGE PB 5/143 ==================================== 2071 44-3N-28-5300-0012-0000 HX 641.50 SHRADER RORIE JENNINGS 1.030AC 97343 AMY DR YULEE FL 32097 LOT 12 IN OR 1993/552 PINE RIDGE PB 5/143 ==================================== 2072 44-3N-28-5300-0016-0000 HX 235.24 LARRISON ANNETTA CREWS J & 1.120AC JONES ALTON F SR (F&D)(ROS) 97412 AMY DR YULEE FL 32097 LOT 16 R568006 IN OR 674/344 PINE RIDGE PB 5/143 ==================================== 2073 44-3N-28-5300-0020-0000 HX 442.92 WYLIE ROBERT M & 1.010AC WYLIE ROBERT F JR (JT/RS) 97326 AMY ROAD YULEE FL 32097 LOT 20 IN OR 1498/996 1995 SKYL DW/MH PINE RIDGE PB 5/143 ==================================== 2074 45-3N-28-0000-0003-0130 348.23 CONFIDENTIAL 3.350AC CONFIDENTIAL ==================================== 2075 45-3N-28-0240-0011-0000 3,634.38 CAPITAL MARKETS GROUP 0.000AC PO BOX 16597 FERNANDINA BEACH FL 32034 LOT 11 & PARCEL 13-7 SEC 38 IN OR 2050/720 CAPTAINS POINTE PB 7/109 ==================================== 2076 46-3N-28-0000-0007-0450 252.04 SCOTT STANLEY V (1/2 INT) & 0.640AC SCOTT STANLEY V TRUSTEE 10624 NW HIGHWAY 225A OCALA FL 34482 PT OF SECT SOUTH OF LANCEFORD OAKS SUB PB 5/145 PT OR 691/57 & PT OR 1718/1885 ==================================== 2077 46-3N-28-5055-0005-0000 8,002.19 4-Y PROPERTIES LLC 0.000AC 96203 MARSH HEN RD FERNANDINA BEACH FL 32034 LOTS 5 & 6 IN OR 2033/1048 BARNWELL PLANTATION PB 5/34 ==================================== 2078 46-3N-28-5065-0001-0000 HX 3,930.62 GROVE NANCY ANN TRUSTEE OF THE NANCY ANN GROVE LIVING TRUST 0.000AC 96082 PARK PLACE FERNANDINA BEACH FL 32034 LOT 1 IN OR 2045/1856 THE COVE @ OYSTER BAY PB 6/79 ==================================== 2079 46-3N-28-5065-0002-0000 1,181.90 GROVE NANCY ANN TRUSTEE OF THE NANCY ANN GROVE LIVING TRUST 0.000AC 96082 PARK PL FERNANDINA BEACH FL 32034 LOT 2 IN OR 2045/1841 THE COVE @ OYSTER BAY PB 6/79 ==================================== 2080 46-3N-28-507F-0001-0000 HX 1,410.20 COX DORIS A 0.000AC 96033 HIDDEN MARSH LANE FERNANDINA BEACH FL 32034 LOT 1 IN OR 885/644 FIDDLERS WALK PB 5/237 ==================================== 2081 46-3N-28-507F-0016-0000 HX 2,090.54 STECKLER EDWARD H TRUSTEE 0.000AC OF EDWARD H STECKLER REV TRUST 95008 SEA HAWK PL FERNANDINA BEACH FL 32034 LOT 16 IN OR 1799/434 FIDDLERS WALK PB 5/237 ==================================== 2082 46-3N-28-509H-0008-0000 HX 4,376.72 MOORE DAVID & PENNY 0.000AC 96205 HIGH POINTE DR FERNANDINA BEACH FL 32034 LOT 8 IN OR 1647/362 HIGH POINTE PB 6/273 ==================================== 2083 46-3N-28-510O-0001-0000 HX 2,155.58 LEE CARL EDWARD & LELA MAE L/E CARL E & LELA M LEE TRUSTEES 1.280AC 95345 BARNWELL ROAD FERNANDINA BEACH FL 32034 LOT 1 L/E OR 1677/110 LANCEFORD OAKS PB 5/145 ==================================== 2084 46-3N-28-5482-0002-0000 1,237.78 PEACOCK JAMES C JR 0.000AC 34 NORTH 14TH STREET FERNANDINA BEACH FL 32034 LOT 2 PT OR 1916/1497 OYSTER BAY #3 PB 5/397 ==================================== 2085 46-3N-28-5482-0003-0000 HX 7,449.47 PEACOCK JAMES C JR 0.000AC 34 NORTH 14TH ST FERNANDINA BEACH FL 32034 LOT 3 (F/K/A 1-4) PT OR 1916/1497 OYSTER BAY #3 PB 5/397 ==================================== 2086 46-3N-28-5484-0010-0000 HX 3,439.89 CAPPS CAROLYN 0.000AC 96087 LIGHTWIND DRIVE FERNANDINA BEACH FL 32034 LOT 10 IN OR 1092/1574 OYSTER BAY #5 PB 6/12 ==================================== 2087 46-3N-28-5500-0011-0000 HX 1,136.78 HARTLEY FRED B 0.000AC 96149 RIVER MARSH BEND FERNANDINA BEACH FL 32034 LOT 11 IN OR 673 PG 925 RIVERSIDE SUB PB 5/231 ==================================== 2088 46-3N-28-576A-0006-0000 HX 2,391.91 SABO JOHN 0.000AC 97096 MILL POND LN FERNANDINA BEACH FL 32034 LOT 6 IN OR 2111/176 SPANISH OAKS UNIT 1-A PB 6/99 ==================================== 2089 46-3N-28-5800-0003-0000 719.63 SCOTT STANLEY V 0.000AC HAYLO FARMS 10624 NW HIGHWAY 225A OCALA FL 34482 LOT 3 PT OR 711/1622 SUMMER ESTATES PB 6/245 ==================================== 2090 46-3N-28-6205-0034-0000 2,611.73 LENDRY HOMES LLC 0.000AC 4745 SUTTON PARK CT STE # 503 JACKSONVILLE FL 32224 LOT 34 IN OR 2115/1971 WATERWAY OAKS AT OYSTER BAY HARBOUR REPLAT PB 7/289 ==================================== 2091 48-3N-28-0130-0009-0000 HX 252.78 SHEFFIELD THOMAS J & CARINA 0.000AC 97183 DIAMOND ST YULEE FL 32097 LOT 9 IN OR 2027/1420 BENCHMARK GLEN PB5/219 ==================================== 2092 48-3N-28-0130-0010-0000 911.95 STROUD ROBERT & MARY 0.000AC 96144 GREEN PINE ROAD YULEE FL 32097 LOT 10 1996 SPRI DWMH IN OR 1439/42 R816101 & R816102 BENCHMARK GLEN PB5/219 ==================================== 2093 48-3N-28-0130-0049-0000 HX 611.30 STEPHENS MICHAEL E 0.000AC 97160 GLEN STREET YULEE FL 32097 LOT 49 IN OR 1596/1548 2002 CHNC TW/MH CONSERVATION ESMT OR 942/1471 BENCHMARK GLEN REPLAT PB 6/168 ==================================== 2094 50-3N-28-0000-0002-0000 4,861.48 TODD DEBRA BROOK 37.000AC 98234 SWAMP FEVER LN YULEE FL 32097 PT WM G CHRISTOPHER GRANT SEC 50-3N-28E & PT OF JOHN W LOWE GRANT SEC 44-3N-28E IN OR 2025/226 (EX UTIL ESMT IN OR 1260/1501 & ESMT IN OR 791/1339 & EX PT IN OR 786/1800) ==================================== 2095 50-3N-28-0000-0002-0010 776.95 TODD DEBRA B 2.000AC 98234 SWAMP FEVER LN YULEE FL 32097 PT WM G CHRISTOPHER GRANT SEC 50-3N-28E IN OR 1857/939 (EX UTIL ESMT IN OR 1260/1500) ==================================== 2096 50-3N-28-0000-0002-0020 HX 1,827.67 THRIFT DEBRA BROOK 2.000AC 98234 SWAMP FEVER LN YULEE FL 32097 PT WM G CHRISTOPHER GRANT SEC 50-3N-28E IN OR 1244/894 (EX UTIL ESMT IN OR 1260/1499) ==================================== 2097 50-3N-28-0000-0016-0090 554.52 WALTON DAVID 0.980AC 96045 CONNER LN YULEE FL 32097 IN OR 1933/1757 R497800 PARCELS 16-9 & 17 ==================================== 2098 50-3N-28-0000-0016-0160 564.12 POTEAT SHIRLEY A 0.000AC 97358 PIRATES WAY YULEE FL 32097 IN OR 1257/1787 ==================================== 2099 50-3N-28-0000-0016-0170 559.87 ISLAND MISSION 1.010AC 86730 PAGES DAIRY RD YULEE FL 32097 IN OR 2042/532 ==================================== 2100 50-3N-28-0000-0017-0020 367.90 ISLAND MISSION 0.000AC 86730 PAGES DAIRY RD YULEE FL 32097 PT WM G CHRISTOPHER DONATION SEC 50-3N-28E IN OR 1940/768 ==================================== 2101 50-3N-28-0000-0022-0010 50.02 RCG HOLDINGS INC 0.440AC C/O SILVERFIELD DEV COMPANY 10175 FORTUNE PKWY UNIT 1005 JACKSONVILLE FL 32256-6756 PT OR 817/373 & OR 1298/1019 EX 22-2 22-3 22-8 & 22-9 EX BLACKROCK HAMMOCK PB 6/286 SEE 50-3N-28-016B ==================================== 2102 50-3N-28-0000-0029-0370 943.33 ROWLAND HEATHER D 0.000AC 96215 MARANATHA RD YULEE FL 32097 IN OR 2025/1814 2002 SKYL TW ==================================== 2103 50-3N-28-0000-0035-0000 HX 948.48 VANZANT OSCAR D 1.000AC 96245 CONFEDERATE OAKS DRIVE YULEE FL 32097 OR 756/1217 & OR 763/412 RP 262 PARCELS 35 & 35-4 ==================================== 2104 50-3N-28-0000-0039-0010 731.94 PARKER MICHAEL W 1.710AC 2900 PARK SQUARE PL FERNANDINA BEACH FL 32034 IN OR 2105/659 ==================================== 2105 50-3N-28-0000-0042-0030 HX 13,098.52 SCARBORO JOHN P JR & FRANCES E 0.000AC 96510 BLACKROCK ROAD YULEE FL 32097 IN OR 1035/683 & OR 1038/1902 PARCELS 42-3 & 43-1 ==================================== 2106 50-3N-28-016B-0017-0000 795.21 NORTON DEAN 0.000AC 622 CR 662 #23 CEDAR BLUFF AL 35959 LOT 17 IN OR 2099/1404 BLACKROCK HAMMOCK PB 6/286 ==================================== 2107 50-3N-28-0305-0001-0000 176.08 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR SUITE 704 SAINT AUGUSTINE FL 32092 LOT 1 IN OR 2106/422 BLACKROCK PARK PBK 8/175 ==================================== 2108 50-3N-28-0305-0005-0000 176.08 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE # 704 ST AUGUSTINE FL 32092 LOT 5 IN OR 2143/1324 BLACKROCK PARK PBK 8/175 ==================================== 2109 50-3N-28-0305-0007-0000 176.08 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR SUITE 704 SAINT AUGUSTINE FL 32092 LOT 7 IN OR 2102/1441 BLACKROCK PARK PBK 8/175 ==================================== 2110 50-3N-28-0305-0008-0000 176.08 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE 704 ST AUGUSTINE FL 32092 LOT 8 IN OR 2138/1620 BLACKROCK PARK PBK 8/175 ==================================== 2111 50-3N-28-0305-0015-0000 176.08 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE 704 ST AUGUSTINE FL 32092 LOT 15 IN OR 2146/1058 BLACKROCK PARK PBK 8/175 ==================================== 2112 50-3N-28-0305-0016-0000 176.08 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE STE # 704 ST AUGUSTINE FL 32092 LOT 16 IN OR 2114/466 BLACKROCK PARK PBK 8/175 ==================================== 2113 50-3N-28-0305-0017-0000 176.08 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE 704 ST. AUGUSTINE FL 32092 LOT 17 IN OR 2138/1648 BLACKROCK PARK PBK 8/175 ==================================== 2114 50-3N-28-0305-0018-0000 176.08 BLACKROCK PARK LLP 0.000AC 2955 HARTLEY ROAD STE 108 JACKSONVILLE FL 32257 LOT 18 BLACKROCK PARK PBK 8/175 ==================================== 2115 50-3N-28-0305-0019-0000 176.08 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE 704 ST AUGUSTINE FL 32092 LOT 19 IN OR 2146/1013 BLACKROCK PARK PBK 8/175 ==================================== 2116 50-3N-28-0305-0020-0000 176.08 BLACKROCK PARK LLP 0.000AC 2955 HARTLEY ROAD STE 108 JACKSONVILLE FL 32257 LOT 20 BLACKROCK PARK PBK 8/175 ==================================== 2117 50-3N-28-5280-0008-0000 HX 1,164.39 BRASWELL STEVEN W & BELINDA A 0.870AC P O BOX 735 FERNANDINA BEACH FL 32035-0735 LOT 8 IN OR 639/290 GLENWOOD S/D R/P DBK 199/409 ==================================== 2118 63-3N-28-0000-0004-0000 106.51 PINEY ISLAND PARTNERSHIP 45.500AC 437 E MONROE STREET SUITE 100 JACKSONVILLE FL 32202 LOT 3 S OF CREEK S1/2 OF LOT 4 & ALL LOT 5 MARSH LAND IN OR 177/299 PT OR 1253/1846 & OR 236/535 & PT OR 1201/1678 & OR 1429/1157 EX PARCEL 4-1 ==================================== 2119 64-3N-28-0000-0002-0000 266.15 SWANN S A EST 143.000AC C/O MRS E C OCONNER 36 LYMAN RD NORTHAMPTON MA 01060 N1/2 N & W OF RIVER FRAC W1/2 OF 1 MARSH LAND ==================================== 2120 09-3N-29-0000-0003-0040 4,473.80 SORRELLS LEA M 0.000AC CO-TRUSTEES OF BILLY J & LEA M 85790 BLACKMON RD YULEE FL 32097 IN OR 1530/1774 3-4,3-9 & N1/2 OF A FERREIRA REPLAT ==================================== 2121 01-6N-29-1300-0061-0000 7,334.67 WHTV AMELIA PARTNERS LLC 0.000AC 1258 OLDE TOWNE RD ALEXANDRIA VA 22307 LOT 61 IN OR 2039/407 MARSH CREEK VILLAGE 1 PB 4/18 ==================================== 2122 01-6N-29-V020-0403-0000 12,085.98 RAY STUART N & MICHELE R 0.000AC 12203 LUCAS LANE ANCHORAGEE KY 40223 UNIT 403 IN OR 1277/875 BEACHSIDE VILLAS CONDO OR 805/64 ==================================== 2123 01-6N-29-V020-0421-0000 15,634.19 COLE ALICE WIGHT & 0.000AC WIGHT ROBERT B 3333 WISCONSIN AVE NW APT 504 WASHINGTON DC 20016 UNIT 421 IN OR 2010/1681 BEACHSIDE VILLAS CONDO OR 805/64 ==================================== 2124 01-6N-29-V040-3030-0000 3,330.27 STAFFORD LAURA C 0.000AC 829 FOREST STREET HINESVILLE GA 31313 VILLA UNIT 3030 IN OR 1347/1873 CLUB VILLAS ==================================== 2125 01-6N-29-V040-3060-0000 3,564.01 COLLINS SUSAN L & 0.000AC CROSBY BARBARA D ET AL 225 WEST 83RD ST APT 10C NEW YORK NY 10024 VILLA UNIT 3060 IN OR 2054/1413 CLUB VILLAS ==================================== 2126 01-6N-29-V090-3211-0000 3,497.28 STANWICH MORTGAGE LOAN TRUST 0.000AC CHRISTIANA TRUST TRUSTEE 3801 KENNETT PIKE STE C200 GREENVILLE DE 19807 VILLA UNIT 3211 IN OR 1968/1882 FAIRWAY OAKS VILLAS PARCEL 9 ==================================== 2127 01-6N-29-V120-1324-0000 6,289.53 LOWTHERS BRUCE & LESLIE 0.000AC 3437 DUNLIN SHORE CT NORCROSS GA 30092 VILLA UNIT 1324 IN OR 2074/1380 SHIP WATCH VILLAS ==================================== 2128 01-6N-29-V14A-1016-0000 8,821.94 MURRAY KEVIN E 0.000AC 81 SANDPIPER CT 8 THOMAS MO LONDON E1W-1AS UK VILLA UNIT 1016 IN OR 1452/333 CAPTAINS COURT VILLAS ==================================== 2129 01-6N-29-V14A-1022-0000 8,821.94 BARNES W M KEN 0.000AC PO BOX 305 WOODBURY GA 30293 VILLA UNIT 1022 IN OR 984/465 CAPTAINS COURT VILLAS ==================================== 2130 01-6N-29-V14B-1161-0000 3,877.14 SPEAS JOANN S 0.000AC 5100 SHARON ROAD 612-EAST CHARLOTTE NC 28210 VILLA UNIT #1161 IN OR 730 PG 57 BEACH WALKER VILLAS ==================================== 2131 01-6N-29-V160-2109-0000 3,078.07 JARDINE WALTER B 0.000AC PO BOX 930 DOUGLAS GA 31534-0930 VILLA UNIT 2109 IN OR 1340/507 BEACH WOOD VILLAS ==================================== 2132 01-6N-29-V17A-0277-0000 2,145.99 CHOW WILLIAM H & MARGARET M & CARTER MICHAEL & C D (JT/RS) 0.000AC 10116 HIGH HILL COURT GREAT FALLS VA 22066 UNIT 277 IN OR 1237/1591 & OR 1312/966 IN OR 1624/899 & OR 1624/900 SANDCASTLES OR 359/238 ==================================== 2133 02-6N-29-DCCO-0001-0210 88.66 AMELIA ISLAND HOLDING COMPANY ATTN JAMES O HARDWICK 0.160AC 4115 ORTEGA BLVD JACKSONVILLE FL 32210 PT FRAC SEC 6-1N-29E PAR 1-21 PT OR 463/443 BEING EXHIBIT G & BEING ONLY PT IN SEC 6 LYING NORTH OF PHASE 4 OF DUNES CLB VILLAS CONDO OR 1497/247 (EX PT OR 821/421,OR 1700/1211, SEA DUNES CONDO OR 424/36) {HB 1721 SEC 4} ==================================== 2134 02-6N-29-V003-1602-0000 6,725.11 LEARSY FLORENCE LEE TRUST 0.000AC FLORENCE LEE LEARSY TRUSTEE 4615 N PARK AVE APT 1101 CHEVY CHASE MD 20815-4516 UNIT 1602 IN OR 2021/188 SEA DUNES OR 424/1 ==================================== 2135 00-00-30-0080-0001-0000 HX 618.50 METTS DIANA 0.000AC 116 BONNIEVIEW ROAD FERNANDINA BEACH FL 32034 LOT 1 R787901 & R787902 IN OR 624 PG 773 AMELIA MARSH SUB PB 4/104 ==================================== 2136 00-00-30-0087-0001-00C0 HX 4,449.28 MARTIN ROBERT B & NANCY J 0.000AC 8030 FIRST COAST HWY BUCCANEER TRAIL UNIT 1C FERNANDINA BEACH FL 32034 UNIT 1-C IN OR 506 PG 1024 AMELIA RETREAT II ==================================== 2137 00-00-30-0090-000A-1130 4,659.23 COOK KATHLEEN HATCHER 0.000AC 5045 HOPEWELL ROAD MUSELLA GA 30166 UNIT A-113 IN OR 1738/976 & OR 1846/493 AMELIA SURF & RACQUET CLUB #2 OR 358 PG 675 ==================================== 2138 00-00-30-0090-000A-1140 3,712.90 COOK KATHLEEN H TRUSTEE 0.000AC OF KATHLEEN H COOK REVOC TRUST 5045 HOPEWELL ROAD EAST MUSELLA GA 31066-3525 UNIT A-114 IN OR 1750/1420 AMELIA SURF & RACQUET CLUB #2 OR 358 PG 675 ==================================== 2139 00-00-30-010A-0002-0130 6,081.53 FLUKER N E SR & JOHNNIE M 0.000AC C/O NICHOLAS E FLUKER JR 905 STATE STREET WAYCROSS GA 31501 BLOCK 2 LOT 13 OR 84 PG 689 AMERICAN BEACH SUB 1 PB 2/42 ==================================== 2140 00-00-30-010A-0003-0182 1,402.60 WILLIAMS PEARL & 0.000AC WILLIAMS LINCOLN C JR 756 SUNKEN MEADOW JACKSONVILLE FL 32218 BLOCK 3 S25 FT OF E75 FT OF 18 IN OR 403 PG 60 AMERICAN BEACH SUB 1 PB 2/42 ==================================== 2141 00-00-30-010A-0004-0250 3,127.68 WILLIAMS PEARL H & LINCOLN C 0.000AC TRUSTEES OF PEARL H WILLIAMS 952 TURTLE CREEK DR NORTH JACKSONVILLE FL 32218 BLOCK 4 LOT 25 IN OR 1591/1949 AMERICAN BEACH SUB # 1 PB 2/42 ==================================== 2142 00-00-30-010A-0007-0500 2,767.24 C M BROOKS LLC 0.000AC 809 SHIPWATCH DR JACKSONVILLE FL 32225 BLOCK 7 LOT 50 IN OR 2113/832 AMERICAN BEACH SUB 1 PB 2/42 ==================================== 2143 00-00-30-010A-0007-0550 1,862.92 EMORY EUGENE K 0.000AC 5576 GREEG ST FERNANDINA BEACH FL 32034 BLOCK 7 LOT 55 IN OR 1062/1690 AMERICAN BEACH SUB # 1 PB 2/42 ==================================== 2144 00-00-30-010B-0011-0050 807.18 RANA AQEEL A 0.000AC 5733 CRESTVIEW RD JACKSONVILLE FL 32210 BLOCK 11 LOT 5 IN OR 1970/1 AMERICAN BEACH SUB 2 PB 3/6 ==================================== 2145 00-00-30-010B-0011-0060 807.18 RANA AQEEL A 0.000AC 5733 CRESTVIEW RD JACKSONVILLE FL 32210 BLOCK 11 LOT 6 IN OR 1970/2 AMERICAN BEACH 2 PB 3/6 ==================================== 2146 00-00-30-010B-0011-0080 2,557.08 CHATMAN JACOB L & ETTY ANN 0.000AC 1136 LAFAYETTE STREET WAYNE PA 19087 BLOCK 11 LOT 8 IN OR 1589/1490 AMERICAN BEACH SUB #2 PB 3/6 ==================================== 2147 00-00-30-010B-0011-0100 807.18 KING FRANCINA C (2/3INT) & 0.000AC KING ALONZO D (1/6INT) & KING PILAR B (1/6INT) 100 BLAIR RD E-8 ST SIMONS GA 31522 BLOCK 11 LOT 10 OR 460/296 & OR 875/1135 AMERICAN BEACH SUB #2 PB 3/6 ==================================== 2148 00-00-30-010B-0011-0110 807.18 BAUGH RUBYE E ESTATE 0.000AC C/O ALTAMEASE E AISTON 1453 W 14TH ST JACKSONVILLE FL 32209 BLOCK 11 LOT 11 AMERICAN BEACH SUB #2 PB 3/6 ==================================== 2149 00-00-30-010B-0012-0070 1,195.03 TRUE BLUE VENTURES LLC 0.000AC 2344 FORBES ST JACKSONVILLE FL 32204 BLOCK 12 LOT 7 IN OR 1884/438 AMERICAN BEACH SUB #2 PB3/6 ==================================== 2150 00-00-30-010B-0012-0080 859.47 FREDERICK NICKOLE E & 0.000AC PERSON CASSANDRA J PO BOX 2486 ORLANDO FL 32802-2486 BLOCK 12 LOT 8 IN OR 1388/849 AMERICAN BEACH SUB 2 PB 3/6 ==================================== 2151 00-00-30-010B-0015-0070 1,197.14 JONES-JACKSON CYNTHIA DEBORAH 0.000AC 5381 HALA CT JACKSONVILLE FL 32224 BLOCK 15 LOTS 7 & 8 IN OR 2049/1307 AMERICAN BEACH SUB #2 PB 3/6 ==================================== rf rfntb DEL. TAX LIST 2017.indd 14 4/30/18 12:20 PM

