Citation
Washington County news

Material Information

Title:
Washington County news
Uniform Title:
Washington County news (Chipley, Fla.)
Place of Publication:
Chipley FL
Publisher:
Halifax Media Group, Nicole Barfield - Publisher
Creation Date:
January 5, 2005
Publication Date:
Frequency:
Semiweekly[<1994>]
Weekly[ FORMER <1931>]
semiweekly
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Chipley (Fla.) ( lcsh )
Newspapers -- Washington County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Washington -- Chipley
Coordinates:
30.780922 x -85.539289

Notes

Additional Physical Form:
Also available on microfilm from the University of Florida.
Dates or Sequential Designation:
Began May 23, 1924.
General Note:
L.E. Sellers, editor.
General Note:
Description based on: Vol. 8, no. 1 (May 28, 1931).
Funding:
Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
Copyright Washington County News. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
000384704 ( ALEPH )
07260886 ( OCLC )
ACC5987 ( NOTIS )
sn 81000810 ( LCCN )
0279-795X ( ISSN )

Related Items

Preceded by:
Chipley banner

Downloads

This item is only available as the following downloads:


Full Text

PAGE 1

** Washington County News | Saturday, July 14, 2018 A1Volume 95 Number 27 Phone: 850-638-0212 Fax: 850-638-4601 Local & State ..............A3 Opinion ....................A4 Kids Activities .............A5 Community ...............A6 Faith .........................A8 Food .........................A9 A6See upcoming local events!A8Signs of Faith @WCN_HCT facebook.com/WashingtonCountyNews.HolmesCountyTimes50 ¢ chipleypaper.com Saturday, July 14, 2018 Washington County News SPRINKLE WITH LOVE FOR EASTPOINT A SUCCESS | A6 News Service FloridaWASHINGTON COUNTY A state appeals courtWednesdaytossed out a 300-year sentence for a man convicted of repeatedly sexually assaulting his adopted daughter --but also asked the Florida Supreme Court to take up a key issue in the Washington County case.A three-judge panel of the 1st District Court of Appeal ordered re-sentencing for former Chipley resident Carl Lewis Burns, who was convicted two years ago of 10 counts of sexual battery on his adopted daughter, who was an underage teen. Wednesdays decision was based on remarks by a circuit judge, who said Burns had "really shown no remorse and denied that any of this took place," as the judge imposed the 300-year sentence.The appeals court said a judge cannot base a sentenc-ing decision on a defendants decision to maintain innocence."The trial judges statement here reflects that he violated the governing law by relying on appellants (Burns) failure to express remorse and refusal to admit guilt in the face of compelling evidence of guilt," said the seven-page ruling, written by Judge Susan Kelsey and joined by judges Clay Roberts and M. Kemmerly Thomas.Court overturns 300-year sentence in rape caseBurns See RAPE, A3 By Jacqueline BostickThe News 850-630-6167 | @_JBostick jbostick@chipleypaper.comCHIPLEY Chipley City Council passed the first reading of an alcohol ordinance aimed at attracting businesses to the area.After months of refinement, the first reading of an amended draft of Ordinance No. 952 was passed unanimously at Tuesday's regular council meet-ing. The amended ordinance mirrors the county's current alcohol rules something that expressly gained the council's approval."It provides continuity," Mayor John Sasser said at a workshop held just a few days before Tuesday's meeting. He later added that the ordinance "fulfills the intent that we origi-nally had."The draft that the board reviewed and voted on Tuesday was yet another amended ver-sion from what was