PAGE 75

2152 00-00-30-010B-0015-0110 614.56 JONES-JACKSON CYNTHIA DEBORAH 0.000AC 5381 HALA COURT JACKSONVILLE FL 32224 BLOCK 15 LOT 11 IN OR 2049/1307 AMERICAN BEACH SUB #2 PB 3/6 ==================================== 2153 00-00-30-010B-0015-0120 614.56 JONES CARLTON D & BARBARA A 0.000AC 5381 HALA COURT JACKSONVILLE FL 32224 BLOCK 15 LOT 12 IN OR 1414/1584 AMERICAN BEACH SUB #2 PB 3/6 ==================================== 2154 00-00-30-010B-0016-0060 863.45 COLLINS ANDREW A & DEBBIE A 0.000AC 1202 WILKES WAY MARIETTA GA 30064 BLOCK 16 LOT 6 IN OR 1025/1733 AMERICAN BEACH SUB #2 PB3/6 ==================================== 2155 00-00-30-010B-0017-0100 HX 1,664.51 HOLMES JOHN T 0.000AC 1705 LEWIS STREET FERNANDINA BEACH FL 32034 BLOCK 17 LOTS 10 & 11 IN OR 523 PG 357 AMERICAN BEACH SUB 2 PB 3/6 ==================================== 2156 00-00-30-010B-0017-0120 531.34 HOLMES JOHN T 0.000AC 1705 LEWIS STREET FERNANDINA BEACH FL 32034 BLOCK 17 LOT 12 IN OR 689 PG 625 AMERICAN BEACH SUB 2 PB 3/6 ==================================== 2157 00-00-30-010B-0018-0070 1,816.14 SMITH KEVIN B & 0.000AC SMITH CHERYL R & PO BOX 1392 ST MARYS GA 31558-1392 BLOCK 18 LOT 7 PT OR 1318/926 AMERICAN BEACH 2 PB 3/6 ==================================== 2158 00-00-30-010B-0018-0090 1,142.30 GADSON ROSELLA EST 0.000AC 1713 LEONARD ST FERNANDINA BEACH FL 32034 BLOCK 18 LOT 9 IN OR 2003/1801 AMERICAN BEACH SUB #2 PB 3/6 ==================================== 2159 00-00-30-010B-0018-0130 614.56 NISSEN NATHANIEL P 0.000AC 5304 SHORE DR ST AUGUSTINE FL 32086 BLOCK 18 LOT 13 IN OR 1973/889 AMERICAN BEACH 2 PB 3/6 ==================================== 2160 00-00-30-010B-0018-0140 566.54 TRUE BLUE VENTURES LLC 0.000AC 2344 FORBES ST JACKSONVILLE FL 32204 BLOCK 18 LOT 14 PT OR 1863/1036 AMERICAN BEACH SUB 2 PB 3/6 ==================================== 2161 00-00-30-010B-0018-0150 566.54 TRUE BLUE VENTURES LLC 0.000AC 2344 FORBES ST JACKSONVILLE FL 32204 BLOCK 18 LOT 15 PT OR 1863/1036 AMERICAN BEACH SUB 2 PB 3/6 ==================================== 2162 00-00-30-010B-0018-0160 566.54 GREEN THERESA 0.000AC 1097 REIMAN ST JACKSONVILLE FL 32209 BLOCK 18 LOT 16 IN OR 2053/1373 AMERICAN BEACH SUB 2 PB 3/6 ==================================== 2163 00-00-30-010C-0001-0270 5,441.55 DOLLISON BOBBY 0.000AC 5553 GREGG STREET FERNANDINA BEACH FL 32034 BLOCK 1 LOT 27 IN OR 293 PG 275 AMERICAN BEACH 3 UNIT 1 PB 3/19 ==================================== 2164 00-00-30-010C-0001-0280 6,533.61 HUGHES ANTHONY ET AL 0.000AC 441 W 16TH STREET JACKSONVILLE FL 32206 BLOCK 1 LOT 28 IN OR 1265/127 & OR 2091/1444 AMERICAN BEACH 3 UNIT 1 PB 3/19 ==================================== 2165 00-00-30-010C-0002-0100 2,961.46 HOOKER WILLIE F SR 0.000AC C/O W F HOOKER JR 8125 BAHIA BLANCA 8 JACKSONVILLE FL 32256 BLOCK 2 LOT 10 AMERICAN BEACH #3 UNIT #1 PB3/19 ==================================== 2166 00-00-30-010C-0002-0110 HX 6,759.07 DOLLISON BOBBY 0.000AC 5553 GREGG STREET FERNANDINA BEACH FL 32034 BLK 2 LOT 11 IN OR 664/1092 AMERICAN BEACH #3 UNIT 1 PBK 3/19 ==================================== 2167 00-00-30-010C-0002-0180 2,695.15 ROBINSON W RUSSELL 0.000AC 208 CHAPEL VALLEY LANE APEX NC 27502 BLOCK 2 LOT 18 IN OR 1214/905 AMERICAN BEACH #3 UNIT #1 PB 3/19 ==================================== 2168 00-00-30-010D-0005-0010 5,322.18 DOBSON ERIN C 0.000AC 6538 KINLOCK DR W JACKSONVILLE FL 32219 BLOCK 5 LOTS 1 & 2 & ABND R/W RESOLUTION 97-200 PT OR 1915/980 AMERICAN BEACH 3 UNIT 2 PB 4/1 ==================================== 2169 00-00-30-010D-0005-0030 HX 1,947.35 GAFFNEY JOHNNY 0.000AC 1748 LEWIS ST FERNANDINA BEACH FL 32034 BLOCK 5 LOT 3 IN OR 1153/227 & OR 1910/488 AMERICAN BEACH 3 SECT #2 PB4/1 ==================================== 2170 00-00-30-010D-0006-0020 1,616.59 CINTRON EDWIN & SHEA 0.000AC 684 TIMBERMILL LN ORANGE PARK FL 32065 BLOCK 6 LOT 2 IN OR 2040/244 AMERICAN BEACH 3 SEC 2 PB 4/1 ==================================== 2171 00-00-30-010D-0006-0040 1,155.52 DOBSEN ERIN C 0.000AC 6538 KINLOCK DR W JACKSONVILLE FL 32219 BLOCK 6 LOT 4 & ABND R/W RESOLUTION 97-200 PT OR 1915/980 AMERICAN BEACH 3 UNIT 2 PB 4/1 ==================================== 2172 00-00-30-010D-0011-0020 855.91 JONES-JACKSON CYNTHIA DEBORAH 0.000AC 5381 HALA COURT JACKSONVILLE FL 32224 BLOCK 11 LOT 2 IN OR 2049/1307 AMERICAN BEACH #3 SEC #2 PB 4/1 ==================================== 2173 00-00-30-0120-0024-0000 1,472.27 ROWE CAROLYN G TRUSTEE OF 0.000AC KENNETH & CAROLYN ROWE 85272 AMARYLLIS CT FERNANDINA BEACH FL 32034 LOT 24 IN OR 1426/844 ASKINS FIVE POINTS PB 0/58 ==================================== 2174 00-00-30-0131-0010-0000 6,127.53 LOGAN-AMELIA ISLAND LLC 0.000AC PO BOX 285 WHEELERSBURG OH 45694 LOT 10 IN OR 1908/707 AZALEA POINTE PB 6/164-165 ==================================== 2175 00-00-30-0131-0014-0000 HX 4,951.65 MCCAFFREY MAURICE E & KAY B 0.000AC 95159 SPRING BLOSSOM LN FERNANDINA BEACH FL 32034-5582 LOT 14 IN OR 986/210 AZALEA POINTE PB 6/164-165 ==================================== 2176 00-00-30-0140-0011-0000 2,108.27 EMBRICK MARK C & STEPHANIE L 0.000AC 382 ASHBOURNE TRAIL LAWRENCEVILLE GA 30043 LOTS 11 & 12 IN OR 1965/48 1966 BILT SW/MH BELLE GLADE SUB PB 3/55 ==================================== 2177 00-00-30-0150-0005-0000 2,296.09 STURGES C MITCHELL EST & 0.000AC MERRITT TEREASA M 517 EMANUEL CHURCH RD BRUNSWICK GA 31523 LOT 5 IN OR 1578/636 & OR 2053/868 BUENA VISTA PB 5/19 1/3 HX INT ==================================== 2178 00-00-30-0170-0009-0000 HX 1,041.77 ALEXANDER TERRY & 0.000AC PEAVY KRISTI A & JERETT ROY 847 CASHEN DR FERNANDINA BEACH FL 32034 LOT 9 L/E OR 571/1033 & OR 1347/1950 IN OR 1593/1351 CASHEN PARK SUB PB 2/49 ==================================== 2179 00-00-30-0174-0036-0000 HX 1,710.22 QUINN TAMMY B 0.000AC 2018 CASHENWOOD DR FERNANDINA BEACH FL 32034 LOT 36 OR 575/1005 PROBATE FILE 96-90-CP CASHEN WOOD SUB PB5/221 ==================================== 2180 00-00-30-0174-0051-0000 HX 1,293.55 LEYENDECKER RONALD N 0.000AC 2361 CASHENWOOD DRIVE FERNANDINA BEACH FL 32034 LOT 51 IN OR 766 PG 1951 CASHEN WOOD SUB PB 5/221 ==================================== 2181 00-00-30-019C-0021-0000 HX 1,260.61 NABORS ANDREW 0.000AC 4749 ST MARC CT UNIT 21 FERNANDINA BEACH FL 32034 UNIT 21 IN OR 2121/1502 THE COLONY CONDO OR 653/712 ==================================== 2182 00-00-30-019C-0030-0000 2,378.92 4762 ST MARC CT LAND TRUST 0.000AC HIGHLINK LLC TRUSTEE 4745 SUTTON PARK CT #601 JACKSONVILLE FL 32224 UNIT 30 IN OR 2133/1428 THE COLONY CONDO OR 653/712 ==================================== 2183 00-00-30-019C-0033-0000 2,303.80 THE COLONY ASSOCIATION 0.000AC OF NASSU COUNTY INC 1022 MAIN ST STE D DUNEDIN FL 34698 UNIT 33 IN OR 1861/320 THE COLONY CONDO OR 653/712 ==================================== 2184 00-00-30-019C-0050-0000 HX 1,103.19 THARIN RUSSELL JR & JANET 0.000AC 4814 WESTWIND CT FERNANDINA BEACH FL 32034 UNIT 50 IN OR 1116/1603 THE COLONY CONDO OR 653/712 ==================================== 2185 00-00-30-0200-0002-0000 713.85 DRURY LINDA DARLENE 0.000AC 2732 EASTWOOD DR DECATUR GA 30032 LOT 2 SADLER ESTATES PB 2/68 IN OR 1295/1160 DRURY HOMES PB 5/3 ==================================== 2186 00-00-30-0200-0004-0000 HX 862.63 KIMBALL BEVERLY ANN EST 0.000AC C/O JEFFREY B KIMBALL 1889 DRURY RD FERNANDINA BEACH FL 32034 LOT 4 IN OR 1676/1851 DRURY HOMES PB 5/3 ==================================== 2187 00-00-30-021C-0054-0000 HX 610.97 ZUMBAR KEVIN S & KATHLEEN A 0.000AC 2136 LAURA LEIGH CT FERNANDINA BEACH FL 32034 LOT 54 IN OR 768/1738 EGANS BLUFF #3 PB 5/243 ==================================== 2188 00-00-30-021E-0027-0000 HX 2,594.87 JOHNSON ALAN & TINA 0.000AC 2547 LE SABRE PLACE FERNANDINA BEACH FL 32034 LOT 27 IN OR 1911/1387 EGANS BLUFF EAST PB 5/367 ==================================== 2189 00-00-30-0220-0002-0000 306.65 HOWE GLYNOVA J 0.000AC 300 WOODLAKE DR NEWNAN GA 30265 LOT 2 PT OR 277 PG 135 EVERETT ACRES PB 5/11 ==================================== 2190 00-00-30-0220-0004-0000 306.65 HOWE GLYNOVA J 0.000AC 300 WOODLAKE DR NEWNAN GA 30265 LOT 4 PT OR 277 PG 135 EVERETT ACRES PB 5/11 ==================================== 2191 00-00-30-0220-0013-0000 306.65 SIMON VINCENT F 0.000AC 7037 PRELLIE STREET JACKSONVILLE FL 32210 LOT 13 PT OR 1627/1872 EVERETT ACRES PB 5/11 ==================================== 2192 00-00-30-0220-0015-0000 581.28 SALARY HENRY M & MARVA J 0.000AC 6825 RHODE ISLAND DR E JACKSONVILLE FL 32209 LOTS 15 & 17 IN OR 366 PG 36 EVERETT ACRES PB 5/11 ==================================== 2193 00-00-30-0220-0025-0000 HX 221.33 DARLINGTON RICHARD F & 0.000AC DARLINGTON KELLI LADAWN ET AL PO BOX 15824 FERNANDINA BEACH FL 32035-3114 LOT 25 R498078 IN OR 1221/1636 & OR 2070/1451 EVERETT ACRES PB 5/11 ==================================== 2194 00-00-30-024B-0045-0000 HX 1,241.13 HENDERSON FRANCES E EST 0.000AC C/O DWIGHT DAVID TURNER 1447 HOLLY DR FERNANDINA BEACH FL 32034 LOT 45 FIVE POINTS #2 PB 3/35 ==================================== 2195 00-00-30-024B-0050-0000 908.72 FOURNIER JOHN E & KAMIE 0.000AC 1428 HOLLY DR FERNANDINA BEACH FL 32034 IN OR 2129/199 FIVE POINTS 2 PB 3/35 R434056 ==================================== 2196 00-00-30-0250-0055-0000 3,623.20 EDMONDSON JOHN STEPHEN 0.000AC 6539 FAIRLAWN DRIVE MCLEAN VA 22101 LOT 55 IN OR 1728/893 FLORENCE POINT PB 4/109 & 110 ==================================== 2197 00-00-30-0254-0005-0000 3,218.42 DUFFY TAWN CHRISTOPHER 0.000AC 1473 FOUNTAIN DR FERNANDINA BEACH FL 32034 LOT 5 IN OR 1794/1398 FOREST PINES SUB PB 6/8 ==================================== 2198 00-00-30-026G-201A-0000 2,026.27 SHACKLEFORD ROBERT 0.000AC 31255 PARADISE COMMONS #913 FERNANDINA BEACH FL 32034 UNIT 201A IN OR 1919/279 VILLAGE CENTER @ GATEWAY TO AMELIA CONDO ==================================== 2199 00-00-30-026G-201H-0000 2,978.14 WIDE SKY PROPERTIES LLC 0.000AC 961687 GATEWAY BLVD STE 201-H FERNANDINA BEACH FL 32034 UNIT 201H IN OR 1314/19 VILLAGE CENTER @ GATEWAY TO AMELIA CONDO ==================================== 2200 00-00-30-0280-0014-0000 447.21 SIMON VINCENT F 0.000AC 7037 PRELLIE STREET JACKSONVILLE FL 32210 LOT 14 PT OR 1627/1872 GURNIE OAKS SUB PB 5/2 ==================================== 2201 00-00-30-0280-0016-0000 306.65 BROWN MERLIN A & 0.000AC BUGGS LISA J (JTROS) 5018 LINCOLN CIRCLE SOUTH JACKSONVILLE FL 32209 LOT 16 IN OR 953/1544 GURNIE OAKS SUB PB5/2 ==================================== 2202 00-00-30-0280-0017-0000 306.65 SAUNDERS MONICA L & RONNIE L 0.000AC 342 GOODWIN STREET JACKSONVILLE FL 32204 LOT 17 IN OR 698 PG 911 GURNIE OAKS SUB PB 5/2 ==================================== 2203 00-00-30-0280-0018-0000 1,215.05 HARRIS IAN C & 0.000AC BACON CEDRIC G & RODRIC L 1280 NW 58TH TR SUNRISE FL 33313 LOT 18 L/E OR 620/854 & OR 758/1690 OR 1749/1651 CASE #11-CP-160 GURNIE OAKS SUB PB 5/2 ==================================== 2204 00-00-30-0280-0022-0000 808.43 YOUNG-SMITH JOYCE 0.000AC 1916 WEST 20TH STREET JACKSONVILLE FL 32209 LOTS 22 & 24 IN OR 1104/933 GURNIE OAKS SUB PB 5/2 ==================================== 2205 00-00-30-028V-0003-03B0 HX 2,666.65 CALDWELL SARAH A 0.000AC 95024 BARCLAY PL UNIT 3 FERNANDINA BEACH FL 32034 BLDG 3 UNIT 3B IN OR 1633/1992 HARRISON COVE VILLAS OR 1370/1244 ==================================== 2206 00-00-30-0290-0001-0020 1,237.12 RUSS LISA VALERIE & 0.000AC KINDT CHARLES & DALE S (T/I/C) 85057 MINER RD YULEE FL 32097 SLY 95 FT OF LOTS 1 & 2 PT OR 966/500 RP 2253 & 2254 HIGHWAY ESTATES PB 3/9 ==================================== 2207 00-00-30-0310-0018-0000 HX 606.15 CHABOT LEONARD J 0.000AC 2101 TALBOT COURT FERNANDINA BEACH FL 32034 LOT 18 IN OR 795/576 ISLAND GROVE PHASE 1 PB 5/44 ==================================== 2208 00-00-30-031B-0011-0000 HX 860.36 HILL ERNEST R SR TRUSTEE 0.000AC ERNEST R HILL SR LIVING TRUST 1726 BLUE HERON LANE FERNANDINA BEACH FL 32034 LOT 11 IN OR 1517/129 ISLAND BLUFF SUB PB 5/92 ==================================== 2209 00-00-30-031B-0023-0000 HX 616.35 BARRY MICHAEL D & LAUREN L 0.000AC 1711 BLUE HERON LANE FERNANDINA BEACH FL 32034 LOT 23 OR 489/207 ISLAND BLUFF SUB PB 5/92 ==================================== 2210 00-00-30-0320-0006-0000 2,059.49 DUBBERLY JAMES C & LAURA C 0.000AC 95239 AMELIA NATIONAL PKWY FERNANDINA BEACH FL 32034 LOT 6 IN OR 2091/572 KENNETH COURT SUB PB 3/50 ==================================== 2211 00-00-30-034B-0007-0020 2,996.84 SHAVE JON 1.500AC 801 PARKVIEW PLACE EAST FERNANDINA BEACH FL 32034 31-3N-28 S1/2 OF LOT 7 (EX S-5) IN OR 1970/254 ESMT IN OR 1327/1773 E O FRIEND SUB DB Z/165 ==================================== 2212 00-00-30-034B-0018-0000 HX 19,094.99 DAVIS JOHN L & BETTE M 7.790AC 1940 SYCAMORE LN FERNANDINA BEACH FL 32034 LOTS 18 & 17 & PT OF SEC 31-3N-28E IN OR 852/1689 & OR 1927/795 E O FRIEND SUB PB Z/165 ==================================== 2213 00-00-30-034C-0002-0000 1,367.93 FULLWOOD SHERMAN ROBERT L/E 0.000AC JONI E CLEMENS 515 J I TAYLOR CT FERNANDINA BEACH FL 32034 LOT 2 (EX S-1) REPLAT OF LOT 28 IN OR 1934/157 & OR 1934/161 E O FRIENDS DB 165/142 ==================================== 2214 00-00-30-0360-0005-0000 7,647.19 SMITH CHARLES L & BETH L 0.000AC 95044 SPRING TIDE LN FERNANDINA BEACH FL 32034 LOT 5 IN OR 2074/357 LEEWARD COVE PB 5/77 ==================================== 2215 00-00-30-0380-0041-0000 HX 1,117.32 ROWLAND JANAN LYNN 0.000AC 2327 AMELIA ROAD FERNANDINA BEACH FL 32034 LOT 41 PT OR 784/684 MARLIN PARK SUB PB 3/14 ==================================== 2216 00-00-30-0380-0042-0000 656.87 ROWLAND JANAN L & 0.000AC ROWLAND JANAN L GUARDIAN FOR 2327 AMELIA ROAD FERNANDINA BEACH FL 32034 LOT 42 IN OR 1698/929 ESMT IN OR 1525/1289 MARLIN PARK SUB 3/14 ==================================== 2217 00-00-30-042C-000E-0050 HX 2,179.76 HOMEFREE PROPERTY SOLUTIONSLLC 0.000AC 339 PARKVIEW AVE GAITHERSBURG MD 20878 BLOCK E S1/2 OF LOT 5 & ALL LOT 7 IN OR 2104/1329 OAK GROVE #2 PB 2/60 ==================================== 2218 00-00-30-042C-000G-0060 HX 1,565.61 HASPEL ROY L 0.000AC 769 MOURNING DOVE LN FERNANDINA BEACH FL 32034 BLOCK G LOT 6 IN OR 1982/291 OAK GROVE UNIT 2 PB 2/60 ==================================== 2219 00-00-30-042C-000G-0080 1,008.58 HICKS KENNETH D 0.000AC 1963 OAK DR FERNANDINA BEACH FL 32034 BLOCK G LOT 8 RP 2060 IN OR 1833/1061 OAK GROVE UNIT 2 PB 2/60 ==================================== 2220 00-00-30-042D-000I-0030 1,005.73 WILLIAMS DAVID R JR & LAUREN M 0.000AC 770 WREN DR FERNANDINA BEACH FL 32034 BLOCK I LOT 3 & IN OR 2087/824 OAK GROVE SUB 3 PB 3/51 ==================================== 2221 00-00-30-042D-000I-0050 HX 1,285.55 755 PELICAN LN FERNANDINA BEACH FL 32034 BLOCK I LOT 5 (EX 58.5 FT) & LOT 6 (LESS E8 1/2 FT) IN OR 1499/489 OAK GROVE SUB 3 PB 3/51 ==================================== 2222 00-00-30-042D-000M-0050 1,146.16 GIBSON NANCY 0.000AC 2202 WILL HARDEE ROAD FERNANDINA BEACH FL 32034 IN OR 833/1607 OAK GROVE #3 PB 3/51 ==================================== 2223 00-00-30-042D-000N-0050 1,911.41 DRURY JOHNNY C EST 0.000AC 1893 PALM DRIVE FERNANDINA BEACH FL 32034 BLOCK N LOT 5 IN OR 1124/1818 OAK GROVE SUB #3 PB 3/51 ==================================== 2224 00-00-30-042D-000P-0040 1,879.14 TAYLOR JIMMY M 0.000AC 749 WAX WING LN FERNANDINA BEACH FL 32034 BLOCK P LOTS 4 & 5 IN OR 1932/1254 1995 FLEETWOOD DW/MH OAK GROVE SUB #3 PB 3/51 ==================================== 2225 00-00-30-042D-000P-0060 HX 601.87 TAYLOR JIMMY M 0.000AC 749 WAX WING LANE FERNANDINA BEACH FL 32034 BLOCK P LOT 6 2003 DW/MH FTWD IN OR 412 PG 229 OAK GROVE SUB 3 PB 3/51 ==================================== 2226 00-00-30-042D-000P-0070 805.08 KILGORE GEORGE B & (ROS) 0.000AC JEAN B TAYLOR 507 SOUTH 17TH ST FERNANDINA BEACH FL 32034 BLOCK P LOT 7 RP 177 IN OR 772/366 OAK GROVE SUB 3 PB 3/51 ==================================== 2227 00-00-30-042D-000P-0080 874.16 COLON MICHAEL A 0.000AC 97253 CARAVEL TRAIL YULEE FL 32097 BLOCK P LOT 8 IN OR 887/1209 R567607 & R567608 OAK GROVE SUB 3 PB 3/51 ==================================== 2228 00-00-30-0438-0003-0000 5,555.47 JONES CARLTON D & BARBARA A 0.000AC 5381 HALA COURT JACKSONVILLE FL 32224 LOTS 3 & 4 IN OR 1035/804 OCEAN BLVD EST #1 PB 6/279 ==================================== 2229 00-00-30-043B-0001-0000 4,424.32 FARIS JANET E 0.000AC 1552 BLUE HERON LN FERNANDINA BEACH FL 32034 LOT 1 IN OR 1904/1413 OAK RIDGE #2 PB 5/155 ==================================== 2230 00-00-30-043C-0013-0000 HX 3,180.09 KELLEY MARY JO L/E 0.000AC 2117 OAK BLUFF COURT FERNANDINA BEACH FL 32034 LOT 13 IN OR 1940/1675 & OR 1940/1723 OAK RIDGE #3 PB5/220 ==================================== 2231 00-00-30-0440-0001-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 1 RIVERBEND PBK 8/182 ==================================== 2232 00-00-30-0440-0002-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 2 RIVERBEND PBK 8/182 ==================================== 2233 00-00-30-0440-0003-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 3 RIVERBEND PBK 8/182 ==================================== 2234 00-00-30-0440-0004-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 4 RIVERBEND PBK 8/182 ==================================== 2235 00-00-30-0440-0005-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 5 RIVERBEND PBK 8/182 ==================================== 2236 00-00-30-0440-0008-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 8 RIVERBEND PBK 8/182 ==================================== 2237 00-00-30-0440-0009-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 9 RIVERBEND PBK 8/182 ==================================== 2238 00-00-30-0440-0010-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND 0.000AC LLC 3675 PINE ST JACKSONVILLE FL 32205 LOT 10 RIVERBEND PBK 8/182 ==================================== 2239 00-00-30-0440-0011-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 11 RIVERBEND PBK 8/182 ==================================== 2240 00-00-30-0440-0012-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 12 RIVERBEND PBK 8/182 ==================================== 2241 00-00-30-0440-0013-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 13 RIVERBEND PBK 8/182 ==================================== 2242 00-00-30-0440-0014-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 14 RIVERBEND PBK 8/182 ==================================== 2243 00-00-30-0440-0015-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC L3675 PINE ST JACKSONVILLE FL 32205 LOT 15 RIVERBEND PBK 8/182 ==================================== 2244 00-00-30-0440-0016-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 16 RIVERBEND PBK 8/182 ==================================== 2245 00-00-30-0440-0017-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 17 RIVERBEND PBK 8/182 ==================================== 2246 00-00-30-0440-0018-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 18 RIVERBEND PBK 8/182 ==================================== 2247 00-00-30-0440-0019-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 19 RIVERBEND PBK 8/182 ==================================== 2248 00-00-30-0440-0020-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 20 RIVERBEND PBK 8/182 ==================================== 2249 00-00-30-0440-0021-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 21 RIVERBEND PBK 8/182 ==================================== 2250 00-00-30-0440-0022-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 22 RIVERBEND PBK 8/182 ==================================== 2251 00-00-30-0440-0024-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 24 RIVERBEND PBK 8/182 ==================================== 2252 00-00-30-0440-0025-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 25 RIVERBEND PBK 8/182 ==================================== 2253 00-00-30-0440-0026-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 26 RIVERBEND PBK 8/182 ==================================== 2254 00-00-30-0440-0028-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 28 RIVERBEND PBK 8/182 ==================================== 2255 00-00-30-0440-0029-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 29 RIVERBEND PBK 8/182 ==================================== 2256 00-00-30-0440-0030-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 30 RIVERBEND PBK 8/182 ==================================== 2257 00-00-30-0440-0033-0000 1,656.06 SUMMERWOODS OF AMELIA ISLAND LLC 0.000AC 3675 PINE ST JACKSONVILLE FL 32205 LOT 33 RIVERBEND PBK 8/182 ==================================== 2258 00-00-30-044A-0004-0030 2,894.98 PATEL LISA 0.000AC 3030 AMELIA ROAD FERNANDINA BEACH FL 32034 3-2N-28 PT OF LOT 4 IN OR 2068/618 OCEAN BREEZE SUB PB 1/11 ==================================== 2259 00-00-30-044A-0025-0030 531.34 OCEAN BREEZE OF AMELIA LLC 0.800AC 414 OLD HARD RD STE 502 FLEMING ISLAND FL 32003 PT LOT 25 IN OR 1926/1880 (EX ESMT IN OR 220/369 & EX PT IN OR 388/528 & PT IN PBK 8/91) OCEAN BREEZE SUB PBK 1/11 ==================================== 2260 00-00-30-044B-0028-0010 10,091.08 THE ASPIRE AT AMELIA II LLC 6.030AC C/O ERIC L WEISS ESQ 260 PEACHTREE ST NW STE 2700 ATLANTA GA 30303 PT LOT 28 (S-1) IN OR 2051/198 (EX RD R/W) OCEAN BREEZE FARMS PB 2/19 ==================================== 2261 00-00-30-044B-0028-0012 8,763.88 THE ASPIRE AT AMELIA II LLC 1.050AC 3017 AMELIA RD FERNANDINA BEACH FL 32034 PT LOT 28 IN OR 2051/189 (EX RD R/W) OCEAN BREEZE FARMS PB 2/19 ==================================== 2262 00-00-30-044B-0028-0014 3,582.63 THE ASPIRE AT AMELIA II LLC 0.000AC 3021 AMELIA ROAD FERNANDINA BEACH FL 32034 PT OF LOT 28 IN OR 2051/194 (EX RD R/W) OCEAN BREEZE FARMS SUB PB 2/19 ==================================== 2263 00-00-30-044B-0091-0020 1,357.92 FRENCH DEAN D 0.000AC 903 AMELIA DR FERNANDINA BEACH FL 32034 5-2N-28 S-2 PT OF LOTS 91 & 92 IN OR 975/1185 OCEAN BREEZE FARMS PB 2/19 ==================================== 2264 00-00-30-044B-0093-0000 7,682.43 PO BOX 471 FERNANDINA BEACH FL 32035 E 1/2 OF LOT 93 IN OR 1488/1661 EX R/W OR 119/230 & 93-1 ESMT OR 1711/646 OCEAN BREEZE FARMS PB 2/19 ==================================== 2265 00-00-30-044B-0105-0002 5,595.17 SKYWAY AMELIA LLC 0.000AC 86271 MEADOWFIELD BLUFFS RD YULEE FL 32097 PT W1/2 OF LOT 105 OF SUB OF SEC 3-2N-28E PBK 1-5 & PT W1/2 OF S1/2 OF LOT 6 OF OCEAN BREEZE FARMS PBK 1-11 & PT OF ABND HIRTH RD & PT OF FRAC SEC 7-2N-28E IN OR 2147/1012 ==================================== 2266 00-00-30-044D-0032-0000 1,648.63 D S WARE HOMES LLC 0.000AC 6101 GAZEBO PARK PL N STE 105 JACKSONVILLE FL 32257 LOT 32 IN OR 2025/153 DUNES OF AMELIA PHASE 1 PBK 8/88 ==================================== 2267 00-00-30-046F-0005-0000 HX 947.54 MISCHLEY WALTER A & DEBORAH L 0.000AC 1637 OCEAN FOREST DR FERNANDINA BEACH FL 32034 LOT 5 IN OR 601 PG 598 OCEAN FOREST PB 5/124 ==================================== 2268 00-00-30-046F-0024-0000 HX 4,946.03 SINGLETON BRIAN 0.000AC 1638 OCEAN FOREST DR FERNANDINA BEACH FL 32034 LOT 24 IN OR 1980/125 OCEAN FOREST PB 5/124 ==================================== 2269 00-00-30-0510-0004-0000 HX 1,026.46 MENTZELL CAROL A 0.000AC 1511 PLANTATION OAKS LANE FERNANDINA BEACH FL 32034 LOT 4 IN OR 664 PG 838 PLANTATION OAKS # 1 PB 4/116 ==================================== 2270 00-00-30-0513-0029-0000 1,197.14 THOMSON MARK S & DENISE 0.000AC PO BOX 714 BUNNELL FL 32110 LOT 29 IN OR 1071/1539 PLANTATION OAKS #3 PB 5/144 ==================================== 2271 00-00-30-0540-0006-0000 1,904.37 BARNARD CODY A L/E 0.000AC DONALD E ROWE & 2040 RAYON ROAD FERNANDINA BEACH FL 32034 LOTS 6 & 8 L/E OR 1514/470 RAYON TERRACE PB 3/31 ==================================== 2272 00-00-30-056O-0021-0000 1,598.99 ROWE CAROLYN G TRUSTEE OF 0.000AC KENNETH & CAROLYN ROWE 85272 AMARYLLIS CT FERNANDINA BEACH FL 32034 LOT 21 IN OR 1426/834 RIVER OAKS OF AMELIA 2 PB6/111 ==================================== 2273 00-00-30-056O-0022-0000 6,833.31 PERSISTENCE HOLDINGS LTD 0.000AC 1276 LEEWARD HIGHWAY PROVIDENCIALES TKCA-1ZZ TURKS & CAICOS LOT 22 F/K/A S-3 OF LOT 64 OF OCEAN BREEZE FARMS PB 2/19 IN OR 2125/843 RIVER OAKS OF AMELIA 2 PB6/111 ==================================== 2274 00-00-30-0600-0001-0220 3,647.22 DRURY DARLENE 0.000AC 2732 EASTWOOD DR DECATUR GA 30032 BLOCK 1 LOT 22 E 1/2 OF 23 L/E IN OR 33/199 & 348/636 & OR 348 PG 635 SADLER ESTATES PB 2/68 ==================================== 2275 00-00-30-0600-0002-0020 11,190.29 SPENCER-BELL PROPERTIES LLC 0.000AC 4756 SADDLEHORN TRAIL MIDDLEBURG FL 32068-3278 BLOCK 2 W93.75 FT OF LOT 2 IN OR 1542/125 ESMT PT OR 1203/651 SADLER ESTATES PB 2/68 ==================================== 2276 00-00-30-0600-0002-0071 608.52 AMELIA LANDINGS PROPERTY 0.000AC OWNERS ASSOCIATION INC 5440 FIRST COAST HWY FERNANDINA BEACH FL 32034 BLOCK 2 PRT LOTS 7 & 8 IN OR 544 PG 905 ESMT OR 1572/78 SADLER ESTATES PB 2/68 ==================================== 2277 00-00-30-0610-0001-0000 HX 2,667.46 BARCARO MARY ANN 0.000AC 1383 SHADOW WOODS FERNANDINA BEACH FL 32034 LOT 1 IN OR 772/1369 SHADOW WOODS SUB PB 4/88 ==================================== 2278 00-00-30-0640-0025-0000 HX 1,987.04 WINGATE JOY MIXON EST 0.000AC C/O MEGHAN JOY WINGATE 1467 ROBIN HOOD DRIVE FERNANDINA BEACH FL 32034 LOT 25 PT OR 275/424 & L/E OR 512/235 SHERWOOD FOREST SUB PB 5/10 ==================================== 2279 00-00-30-065S-0200-0000 3,441.36 AMELIA PROPERTIES LLC 0.000AC 5211 S FLETCHER AV FERNANDINA BEACH FL 32034 UNIT 200 IN OR 1987/1763 SOUTH FLETCHER PROFESSIONAL CENTER CONDO OR 1504/510 ==================================== 2280 00-00-30-065S-0201-0000 2,589.04 AMELIA PROPERTIES LLC 0.000AC 5211 S FLETCHER AV FERNANDINA BEACH FL 32034 UNIT 201 IN OR 1987/1763 SOUTH FLETCHER PROFESSIONAL CENTER CONDO OR 1504/510 ==================================== 2281 00-00-30-065S-0202-0000 2,495.43 AMELIA PROPERTIES LLC 0.000AC 5211 S FLETCHER AV FERNANDINA BEACH FL 32034 UNIT 202 IN OR 1987/1763 SOUTH FLETCHER PROFESSIONAL CENTER CONDO OR 1504/510 ==================================== 2282 00-00-30-065S-0203-0000 2,803.36 AMELIA PROPERTIES LLC 0.000AC 5211 S FLETCHER AV FERNANDINA BEACH FL 32034 UNIT 203 IN OR 1987/1763 SOUTH FLETCHER PROFESSIONAL CENTER CONDO OR 1504/510 ==================================== 2283 00-00-30-0740-0060-0020 HX 712.96 PAGE BOBBIE S MARDEGAN 1.100AC 2633 AMELIA ROAD FERNANDINA BEACH FL 32034 PT OF LOTS 60 61 IN OR 570/1213 SUB PT OF SEC 4 PB 0/59 ==================================== 2284 00-00-30-0741-0093-0000 1,613.25 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 93 IN OR 1992/1048 OCEAN BREEZE AT AMELIA PB 8/91 ==================================== 2285 00-00-30-0741-0101-0000 1,613.25 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR STE 704 ST AUGUSTINE FL 32092 LOT 101 IN OR 1992/1048 OCEAN BREEZE AT AMELIA PB 8/91 ==================================== 2286 00-00-30-0760-0004-0170 8,520.80 ECHARD BRIAN D & KATHRYN A 0.000AC TRUSTEES OF BEEK TRUST PO BOX 511 FERNANDINA BEACH FL 32035-0511 PT OF LOT 4 IN OR 1710/348 ESMT PT OR 1826/395 SUB OF SO PT SEC 12 DB 39/292 ==================================== 2287 00-00-30-0760-0006-0020 HX 3,292.09 ABERSON JAMES E JR & 1.670AC BEVERLY AMY A 4820 FIRST COAST HWY FERNANDINA BEACH FL 32034 PT OF LOT 6 IN OR 729/658 SUB OF SO PT SEC 12 DB 39/292 ==================================== 2288 00-00-30-0760-0042-0000 43.10 PHILIPS JANE G EST 0.000AC 1641 PHILIPS MANOR RD FERNANDINA BEACH FL 32034 PT OF LOT 42 LYING E OF LANDS IN OR 297/583 & S OF LANDS IN PB 4/90 SUB OF SEC 12 DBK 39/292 ==================================== 2289 00-00-30-0780-0003-0000 20,837.91 SUMMERWOODS OF AMELIA ISLAND 10.000AC LLC 3675 PINE ST JACKSONVILLE FL 32205 LOT 3 IN OR 1828/1989 ESMT OR 1601/536 AMELIA SUB OF SEC 15 DB Y/128 ==================================== 2290 00-00-30-0780-0019-0080 HX 987.42 WILKES CHARLES R & CAROLYN 0.000AC 4856 WHY ROAD FERNANDINA BEACH FL 32034 PT OF LOT 19 OR 153 PG 385 SUB OF SEC 15 DB Y/128 ==================================== 2291 00-00-30-0800-0001-0030 100.65 LEE LYNDA H ETAL 0.220AC 236 HIGHPOINTE TRAIL ELIJAY GA 30536 PT OF S1/2 LOT 1 IN OR 1982/473 (EX PT IN OR 611/550 & OR 859/861) SUB OF SEC 30 PBK 1/5 ==================================== 2292 00-00-30-0800-0030-0030 HX 603.67 BARNARD DENISE R 0.000AC 762 GEIGER RD FERNANDINA BEACH FL 32034 PT OF LOT 30 IN OR 393 PG 469 R359710 & R359711 SUB OF SEC 30 PB 1/5 ==================================== 2293 00-00-30-0800-0030-0040 897.67 BARNARD DENISE R 0.000AC 762 GEIGER RD FERNANDINA BEACH FL 32034-7821 PT OF LOT 30 IN OR 669 PGS 208-217 SUB OF SEC 30 PB 1/5 ==================================== 2294 00-00-30-0800-0031-0010 HX 2,511.71 TAVANIS AUDREY L/E 0.000AC NICHOLAS AUDREY & SANDRA COTRS 1417 SADLER RD #217 FERNANDINA BEACH FL 32034 PT OF LOT 31 L/E OR 1467/166 SUB OF SEC 30 PB 1/5 ==================================== 2295 00-00-30-0800-0042-0050 921.19 DUKES LARRY B & 0.000AC DUKES CAROL B 1982 BOLES CIRCLE FERNANDINA BEACH FL 32034 PT LOT 42 R359550 OR 511 PG 357 SUB OF SEC 30 PB 1/5 ==================================== 2296 00-00-30-0820-0012-0030 2,921.20 THOMAS ROSA EST 0.000AC 1601 LEWIS ST FERNANDINA BEACH FL 32034 PT OF LOT 12 OR 120/332 SUHRER TRACT SUB DB 39/289 ==================================== 2297 00-00-30-085U-0011-0000 HX 3,201.78 COLEMAN KIMBERLY J 0.000AC 2954 TIDEWATER STREET FERNANDINA BEACH FL 32034 LOT 11 IN OR 1262/1685 TIDEWATER @ OCEAN REACH #2 PB 6/105-106 ==================================== 2298 00-00-30-0880-0001-0000 HX 159.90 BLACKWELDER THOMAS EARL L/E 0.000AC BLACKWELDER TRACEY & JOSH 503 SUNSET ROAD FERNANDINA BEACH FL 32034-9149 LOT 1 IN OR 481 PG 21 WILLA-VILLA SUB PB 3/57 ==================================== 2299 00-00-30-0880-0004-0000 HX 382.28 MAYO AMY J L/E 0.000AC MARJORIE ELAINE MAYO 539 SUNSET ROAD FERNANDINA BEACH FL 32034 IN OR 602/1286 WILLA-VILLA SUB PB 3/57 ==================================== 2300 00-00-30-0880-0010-0000 HX 416.12 MAYO EDISON HOBART & KATHY G 0.000AC 540 SUNSET RD FERNANDINA BEACH FL 32034 LOT 10 IN OR 1152/1399 WILLA-VILLA SUB PB 3/57 ==================================== 2301 00-00-30-090C-0008-0000 HX 1,793.12 HOWARD EVERETT EUGENE JR 0.000AC 4939 WINDWARD PLACE FERNANDINA BEACH FL 32034 LOT 8 IN OR 667 PG 1493 WINDWARD COVE PB 5/294 ==================================== 2302 00-SB-30-022C-0G71-0000 484.75 TYNDALL DAVID R & SARAH W 0.000AC 15 CHEROKEE RD MOULTRIE GA 31768 GARAGE G-71 IN OR 1980/995 EXCLUSIVE ESMT CARLTON DUNES CONDO ==================================== 2303 00-SB-30-022C-7402-0000 HX 19,251.96 TYNDALL DAVID R & SARAH W 0.000AC 4602 CARLTON DUNES DR #8 FERNANDINA BEACH FL 32034 UNIT 7402 IN OR 1980/995 CARLTON DUNES PHASE 7 OR 960/1645-1683 ==================================== 2304 00-SB-30-065B-0027-0000 2,279.03 HATCHELL GARY C & SHARON K 0.000AC 95471 CAPTAINS WAY FERNANDINA BEACH FL 32034 LOT 27 IN OR 995/1490 GOLFSIDE @ SUMMER BEACH #2 PB 5/119-123 ==================================== rf rfntb DEL. TAX LIST 2017.indd 15 4/30/18 12:20 PM

PAGE 76

2305 00-SB-30-065B-0028-0000 HX 3,107.20 HATCHELL SHARON K & GARY C 0.000AC 95471 CAPTAINS WAY FERNANDINA BEACH FL 32034 LOT 28 IN OR 729 PG 1208 GOLFSIDE AT SUMMER BEACH #2 PB 5/119-123 ==================================== 2306 00-SB-30-065B-0059-0000 7,291.32 CRADDOCK MARY KING 0.000AC 5514 WESTERN AVENUE CHEVY CHASE MD 20815 LOT 59 & PT LOT 58 IN OR 2025/1355 GOLFSIDE AT SUMMER BEACH #2 PB 5/119-123 ==================================== 2307 00-SB-30-1520-0001-0000 HX 3,941.49 VINES RONALD C SR 0.000AC 4993 SUMMER BEACH BLVD FERNANDINA BEACH FL 32034 LOT 1 IN OR 645 PG 1119 OCEANSIDE #1 PB 5/321 ==================================== 2308 00-SB-30-152P-0068-0000 5,461.13 ONE AMELIA COMPANY LLC 0.000AC 4835 CASTLE BAR CANTON OH 44708 UNIT 68 (A/K/A 2703) IN OR 1514/636 OCEAN PLACE @ SUMMER BEACH OR 810/1800 ==================================== 2309 00-SB-30-152P-0C11-0000 364.89 CLIFTON JOE CROSBY 0.000AC 1066 RIDGE ROAD VALDOSTA GA 31605 GARAGE NUMBER C-11 PT OR 912/877 OCEAN PLACE @ SUMMER BEACH CONDO OR 793/475 ==================================== 2310 00-SB-30-157V-0016-0000 7,508.22 LASH MARY 0.000AC 1857 OCEAN VILLAGE PLACE FERNANDINA BEACH FL 32034 LOT 16 IN OR 788/227 OCEAN VILLAGE #3 PB 6/27-28 ==================================== 2311 00-SB-30-1900-0204-0000 7,057.74 STELLING MARTHA M GST TRUST 0.000AC MARTHA M STELLING TRUSTEE 5010 SUMMER BEACH BLVD #204 FERNANDINA BEACH FL 32034 UNIT 204 IN OR 2060/1863 SAILMAKER AT SUMMER BEACH CLUB OR 493/162 ==================================== 2312 00-SB-30-1900-0211-0000 1,937.25 ADLER JOAN G TRUSTEE 0.000AC OF JOAN G ADLER FAMILY TRUST 4362 WESTOVER PLACE NW WASHINGTON DC 20016 UNIT 211 IN OR 1417/741 SAILMAKER AT SUMMER BEACH CLUB OR 493/162 ==================================== 2313 00-00-31-087I-0046-0000 HX 6,375.84 HADDOCK EDD WAYNE 0.000AC 2659 BURTON BLVD HOBOKEN GA 31542 LOT 46 IN OR 2135/298 ISLE DE MAI AT AMELIA PB 7/12 ==================================== 2314 00-00-31-087I-0097-0000 HX 5,206.13 COLEMAN JOSEPH W & EVALYN G T 0.000AC 570 SANTA MARIA DR FERNANDINA BEACH FL 32034 LOT 97 IN OR 1929/1511 ISLE DE MAI AT AMELIA PB 7/12 ==================================== 2315 00-00-31-1010-0017-0000 6,735.62 WALKER TAMMY CISCO & 0.000AC MOORE ALETHA CISCO (JTROS) 851 PARKVIEW PL W FERNANDINA BEACH FL 32034 UNIT 17 IN OR 919/1406 AMELIA BY THE SEA OR 148/542 ==================================== 2316 00-00-31-1010-0019-0000 6,735.62 STRICKLAND DEVIN B 0.000AC 305 WEST WARING ST WAYCROSS GA 31503 UNIT 19 IN OR 802/214 AMELIA BY THE SEA OR 148/542 ==================================== 2317 00-00-31-1010-0023-0000 HX 5,405.18 NEWTON JAMES E & FRANCES B & NEWTON-LAPORTE CAROL E & 0.000AC 3240 SOUTH FLETCHER AVE FERNANDINA BEACH FL 32034 UNIT 23 IN OR 1680/442 AMELIA BY THE SEA OR 148/542 ==================================== 2318 00-00-31-1010-0069-0000 6,735.62 W J CAPTIAL LLC 0.000AC 192 E CHERRY ST JESUP GA 31598-6409 UNIT 69 IN OR 2099/232 AMELIA BY THE SEA OR 148/542 ==================================== 2319 00-00-31-1014-0001-0000 1,001.99 PO BOX 471 FERNANDINA BEACH FL 32035-0471 LOT 1 PT OR 1488/1660 AMELIA HEIGHTS SUB PB 5/169 ==================================== 2320 00-00-31-1014-0002-0000 1,001.99 PO BOX 471 FERNANDINA BEACH FL 32035-0471 LOT 2 PT OR 1488/1660 AMELIA HEIGHTS SUB PB 5/169 ==================================== 2321 00-00-31-1014-0003-0000 1,001.99 PO BOX 471 FERNANDINA BEACH FL 32035-0471 LOT 3 PT OR 1488/1660 AMELIA HEIGHTS