introduced to the council at the preceding workshop last week, with the removal of section 3-12 entitled "Seizure and forfeiture" and the latter part of section 3-11, "Prohibitions," which presented language to protect an inebriated patron by refusal of sale.Regarding uniformity with the county, the ordinance nixes the council's previous decision to restrict alcohol sales from midnight to 7 a.m. daily, instead, loosening that restric-tion to midnight to 4 a.m. daily. It also incorporates the county's distance rules which are no sale of alcohol within 500 feet of a church, public park, residence and school, and restricts alcohol sales by bottle clubs to 1,000 feet from any church, public park, residence or school.The ordinance will have its second reading and final vote at a regular meeting to be held Tuesday, Aug. 14 at City Hall, 1442 Jackson Ave.In other business at Tuesday's meeting, the council passed Ordinance No. 951, which amends Chapter 19 regarding a decrease of utility impact fees and usage rates. The council will hold its next regular meeting 6 p.m. Aug. 14 at City Hall.Alcohol rule passes rst reading By Diane M. RobinsonThe News | @HCTA_Diane Drobinson@chipleypaper.comCHIPLEY … A half-cent school capital outlay surtax was approved to go on the August primary referendum.Washington County Board of Count Commissioners held a public hearing on behalf of the Washington County School District on July 10 and then voted unanimously to place the measure on the ballot. Commission Chairman Tray Hawkins said it will be up to the tax payers to either vote for or against the issue.We leave it up to the tax payers of Washington County to vote, and to decide if the way the School Board is going to use the money is worth it (paying the half-cent sales tax) to them,Ž said Hawkins.Superintendent Joe Taylor and the rest of the BOCC all agreed that raising taxes is the last thing any governing body wants to do -but sales tax is the fairest way to do it.Nobody likes taxes; but, at least with this one, we are accountable to the public to show them how it is spent,Ž Taylor said. The money would be used to fund capital projects and sooth educational technology needs over the course of 10 years, beginning January 2019 should the voters pass the referendum.BOCC approves sales tax for ballotSigns posted last week cause confusion By Diane M. RobinsonThe News | @HCTA_Diane Drobinson@chipleypaper.comWASHINGTON COUNTY It has been said good fences make good neighbors, and that could very well be the case should the Washington County Board of County Commissioners make a decision to erect a fence at the Wayside Park in Vernon.The issue came up at a recent board meeting, where board members discussed complaints regarding trespassing signs posted at the park. According to officials, the signs had been posted by Hal Kirk, the owner of nearby Holmes Creek Canoe and Livery.However, there has long been a discussion about where Kirk's property and the county's property divide. Apparently, Kirk felt at liberty to personally post the signs on the prop-erty because, according to WCBOCC Chairman Tray Hawkins, Kirk was worried about the park's patrons and liability issues.In response, the com-mission instructed County Asserting ownershipHolmes Creek at Wayside Park. [FILE PHOTO] Holmes Creek Canoe and Livery Owner Hal Kirk with the sign posted several years ago by WCBOCC to inform patrons that their tax dollars are hard at work. [FILE PHOTO] See PARK, A2We leave it up to the tax payers of Washington County to vote, and to decide if the way the School Board is going to use the money is worth it (paying the half-cent sales tax) to them.Ž Tray Hawkins