SUB PB 5/169 ==================================== 2322 00-00-31-1014-0004-0000 1,001.99 PO BOX 471 FERNANDINA BEACH FL 32035-0471 LOT 4 PT OR 1488/1660 AMELIA HEIGHTS SUB PB 5/169 ==================================== 2323 00-00-31-1015-0010-0000 11,204.51 CAPPS INVESTMENT HOLDINGS LLC 0.000AC 2383 SHANNON ROAD FERNANDINA BEACH FL 32034 LOT 10 (EX S 25 FT) IN OR 1756/1894 AMELIA ISLAND INDUSTRIAL PARK # 1 PBK 4/67 ==================================== 2324 00-00-31-1017-0019-0000 5,355.69 PO BOX 471 FERNANDINA BEACH FL 32035-0471 LOT 19 IN OR 1399/1558 AMELIA ISLAND INDUSTRIAL PARK SEC 3 PB 5/59 ==================================== 2325 00-00-31-1017-0023-0000 31,833.61 PEMBROKE PINES INVESTORS LLC 0.000AC 1700 EMBASSY DRIVE APT 306 WEST PALM BEACH FL 33401 LOTS 23 & 24 IN OR 2141/1717 AMELIA ISLAND INDUSTRIAL PARK # 3 PBK 5/59 ==================================== 2326 00-00-31-1017-0028-0000 5,868.16 PO BOX 471 FERNANDINA BEACH FL 32035 LOT 28 IN OR 1478/1722 AMELIA ISLAND INDUSTRIAL PARK #3 PB 5/59 ==================================== 2327 00-00-31-1017-0029-0000 5,683.87 NASSAU EQUIPMENT INC 0.000AC 2385 JAMESTOWN ROAD FERNANDINA BEACH FL 32034-5240 LOT 29 IN OR 914/1977 AMELIA ISLAND INDUSTRIAL PARK SEC 3 PB 5/59 ==================================== 2328 00-00-31-1020-0056-0010 1,664.47 THE PARKIN COMPANY 0.000AC 31 S FLETCHER AVE FERNANDINA BEACH FL 32034 PT OF LOTS 56 & 57 S-1 IN OR 950/128 AMELIA LIGHTHOUSE RESERVATION PB 2/24 ==================================== 2329 00-00-31-102U-P101-0000 2,671.88 AMELIA PARK TOWN CENTER LLC 0.000AC 914 ATLANTIC AVE 1D FERNANDINA BEACH FL 32034 UNIT P101 PARK & 14TH CONDO OR 1421/1973 ==================================== 2330 00-00-31-102U-P102-0000 2,852.95 AMELIA PARK TOWN CENTER LLC 0.000AC 914 ATLANTIC AVE 1D FERNANDINA BEACH FL 32034 UNIT P102 PARK & 14TH CONDO OR 1421/1973 ==================================== 2331 00-00-31-102U-P201-0000 4,557.49 AMELIA PARK TOWN CENTER LLC 0.000AC 914 ATLANTIC AV 1D FERNANDINA BEACH FL 32034 UNIT P201 PARK & 14TH CONDO OR 1421/1973 ==================================== 2332 00-00-31-102U-P202-0000 4,840.51 AMELIA PARK TOWN CENTER LLC 0.000AC 914 ATLANTIC AV 1D FERNANDINA BEACH FL 32034 UNIT P202 PARK & 14TH CONDO OR 1421/1973 ==================================== 2333 00-00-31-102U-S101-0000 2,968.12 AMELIA PARK TOWN CENTER LLC 0.000AC 914 ATLANTIC AV 1D FERNANDINA BEACH FL 32034 UNIT S101 PARK & 14TH CONDO OR 1421/1973 ==================================== 2334 00-00-31-102U-S102-0000 3,337.70 AMELIA PARK TOWN CENTER LLC 0.000AC 914 ATLANTIC AV 1D FERNANDINA BEACH FL 32034 UNIT S102 PARK & 14TH CONDO OR 1421/1973 ==================================== 2335 00-00-31-102U-S103-0000 3,326.05 AMELIA PARK TOWN CENTER LLC 0.000AC 914 ATLANTIC AV 1D FERNANDINA BEACH FL 32034 UNIT S103 PARK & 14TH CONDO OR 1421/1973 ==================================== 2336 00-00-31-1030-002K-0000 5,359.34 TUCKER MARY ALICE TRUST 0.000AC C/O JAMES A TUCKER 8619 VILLA SAN JOSE DR E JACKSONVILLE FL 32207 UNIT 2K & F/K/A CARPORT UNIT I-36 N/K/A PARKING UNIT I-36 OR 202/132 & OR 666/125 PT OR 1085/1359 AMELIA SOUTH ==================================== 2337 00-00-31-1030-002L-0000 5,359.34 SMITH MARY DUNCAN 0.000AC C/O SMITH ELISABETH & HOYT B 1902 OAK DRIVE FERNANDINA BEACH FL 32034 UNIT 2L & F/K/A CARPORT UNIT I-32 N/K/A PARKING UNIT I-32 OR 278/634 & PT OR 1085/1359 AMELIA SOUTH ==================================== 2338 00-00-31-1030-003B-0000 5,359.34 CARTER SUSAN 0.000AC 3350 S FLETCHER AVE #3B FERNANDINA BEACH FL 32034 UNIT 3B & F/K/A CARPORT UNIT I-28 N/K/A PARKING UNIT I-28 IN OR 2143/738 OR 1104/1636 & PT OR 1085/1359 AMELIA SOUTH ==================================== 2339 00-00-31-1030-005L-0000 5,399.21 HUGHES DENNIS F 0.000AC 180 CHURCH ST BLACKSHEAR GA 31516 UNIT 5L & F/K/A CARPORT UNIT I-45 N/K/A PARKING UNIT I-45 IN OR 2049/355 AMELIA SOUTH ==================================== 2340 00-00-31-1030-007J-0000 5,892.07 DAUGHTREY JAMES T & MARCIA 0.000AC P O BOX 74 CECIL GA 31627 UNIT 7J & F/K/A CARPORT UNIT I-67 N/K/A PARKING UNIT I-67 OR 791/1458 & PT OR 1085/1359 AMELIA SOUTH ==================================== 2341 00-00-31-1035-0007-0108 2,854.02 THURNE SARAH JUNE 0.000AC 2700 MIZELL AV #708 FERNANDINA BEACH FL 32034 BLDG 7 UNIT 108 IN OR 1106/573 AMELIA WOODS BEACH & RACQUET CLUB OR 240/639 ==================================== 2342 00-00-31-1040-0026-0100 15,856.17 SMITH CHESTER M JR 0.000AC FAMILY LIMITED PARTNERSHIP 3571 HIGHWAY 20 WEST HAMPTON GA 30228 BLOCK 26 LOT 10 IN OR 1317/53 ASKINS OCEAN CITY PB 0/51 ==================================== 2343 00-00-31-1060-000B-0021 HX 713.29 BIRD SUSAN K 0.000AC 22 N 17TH ST FERNANDINA BEACH FL 32034 BLOCK B LOT N 1/2 OF 2 IN OR 1698/931 ATLANTIC HIGHLANDS SUB DB 39/297 ==================================== 2344 00-00-31-1060-000F-0022 667.09 RENFROW BENJAMIN E & CAROLYN R 0.000AC 4542 GILBERTS BEACH RD TYNER NC 27980 BLOCK F N1/2 OF W100 FT OF LOT 2 OR 1732/1709 ATLANTIC HIGHLANDS SUB DB 39/297 ==================================== 2345 00-00-31-1060-000F-0042 HX 1,134.65 MURRAY DANIEL N & KATHY M 0.000AC 2022 ALACHUA ST FERNANDINA BEACH FL 32034 BLOCK F LOT W1/2 OF 4 IN OR 404 PG 415 ATLANTIC HIGHLANDS SUB DB 39/297 ==================================== 2346 00-00-31-1060-000J-0021 HX 832.71 CAMPBELL JOHN C 0.000AC 1624 HIGHLAND ST FERNANDINA BEACH FL 32034 BLOCK J E1/2 OF LOT 2 IN OR 1467/1681 ATLANTIC HIGHLANDS SUB DB 39/297 ==================================== 2347 00-00-31-1060-000J-0052 2,259.93 FERRELL DEBORAH KAY & 0.000AC MIRANDA ARABELLE VIERA (JTROS) 6824 CITATION WAY VICTOR NY 14564 BLOCK J LOT W 67 FT OF LOT 5 IN OR 513 PG 986 L/E IN OR 902/232 ATLANTIC HIGHLANDS SUB DB 39/297 ==================================== 2348 00-00-31-114A-0045-0000 5,932.90 LASSERRE CURTISS H TRUSTEE 0.000AC OF CURTISS H LASSERRE REVOCABLE PO BOX 653 FERNANDINA BEACH FL 32035-0653 LOT 45 PT OR 2004/377 BEING PARCL 4 BUCKS FDNA BEACH #1 PB 2/30 ==================================== 2349 00-00-31-114A-0061-0000 HX 11,901.46 RICHARDS JANET CHASE 0.000AC 2700 S FLETCHER AVE FERNANDINA BEACH FL 32034 LOT 61 IN OR 1143/316 BUCKS FDNA BEACH #1 PB 2/30 ==================================== 2350 00-00-31-114A-0067-0050 13,034.43 MUIRHEAD WILLIAM B & DIANE T 0.000AC 2826 S FLETCHER AV FERNANDINA BEACH FL 32034 S50 FT OF N250 FT OF LOT 67 IN OR 1727/598 BUCKS FDNA BEACH 1 PB 2/30 ==================================== 2351 00-00-31-114A-0094-0000 3,514.82 LASSERRE CHARLES W 0.000AC 130 S 7TH ST FERNANDINA BEACH FL 32034 LOT 94 IN OR 2085/1832 BUCKS FDNA BEACH #1 PB 2/30 ==================================== 2352 00-00-31-114B-0006-0010 HX 2,020.43 JONAS BRADFORD LEE 0.000AC 2453 1ST AVE FERNANDINA BEACH FL 32034 BLOCK 6 LOT 1 IN OR 1012/466 BUCKS FDNA BEACH = 2PB3/17 ==================================== 2353 00-00-31-1180-0072-0010 HX .07 WALL EDWARD MILTON & FRANCES E 0.000AC 1920 BEECH ST FERNANDINA BEACH FL 32034 E 75 FT OF W 300 FT OF N 125 FT OF LOT 72 IN OR 488 PG 721 CITRONA UNR ==================================== 2354 00-00-31-1240-0003-0050 1,023.25 ROBERTS ERNEST & 0.000AC ROBERTS BYRON K 875 PROSPECT ST JACKSONVILLE FL 32254 BLOCK 3 LOTS 5 & N5 FT OF 4 & S5 FT OF 6 IN OR 1482/1490 EGAN MEADOWS 1 PB 3/45 ==================================== 2355 00-00-31-1250-6312-0000 3,437.70 BRUCE MARGARITE P 0.000AC 403 BRITTANY DOWNS DRIVE MACON GA 31210 UNIT 6312 IN OR 1223/949 FERNANDINA SHORES OR 267/354 ==================================== 2356 00-00-31-125C-0101-0000 6,609.83 SCARBOROUGH LONNIE T 0.000AC 201 E 50TH ST SAVANNAH GA 31405-2235 UNIT 101 IN OR 1484/270 FERNANDINA CAY CONDO OR 1254/978 ==================================== 2357 00-00-31-126B-0013-0000 888.74 CROSBY ROBERT E & REBECCA LYNN 0.000AC 2865 FIRST AVE FERNANDINA BEACH FL 32034 LOT 13 SECT # 2 IN OR 2001/1784 FERREIRA REPLAT OF FDNA BEACH PB 3/54 ==================================== 2358 00-00-31-126B-0014-0000 HX 3,108.19 NACHBAUER MATTHEW E 0.000AC 1125 N FLETCHER AV FERNANDINA BEACH FL 32034 LOT 14 IN OR 1941/938 FERREIRAS REPLAT OF FDNA BEACH #2 PB 3/54 ==================================== 2359 00-00-31-128A-0027-0000 6,691.81 SHAFFER APRIL A 0.000AC 1802 CAROLE CT PERU IN 46970 LOT 27 IN OR 2017/658 FOREST HILLS #1 PB 2/76 ==================================== 2360 00-00-31-128A-0028-0000 2,926.45 SIMMONS SHERRI O & 0.000AC AUCK DARREN D & BRYAN L 508 STANLEY DR FERNANDINA BEACH FL 32034 LOT 28 IN OR 1345/1497 FOREST HILLS #1 PB 2/76 ==================================== 2361 00-00-31-128A-0037-0000 4,711.03 DEMKO DONNA J 0.000AC 1809 HIGHLAND DRIVE FERNANDINA BEACH FL 32034 LOT 37 IN OR 1327/116 FOREST HILLS 1 PB 2/76 ==================================== 2362 00-00-31-128R-000E-0030 3,416.14 ASLEEP AT THE REEL LLC 0.000AC 2643 FOREST RIDGE DR FERNANDINA BEACH FL 32034 UNIT E-3 IN OR 1869/1148 FOREST RIDGE VILLAGE OR380/237 ==================================== 2363 00-00-31-128R-000F-0050 2,553.94 PARKER MICHAEL W 0.000AC 2900 PARK SQUARE PLACE FERNANDINA BEACH FL 32034 UNIT F-5 IN OR 2027/313 FOREST RIDGE VILLAGE OR380/237 ==================================== 2364 00-00-31-128R-000I-0020 2,196.90 HILL JOHN W & KAREN Y 0.000AC 2742 FOREST RIDGE DR FERNANDINA BEACH FL 32034 UNIT I-2 IN OR 1004/1749 FOREST RIDGE VILLAGE OR380/237 ==================================== 2365 00-00-31-128R-000L-0010 2,886.77 CROOM CONNIE 0.000AC PO BOX 912 TAOS NM 87571 UNIT L-1 IN OR 1838/1161 FOREST RIDGE VILLAGE OR380/237 ==================================== 2366 00-00-31-134A-0084-0000 9,131.51 AGRONOW DAN & BECKY 0.000AC 9481 GRACE LAKE DR DOUGLASVILLE GA 30135 LOTS 84 & 155 IN OR 1789/1077 GA FDNA BEACH SUB #1 PB 2/35 GA FDNA BEACH SUB #3 ==================================== 2367 00-00-31-134A-0094-0000 HX 10,149.66 FISHER GREGORY A 0.000AC 625 OCEAN AVE FERNANDINA BEACH FL 32034 LOT 94 IN OR 1459/1007 GA FDNA BEACH SUB PB 2/35 ==================================== 2368 00-00-31-134A-0101-0000 6,474.97 DUMARS CHARLES T & CHRISTINA B 0.000AC 12200 SAN BERNANDINO NE ALBUQUERQUE NM 87122 LOT 101 IN OR 1831/1628 ESMT OR 55/575 GA FDNA BEACH SUB PB 2/35 ==================================== 2369 00-00-31-134B-0145-0000 3,084.99 FISHER GREGORY A 0.000AC 625 OCEAN AV FERNANDINA BEACH FL 32034 LOT 145 IN OR 1542/500 GA FDNA BEACH 2 UNR ==================================== 2370 00-00-31-134B-0183-0000 2,601.27 BATES TODD 0.000AC 3106 JULINGTON CREEK RD JACKSONVILLE FL 32223 LOT 183 IN OR 2101/197 EX ESMT OR 1386/861 GA FDNA BEACH 2 UNR ==================================== 2371 00-00-31-134B-0189-0000 3,595.50 SMITH MATTHEW 0.000AC 731 N FLETCHER AVE FERNANDINA BEACH FL 32034 LOT 189 IN OR 1871/985 GA FDNA BEACH #2 UNR ==================================== 2372 00-00-31-134B-0192-0000 5,447.62 ROBERSON ANTHONY L & LENORE K 0.000AC PO BOX 773 FOLKSTON GA 31537 LOT 192 IN OR 2060/1432 GA FDNA BEACH 2 UNR ==================================== 2373 00-00-31-134B-0238-00B0 HX 2,216.30 VESTAL CURTIS D & JANET L 0.000AC 432-B TARPON AV FERNANDINA BEACH FL 32034 LOT 238-B IN OR 885/1746 DECLARATION CVNTS & RSTR OR 647/25 ==================================== 2374 00-00-31-1360-0033-0000 19,809.02 RUSSELL JERRY K 0.000AC 237 MARSH LAKES DRIVE FERNANDINA BEACH FL 32034-6811 LOT 33 IN OR 1687/1545 HAMBYS SUB PB 2/32 ==================================== 2375 00-00-31-1390-0012-0030 HX 2,676.28 JULIAO RICARDO 0.000AC 2976-A 1ST AV FERNANDINA BEACH FL 32034 PT OF LOT 12 IN OR 1575/378 PRTY WALL & COMMON MAINTENANCE AGREEMENT PT OR 855/1814-1816 HUTCHINS SOUTH BEACH PB 4/70 ==================================== 2376 00-00-31-1390-0013-0000 2,974.28 RIVER GREEN ESTATES LLC 0.000AC 11323 PHILLIPS PKWY DR E STE 7 JACKSONVILLE FL 32256 TRACT 13 IN OR 2056/280 HUTCHNS SOUTH BEACH PB 4/70 ==================================== 2377 00-00-31-141K-0100-0000 5,097.43 KETCH COURTYARD ASSOCIATION 0.000AC INC 3150 SOUTH FLETCHER AVE FERNANDINA BEACH FL 32034 UNIT 100 IN OR 926/1834 KETCH COURTYARD OR 424/386 ==================================== 2378 00-00-31-142I-0013-0000 HX 2,743.00 DEADY ERIC M 0.000AC 1035 ISLE OF PALMS LN FERNANDINA BEACH FL 32034 LOT 13 IN OR 1810/508 ISLE OF PALMS OF AMELIA PB 6/189 ==================================== 2379 00-00-31-142L-0007-00E0 2,489.27 TAYLOR SCOTT 0.000AC 145 COOL BREEZE LN ALMA GA 31510-5054 UNIT 7-E IN OR 942/395 AMELIA LANDINGS II OR 407/599 ==================================== 2380 00-00-31-143B-0012-0000 HX 2,568.68 NIPPER JUSTIN & MARIE 0.000AC 2202 WILL HARDEE ROAD FERNANDINA BEACH FL 32034 LOT 12 IN OR 1775/673 LAKEWOOD #4 PB 5/245 ==================================== 2381 00-00-31-143B-0015-0000 4,006.20 THOMASON JOSEPH D EST 0.000AC 2232 WILL HARDEE ROAD FERNANDINA BEACH FL 32034 LOT 15 IN OR 635 PG 337 LAKEWOOD #4 PB 5/245 ==================================== 2382 00-00-31-143C-0039-0000 HX 1,299.18 BERRY NANCY W 0.000AC 2133 CANTERBURY LANE FERNANDINA BEACH FL 32034 LOT 39 IN OR 733/1961 LAKEWOOD #5 PB 5/380 ==================================== 2383 00-00-31-1460-0013-0000 16,490.91 NIXON WILLIAM F JR 0.000AC 16 MEETINGHOUSE LN SOUTH EASTON MA 02375 LOT 13 IN OR 1879/1166 MIRAMAR BEACH PB 2/61 ==================================== 2384 00-00-31-147L-008B-0000 HX 2,065.06 SALAMATIN JAMES N & 0.000AC SALAMATIN APRIL L (B&S) 1116-B NATURES WALK DR FERNANDINA BEACH FL 32034 LOT 8B IN OR 943 PG 1216 L/E IN OR 943 PG 1216 NATURES WALK PB 5/202 ==================================== 2385 00-00-31-147L-017B-0000 2,950.25 LAND CAROLYN & 0.000AC ROBERTS THOMAS H JR 1131 B NATURES WALK CT FERNANDINA BEACH FL 32034 LOT 17-B IN OR 2030/1700 NATURES WALK PB 5/202 ==================================== 2386 00-00-31-147L-026A-0000 HX 1,529.31 BERRY CRYSTAL L/E 0.000AC SUE ANN BERRY HILDEBRAND 2072-A NATURES LN FERNANDINA BEACH FL 32034 L/E OR 1846/1964 NATURES WALK PB 5/202 ==================================== 2387 00-00-31-1480-0025-0000 766.76 ERDMANN THOMAS J 0.000AC 1314 CLINCH DR FERNANDINA BEACH FL 32034 LOT 25 IN OR 2097/211 OAK GROVE PLACE PB 3/2 ==================================== 2388 00-00-31-150C-0005-0110 HX 862.43 HOLLAND CHRISTOPHER A & MISTY 0.000AC 301 S 16TH ST FERNANDINA BEACH FL 32034 BLOCK 5 LOT 11 IN OR 807/1559 OAK LAWN PARK #3 PB 3/28 ==================================== 2389 00-00-31-150F-0007-0140 769.87 LIPINSKI DOLORES J EST 0.000AC 503 S 17TH ST FERNANDINA BEACH FL 32034 BLOCK 7 LOT 14 OAK LAWN PARK 6 PB 3/40 ==================================== 2390 00-00-31-150F-0007-0160 3,024.51 FEDERAL NATIONAL MORTGAGE 0.000AC ASSOCIATION 950 EAST PACES FERRY RD #1900 ATLANTA GA 30326 BLOCK 7 LOT 16 IN OR 1319/1648 OAK LAWN PARK #6 PB 3/40 ==================================== 2391 00-00-31-150F-0007-0180 HX 692.92 TAYLOR JIMMY R & JEAN B 0.000AC 507 S 17TH ST FERNANDINA BEACH FL 32034 BLOCK 7 LOT 18 OAK LAWN PARK #6 PB3/40 ==================================== 2392 00-00-31-150F-0008-0050 HX 875.29 PATTERSON EDWARD G JR 0.000AC 404 S 17TH ST FERNANDINA BEACH FL 32034 BLOCK 8 LOT 5 IN OR 1984/1602 & OR 1984/1604 OAK LAWN PARK #6 PB3/40 ==================================== 2393 00-00-31-150F-0008-0070 HX 1,336.71 HORNSBY STACEY L 0.000AC 404 S 17TH ST FERNANDINA BEACH FL 32034 BLOCK 8 LOT 7 IN OR 2018/163 & OR 2022/728 OAK LAWN PARK 6 PB 3/40 ==================================== 2394 00-00-31-150F-0008-0110 HX 712.38 EBENAL AMY R 0.000AC 500 S 17TH ST FERNANDINA BEACH FL 32034 BLOCK 8 LOT 11 IN OR 1511/1728 OAK LAWN PARK #6 PB 3/40 ==================================== 2395 00-00-31-1520-0002-0020 HX 3,970.35 HARRIS JUNE WIRSING 0.000AC 333 S FLETCHER AV FERNANDINA BEACH FL 32034 BLOCK 2 LOT 2 IN OR 541 PG 162 OCEAN CITY NORTH PORTION R/P PBK 2/38 ==================================== 2396 00-00-31-1520-0003-0060 7,174.23 LASSERRE CURTISS H TRUSTEE 0.000AC OF CURTISS H LASSERRE REVOCABLE PO BOX 653 FERNANDINA BEACH FL 32035-0653 BLK 3 LOT 6 OCEAN CITY NORTH PORTION R/P PBK 2/38 ==================================== 2397 00-00-31-1540-0017-0010 3,832.24 J R HOLDINGS OF NORTH FLORIDA 2.470AC INC 109 NORTH LIBERTY ST JACKSONVILLE FL 32202 PT BLKS 16,17,19 & PT BEING PARCEL A (EX OR 1323/1944,OR 1876/1132 & UTIL ESMT IN OR 839/1369) OCEAN CITY SUB DBK U/384 ==================================== 2398 00-00-31-155E-0008-0000 3,265.28 EVANS JOHN R LVG IRREV TRUST 0.000AC JOHN R & ANN D EVANS TRUSTEES 2804 ST JOHNS BLUFF RD S JACKSONVILLE FL 32246 LOT 8 PT OR 2029/175 OCEANS EIGHT PB 5/41 ==================================== 2399 00-00-31-155I-2168-00A0 4,925.00 DOUGLAS COMPANIES LLC 0.000AC 85352 BOSTICK WOOD DR FERNANDINA BEACH FL 32034 NORTH UNIT AMELIA HILLS TOWNHOMES CONDO OR 1685/1241 ==================================== 2400 00-00-31-155I-2168-00B0 4,925.00 DOUGLAS COMPANIES LLC 0.000AC 85352 BOSTICK WOOD DR FERNANDINA BEACH FL 32034 SOUTH UNIT AMELIA HILLS TOWNHOMES CONDO OR 1685/1241 ==================================== 2401 00-00-31-155R-0018-0000 4,622.72 MATNEY JIMMY L & JILL A 0.000AC 2703 MOORE CROSSING ROAD VALDOSTA GA 31606 LOT 18 IN OR 1766/1425 OCEAN RIDGE PB 5/103 & 104 ==================================== 2402 00-00-31-155S-0017-0000 HX 3,262.80 TAYLOR MONTIE E & CHERIE L 0.000AC 1417 SADLER RD # 157 FERNANDINA BEACH FL 32034 LOT 17 IN OR 785/386 OCEAN SOUND PB 5/295 ==================================== 2403 00-00-31-1580-0012-0040 791.37 WILSON JOAN 0.000AC 515 HIO RIDGE RD BRIDGTON ME 04009 BLOCK 12 LOT 4 PT OR 2077/1410 OLD TOWN ==================================== 2404 00-00-31-1580-0023-0010 1,237.37 PAULS DEBORAH A & MARTIN A 0.000AC 6690 NW 33RD AVENUE FT LAUDERDALE FL 33309 BLK 23 LOT 1 IN OR 2133/1779 OLD TOWN S/D UNR ==================================== 2405 00-00-31-1600-0002-0020 HX 939.05 PARKIN PETER GORDON TRUSTEE 0.000AC OF PETER G PARKIN REV TRUSTE 1521 ALACHUA ST FERNANDINA BEACH FL 32034 OUT LOT E1/2 OF S1/2 OF 2 IN OR 2115/1396 OUT LOTS ==================================== 2406 00-00-31-1600-0004-0040 HX 2,029.74 BROWN PAMELA L & 0.000AC BROWN MICHAEL D 1503 BROOME STREET FERNANDINA BEACH FL 32034 1/2 HX INT (S&B) W72 FT OF E215 FT OF N136.5 FT OF S1/2 OF OUTLOT 4 IN OR 1616/1598 CASE #09-CP-68 OUTLOTS SUB U/R ==================================== 2407 00-00-31-1600-0228-0020 2,794.91 DOBROSKY TERRANCE A 0.000AC 506 STARBOARD LNDG FERNANDINA BEACH FL 32034 E 136.5 FT OF W 166.5 FT OF S 79 FT OF OUT LOT 228 IN OR 668 PG 1212 OUT LOTS ==================================== 2408 00-00-31-1611-0003-0000 2,079.73 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 3 IN OR 2032/1123 COASTAL OAKS PBK 8/109 ==================================== 2409 00-00-31-1611-0006-0000 2,079.73 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 6 IN OR 2032/1123 COASTAL OAKS PBK 8/109 ==================================== 2410 00-00-31-1611-0007-0000 2,079.73 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 7 IN OR 2032/1123 COASTAL OAKS PBK 8/109 ==================================== 2411 00-00-31-1611-0010-0000 2,079.73 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 10 IN OR 2032/1123 COASTAL OAKS PBK 8/109 ==================================== 2412 00-00-31-1611-0013-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR SUITE 704 SAINT AUGUSTINE FL 32092 LOT 13 IN OR 2100/284 COASTAL OAKS PBK 8/109 ==================================== 2413 00-00-31-1611-0014-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE STE # 704 ST AUGUSTINE FL 32092 LOT 14 IN OR 2115/384 COASTAL OAKS PBK 8/109 ==================================== 2414 00-00-31-1611-0016-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY DRIVE SUITE 704 ST AUGUSTINE FL 32092 LOT 16 IN OR 2130/1641 COASTAL OAKS PBK 8/109 ==================================== 2415 00-00-31-1611-0019-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE 204 ST AUGUSTINE FL 32092 LOT 19 IN OR 2130/1572 COASTAL OAKS PBK 8/109 ==================================== 2416 00-00-31-1611-0024-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE STE #704 ST AUGUSTINE FL 32092 LOT 24 IN OR 2114/1134 COASTAL OAKS PBK 8/109 ==================================== 2417 00-00-31-1611-0026-0000 2,079.73 ESB INVESTMENTS LLC 0.000AC 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 LOT 26 IN OR 2032/1123 COASTAL OAKS PBK 8/109 ==================================== 2418 00-00-31-1611-0027-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DR SUITE 704 SAINT AUGUSTINE FL 32092 LOT 27 IN OR 2102/1392 COASTAL OAKS PBK 8/109 ==================================== 2419 00-00-31-1611-0028-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE STE # 704 ST AUGUSTINE FL 32092 LOT 28 IN OR 2112/564 COASTAL OAKS PBK 8/109 ==================================== 2420 00-00-31-1611-0030-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE #704 ST AUGUSTINE FL 32092 LOT 30 IN OR 2144/1600 COASTAL OAKS PBK 8/109 ==================================== 2421 00-00-31-1611-0036-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE 704 ST AUGUSTINE FL 32092 LOT 36 IN OR 2124/1732 COASTAL OAKS PBK 8/109 ==================================== 2422 00-00-31-1611-0040-0000 975.24 ADVANTAGE HOME BUILDERS INC 0.000AC 305 KINGSLEY LAKE DRIVE SUITE 704 ST AUGUSTINE FL 32092 LOT 40 IN OR 2124/1760 COASTAL OAKS PBK 8/109 ==================================== 2423 00-00-31-1632-0407-0000 8,444.04 GRIFFIN LYNDA K TRUSTEE 0.000AC OF LYNDA K GRIFFIN REV TRUST 8 ROCK CREST LANE SIGNAL MOUNTAIN TN 37377 UNIT 407 IN OR 1755/733 THE PELICANS OR 454/407 ==================================== 2424 00-00-31-163P-00E1-0000 606.13 THOMAS CORY 0.000AC 1601 NECTARINE STREET E1 FERNANDINA BEACH FL 32034 UNIT E1 IN OR 1991/703 THE PALMS AT AMELIA CONDO OR 1390/33 ==================================== 2425 00-00-31-163V-0003-0000 HX 4,316.81 CISCO ALETHA K 0.000AC 851 PARKVIEW PLACE W FERNANDINA BEACH FL 32034 LOT 3 IN OR 1240/1581 PARKVIEW PB 6/390 ==================================== 2426 00-00-31-1652-0001-0000 6,914.74 WARNER BRETT C 0.000AC 1417 SADLER #331 FERNANDINA BEACH FL 32034 LOT 1 & PT OF LOT 42(S-1) THE RESIDENCE @ AMELIA LANDING #1 PB 5/247 IN OR 934/1837 EX S-3 OF LOT 42 THE RESIDENCE @ AMELIA LANDINGS #4 PB 6/29 ==================================== 2427 00-00-31-1665-0110-0000 4,623.23 TRAPNELL RALPH 0.000AC PO BOX 1409 JESUP GA 31598-6409 UNIT 110 IN OR 1456/199 SAND DOLLAR VILLAS OR 358/475 ==================================== 2428 00-00-31-1665-0111-0000 4,623.23 JAMES LESLIE PROPERTIES LLC 0.000AC 162 VIRGINIA AVENUE SOUTH TIFTON GA 31794 UNIT 111 IN OR 2073/1490 SAND DOLLAR VILLAS OR 358/475 ==================================== 2429 00-00-31-1665-0313-0000 HX 3,755.37 SCARBORO JOHN & FRANCES 0.000AC 96510 BLACKROCK ROAD FERNANDINA BEACH FL 32034 UNIT 313 IN OR 2144/1585 SAND DOLLAR VILLAS OR 358/475 ==================================== 2430 00-00-31-1670-0006-0000 HX 2,878.12 CRIBBS JACK W & REBECCA M 0.000AC 3165 S FLETCHER AVE #6 FERNANDINA BEACH FL 32034 LOT 6 IN OR 736/1016 SEA CASTLES PB 4 PG 100 ==================================== 2431 00-00-31-1676-0034-0000 HX 7,515.13 HANEY HALLE B 0.000AC 2752 SEA GROVE LANE FERNANDINA BEACH FL 32034 LOT 34 IN OR 1519/1421 & OR 1956/524 SEA GROVE PB 6/152-154 ==================================== 2432 00-00-31-1678-0026-0000 2,581.48 PARKIN PETER GORDON TRUSTEE 0.000AC OF PETER G PARKIN REV TRUST 1521 ALACHUA ST FERNANDINA BEACH FL 32034 LOT 26 PT OR 2115/1398 SEA ISLAND PLANTATION PB5/275 ==================================== 2433 00-00-31-167C-0009-0000 1,517.21 HARTLEY CHRISTOPHER C 0.000AC 2410 SAFE HARBOR FERNANDINA BEACH FL 32034 LOT 9 IN OR 2132/1357 SCHOONER LANDING PB 6/246 ==================================== 2434 00-00-31-167C-0027-0000 5,951.08 COMINSKY STEPHEN & MARGARET 0.000AC 105 GAIL LN SYRACUSE NY 13219 LOT 27 IN OR 1949/292 SCHOONER LANDING PB 6/246 ==================================== 2435 00-00-31-1680-0010-0120 6,414.37 DYE AMY L 0.000AC 96044 PINEY ISLAND DRIVE FERNANDINA BEACH FL 32034 BLOCK 10 LOTS 12 13 18 19 & 50 FT STRIP E OF LOTS IN OR 1523/964 SEAVIEW SUB PB 1/7 ==================================== 2436 00-00-31-1680-0013-0110 9,175.91 URIE ANTHONY M 0.000AC 18130 MIDVALE AVE NORTH SHORELINE WA 98133-4536 BLOCK 13 LOTS 11 & 12 & PT ABANDONED R/W IN OR 1422/802 SEAVIEW SUB PB 1/7 ==================================== 2437 00-00-31-1680-0013-0290 9,307.42 BATES ROGER TODD & 0.000AC BATES JENNIFER WRIGHT (JT/RS) 3580 FIRST AVE FERNANDINA BEACH FL 32034 BLOCK 13 LOTS 29 30 31 32 IN OR 2073/1574 SEAVIEW SUB PB 1/7 ==================================== 2438 00-00-31-1680-0019-0110 975.04 RIVER GREEN ESTATES LLC 0.000AC 11323 PHILLIPS HWY DR E STE 7 JACKSONVILLE FL 32256 BLOCK 19 LOT 11 PT OR 2055/1607 SEAVIEW SUB PB 1/7 ==================================== 2439 00-00-31-1680-0019-0120 1,918.07 RIVER GREEN ESTATES LLC 0.000AC 11323 PHILLIPS HWY DR E STE 7 JACKSONVILLE FL 32256 BLOCK 19 LOTS 12 13 PT OR 2055/1607 SEAVIEW SUB PB 1/7 ==================================== 2440 00-00-31-1681-0004-0000 5,714.54 ALPHA INVESTMENTS OF ST 0.000AC AUGUSTINE LLC 242 OCEAN CAY BLVD ST AUGUSTINE FL 32080 LOT 4 IN OR 2079/765 SEAVIEW SUB 2 PB 5/26 ==================================== 2441 00-00-31-1690-0004-0000 2,974.68 PEACOCK JAMES C JR 0.000AC 34 NORTH 14TH STREET FERNANDINA BEACH FL 32034 LOTS 4 & 5 PT OR 1916/1497 SORENSEN TERRACE REPLAT PB 2/59 ==================================== 2442 00-00-31-1690-0017-0010 517.00 WESLEY JAMES WILLIAM EST 0.000AC C/O JACQUELINE WESLEY 85386 MINER RD YULEE FL 32097 LOT 17 EX W 20 FT OF N 65 FT IN OR 562 PG 1127 SORENSEN TERRACE REPLAT PB 2/59 ==================================== 2443 00-00-31-1700-0022-0000 3,570.37 CURNUTTE WILLIAM D & 0.000AC CURNUTTE SYLVIA L (JT/RS) 221 LIGHTHOUSE CR FERNANDINA BEACH FL 32034 LOT 22 & S 6 FT OF LOT 23 IN OR 1583/271 SORENSENS OCEAN TERRACE UNR ==================================== 2444 00-00-31-1700-0023-0000 HX 2,867.58 TUTEN FRANK DAVID 0.000AC 843 MARY ST FERNANDINA BEACH FL 32034 LOT 23 (EX SO 6 FT) & S 6 FT OF LOT 24 IN OR 421/451 & OR 426/630 SORENSENS OCEAN TERRACE UNR ==================================== 2445 00-00-31-1720-000A-0110 4,876.11 RIVER GREEN ESTATES LLC 0.000AC 11323 PHILLIPS PKWY DR E STE 7 JACKSONVILLE FL 32256 PT OF TRACT A IN OR 2068/203 SOUTH BEACH SUB PB 3/11 ==================================== 2446 00-00-31-1720-000A-0140 1,845.97 RIVER GREEN ESTATES LLC 0.000AC 11323 PHILIPS PKWY DR E STE 7 JACKSONVILLE FL 32256 PT OF TRACT A IN OR 2004/1970 ESMT IN OR 362 PG 147 SOUTH BEACH SUB PB 3/11 ==================================== 2447 00-00-31-1741-0001-0010 9,007.47 TOLBERT CARLTON E JR & 0.000AC WILSON-TOLBERT ROBIN G (38.6%) & WILSON KATHLEEN LIV TST ETAL 45 W DURHAM STREET PHILADELPHIA PA 19119 LOT 1-1 INOR 1698/1339 & INOR 2141/23 SURF UNIT ONE PB 7/300 ==================================== 2448 00-00-31-1760-0005-0020 5,053.16 LEIBMAN MARILYN C 0.000AC P O BOX 150 SOUND BEACH NY 11789 PT LOT 5 IN OR 788/1368 FNDA BCH WATER LOTS SUB UNR ==================================== 2449 00-00-31-179D-348B-0000 HX 2,769.98 LEE MICHAEL PAUL 0.000AC 348B S FLETCHER AV FERNANDINA BEACH FL 32034 LOT 348-B IN OR 580/1297 WINDWARD DUPLEXES OR 551/150 F/N/A PT LOTS 3-5 & S 12.5 FT OF ADJ R/W STRATHMORE PLACE PB 3/10 ==================================== 2450 00-00-31-1800-0001-0012 11,117.75 TOUNDAS PATRICIA C 0.000AC 96213 BLACKROCK ROAD YULEE FL 32097 BLK 1 W1/2 OF LOTS 1,2,3 & 4 IN OR 1558/1447 CITY OF FDNA BEACH ==================================== 2451 00-00-31-1800-0008-0020 895.43 LEIBMAN MARILYN C 0.000AC P O BOX 150 SOUND BEACH NY 11789 BLOCK 8 LOTS 2 THRU 4 IN OR 932/135 CITY OF FDNA BEACH ==================================== 2452 00-00-31-1800-0008-0310 HX 3,203.75 CLAYTON KERSTIN (3/16%) & 0.000AC HOLMES WM O & LAWRENCE & 211 BROOME ST FERNANDINA BEACH FL 32034 BLOCK 8 LOTS 31 & 32 & N1/2 OF LOT 30 (EX E7 FT) PT OR 1172/1741 & OR 1104/446 18.75 HX INT CITY OF FDNA BEACH ==================================== 2453 00-00-31-1800-0010-0150 9,681.59 POYNTER PROPERTIES LLC 0.000AC 27 NORTH 3RD STREET FERNANDINA BEACH FL 32034 BLOCK 10 LOTS 15 TO 18 INC IN OR 1325/992 CITY OF FDNA BEACH ==================================== 2454 00-00-31-1800-0011-0240 3,922.60 VILLANI NICHOLAS 0.000AC 7838 GRANITE WALK AV LAS VEGAS NV 89178-8217 BLOCK 11 LOTS 24 THRU 30 INC IN OR 1225/862 CITY OF FDNA BEACH ==================================== 2455 00-00-31-1800-0017-0180 447.88 TAYLOR MAMIE EST 0.000AC C/O RAYMOND T TAYLOR 841 MARY STREET APT A FERNANDINA BEACH FL 32034 BLOCK 17 LOT 18 CITY OF FDNA BEACH ==================================== 2456 00-00-31-1800-0019-0020 1,019.27 HOWARD JAMES W ESTATE 0.000AC C/O STEWART WILLIAM E PO BOX 1151 CALLAHAN FL 32011-1151 BLOCK 19 LOT 2 IN OR 1244/1386 CITY OF FDNA BEACH ==================================== 2457 00-00-31-1800-0019-0130 183.34 STEWART WILLIAM E 0.000AC PO BOX 1151 CALLAHAN FL 32011-1151 BLOCK 19 LOT 13 IN OR 1253/481 CITY OF FDNA BEACH ==================================== rf rfntb DEL. TAX LIST 2017.indd 16 4/30/18 12:20 PM

PAGE 77

2458 00-00-31-1800-0019-0140 426.91 STEWART WILLIAM ELSWORTH 0.000AC PO BOX 1151 CALLAHAN FL 32011 BLOCK 19 LOTS 14 & 15 IN OR 1288/91 CITY OF FDNA BEACH ==================================== 2459 00-00-31-1800-0023-0130 19,480.58 WHITMIRE JENNIFER N 0.000AC 4045 BRANDYWINE POINTE BLVD OLD HICKORY TN 37138 BLK 23 LOT 14 & E 30FT OF LOT 15 & E 80FT LOT 13 IN OR 1980/1094 CITY OF FDNA BEACH OF SEC 22-3N-28E U/R ==================================== 2460 00-00-31-1800-0026-0020 3,393.20 RICHO JEROME & 0.000AC PRENTICE DARIUS 330 S 12TH STREET FERNANDINA BEACH FL 32034 BLOCK 26 LOT 2 & N1/2 OF 3 IN OR 2116/522 CITY OF FDNA BEACH ==================================== 2461 00-00-31-1800-0026-0050 1,603.17 EARNEST & KHEMANI PROPERTIES LLC 0.000AC 4896 HUGH HOWELL ROAD STONE MOUNTAIN GA 30087 BLOCK 26 LOT N45 FT OF 5 & S5 FT OF E1/2 OF 5 IN OR 1532/909 CITY OF FDNA BEACH ==================================== 2462 00-00-31-1800-0026-0140 2,988.31 BREAKER MARY L L/E 0.000AC FAREEDAH T JONES 1619 W 30TH ST JACKSONVILLE FL 32209 BLOCK 26 LOT 14 OR 455/588 & OR 458/557 L/E IN OR 843/1632 CITY OF FDNA BEACH ==================================== 2463 00-00-31-1800-0026-0150 980.43 BREAKER MARY LOUISE L/E 0.000AC FAREEDAH T JONES 1619 W 30TH ST JACKSONVILLE FL 32209 BLOCK 26 LOT 15 OR 455/588 & OR 458/557 L/E IN OR 843/1632 HUFF & BATTISE FUNERAL HOME CITY OF FDNA BEACH ==================================== 2464 00-00-31-1800-0027-0041 48.60 CHAMPION WALTER EST 0.000AC 221 S 5TH ST FERNANDINA BEACH FL 32034 PT OR 108/750 CITY OF FDNA BEACH ==================================== 2465 00-00-31-1800-0030-0014 371.02 NORTHWOODS LLC 0.000AC 3190 NORTHEAST EXPRESSWAY #120 ATLANTA GA 30341 BLK 30 E 3.40FT OF W 35FT OF LOT 1 & E 3.4FT OF W 35FT OF S 30FT OF LOT 2 CITY OF FDNA BEACH OF SEC 22-3N-28E S/D UNR ==================================== 2466 00-00-31-1800-0033-0130 1,217.53 HARRIS CHARLES E JR 0.000AC 1280 NW 58TH TERRACE SUNRISE FL 33313 BLOCK 33 LOT 13 IN OR 2094/1270 CITY OF FDNA BEACH ==================================== 2467 00-00-31-1800-0041-0030 3,095.05 LASSERRE CURTISS H TRUSTEE 0.000AC OF CURTISS H LASSERRE REVOCABLE PO BOX 653 FERNANDINA BEACH FL 32035-0633 BLK 41 LOT 3 PT OR 2004/377 BEING PARCEL 18 CITY OF FDNA BEACH ==================================== 2468 00-00-31-1800-0048-0031 1,771.64 MACEDONIA A M E CHURCH 0.000AC P O BOX 6216 FERNANDINA BEACH FL 32035 BLOCK 48 N1/2 OF LOT 3 IN OR 1341/1107 CITY OF FDNA BEACH ==================================== 2469 00-00-31-1800-0048-0041 HX 637.47 BLUE QUINTIN O 0.000AC 905 CEDAR ST FERNANDINA BEACH FL 32034 BLOCK 48 LOT E1/2 OF 4 IN OR 1243/614 CITY OF FDNA BEACH ==================================== 2470 00-00-31-1800-0048-0042 1,740.11 MACEDONIA A M E CHURCH 0.000AC PO BOX 6216 FERNANDINA BEACH FL 32035-6216 BLOCK 48 LOT W1/2 OF 4 IN OR 1501/731 CITY OF FDNA BEACH ==================================== 2471 00-00-31-1800-0048-0051 437.07 JOHNSON GEORGIA L EST & 0.000AC SPAULDING LOURYNE & ANNETTE & 913 CEDAR ST FERNANDINA BEACH FL 32034 BLOCK 48 LOT E1/2 OF 5 IN OR 1934/282 CITY OF FDNA BEACH 1/5 HX INT ==================================== 2472 00-00-31-1800-0049-0010 HX 2,482.09 DAVIS-TAYLOR CECILIA M 0.000AC 112 S 9TH ST FERNANDINA BEACH FL 32034 BLOCK 49 LOTS 1 2 & 7 IN OR 1335/1202 CITY OF FDNA BEACH ==================================== 2473 00-00-31-1800-0051-0060 363.94 BAKER INEZ EST 0.000AC C/O GREEN HENRY D 923 VERNON ST FERNANDINA BEACH FL 32034 BLOCK 51 LOTS 6 7 CITY OF FDNA BEACH ==================================== 2474 00-00-31-1800-0052-0021 2,343.49 RICHO CATHERINE SUSIE & 0.000AC RICHO EDDIE JR & 16 N 10TH ST FERNANDINA BEACH FL 32034 BLOCK 52 LOT N1/2 OF 2 IN OR 714/1457 CITY OF FDNA BEACH 1/3 HX INT ==================================== 2475 00-00-31-1800-0052-0022 3,101.24 RAY CATHERINE EST 0.000AC 12 N 10TH ST FERNANDINA BEACH FL 32034 BLOCK 52 S1/2 OF 2 IN OR 714/1454 CITY OF FDNA BEACH ==================================== 2476 00-00-31-1800-0054-0051 912.51 BLUE ROBERT ELLIOTT JR & 0.000AC SHUNTAY LAWANNA BLUE P O BOX 579 FERNANDINA BEACH FL 32035 OF W 1/2 OF LOT 5 BY WILL CITY OF FDNA BEACH ==================================== 2477 00-00-31-1800-0054-0052 HX 418.69 BLUE SHUNTAY LAWANNA 0.000AC PO BOX 579 FERNANDINA BEACH FL 32035-0579 LOT 5 IN OR 770/247 CITY OF FDNA BEACH ==================================== 2478 00-00-31-1800-0054-0053 786.09 RAYSOR SHUNTAY B & 0.000AC MCGAHEE WENDALL K PO BOX 579 FERNANDINA BEACH FL 32035-0579 W 25 FT OF N 35 FT OF LOT 5 IN OR 1705/457 CITY OF FDNA BEACH ==================================== 2479 00-00-31-1800-0055-0032 1,309.97 TURNER CYNTHIA E DAVIS 0.000AC P O BOX 1260 FERNANDINA BEACH FL 32035-1260 BLOCK 55 LOT S1/2 OF 3 IN OR 1544/1869 CITY OF FDNA BEACH ==================================== 2480 00-00-31-1800-0065-0011 516.00 SHINE CELESTINE EST 0.000AC 2304 JOHNS CT ANTIOCH CA 94531 BLOCK 65 LOT E1/2 OF 1 CITY OF FDNA BEACH ==================================== 2481 00-00-31-1800-0067-0080 181.16 PO BOX 471 FERNANDINA BEACH FL 32035-0471 BLOCK 67 LOT 8 EX N 10 FT PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2482 00-00-31-1800-0068-0040 43.87 SNIPE VIOLA & 0.000AC SIMMONS LOUIS 914 CALHOUN ST FERNANDINA BEACH FL 32034 BLOCK 68 LOT 4 CITY OF FDNA BEACH ==================================== 2483 00-00-31-1800-0071-0031 578.91 PO BOX 471 FERNANDINA BEACH FL 32035-0471 BLOCK 71 LOT N 1/3 OF 3 PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2484 00-00-31-1800-0072-0011 73.44 PO BOX 471 FERNANDINA