PAGE 2

** A2 Saturday, July 14, 2018 | Washington County NewsAdministrator Jeff Massey to have a survey done to carve out exact property lines in order to make plans to secure the property."Due to circumstances beyond our control, we're going to move forward to make sure the public understands that the ownership of the Holmes Creek Wayside Park is Washington County's and will always continue to be Washington County's," Hawkins said.In 2014, Circuit Judge Chris Patterson ruled that Wayside Park belonged to Washington County because it had been public for more than 50 years. At the meeting, commissioners affirmed that ruling and emphasized to the public that the park will remain in the county's possession.The board is expected to discuss options for secur-ing the property during its regular workshop to be held 9 a.m. July 18; and to make a final decision in the special session following the workshop. PARKFrom Page A1 News Service FloridaCompanies with ties to charter schools and a controversial federal visa program are providing the bulk of contributions to an effort to pass a constitu-tional amendment that would impose an eight-year term limit on school board members.Through June, the 8isGreat.org political committee has raised $54,532 in support of Amendment 8, state elec-tion records show.The amendment, which was approved by the Flor-ida Constitution Revision Commission, would impose term limits on school board members but would also provide more authority to the Legisla-ture to create alternative public education initia-tives, like charter schools.The amendment also would require civics literacy instruction in the public schools. Nearly three-quarters of the money raised by the 8isGreat group has come from companies involved with charter schools.Red Apple Development, a Fort Lauderdale company that has helped develop more than three dozen charter school projects in Florida, donated $10,000 to the amendment effort. GreenAccess, a Jupiter company also involved in more than three dozen charter schools in Florida, donated $15,000.Florida Overseas Investment Center, a Sarasota company, also made a $15,000 contri-bution to the amendment campaign, records show. GreenAccess and Florida Overseas Investment are both involved in the EB-5 investor visa program, which provides a path to U.S. residency for wealthy foreign immigrants. Under the program, the foreign investors can obtain a "green card" for themselves and their families if they provide at least $500,000 for projects, such as schools, that are tied to job creation. Critics have said the visa program is loosely regulated, while support-ers have defended it as a way to direct investments and jobs to under-served communities.Amendment 8 is one of 13 state constitutional amendments on the Nov. 6 general-election ballot. Each amendment will require support from at least 60 percent of the voters to be enacted.Charter schools back amendment e ort By Diane M. RobinsonThe News | @HCTA_Diane Drobinson@chipleypaper.comCARYVILLE … An ordinance to change term limits unanimously passed its first reading Tuesday at a Caryville Town Council meeting.If it gains a final approval, the ordinance will change term limits from two years to four years, and will go into effect at the next election of council members. At a past meeting, council members spoke favorably about the change, seeing it as an opportunity to pro-vide stability from start to finish of Town projects.In other business, the council accepted a proposal from Southern Engineering Solutions for engineering services. As the only proposal received for the towns Community Development Block Grant (CDBG) to update their water lines, the council a motion to enter into con-tract negotiations with the company.Also at the meeting, council chairman Millard French was appointed to represent the town on the Tourist Development Council after receiving a letter of request for a new representative.As a result of interruption of service earlier this month, the council voted to credit $5 on next month's bill for all Town trash pick-up customers.Caryville Town Council will meet again in regular session at 6 p.m. on August 14.Term limits ordinance passes rst readingBy Diane M. RobinsonThe News | @HCTA_Diane Drobinson@chipleypaper.comCHIPLEY …The Washington County Planning Commission held a public hearing to change language in the Land Development Code concerning major devel-opment reviews.The current language states the planning board has the final say in any major developments in unincorporated areas of the county. However, the new language adds an additional step for approval to be made by the Washington County Board of County Commissioners.In the case of any major development in a munici-pality, that city would still have the power to give the final approval.Also at the meeting, a development review application was approved for a caf to be added to an already existing produce market located at 5157 Highway 77. The name of the business was not immediately released. The owner of the cafe, Moses Hernandez, said the cafe would have a seating capacity of 25.Washington County Planning Commission will meet again in regular session at 5 p.m. on August 7.Planning Commission updates development codeBy News Service of FloridaTALLAHASSEE A school-safety commis-sion examining the mass shooting at a Parkland high school heard testimony Thursday about Floridas fractured and overwhelmed mental health system.As part of a threeday hearing in Broward County, the Marjory Stoneman Douglas High School Public Safety Commission turned its focus to the role the mental health system may have played in the Feb. 14 tragedy that left 14 students and three staff members dead.Pinellas County Sheriff Bob Gualtieri, who leads the panel, said the commission and the public need to better understand how the system works and to clear up the myths about it.