BEACH FL 32035-0471 BLOCK 72 LOT N 25 FT OF 1 PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2485 00-00-31-1800-0072-0012 104.08 PO BOX 471 FERNANDINA BEACH FL 32035-0471 BLOCK 72 LOT S 75 FT OF 1 (EX S-3) PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2486 00-00-31-1800-0072-0013 752.94 PO BOX 471 FERNANDINA BEACH FL 32035-0471 PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2487 00-00-31-1800-0072-0020 1,274.98 PO BOX 471 FERNANDINA BEACH FL 32035-0471 BLOCK 72 LOT 2 PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2488 00-00-31-1800-0072-0030 1,274.98 PO BOX 471 FERNANDINA BEACH FL 32035-0471 BLOCK 72 LOT 3 PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2489 00-00-31-1800-0072-0071 160.37 PO BOX 471 FERNANDINA BEACH FL 32035-0471 BLOCK 72 LOT N1/2 OF 7 PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2490 00-00-31-1800-0072-0072 160.37 PO BOX 471 FERNANDINA BEACH FL 32035-0471 BLOCK 72 LOT S1/2 OF 7 PT OR 1488/1658 CITY OF FDNA BEACH ==================================== 2491 00-00-31-1800-0077-0031 709.53 WRIGHT LOIS 0.000AC 1372 WASHINGTON AV #13E BRONX NY 10456 BLOCK 77 N 1/2 OF LOT 3 IN OR 1913/648 CITY OF FERNANDINA BCH ==================================== 2492 00-00-31-1800-0077-0071 160.37 TIFTON NASSAU LLC 0.000AC PO BOX 15163 FERNANDINA BEACH FL 32035 BLOCK 77 N1/2 OF LOT 7 PT OR 1751/1277 CITY OF FDNA BEACH ==================================== 2493 00-00-31-1800-0078-0020 756.76 SWANN S A EST 0.000AC 36 LYMAN RD NORTHAMPTON MA 01060 BLOCK 78 LOTS 2 3 6 CITY OF FDNA BEACH ==================================== 2494 00-00-31-1800-0080-0011 HX 229.84 BARRY SHAUN 0.000AC 108 N 10TH ST FERNANDINA BEACH FL 32034 BLOCK 80 N1/2 OF LOT 1 IN OR 2021/1164 CITY OF FDNA BEACH ==================================== 2495 00-00-31-1800-0081-0030 HX 1,107.16 DAVIS JOHN L EST 0.000AC C/O LAURINE MURRAY DAVIS 222 N 10TH ST FERNANDINA BEACH FL 32034 BLOCK 81 LOT 3 OR 130/615 CITY OF FDNA BEACH ==================================== 2496 00-00-31-1800-0082-0050 134.69 ALBERTIE GREGORY K & KATHERINE 0.000AC 319 NORTH 11TH ST FERNANDINA BEACH FL 32034 BLOCK 82 LOT 5 PT OR 792/887 CITY OF FDNA BEACH ==================================== 2497 00-00-31-1800-0082-0080 1,623.31 BOOTH SHARON H 0.000AC 1009 CALHOUN ST FERNANDINA BEACH FL 32034-3379 BLOCK 82 W1/2 OF LOT 8 IN OR 1414/1133 CITY OF FDNA BEACH ==================================== 2498 00-00-31-1800-0084-0040 HX 1,459.44 RILEY FANNIE MAE EST 0.000AC C/O REBECCA LESTER 1012 FRANKLIN ST FERNANDINA BEACH FL 32034 BLOCK 84 LOT 4 2/6 HX INT CITY OF FDNA BEACH ==================================== 2499 00-00-31-1800-0084-0051 608.91 RILEY IDA MAE & 0.000AC RILELY IRA & REBECCA & HELEN M 1012 FRANKLIN STREET FERNANDINA BEACH FL 32034 BLOCK 84 LOT N 1/2 OF 5 L/E OR 254/177 CITY OF FDNA BEACH ==================================== 2500 00-00-31-1800-0084-0080 HX 998.21 LOVETT BARBARA L H EST 0.000AC 511 N 11TH ST FERNANDINA BEACH FL 32034 BLK 84 S 75FT OF LOT 8 OR 324/526 CITY OF FDNA BEACH ==================================== 2501 00-00-31-1800-0129-0030 3,916.28 BUILDING AMELIA LLC 0.000AC 1035 ISLE OF PALMS LN FERNANDINA BEACH FL 32034 BLOCK 129 LOT 3 PT OR 2001/1010 CITY OF FDNA BEACH ==================================== 2502 00-00-31-1800-0129-0062 446.94 BUILDING AMELIA LLC 0.000AC 1035 ISLE OF PALMS LN FERNANDINA BEACH FL 32034 BLOCK 129 LOT S1/2 OF 6 IN OR 2001/1010 CITY OF FDNA BEACH ==================================== 2503 00-00-31-1800-0130-0022 1,960.05 LEIBMAN MARILYN C 0.000AC PO BOX 150 SOUND BEACH NY 11789 BLOCK 130 S1/2 OF LOT 2 IN OR 1207/1645 CITY OF FDNA BEACH ==================================== 2504 00-00-31-1800-0130-0052 513.95 ARLINE GLORIA QUARTERMAN 0.000AC 11668 CHERRY BARK DRIVE EAST JACKSONVILLE FL 32218 BLOCK 130 LOT S1/2 OF 5 IN OR 684/1560 CITY OF FDNA BEACH ==================================== 2505 00-00-31-1800-0130-0060 513.95 TOLBERT CARLTON E 0.000AC 45 WEST DURHAM ST PHILADELPHIA PA 19119 BLOCK 130 LOT 6 (EX S-1) IN OR 1829/602 CITY OF FDNA BEACH ==================================== 2506 00-00-31-1800-0130-0071 1,546.34 TOLBERT CARLTON E & 0.000AC WILSON-TOLBERT ROBIN (H&W) 45 W DURHAM ST PHILADELPHIA PA 19119 BLOCK 130 N1/2 OF LOT 7 IN OR 1743/226 CITY OF FDNA BEACH ==================================== 2507 00-00-31-1800-0133-0060 513.95 YOUMAN EARL 0.000AC TRAEYE PATRICIA & 425 SOUTH 10TH STREET FERNANDINA BEACH FL 32034 BLK 133 LOT 6 (EX PT IN OR 1043/1134) CITY OF FDNA BEACH OF SEC 23-3N-28E ==================================== 2508 00-00-31-1800-0134-0062 HX 586.20 RAYSOR ROBIN R 0.000AC 423 S 9TH ST FERNANDINA BEACH FL 32034 BLOCK 134 LOT S1/2 OF 6 IN OR 1993/1083 CITY OF FDNA BEACH ==================================== 2509 00-00-31-1800-0135-0050 5,439.38 HAIR TONY R & VIRGINIA G 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 BLOCK 135 LOTS 5 & 6 PT OR 1019/1866 CITY OF FDNA BEACH ==================================== 2510 00-00-31-1800-0135-0070 1,540.86 HAIR TONY R & VIRGINIA G 0.000AC 2638 MCGREGOR BLVD FERNANDINA BEACH FL 32034 BLOCK 135 LOT 7 PT OR 1019/1866 ESMT PT OR 1020/522 FDNA OF FDNA BEACH ==================================== 2511 00-00-31-1800-0139-0080 HX 1,896.64 JONES TERRY & 0.000AC ANDREA RACHAEL 531 S 6TH ST FERNANDINA BEACH FL 32034 BLOCK 139 LOTS 8 & 9 IN OR 523 PG 19 (1/2 INT HX) CITY OF FDNA BEACH ==================================== 2512 00-00-31-1800-0139-0130 1,666.31 BROWN ALDO R EST 0.000AC 511 S 6TH ST FERNANDINA BEACH FL 32034 BLOCK 139 LOT 13 CITY OF FDNA BEACH ==================================== 2513 00-00-31-1800-0140-0070 HX 901.27 TESTON RASTUS T JR 0.000AC 517 S 7TH ST FERNANDINA BEACH FL 32034 BLOCK 140 LOT 7 OR 554/555 & OR 841/1249 CITY OF FDNA BEACH ==================================== 2514 00-00-31-1800-0143-0021 HX 328.90 REEVES BESSIE L/E 0.000AC WILLIE B POLLARD JR 512 S 9TH ST FERNANDINA BEACH FL 32034 BLOCK 143 LOT N1/2 OF 2 L/E IN OR 794/463 CITY OF FDNA BEACH ==================================== 2515 00-00-31-1800-0143-0022 715.63 GILBERT WARREN EST 0.000AC C/O TRANELL B GILBERT PO BOX 16763 FERNANDINA BEACH FL 32035-3130 BLOCK 143 LOT S1/2 OF 2 CITY OF FDNA BEACH ==================================== 2516 00-00-31-1800-0143-0042 445.84 LEIBMAN MARILYN C 0.000AC PO BOX 150 SOUND BEACH NY 11789-0150 BLOCK 143 LOT S1/2 OF 4 IN OR 1279/1351 CITY OF FDNA BEACH ==================================== 2517 00-00-31-1800-0146-0022 460.16 RIVER GREEN ESTATES LLC 0.000AC 11323 PHILLIPS PKWY DR STE 7 JACKSONVILLE FL 32256 BLOCK 146 LOT S1/2 OF 2 IN OR 2144/1597 CITY OF FDNA BEACH ==================================== 2518 00-00-31-1800-0146-0061 HX 1,520.15 HOLCEY MARK C & 0.000AC HOLCEY CARLOS D & CHERRELL M & 619 SOUTH 10TH STREET FERNANDINA BEACH FL 32034 BLOCK 146 N1/2 OF LOT 6 IN OR 1658/96 CITY OF FDNA BEACH 1/4 HX INT ==================================== 2519 00-00-31-1800-0156-0270 4,083.74 TYLER ONEAL JR TRUSTEE 0.000AC OF ONEAL TYLER SR FAMILY 504 NORTH DONAR DRIVE COLUMBIA SC 29229 BLOCK 156 LOTS 27 28 29 30 31 & 32 PT OR 1500/927 CITY OF FDNA BEACH ==================================== 2520 00-00-31-1800-0157-0011 1,942.33 JGSP INVESTMENTS LLC 0.000AC 330 S 12TH STREET FERNANDINA BEACH FL 32034 BLOCK 157 E1/2 OF LOTS 1 2 3 4 IN OR 2138/1008 CITY OF FDNA BEACH ==================================== 2521 00-00-31-1800-0158-0070 252.16 EVANS JESSIE H EST 0.000AC C/O BONNIE WILLIAMS 3501 T AVENUE RIVIERA BEACH FL 33404 BLOCK 158 LOT 7 CITY OF FDNA BEACH ==================================== 2522 00-00-31-1800-0160-0030 HX 512.56 EVANS JOE III & 0.000AC HOLMES LISA & KAREN LOCKETT & 810 S 7TH ST FERNANDINA BEACH FL 32034 BLOCK 160 LOTS 3 4 & 5 IN OR 977/1609 CITY OF FDNA BEACH ==================================== 2523 00-00-31-1800-0168-0090 469.91 MCCOY BERTHA EST 0.000AC C/O MCNEAR THELMA & 905 S 9TH ST FERNANDINA BEACH FL 32034 BLOCK 168 LOTS 9 10 CITY OF FDNA BEACH ==================================== 2524 00-00-31-1800-0170-0070 2,818.35 TYLER LEONIA M 0.000AC 1274 NIPIGON AVE ATLANTIC BCH FL 32233 BLOCK 170 LOTS 7 8 9 & 10 IN OR 893/345 CITY OF FDNA BEACH ==================================== 2525 00-00-31-1800-0171-0110 HX 115.18 LOVETT FRANCES M 0.000AC 1024 S 9TH ST FERNANDINA BEACH FL 32034 BLOCK 171 LOTS 11 & 12 IN OR 83 PG 518 CITY OF FDNA BEACH ==================================== 2526 00-00-31-1800-0171-0190 2,234.52 OLSON FAMILY LIVING TRUST 0.000AC THOMAS W OLSON TRUSTEE ET AL 3RA AVE SUR 20 ANTIGUA SACATEPQUEZ GUATEMALA BLOCK 171 LOTS 19 20 21 & S1/2 OF LOT 22 IN OR 2080/1894 CITY OF FDNA BEACH ==================================== 2527 00-00-31-1800-0172-0310 1,156.59 KYLE ELAINE S TRUSTEE 0.000AC KYLE LIVING TRUST 1050 VICTORY LAKE DRIVE JACKSONVILLE FL 32221-1388 BLOCK 172 LOTS 31 & 32 IN OR 929/1157 & OR 1364/776 CITY OF FDNA BEACH ==================================== 2528 00-00-31-1800-0181-0020 HX 1,637.35 FISHER PAMELIA F & 0.000AC WILSON NETHERLAND F 816 VERNON ST FERNANDINA BEACH FL 32034 BLOCK 181 LOT 2 & N1/2 OF LOT 7 & S1/2 OF LOT 8 IN OR 1231/301 1/2 HX INT CITY OF FDNA BEACH ==================================== 2529 00-00-31-1800-0182-0071 HX 569.83 POLLARD JAVONE D 0.000AC 1111 S 11TH ST FERNANDINA BEACH FL 32034 BLOCK 182 N1/2 OF LOT 7 A/K/A SUBLOTS A & B IN OR 802/577 CITY OF FDNA BEACH PB 1/25 ==================================== 2530 00-00-31-1800-0182-0072 513.95 MARTIN ROBERT EST 0.000AC C/O THOMAS A SANDERS P O BOX 15073 FERNANDINA BEACH FL 32035-3102 BLOCK 182 S1/2 OF LOT 7 A/K/A SUBLOTS C & D IN OR 222/616 CITY OF FDNA BEACH PB 1/25 ==================================== 2531 00-00-31-1800-0185-0010 849.92 1224 S 8TH ST FERNANDINA BEACH FL 32034 BLOCK 185 LOTS 1 2 7 & 8 EAST OF HWY & PT OF VACATED S 9TH ST IN OR 1233/1012 (EX PT ST RD IN OR 1594/617) CITY OF FDNA BEACH ==================================== 2532 00-00-31-1800-0187-0070 1,080.94 JACKSON NATHALIE 0.000AC 1251 6TH ST S FERNANDINA BEACH FL 32034 BLOCK 187 N 90 FT OF LOT 7 IN OR 2007/141 CITY OF FDNA BEACH ==================================== 2533 00-00-31-1800-0188-0080 HX 671.07 DOUGLAS MARK S & NANCY 0.000AC 1223 S 5TH ST FERNANDINA BEACH FL 32034 BLOCK 188 LOT 8 IN OR 893/1042 CITY OF FDNA BEACH ==================================== 2534 00-00-31-1800-0190-0010 HX 460.93 FRENCH SUSAN N 0.000AC 360 MAGNOLIA ST FERNANDINA BEACH FL 32034 BLOCK 190 LOTS 1 2 & 8 OR 169 PG 44 CITY OF FDNA BEACH ==================================== 2535 00-00-31-1800-0190-0070 1,016.11 THEOBALD THOMAS A & RAMONA R 0.000AC 96568 CALHOUN RD FERNANDINA BEACH FL 32034 BLOCK 190 LOT 7 IN OR 1210/1508 CITY OF FDNA BEACH ==================================== 2536 00-00-31-1800-0192-0020 839.58 THEOBOLD THOMAS A & RAMONA R 0.000AC 96568 CALHOUN RD FERNANDINA BEACH FL 32034 BLOCK 192 LOT 2 IN OR 1254/102 CITY OF FDNA BEACH ==================================== 2537 00-00-31-1800-0192-0030 HX 753.40 LOVE SHEILA A EST 0.000AC 1320 S 5TH ST EXT FERNANDINA BEACH FL 32034 BLOCK 192 LOT 3 IN OR 1841/292 CITY OF FDNA BEACH ==================================== 2538 00-00-31-1800-0193-0030 1,750.93 NAGLE EARL S IV 0.000AC 7343 TARPON AVE FERNANDINA BEACH FL 32034 BLOCK 193 LOT 3 IN OR 1697/1090 CITY OF FDNA BEACH ==================================== 2539 00-00-31-1800-0193-0042 1,945.15 THRIFT BARBARA SUE 0.000AC 1330 S 6TH ST FERNANDINA BEACH FL 32034 BLOCK 193 S10 FT OF LOT 4 & BLOCK 200 N10 FT OF LOT 1 & PARCEL 5 24-3N-28 IN OR 1730/933 CITY OF FDNA BEACH ==================================== 2540 00-00-31-1800-0196-0010 1,488.64 GALLUP WILLIAM F & MARILYN L 0.000AC 1108 OLIVE ST FERNANDINA BEACH FL 32034 BLOCK 196 LOTS 1 2 & 3 IN OR 840/276 CITY OF FDNA BEACH ==================================== 2541 00-00-31-1800-0196-0080 HX 567.84 GALLUP WILLIAM F & 0.000AC GALLUP MARILYN L 1090 OLIVE ST FERNANDINA BEACH FL 32034 BLOCK 196 LOT 8 IN OR 1710/100 R/W IN OR 150/517 CITY OF FDNA BEACH ==================================== 2542 00-00-31-1800-0199-0030 HX 463.26 FELDMAN IRMA K 0.000AC 1474 CLINCH DRIVE FERNANDINA BEACH FL 32034 BLOCK 199 LOT 3 OR 161 PG 387 CITY OF FDNA BEACH ==================================== 2543 00-00-31-1800-0199-0081 301.69 BRAND JANICE 0.000AC 3163 GLENRIDGE DR PALM HARBOR FL 34685 BLOCK 199 N10 FT OF LOT 8 & PARCEL 4-1 OF SEC 24-3N-28 IN OR 1891/1356 CITY OF FDNA BEACH ==================================== 2544 00-00-31-1800-0201-0010 858.14 PLATT MICHAEL V EST 0.000AC 1411 S 6TH ST FERNANDINA BEACH FL 32034 BLOCK 201 LOTS 1 & 8 R787411 IN OR 906/620 CITY OF FDNA BEACH ==================================== 2545 00-00-31-1800-0201-0020 532.31 HOOPER SPICER EST 0.000AC C/O MARGARET S TURNER 1412 SO NAPA ST PHILDELPHIA PA 19146 BLOCK 201 LOT 2 CITY OF FDNA BEACH ==================================== 2546 00-00-31-1800-0201-0050 657.37 HOOPER JACKIE LASHAWN 0.000AC 86145 FORTUNE DRIVE YULEE FL 32097 BLOCK 201 LOT 5 IN OR 1518/226 CITY OF FDNA BEACH ==================================== 2547 00-00-31-1800-0201-0070 657.37 HOOPER MARION H 0.000AC C/O MARGARET S TURNER 1412 S NAPA STREET PHILADELPHIA PA 19146 BLOCK 201 LOT 7 CITY OF FDNA BEACH ==================================== 2548 00-00-31-1800-0206-0070 626.12 SIMMONS ARTHUR 0.000AC C/O MRS M J WHITLEY 5028 DOSTIE DR S JACKSONVILLE FL 32209 BLK 206 LOT 7 CITY OF FDNA BEACH S/D OF SEC 24-3N-28E ==================================== 2549 00-00-31-1800-0209-0011 854.07 GALLUP WILLIAM 0.000AC 1108 OLIVE ST FERNANDINA BEACH FL 32034 BLOCK 209 N1/2 OF LOT 1 IN OR 467 PG 236 CITY OF FDNA BEACH ==================================== 2550 00-00-31-1800-0209-0012 614.56 GALLUP WILLIAM & MARILYN 0.000AC 1108 OLIVE ST FERNANDINA BEACH FL 32034 BLOCK 209 LOT S1/2 OF 1 IN OR 673 PG 1351 CITY OF FDNA BEACH ==================================== 2551 00-00-31-1800-0213-0022 2,368.89 BLUE BENJAMIN J & 0.000AC BLUE JAMES C JR & ROBERT E SR PO BOX 371 FERNANDINA BEACH FL 32035-0371 IN OR 1522/801 CITY OF FDNA BEACH ==================================== 2552 00-00-31-1800-0213-0061 HX 177.80 JONES EVANS & ROSIE M 0.000AC 923 S 12TH ST FERNANDINA BEACH FL 32034 BLK 213 N 65.5 FT OF S 147.5 FT OF E 100 FT OF LOT 6 OR 175 PG 503 CITY OF FDNA BCH ==================================== 2553 00-00-31-1800-0213-0091 HX 1,275.12 JONES JOLYN & DAVIS 0.000AC BRIDGETTE & JONES RONALD 815 S 12TH ST FERNANDINA BEACH FL 32034 BLOCK 213 N50 FT OF E100 FT OF LOT 9 & S11 FT OF E100 FT OF LOT 10 IN OR 2047/911 & OR 2047/915 CITY OF FDNA BEACH ==================================== 2554 00-00-31-1800-0213-0094 325.98 CMR ISLAND LLC 0.000AC 1766 MEMORIAL DR SUITE 1 WAYCROSS GA 31501 BLOCK 213 PT OF LOTS 9 & 10 IN OR 2125/589 CITY OF FDNA BEACH ==================================== 2555 00-00-31-1800-0213-0103 325.98 CMR ISLAND INC 0.000AC 1766 MEMORIAL DR #1 WAYCROSS GA 31501 IN OR 2125/585 CITY OF FDNA BEACH ==================================== 2556 00-00-31-1800-0214-01A0 2,584.01 HARDY MERRITT S 0.000AC 528 S 13TH TERRACE FERNANDINA BEACH FL 32034 BLK 214 TRACT A OF LOT 1 & N 14 FT OF TRACT B OF LOT 1 IN OR 1948/1827 CITY OF FDNA BEACH S/D OF SEC 24-3N-28E UNR ==================================== 2557 00-00-31-1800-0214-03D2 1,639.31 MCNEIL DELORES M EST 0.000AC 1109 GUM ST FERNANDINA BEACH FL 32034 BLK 214 W1/2 OF S 44 FT OF TRACT C OF LOT 2 & W1/2 OF TRACT D OF LOT 3 IN OR 510/277 CITY OF FDNA BEACH S/D OF SEC 24-3N-28E UNR ==================================== 2558 00-00-31-1800-0214-06A1 HX 501.37 RICHO ABRAHAM & DOROTHY J 0.000AC 722 DIVISION ST FERNANDINA BEACH FL 32034 BLOCK 214 SUB N 72 FT OF A OF 6 SUB S 28 FT OF B OF 7 FINAL JDGMNT QUIETING TITLE IN OR 994/603 CITY OF FDNA BEACH ==================================== 2559 00-00-31-1800-0214-07A2 1,636.82 ABENDROTH AMANDA 0.000AC 13700 RICHMOND PARK DR N #1301 JACKSONVILLE FL 32224 BLOCK 214 LOT S 42 FT OF A & N 8 FT OF B OF 7 IN OR 1971/881 CITY OF FDNA BEACH ==================================== 2560 00-00-31-1800-0214-07D1 1,350.51 DUFFY TAWN CHRISTOPHER 0.000AC 1473 FOUNTAIN DR FERNANDINA BEACH FL 32034 BLOCK 214 N 50 FT OF D OF 7 IN OR 1851/1414 CITY OF FDNA BEACH ==================================== 2561 00-00-31-1800-0214-08D0 HX 609.96 WHICKER DANA ROBERT 0.000AC 842 PARKVIEW PLACE E FERNANDINA BEACH FL 32034 BLK 214 SUB D OF 8 IN OR 2146/1176 CITY OF FDNA BEACH ==================================== 2562 00-00-31-1800-0214-09C2 456.11 WHICKER DANA ROBERT 0.000AC 842 PARKVIEW PL E FERNANDINA BEACH FL 32034 BLOCK 214 S44 FT OF SUB C OF LOT 9 IN OR 2129/1022 CITY OF FDNA BEACH ==================================== 2563 00-00-31-1800-0214-10B0 1,480.33 HARDENBERGH DIANNE E EST 0.000AC 1125 N FLETCHER AV FERNANDINA BEACH FL 32034 BLOCK 214 N50 FT OF S72 FT OF SUB B OF LOT 10 IN OR 1408/917 CITY OF FDNA BEACH ==================================== 2564 00-00-31-1800-0215-02C1 1,088.34 RICHO DAYLON 0.000AC 330 SOUTH 12TH STREET FERNANDINA BEACH FL 32034 BLOCK 215 N29 FT OF C OF LOT 2 & S28 FT OF D OF LOT 2 IN OR 2008/118 CITY OF FDNA BEACH ==================================== 2565 00-00-31-1800-0215-10A0 653.69 SMITH MENTORIA 0.000AC 400 RONDA KAY CT APT 68 FT WALTON BEACH FL 32548 BLOCK 215 SUB A OF 10 IN OR 610/365 & OR 1915/1260 CITY OF FDNA BEACH ==================================== 2566 00-00-31-1800-0216-03D0 HX 38.22 REED MATTIE 0.000AC 227 DIVISION ST FERNANDINA BEACH FL 32034 BLK 216 TRACT D OF LOT 3 & S1/2 OF TRACT C OF LOT 2 IN OR 783/1909 & OR 785/1881 CITY OF FDNA BEACH S/D OF SEC 23-3N-28E UNR ==================================== 2567 00-00-31-1800-0216-04A0 653.69 ULSAKER NORMAN L & JUNE TRUST 0.000AC 325 ROUNDHOUSE DR PERRYVILLE MD 21903 BLOCK 216 SUB A OF LOT 4 IN OR 1498/1027 CITY OF FDNA BEACH ==================================== 2568 00-00-31-1800-0216-04D2 311.53 SADLER BELLE 0.000AC C/O PEGGY B DEAN 1476 N W 37TH ST MIAMI FL 33142 BLOCK 216 SUB S 29 FT OF D OF 4 CITY OF FDNA BEACH ==================================== 2569 00-00-31-1800-0216-05D0 653.69 REMSON DOROTHY 0.000AC 102 W PALM CT KINGSLAND GA 31548 BLOCK 216 SUB D OF 5 IN OR 1540/1740 CITY OF FDNA BEACH ==================================== 2570 00-00-31-1800-0216-08B0 HX 541.25 SOUTHERS REBECCA G EST & 0.000AC BAILEY DAISEY M EST 304 DIVISION ST FERNANDINA BEACH FL 32034 BLOCK 216 SUB B OF 8 CITY OF FDNA BEACH ==================================== 2571 00-00-31-1800-0230-01A0 1,453.67 THE AMERICAN LEGION POST 174 0.000AC PO BOX 15704 FERNANDINA BEACH FL 32035 BLOCK 230 SUB A & B OF 1 IN OR 1659/1505 CITY OF FDNA BEACH ==================================== 2572 00-00-31-1800-0230-03A0 629.49 HARRIS CHARLES E JR 0.000AC 1280 NW 58TH TERRACE SUNRISE FL 33313 BLOCK 230 SUB A OF LOT 3 IN OR 2094/1268 CITY OF FDNA BCH ==================================== 2573 00-00-31-1800-0230-03D0 1,940.62 HARRIS CHARLES E JR 0.000AC 1280 NW 58TH TERRACE SUNRISE FL 33313 BLOCK 230 SUB D OF 3 IN OR 2094/1272 CITY OF FERNANDINA BEACH ==================================== 2574 00-00-31-1800-0230-05B0 HX 598.95 RICHO JEROME & 0.000AC RICHO RYAN 330 S 12TH ST FERNANDINA BEACH FL 32034 BLOCK 230 SUB B OF LOT 5 IN OR 2116/520 CITY OF FDNA BEACH ==================================== 2575 00-00-31-1800-0230-08B0 HX 579.89 BENTON TOMMIE L 0.000AC PO BOX 1234 FERNANDINA BEACH FL 32035-1234 BLK 230 TRACT B OF LOT 8 IN OR 631/1090 CITY OF FDNA BEACH S/D OF SEC 23-3N-28E UNR ==================================== 2576 00-00-31-1800-0230-08D0 HX 721.57 JONES CATHERINE & 0.000AC JONES CORNELLIA & 229 S 13TH STREET FERNANDINA BEACH FL 32034 BLK 230 TRACT D OF LOT 8 IN OR 701/1991 CITY OF FDNA BEACH S/D OF SEC 23-3N-28E UNR ==================================== 2577 00-00-31-1800-0230-09C0 HX 622.14 DEMPS OSTEAN JR 0.000AC 225 S 13TH ST FERNANDINA BEACH FL 32034 BLK 230 TRACT C OF LOT 9 IN OR 2087/1389 CITY OF FDNA BEACH S/D OF SEC 23-3N-28E UNR ==================================== 2578 00-00-31-1800-0230-09D0 2,332.01 SIMS DORIS J 0.000AC 217 S 13TH ST FERNANDINA BECH FL 32034 BLOCK 230 SUB D OF LOT 9 IN OR 1752/41 CITY OF FDNA BEACH ==================================== 2579 00-00-31-1800-0231-02C2 581.42 RIVER GREEN ESTATES LLC 0.000AC 11323 PHILLIPS PKWY DR STE 7 JACKSONVILLE FL 32256 BLK 231 W1/2 TRACT C OF LOT 2 & W1/2 OF TRACT D OF LOT 3 IN OR 2144/1745 CITY OF FDNA BEACH ==================================== 2580 00-00-31-1800-0232-05C2 1,765.05 THOMAS LORA ANN 0.000AC 731 VERNON ST FERNANDINA BEACH FL 32034 BLOCK 232 S 50 FT OF C OF 5 IN OR 330 PG 615 CITY OF FDNA BEACH ==================================== 2581 00-00-31-1800-0233-0023 HX 1,327.89 ROBERTS TERRY LEE 0.000AC 816 S 12TH ST FERNANDINA BEACH FL 32034 BLOCK 233 W 100FT OF N 1/2 OF LOT 2 IN OR 1332/1276 CITY OF FDNA BEACH ==================================== 2582 00-00-31-1800-0233-0041 HX 702.16 WILLIAMSON JAMES JR 0.000AC 909 VERNON ST FERNANDINA BEACH FL 32034 BLOCK 233 N 65.5 FT OF W100 FT OF E130 FT OF LOT 4 IN OR 678 PG 1543 CITY OF FDNA BEACH ==================================== 2583 00-00-31-1800-0233-0046 HX 233.74 WILLIAMS BETTY LEOLA 0.000AC 920 S 12TH ST FERNANDINA BEACH FL 32034 BLOCK 233 S 41 FT OF W 100 FT OF LOT 4 & N 24.5 FT OF W 100 FT OF LOT 5 IN OR 199/202 & OR 375/514 CITY OF FDNA BEACH ==================================== 2584 00-00-31-1800-0233-0076 1,720.54 MITCHELL GLENITA M 0.000AC 920 VERNON ST FERNANDINA BEACH FL 32034 BLOCK 233 S41 FT OF E100 FT OF W130 FT OF LOT 7 & N24.5 FT OF E100 FT OF W130 FT OF LOT 6 IN OR 791/1460 CITY OF FDNA BEACH ==================================== 2585 00-00-31-1800-0233-0093 HX 618.23 WILSON NETHERLAND F 0.000AC 816 VERNON ST FERNANDINA BEACH FL 32034 BLOCK 233 E100 FT OF W130 FT OF N1/2 OF LOT 9 IN OR 1943/1206 CITY OF FDNA BEACH ==================================== 2586 00-00-31-1800-0238-0070 HX 1,828.24 MURPHY LONNIE HOWARD 0.000AC 1107 S 14TH ST FERNANDINA BEACH FL 32034 BLOCK 238 LOT 7 EX S1/2 IN OR 1908/804 & OR 1909/144 CITY OF FDNA BEACH ==================================== 2587 00-00-31-1800-0240-0091 2,456.70 MCLAUGHLIN HOLLE M 0.000AC 1849 HIGHLAND DR FERNANDINA BEACH FL 32034-2408 BLOCK 240 LOT E200 FT OF N 1/2 OF 9 IN OR 604 PG 274 CITY OF FDNA BEACH ==================================== 2588 00-00-31-1800-0241-1090 1,027.03 14TH STREET FERNANDINA LLC 0.000AC 56 MARSH CREEK ROAD FERNANDINA BEACH FL 32034 BLOCK 241 LOTS 109 110 111 & 112 IN OR 1551/1660 CITY OF FDNA BEACH ==================================== 2589 00-00-31-1800-0242-02C0 2,253.52 BENJAMIN CARL T & MARGIE L 0.000AC 294 HILLCREST RD TIFTON GA 31794 BLOCK 242 SUB C & D OF LOT 2 IN OR 372 PG 333 CITY OF FDNA BEACH ==================================== 2590 00-00-31-1800-0242-10A0 HX 256.50 HILL SHEILA 0.000AC 1316 BEECH ST FERNANDINA BEACH FL 32034 BLOCK 242 SUB A OF LOT 10 OR 1588/1490 CASE #08-CP-165 IN OR 1594/78 & 80 CITY OF FDNA BEACH ==================================== 2591 00-00-31-1800-0243-05C0 1,057.12 THOMPSON LEROY BERNARD & 0.000AC PATRICIA 1311 BEECH ST FERNANDINA BEACH FL 32034 BLOCK 243 SUB C OF 5 IN OR 574/117 CITY OF FDNA BEACH ==================================== 2592 00-00-31-1800-0243-05D0 HX 724.24 THOMPSON LEROY B SR & PATRICIA 0.000AC 1311 BEECH ST FERNANDINA BEACH FL 32034 BLOCK 243 SUB LOT D OF 5 IN OR 411/771 & OR 502/983 CITY OF FDNA BEACH ==================================== 2593 00-00-31-1800-0243-06D0 638.31 BEACH DANA & JENNIFER (M/C) 0.000AC 85052 CHAMPLAIN DR FERNANDINA BEACH FL 32034 BLK 243 TRACT D OF LOT 6 IN OR 2122/880 CITY OF FDNA BEACH S/D IN SEC 23-3N-28E ==================================== 2594 00-00-31-1800-0244-06A2 1,050.84 GEORGE PATSY SUE EST 0.000AC 128 N 13TH ST TER FERNANDINA BEACH FL 32034 BLOCK 244 SUB G N12 FT OF H OF LOT 6 & S5 FT OF A OF 6 IN OR 723 PG 476 CITY OF FDNA BEACH ==================================== 2595 00-00-31-1800-0244-10B1 2,887.74 DEONAS NICK D & HELEN D 0.000AC 96208 LIGHTWIND DR FERNANDINA BEACH FL 32034-6170 BLK 244 N 55 FT OF TRACT B OF LOT 10 IN OR 727/1257 CITY OF FDNA BEACH ==================================== 2596 00-00-31-1800-0245-01B1 1,206.85 LEIBMAN MARILYN C 0.000AC PO BOX 150 SOUND BEACH NY 11789 BLK 245 N1/2 OF TRACT B OF LOT 1 & S 7FT OF TRACT D OF LOT 2 IN OR 1977/252 FERNANDINA DOCK & REALTY CO R/P PBK 2/54 ==================================== 2597 00-00-31-1800-0245-02A0 HX 311.23 BOUNDS JUDY 0.000AC 225 N 13TH ST FERNANDINA BEACH FL 32034 BLK 245 TRACTS A,B,C & NORTH 79 FT OF TRACT D OF LOT 2 & TRACT D OF LOT 3 IN OR 1929/191 FERNANDINA DOCK & REALTY CO R/P PBK 2/54 ==================================== 2598 00-00-31-1800-0245-10A0 HX 252.56 RYALS JUANITA C 0.000AC 205 N 14TH ST FERNANDINA BEACH FL 32034 BLOCK 245 SUB A & B 0F 10 IN DB 198 PG 265 REPLAT OF BLOCK 245 PB 2/54 CITY OF FDNA BEACH ==================================== 2599 00-00-31-1800-0253-0051 6,757.52 VELTRE SUZAN & 0.000AC VELTRE JOSEPH M & JOHN K 1401 HIGHLAND DR FERNANDINA BEACH FL 32034 BLK 253 PT OF LOTS 5,6 & BLK 252 PT OF LOT 8 & PT OF UNDEVELOPED PROPOSED R/W LYING BETWEEN BLKS 252 & 253 IN OR 2096/1532 CITY OF FDNA BEACH S/D UNR ==================================== 2600 00-00-31-1800-0256-0102 HX ,533.13 HAWKE JENNIFER SUPAN & 0.000AC SUPAN CURT J & MARY E 1423 FRANKLIN STREET FERNANDINA BEACH FL 32034 BLOCK 256 W80 FT OF LOT 10 IN OR 1460/1406 CITY OF FDNA BEACH ==================================== 2601 00-00-31-1800-0258-0050 1,994.84 DWORETZKY ANDREW 0.000AC 1314 5TH ST FAIR LAWN NJ 07410 BLOCK 258 W100 FT OF W200 FT OF N1/2 OF LOT 5 IN OR 1980/1803 CITY OF FDNA BEACH ==================================== 2602 00-00-31-1800-0258-R10C HX 700.84 MILLS ROBERT 0.000AC 1425 BROOME STREET FERNANDINA BEACH FL 32034 SUBLOT C & S 22 FT OF SUBLOT A OF LOT 10 OR 2019/150 REPLAT BLOCK 258 PB 2/54 CITY OF FDNA BEACH ==================================== 2603 00-00-31-1800-0261-0091 2,458.93 PETRO BARBARA GLADYS DOUGLASS 0.000AC 1430 BEECH ST FERNANDINA BEACH FL 32034 BLOCK 261 N1/2 OF LOT 9 & TRACTS A,B,G & H OF LOT 10 & E1/2 ABANDONED ST LYING W THEREOF IN OR 1972/150 CITY OF FDNA BEACH S/D IN SEC 18-3N-28E UNR ==================================== 2604 00-00-31-1800-0262-0041 2,557.17 YOUNG PATRICIA 0.000AC 86058 JEAN ROAD YULEE FL 32097 BLOCK 262 S75 FT OF N106 FT OF LOT 4 IN OR 1653/1161 CITY OF FDNA BEACH ==================================== 2605 00-00-31-1800-0266-0061 10,919.31 CEMR INC 0.000AC 86229 NORTH HAMPTON CLUB WAY FERNANDINA BEACH FL 32034 BLK 266 E 180FT OF LOT 6 IN OR 1190/1786 CITY OF FDNA BEACH ==================================== 2606 00-00-31-1800-0269-0280 1,637.29 BURGESS ANNETTE J 0.000AC 216 CENTRE ST FERNANDINA BEACH FL 32034 BLOCK 269 LOT 28 EX S29.9 FT IN OR 697/881 CITY OF FDNA BEACH ==================================== 2607 00-00-31-1800-0271-0110 3,405.45 ARTISAN HOMES LLC 0.000AC 9995 GATE PARKWAY N STE 400 JACKSONVILLE FL 32246 BLOCK 271 PT LOTS 11 & 12 EAST OF SAR R/W & LOTS 22 & 23 IN OR 2113/1862 CITY OF FDNA BEACH ==================================== rf rfntb DEL. TAX LIST 2017.indd 17 4/30/18 12:20 PM

PAGE 78

2608 00-00-31-1800-0273-0010 HX 5,081.45 GIEDRYS NORA 0.000AC 208 BEECH ST FERNANDINA BEACH FL 32034 BLK 273 PT LOTS 1,2,3,4,5,32, 33 & 34 IN OR 974/1225 CITY OF FDNA BEACH S/D OF SEC 23-3N-28E ==================================== 2609 00-00-31-1800-0280-0080 2,857.16 DAVIS MITCHELL W & 0.000AC DAVIS GRADY L 409 FIR ST FERNANDINA BEACH FL 32034 BLOCK 280 LOT 8 IN OR 1741/85 CITY OF FDNA BEACH ==================================== 2610 00-00-31-1800-0281-0002 2,538.60 RICHARDSON MICHAEL 0.000AC PO BOX 483 FERNANDINA BEACH FL 32035-0483 BLOCK 281 LOTS LYING EAST OF A STRAIGHT LINE DRAWN FROM NW CORNER OF LOT 31 TO SE CORNER OF LOT 20 OR 868/1805 & PT OR 1232/228 CITY OF FDNA BEACH ==================================== 2611 00-00-31-1800-0281-0020 525.05 RICHARDSON MICHAEL 0.000AC PO BOX 483 FERNANDINA BEACH FL 32035-0483 BLOCK 281 LOTS 2-5 & PT OF LOTS 21-26 & PT OF LOTS 30-31 PT OR 1246/1381 CITY OF FDNA BEACH ==================================== 2612 00-00-31-1800-0308-0080 2,210.09 DRAKUS NICHOLAS L 0.000AC 94140 MERLIN DR FERNANDINA BEACH FL 32034 E OF RR & PT LOT 2 BLOCK 185 INCL PT OF R/W IN OR 1558/1367 CITY OF FDNA BEACH ==================================== 2613 00-00-31-1800-0309-0032 2,340.04 GAGE SCOTT MICHAEL & 0.000AC GAGE CARLA SUSAN (H&W) 4901 E WINDRIDGE AVE WASILLA AK 99654 BLOCK 309 PT OF LOTS 3 4 5 & 6 W OF HWY IN OR 2134/1836 CITY OF FDNA BEACH ==================================== 2614 00-00-31-1800-0310-0050 336.98 BRAND JANICE 0.000AC 3163 GLENRIDGE DR PALM HARBOR FL 34685 BLOCK 310 LOT 5 (W OF RR) IN OR 1891/1354 CITY OF FDNA BEACH ==================================== rf rfntb Pursuant to Chapter 197.062, notice is here by given that on the 23rd day of May 2018, a Tax Certificate Sale will be held online at www.bidnassau.com at 8 a.m. Tax Certificates will be sold on the following described lands to pay the amount due for taxes, herein set opposite the same, together with all costs of such sale and advertising for the years indicated below. If you have any questions regarding the Tax Certificate Sale website please contact Grant Street Group at (800)410-3445. ==================================ROLL YEAR 2016==================================en 2615 20-3N-24-2020-0046-0000 HX 521.18 HODGES WILL RANDALL & LISA K & 15595 COUNTY ROAD 108 HILLIARD, FL 32046 LOT 46 IN OR 1195/801 1997 WEST SW/MH & 1985 SHOW SW/MH CORNWALL SURVEY =================================== 2616 09-4N-24-0000-0002-0140 HX 605.11 EADY WILLIAM JR & LISA 39313 KOLARS FERRY ROAD HILLIARD, FL 32046 PT OF NE1/4 OF NE1/4 IN OR 855/1179 2001 MERT DW/MH =================================== 2617 04-1N-25-2760-0014-0040 HX 1,905.62 DENHAM PERRY P & JENNIFER L 44127 MCKENDREE DRIVE CALLAHAN, FL 32011 PT OF LOT 14 (S-4) IN OR 962/43 EAST GRAY GABLES SUB PB 2/50 =================================== 2618 42-2N-27-4613-0012-0030 HX 777.58 MABE FRANCES J 85449 BROOKE ST YULEE, FL 32097 BLOCK 12 LOT 3 IN OR 906/520 R787585 & R787586 YULEE WOODS #3 PB 5/239 ==================================== 2619 31-2N-28-0235-0005-0000 HX 1,004.15 HAYS ANN M 95260 BARBARAS PL FERNANDINA BEACH, FL 32034 LOT 5 & PT GOVT LOT 2 OF SEC 35-2N-28E IN OR 1740/1277 CEDAR RIDGE #1 PBK 6/95 {1999 FTWDDW/MH}==================================ROLL YEAR 2015================================= en 2620 42-2N-27-4613-0012-0030 HX 904.04 MABE FRANCES J 85449 BROOKE ST YULEE, FL 32097 BLOCK 12 LOT 3 IN OR 906/520 R787585 & R787586 YULEE WOODS #3 PB 5/239 =================================== 2621 31-2N-28-0235-0005-0000 HX 1,338.77 HAYS ANN M 95260 BARBARAS PL FERNANDINA BEACH, FL 32034 LOT 5 & PT GOVT LOT 2 OF SEC 35-2N-28E IN OR 1740/1277 CEDAR RIDGE #1 PBK 6/95 {1999 FTWDDW/MH}==================================ROLL YEAR 2014================================= en 2622 42-2N-27-4613-0012-0030 HX 1,098.49 MABE FRANCES J 85449 BROOKE ST YULEE, FL 32097 BLOCK 12 LOT 3 IN OR 906/520 R787585 & R787586 YULEE WOODS #3 PB 5/239 =================================== 2623 31-2N-28-0235-0005-0000 HX 974.56 HAYS ANN M 95260 BARBARAS PL FERNANDINA BEACH, FL 32034 LOT 5 PT OR 1740/1277 1999 FTWD DW/MH CEDAR RIDGE #1 PB 6/95 =================================== 2624 35-2N-28-0000-0001-1130 683.30 HAYS ANN M PO BOX 15579 FERNANDINA BEACH, FL 32034 PT OR 1740/1277==================================ROLL YEAR 2013================================== 2625 35-2N-28-0000-0001-1130 741.17 HAYS ANN M PO BOX 15579 FERNANDINA BEACH, FL 32034 PT OR 1740/1277 ==================================== DEL. TAX LIST 2017.indd 18 4/30/18 12:20 PM

PAGE 79

rf rfntb This page intentionally left blank. Tangible property taxes are listed on page 20. DEL. TAX LIST 2017.indd 19 4/30/18 12:20 PM

PAGE 80

rnntbnt In accordance with Florida Statute 197.402, the list of unpaid properties is advertised three times. Accounts listed within this publication were unpaid as of April 19, 2018. Please note that some of the listed properties have subsequently been paid. Florida law requires the delinquent list to be organized by account number, not by alphabetical order. As provided by Chapter 197.016, Acts of 1972, notice is hereby given that Tangible Personal Property Taxes for the years indicated below are delinquent and such taxes are now drawing interest of 1.5 percent per month plus the proportionate cost of publishing this notice. Unless the amount set opposite each name is paid by the last day of May 2018, warrants may be issued thereon directing levy upon and sei zure of the tangible personal property of the taxpayers. ==================================ROLL YEAR 2014================================== 137 12750-000 585.82 SONNYS REAL PIT BAR-B-Q JUST RIGHT ENTERPRISES INC FERNANDINA BEACH, FL 32034 2742 SOUTH 8TH ST ================================== rfntb As provided by Chapter 197.016, Acts of 1972, notice is hereby given that Tangible Personal Property Taxes for 2017 are now delinquent and beginning on April 1 such taxes are now drawing interest of 1.5 percent per month plus the pro portionate cost of publishing this notice. Unless the amount set opposite each name is paid by the last day of May 2018, warrants may be issued thereon directing levy upon and sei zure of the tangible personal property of the taxpayers. ==================================== 1 00152-500 451.16 A1A GOLD INC 463152 SR 200 YULEE FL 32097 463152 SR 200 ==================================== 2 00164-700 141.02 AA BOTTLED GAS COMPANY INC PO BOX 26008 JACKSONVILLE FL 32226 450044 SR 200 ==================================== 3 00185-050 841.85 KAIVAL MEERA CORPORATION C/O H & R BLOCK 162 OCILLA HWY #7 FITZGERALD GA 31750 15807 CR 108 ==================================== 4 00229-000 312.94 HANG GLIDE USA LLC 650 AIRPORT RD FERNANDINA BEACH FL 32034 650 AIRPORT RD ==================================== 5 00245-000 153.25 ALL AMERICAN CARPET CARE & SALES INC 85074 MINER RD YULEE FL 32097 85074 MINER RD ==================================== 6 00266-000 1,486.48 ALL PRO OF FERNANDINA 1852 SADLER RD FERNANDINA BEACH FL 32034 1852 SADLER RD ==================================== 7 00273-000 1,954.63 STROME NETWORKS PO BOX 2437 SMYRNA GA 30081-2437 ==================================== 8 00445-000 242.39 AMELIA ISLAND LANDSCAPES LLC 76458 DOVE RD YULEE FL 32097 76458 DOVE RD ==================================== 9 00525-098 459.63 AMELIA MUSICAL PLAYHOUSE LLC 1955 ISLAND WALKWAY FERNANDINA BEACH FL 32034 1955 ISLAND WALKWAY ==================================== 10 00542-200 504.94 AMELIA URGENT CARE LLC 96279 BRADY POINT RD FERNANDINA BEACH FL 32034 96279 BRADY POINT RD ==================================== 11 00546-100 2,012.25 