ŽSome have suggested that the shootings may have been prevented if Nikolas Cruz, the former Stoneman Douglas student who has been charged in the slayings, had been committed to a mental health facility.Prior to the incident, Cruz was picked up and sent for an examination under the states Baker Act, which under certain circumstances allows for mentally ill individuals to be committed for treatment. But Cruz was released after it was determined he did not meet the criteria for an involuntary commitment.Gualtieri said he was not surprised. So many people think the Baker Act is the magic wand. The Baker Act cures and fixes all,Ž Gual-tieri said. The Baker Act is a temporary custody status for assessment. Rarely does the Baker Act result in any treatment.ŽAdditionally, Gualtieri said there is often little follow-up after an individual like Cruz comes into contact with the system and then is released, calling it the greatest voidŽ in the states mental health network.Gualtieris comments were bolstered by testi-mony from Miami-Dade County Circuit Judge Steve Leifman, who has been working for years with the Florida Supreme Court and the state Leg-islature to improve Floridas mental health system.Of the approximately 200,000 Floridians who were brought in for a Baker Act examination last year, just over 1,700 ended up in mental health facility, the judge said.Its a fraction,Ž he said.Leifman blamed part of the problem on out-dated criteria in the 1971 law, suggesting it should be broadened to adapt to ongoing developments in the science of mental health.Leifman also said the overall mental health system remains underfunded, citing data that shows Florida percapita spending ranks 49th or lower among the states. He said that means roughly one-fifth of residents who need treatment get it, while 80 percent are untreated.Leifman also agreed that intensive followups for individuals who undergo Baker Act examinations often do not occur. He contrasted it with his dog, who was treated for a minor infec-tion on a Saturday and then got a follow-up call from the veterinarians office on the following Monday.Were treating our dogs better than were treating our fellow citizens in our state,Ž Lei-fman said.Another theme in the testimony and discussion on Thursday was that many individuals like Cruz are identified as having mental or behavioral problems but there is often little communication between entities like schools, community mental health programs, the juvenile justice system, law enforcement agencies or health-care programs like Medicaid.Thats the cornerstone of what were trying to do here because after the fact everybody knew he (Cruz) was going to do it sometime. But none of the dots ever got connected in advance,Ž said Polk County Sheriff Grady Judd, a commission member.How do we create a process or a system where we can get all of this indi-vidual data together and break down silos and make sure they get services and then we are able to follow their ebbs and flows in the process?Ž Judd asked.Max Schachter, a commission member whose 14-year-old son, Alex, was among the 14 slain students, called the gaps in the state's mental health system horrible.ŽThats a concern of mine that we could have more of these attacks if we dont address these issues. Its very disconcerting to hear that all of these agencies dont talk. Theres all these silos of information. Its never going to get fixed if we are not communicating,Ž he told reporters during an afternoon break.Ute Gazioch, director of mental health and substance abuse for the Department of Children and Families, said ideally individuals should be receiving treatment before they reach the point where they are being sent to a crisis-stabiliza-tion unit under the Baker Act.The more we can do early on working with families and children, the quicker we can intervene, I would hope we wouldnt have that many (Baker Act) contacts,Ž she said.She also said individuals who are released after a Baker Act examination should be given a dischargeŽ plan, saying it may be something that needs to be re-emphasized.Department of Children and Families Secretary Mike Carroll, whose agency oversees the community mental health system and who also serves on the commission, said that, while the state cannot force people to accept treatment, mental health workers can aggressively and pro-activelyŽ engage individuals and try to convince them that further treatment is in their interest.Delivering treatment to children as early as possible is the best strategy, he said, although parents sometimes shun the rec-ommendations because they dont want to stig-matizeŽ their children.With the statewide school system receiving more funding for mental health services, Carroll also said it will be impor-tant for the schools to coordinate with community mental health providers, noting that students spend more time in their homes and com-munities than in school.The commission is working on a series of recommendations in the wake of the February mass shooting that will be pre-sented to state officials by Jan. 1 in advance of the 2019 legislative session. Nathalie Sczublewski contributed to this story, with reporting from Sunrise.Parkland panel examines mental health issuesDepartment of Children and Families Secretary Mike Carroll, whose agency oversees the community mental health system and who also serves on the commission, said that, while the state cannot force people to accept treatment, mental health workers can aggressively and pro-activelyŽ engage individuals and try to convince them that further treatment is in their interest. Red Apple Development, a Fort Lauderdale company that has helped develop more than three dozen charter school projects in Florida, donated $10,000 to the amendment e ort. GreenAccess, a Jupiter company also involved in more than three dozen charter schools in Florida, donated $15,000.