PO BOX 1496 FERNANDINA BEACH FL 32035 1 SOUTH FRONT ST ==================================== 12 00546-450 107.57 9900 AMELIA ISLAND PKWY #100 FERNANDINA BEACH FL 32034 9900 AMELIA ISLAND PKWY 100 ==================================== 13 00758-000 137.60 ANNE PENMAN LASER THERAPY 961687 GATEWAY BLVD #201A FERNANDINA BEACH FL 32034 961687 GATEWAY BLVD 201A ==================================== 14 00772-700 64.11 APPLIANCE MART 474347 SR 200 #3 FERNANDINA BEACH FL 32034 474347 SR 200 ==================================== 15 00854-340 101.79 PO BOX 381 HILLIARD FL 32046-0381 27518 WEST 4TH AV ==================================== 16 00911-200 242.39 376621 KINGS FERRY RD HILLIARD FL 32046 73229 ORANGE ST ==================================== 17 00997-000 166.26 BACKWATER ADVENTURE AMELIA ISLAND 210 CENTRE ST FERNANDINA BEACH FL 32034 210 CENTRE ST ==================================== 18 01015-800 2,285.02 TJS INTERNATIONAL INC BAR ZIN BISTRO & WINE BAR 1837 PERIMETER PARK RD FERNANDINA BEACH FL 32034 4921 FIRST COAST HWY 10 ==================================== 19 01016-200 312.94 BARBER STUDIO 1 LLC 1428 SADLER RD FERNANDINA BEACH FL 32034 1428 SADLER RD ==================================== 20 01016-500 2,219.90 BARBERITOS SOUTHWESTERN GRILLE & CANTINA PO BOX 16702 FERNANDINA BEACH FL 32035 1521 SADLER RD ==================================== 21 01016-501 1,690.89 BARBERITOS SOUTHWESTERN GRILLE & CANTINA PO BOX 16702 FERNANDINA BEACH FL 32035 463867 SR 200 5 ==================================== 22 01030-000 107.57 BANKO DESIGN 626 SOUTH 8TH ST FERNANDINA BEACH FL 32034 626 SOUTH 8TH ST ==================================== 23 01263-000 777.22 BECKER MARVIN ROY 56585 DAVIS RD CALLAHAN FL 32011-8823 ==================================== 24 01265-000 175.56 BECKHAM VISION CARE PC AMY BECKHAM PO BOX 16445 FERNANDINA BEACH FL 32035 464016 SR 200 ==================================== 25 01383-000 175.56 BEST PRICE FURNITURE 474270 SR 200 FERNANDINA BEACH FL 32034 474270 SR 200 ==================================== 26 01470-000 472.64 THE BEAUTY BAR AI 2245 SADLER RD FERNANDINA BEACH FL 32034 2245 SADLER RD ==================================== 27 01472-000 86.41 BODYWORKS OF NORTHEAST FLORIDA LLC 473951 MIDDLE RD HILLIARD FL 32046 473951 MIDDLE RD ==================================== 28 02139-500 3,674.23 CAFE KARIBO INC 27 NORTH 3RD ST FERNANDINA BEACH FL 32034 27 NORTH 3RD ST ==================================== 29 02193-000 626.89 CALLAHAN AUTOMOTIVE PO BOX 591 CALLAHAN FL 32011-0591 450042 SR 200 ==================================== 30 02203-000 141.02 CALLAHAN BARBERS AND GROOMING SPA 44108 BECKER AVE CALLAHAN FL 32011 542412 US HWY 1 A ==================================== 31 02205-000 710.37 CALLAHAN PAINT & BODY SHOP 541703 US HWY 1 CALLAHAN FL 32011 541703 US HWY 1 ==================================== 32 02300-000 1,477.12 CALLAHAN FUNERAL HOME C/O DORIS MCANINCH PO BOX 282 CALLAHAN FL 32011-0282 617365 BRANDIES AV ==================================== 33 02348-000 47.14 CALLAHAN PHARMACY INC 2704 SECRET HARBOR DR ORANGE PARK FL 32065 450077 SR 200 ==================================== 34 02442-000 1,635.78 CAPPS INVESTMENT COMPANY OF NORTH FLORIDA INC 2383 SHANNON RD FERNANDINA BEACFH FL 32097 2383 SHANNON RD ==================================== 35 02615-001 49.58 CEDAR RIVER SEAFOOD OF FERNANDINA INC PO BOX 634 CALLAHAN FL 32011-0634 2728 SADLER RD ==================================== 36 02765-050 130.99 86112 SPRING MEADOW AVE YULEE FL 32097 86112 SPRING MEADOW AV ==================================== 37 02780-000 312.94 CHRYSALIS A COLOR SALON 1890 SOUTH 14TH ST #101 FERNANDINA BEACH FL 32034 1890 SOUTH 14TH ST 101 ==================================== 38 02948-000 107.57 COASTAL FABRICS 2136 SADLER SQUARE FERNANDINA BEACH FL 32034 2136 SADLER SQUARE ==================================== 39 02992-500 107.57 COLOR IT GREEN INC 1008 ATLANTIC AVE FERNANDINA BEACH FL 32034 1008 ATLANTIC AV ==================================== 40 03425-700 353.82 CREATIVE HAIR STUDIO INC 464073 SR 200 #10 YULEE FL 32097 464073 SR 200 10 ==================================== 41 03450-000 96.51 WILLIAMS WANDA L 44002 KOREYS LANE CALLAHAN FL 32011 44002 KOREYS LN ==================================== 42 03550-500 197.83 CABANA VILLAS LLC 13618 PICARSA DR JACKSONVILLE FL 32225 545737 US HWY 1 ==================================== 43 04007-300 940.76 DON PATRON MEXICAN GRILL & CANTINA 96098 LOFTON SQUARE CT YULEE FL 32097 96098 LOFTON SQUARE CT ==================================== 44 04225-500 699.19 DREAMSCAPES DESIGN INC PO BOX 431 FERNANDINA BEACH FL 32035-0431 1500 SOUTH 14TH ST ==================================== 45 04463-500 132.84 EIGHT FLAGS AUTOSPORTS 2588 SOUTH 8TH ST FERNANDINA BEACH FL 32034 2588 SOUTH 8TH ST ==================================== 46 04468-900 107.57 ELECTRIC MERMAID TATTOO 745 HAYWOOD RD ASHVILLE NC 28806 1001 ATLANTIC AV ==================================== 47 04966-000 958.36 PARTY BOUNCE PLAY 1852 SADLER RD FERNANDINA BEACH FL 32034 1852 SADLER RD ==================================== 48 05104-000 688.07 NASSAU FUNERAL HOME PO BOX 575 CALLAHAN FL 32011-0575 541720 US HWY 1 ==================================== 49 05402-000 3,397.93 FLASH FOODS LLC 5062 C/O DELTA PROPERTY TAX ADVISOR PO BOX 91898 AUSTIN TX 78709 551758 US HWY 1 ==================================== 50 05420-000 312.94 FLORIDA ADVENTURE SPORTS 3990 CENTURION WAY FERNANDINA BEACH FL 32034 3990 CENTURION WAY ==================================== 51 05904-000 262.48 FROSTED MONKEY 45064 AMHURST OAKS DR CALLAHAN FL 32011 45071 PAGE ST ==================================== 52 06028-700 136.91 GATOR FIRE EXTINGUISHER TROY PITTS PO BOX 904 FERNANDINA BEACH FL 32035-0904 205 SOUTH 14TH ST ==================================== 53 06174-300 1,486.48 KITCHEN INC 5290 BIG ISLAND DR #3106 JACKSONVILLE FL 32246 510 SOUTH 8TH ST ==================================== 54 06236-000 664.85 GREAT CLIPS AT VILLAGES OF AMELIA 463867-6 SR 200 YULEE FL 32097 463867 SR 200 6 ==================================== 55 06435-000 108.70 541064 US HWY 1 CALLAHAN FL 32011 541064 US HWY 1 ==================================== 56 06765-000 371.61 HADDOCK PEST CONTROL 512 SOUTH 8TH ST FERNANDINA BEACH FL 32034 512 SOUTH 8TH ST ==================================== 57 06772-000 108.72 HADDOCK TIMBER 27359 GEIGER RD HILLIARD FL 32046 553079 US HWY 1 ==================================== 58 06784-000 1,486.48 FERNANDINA HALFTIME SPORTS BAR & GRILL LLC 1035 ISLE OF PALMS LANE FERNANDINA BEACH FL 32034 320 SOUTH 8TH ST ==================================== 59 06974-000 130.99 541735 US HWY 1 CALLAHAN FL 32011 541735 US HWY 1 ==================================== 60 07268-000 465.24 KNUCKLEHEADS TAVERN 850532 US HWY 17 YULEE FL 32097 850532 US HWY 17 ==================================== 61 07330-000 166.26 HOLISTIC WELLNESS 819 SOUTH 8TH ST FERNANDINA BEACH FL 32034 819 SOUTH 8TH ST ==================================== 62 07448-000 92.44 HOOKS AND HORNS INC 12542 PERCY LANE JACKSONVILLE FL 32218 45258 THIRD AV ==================================== 63 07451-150 465.24 HORNE ANN C & ELWIN 174 GREENVILLE RD KINGSLAND GA 31548 ==================================== 64 07500-004 799.51 HUDDLE HOUSE-YULEE WAYNE HARRISON 3000 NORTH ATLANTIC AVE #14 DAYTONA BEACH FL 32118-3019 463949 SR 200 ==================================== 65 07581-000 665.94 H AND N FOOD STORES INC 450547 SR 200 CALLAHAN FL 32011-4413 450537 SR 200 ==================================== 66 07878-000 1,133.77 IRON WORKS GYM 76489 LONG LEAF LOOP YULEE FL 32097 850500 US HWY 17 ==================================== 67 07878-001 996.95 IRONWORKS GYM CORI HOPKINSON 76489 LONG LEAF LOOP YULEE FL 32097 542386 US HWY 1 ==================================== 68 07885-000 1,046.37 ISLAND AVIATION INC 602 AIRPORT RD FERNANDINA BEACH FL 32034-0915 602 AIRPORT RD ==================================== 69 07925-200 195.58 ISLAND VIBE SURF SHOP LLC 2870 FIRST AVE #A FERNANDINA BEACH FL 32034 2870 FIRST AV A ==================================== 70 07925-700 197.83 PO BOX 997 YULEE FL 32041 86515 WORTHINGTON DR ==================================== 71 07938-000 930.38 J GRAY & ASSOCIATES INC 629 SOUTH 8TH ST FERNANDINA BEACH FL 32034 629 SOUTH 8TH ST ==================================== 72 08160-600 317.18 AMELIA BISTRO AND CAFE LLC 85211 MAJESTIC WALK BLVD FERNANDINA BEACH FL 32034 105 SOUTH 3RD ST ==================================== 73 08371-000 48.89 JUST SEW ALTERATIONS LLC 1020 SOUTH 14TH ST FERNANDINA BEACH FL 32034 1020 SOUTH 14TH ST ==================================== 74 08420-000 1,438.80 KEELCO INC 542752 US HWY 1 CALLAHAN FL 32011 542752 US HWY 1 ==================================== 75 08545-000 1,926.55 LA MANCHA LLC 2709 SADLER RD FERNANDINA BEACH FL 32034 2709 SADLER RD ==================================== 76 08646-000 54.26 LAROSE CAROLYN 3105 CR 121 BALDWIN FL 32234 3105 CR 121 ==================================== 77 08653-150 166.26 PRYOR JERRY W LAW OFFICE 914 ATLANTIC AVE 2C FERNANDINA BEACH FL 32034 914 ATLANTIC AV 2C ==================================== 78 08654-200 64.84 1637 SOUTH 8TH ST FERNANDINA BEACH FL 32034 1637 SOUTH 8TH ST ==================================== 79 08706-850 137.60 LECHONERA EL COQUI INC 232 NORTH 2ND ST FERNANDINA BEACH FL 32034 232 NORTH 2ND ST ==================================== 80 08953-500 178.15 LILI THORNES HAIR ARTISTRY 94141 DUCK LAKE DR FERNANDINA BEACH FL 32034 1935 SOUTH 8TH ST ==================================== 81 08971-000 697.88 LINDER CARTAGE INC 18124 LINDER LANE HILLIARD FL 32046 18124 LINDER LN ==================================== 82 08971-450 130.99 LIQUIDATION OUTLET 474347 SR 200 FERNANDINA BEACH FL 32034 474347 SR 200 ==================================== 83 08980-000 576.67 LITTLEBERRY FARM 95540 CLEMENTS RD FERNANDINA BEACH FL 32034 95546 CLEMENTS RD ==================================== 84 08987-000 899.69 2269 E US 27 HWY PERRY FL 32347 816 SOUTH 8TH ST ==================================== 85 08993-000 132.84 LIVE LONG WELL CARE OF NASSAU COUNTY 48 OSPREY VILLAGE DR FERNANDIAN BEACH FL 32034 48 OSPREY VILLAGE DR ==================================== 86 09060-000 192.54 LLARENA ALEX MD 96257 RIDGEWOOD CIRCLE FERNANDINA BEACH FL 32034 1411 SOUTH 14TH ST B ==================================== 87 09256-100 886.98 614 CENTRE ST FERNANDINA BEACH FL 32034 314 CENTRE ST ==================================== 88 09325-000 1,633.15 ATHENA FOOD HOST INC 96213 BLACKROCK RD YULEE FL 32097 101 CENTRE ST ==================================== 89 09579-000 197.83 MEEKS HEATING & AIR INC 96691 CHESTER RD YULEE FL 32097 96691 CHESTER RD ==================================== 90 09579-800 166.26 MEGA BITE INC 531 SOUTH 8TH ST FERNANDINA BEACH FL 32034-3611 531 SOUTH 8TH ST ==================================== 91 09580-500 122.34 MELTON TRUCKING LLC 37980 OXFORD ST HILLIARD FL 32046-8108 37980 OXFORD ST ==================================== 92 09661-030 125.26 MILLS CREEK SERVICES LLC 26458 SNAKE CREEK RD HILLIARD FL 32046 26458 SNAKE CREEK RD ==================================== 93 09757-800 130.99 MOWER MEDIC 540431 US HWY 1 CALLAHAN FL 32011 540431 US HWY 1 ==================================== 94 09991-000 371.61 85157 CHAMPLAIN DR FERNANDINA BEACH FL 32034 13 NORTH 3RD ST ==================================== 95 10325-090 1,574.91 DEERFIELD LAKES COUNTRY CLUB 54002 DEERFIELD COUNTRY CLUB RD CALLAHAN FL 32011 ==================================== 96 10427-900 101.79 377550 KINGS FERRY RD HILLIARD FL 32046-6356 551716 US HWY 1 ==================================== 97 10453-000 92.44 618351 MARTIN LUTHER KING JR DRIVE CALLAHAN FL 32011 542430 US HWY 1 ==================================== 98 10475-000 178.15 NORTH NASSAU RECYCLING LLC 1247 SOUTH 8TH ST #D FERNANDINA BEACH FL 32034 1247 SOUTH 8TH ST D ==================================== 99 10641-575 195.58 OLIVE AMELIA LLC 809 BEECH ST FERNANDINA BEACH FL 32034 809 BEECH ST ==================================== 100 10642-800 340.66 ALLEY CAT SEAFOOD BEER HOUSE & WINE BOUTIQUE LLC 316 CENTRE ST A&B FERNANDINA BEACH FL 32034 316 CENTRE ST ==================================== 101 10652-100 122.34 AIR CONDITIONING LLC 371067 EASTWOOD RD HILLIARD FL 32046-6740 3726 RAILROAD ST ==================================== 102 10775-925 4,880.57 P & S LOGGING INC PO BOX 969 HILLIARD FL 32046-0969 17320 CROSS BRANCH RD ==================================== 103 10776-725 107.57 PAJAMALIFE 12 SOUTH 2ND ST FERNANDINA BEACH FL 32034 12 SOUTH 2ND ST ==================================== 104 10815-000 224.93 PARKER CONTRACTING INC 1035 ISLE OF PALMS LANE FERNANDIAN BEACH FL 32034 1035 ISLE OF PALMS LN ==================================== 105 10900-000 136.42 PARKWAY GRILLE INC 5517 SOUTH FLETCHER AVE FERNANDINA BEACH FL 32034 5517 SOUTH FLETCHER AV ==================================== 106 10983-000 1,735.22 LOS ARRAYANES INC 530 CENTRE ST FERNANDINA BEACH FL 32034 530 CENTRE ST ==================================== 107 11080-070 107.57 PHONE RESQ 1001 ATLANTIC AVE FERNANDINA BEACH FL 32034 1001 ATLANTIC AV ==================================== 108 11204-700 108.70 PIRATES LAWN & IRRIGATION SERVICE PO BOX 6201 FERNANDINA BEACH FL 32035 940059 OLD NASSAUVILLE RD ==================================== 109 11268-000 86.41 95762 AMELIA CONCOURSE FERNANDINA BEACH FL 32034 95762 AMELIA CONCOURSE ==================================== 110 11475-500 108.70 QUICK CASH PAWN & JEWELRY 85017 RADIO AVE YULEE FL 32097 85017 RADIO AV ==================================== 111 11803-500 78.21 RESALEX 208 BEECH ST FERNANDINA BEACH FL 32034 208 BEECH ST ==================================== 112 11900-000 2,933.17 ARGOS USA LLC ATTN SUZANNE BEERS 3015 WINDWARD PLAZA #300 ALPHARETTA GA 30005 463081 SR 200 ==================================== 113 11900-001 54.26 ARGOS USA LLC ATTN SUZANNE BEERS 3015 WINDWARD PLAZA #300 ALPHARETTA GA 30005 463081 SR 200 ==================================== 114 12140-000 132.84 SALON MARIPOSA BY GINA 2188 SADLER RD FERNANDINA BEACH FL 32034 2188 SADLER RD ==================================== 115 12214-000 86.41 SMOKE & VIPE OUTLET 542114 US HWY 1 CALLAHAN FL 32011 542114 US HWY 1 ==================================== 116 12369-000 87.54 SELECT TRONIX INC 1875 SOUTH 14TH ST #D FERNANDINA BEACH FL 32034 1875 SOUTH 14TH ST D ==================================== 117 12556-500 465.24 SHUCKERS OYSTER BAR 95415 BARNWELL RD FERNANDINA BEACH FL 32034 942699 OLD NASSAUVILLE RD ==================================== 118 12690-000 2,458.26 SMITH MACHINE SERVICE INC PO BOX 41285 JACKSONVILLE FL 32203 552121 US HWY 1 ==================================== 119 12752-500 383.96 45064 AMHURST OAKS DR CALLAHAN FL 32011 45064 AMHURST OAKS DR ==================================== 120 13055-110 2,941.34 SPRINT COMMUNICATIONS CO LP ATTN DAVID W SCHNEIDER PO BOX 12913 SHAWNEE MISSION KS 66282-2913 ==================================== 121 13055-120 420.42 SPRINT COMMUNICATIONS CO LP ATTN DAVID W SCHNEIDER PO BOX 12913 SHAWNEE MISSION KS 66282-2913 ==================================== 122 13067-005 142.89 D/B/A CONSOLIDATED LABORATORY 4203 BELFORT RD #106 JACKSONVILLE FL 32216 551616 US HWY 1 ==================================== 123 13530-025 778.53 SUBWAY 850409 US HWY 17 YULEE FL 32097 850409 US HWY 17 ==================================== 124 13985-600 1,779.83 THE 801 KITCHEN & BAR LLC 801 BEECH ST FERNANDINA BEACH FL 32034 801 BEECH ST ==================================== 125 13986-750 1,378.83 THE HORSESHOE SWEEPSTAKES 1639 SOUTH 8TH ST FERNANDINA BEACH FL 32034 1639 SOUTH 8TH ST ==================================== 126 13987-045 68.13 THE LITTLE WHITE HOUSE 618351 DR MARTIN LUTHER KING JR DR CALLAHAN FL 32011 45497 DIXIE AV ==================================== 127 13987-150 189.61 CALLAHAN MEATS 450030 SR 200 CALLAHAN FL 32011 450030 SR 200 ==================================== 128 13989-725 132.84 THE TREE SURGEONS 1745 PHEASANT LANE FERNANDINA BEACH FL 32034 1745 PHEASANT LN ==================================== 129 13997-000 87.54 THOMAS CLINIC 5422 FIRST COAST HWY #112 FERNANDINA BEACH FL 32034 5422 FIRST COAST HWY ==================================== 130 14212-000 2,203.42 TOUAX MODULAR BUILDING USA INC 8030 NW 74TH ST MEDLEY FL 33166 ==================================== 131 14307-000 118.07 TREASURE ISLAND GAME ROOM 540223 US HWY 1 CALLAHAN FL 32011 1683 SOUTH 8TH ST ==================================== 132 14397-000 130.99 TRUCK TOWN & TOYS LLC 463495 SR 200 YULEE FL 32097 463495 SR 200 ==================================== 133 14464-500 1,600.14 SIMRIN INC D/B/A DAIRY QUEEN #11037 2784 SADLER RD FERNANDINA BEACH FL 32034 2784 SADLER RD ==================================== 134 14484-001 2,545.42 PHYSICIANS GROUP SERVICES PA D/B/A COASTAL SPINE AND PAIN 3839 COUNTY RD 218 MIDDLEBURG FL 32068 1865 LIME ST 101 ==================================== 135 14932-000 130.99 WE WACK WEEDS 85276 ASHLEY AVE YULEE FL 32097 85276 ASHLEY AV ==================================== 136 15562-000 132.84 WORRY FREE AUTO GROUP 14476 DUVAL PL W STE 102 JACKSONVILLE FL 32218-9404 720 MAGNOLIA LN ==================================== DEL. TAX LIST 2017.indd 20 4/30/18 12:20 PM