PAGE 3

** Washington County News | Saturday, July 14, 2018 A3 LOCAL & STATEThe appeals court, how-ever, asked the Supreme Court to consider the case because of circumstances involving a pre-trial con-fession by Burns. The ruling said Burns gave a "strikingly detailed" confession that included discussion of having sex with the teen for more than a year and not wearing condoms.At trial, however, Burns said the confession was false and maintained his innocence. The appeals court wants the Supreme Court to decide whether the circuit judge could take into consideration the pre-trial confession when determin-ing whether Burns showed a lack of remorse."May a sentencing court rely on a defendants lack of remorse after the defendant has given a ƒ sworn con-fession to the crime and has obviously lied under oath at trial about his guilt?" RAPEFrom Page A1 Staff ReportCHIPLEY Aman and womanwill spend time together at the same jail after allegedly burglarizing a home.Brett Allen Thomas, 34, of Wausau, and Jennifer Claborn, 36, of Chipley, were arrested Thursday, July 5, after allegedly breaking into a residence on Southern Way.No one was at the house during the time of the crime, however, a person called law enforcement after he or she reportedly arrived at the residence and heard voices coming from inside of the home, a Washing-ton County Sheriff's Office news release stated.WCSO deputy arrived on the scene about 2:45 p.m.As the deputy began clearing the property, he noticed Thomas and Claborn running into woods and the back screen door swing shut, the release stated. Theduo was apprehended.Both Claborn and Thomas were taken into custody without further incident and booked into the Washington County Jail on the charges of burglary of an unoccupied dwelling and trespassing, according to the Washington County Sheriffs Office.Two charged in burglary of a dwellingClaborn Thomas Staff ReportCHIPLEY The pungent scent of marijuana blew one Chipley man, who was out on bond, back into jail.George Davis, 55, was arrested Sunday, July 8, and charged with new felony drug charges, a Washington County Sher-iff's Office news release stated. He was out on a $20,000 bond for the pre-vious charges of sale of methamphetamine and marijuana.Davis, was stopped on Orange Hill Road near Corbin Road for a traffic infraction on Sunday, the release stated, when a WCSO deputy noticed a strong odor of marijuana coming from the vehicle.A search of the vehicle led to the discovery of three bags of metham-phetamine and more than 28 grams of marijuana, according to the release.Davis was arrested and transported to the Washington County Jail for booking on the charges of possession of methamphetamine with intent to sell and possession of mar-ijuana more than 20 grams.As Davis was booked into the jail, a small bag of cocaine was found on his person. Davis received additional charges of pos-session of cocaine and introduction of contraband into a correctional facility, the release stated.Marijuana odor blows man back in jailBy Zack McDonald747-5071 | @PCNHzack zmcdonald@pcnh.comPANAMA CITY „ A cir-cuit judge presiding over the felony case against former Deputy Chief State Attorney Greg Wilson said he has yet to estab-lish cause to call Wilsons old boss as a witness and admonished his defense attorneys for attempting to circumvent the author-ity of the court in doing so.Circuit Judge Michael Overstreet addressed the issue Tuesday during a motion hearing in the case. He recently issued an order to show cause why Wilsons defense attorneys, Lisa Anderson and James Dowgul, should not face sanctions for issuing subpoenas to several constitutional officers „ State Attorney Glenn Hess, Bay County Sheriff Tommy Ford and 1st Circuit State Attorney Bill Eddins „ without first clearing it with the court.After hearing explanations from the defense counsel, however, Overstreet said they did not receive permission to pursue the depositions, but he did not think their actions were an intentional decision to violate the rules of the court.The concern I have is you issued subpoenas without prior authorization of the court,Ž Overstreet said. You noticed their depositions without prior authorization of the court, and you should have done so. ƒ In the future, it would be prudent for you and any other officer of the court to obtain court authorization to notice and subpoena Category B witnesses.ŽOverstreet did not rule out allowing subpoenas to be issued to the three men. He added, though, that he did not think it would be likely because Wilsons defense team had yet to establishfirm legal ground.If youre contending today that there is some kind of discriminatory prosecution taking place, and thats the end game of your defense, then you need to set forth a basis for that,Ž Overstreet said. ƒ As of now, those wit-nesses are not material to your defense. They simply arent.ŽBefore hearing Overstreets decision, Anderson attempted to show the court that unfor-tunate timingbetween filings in the courtand scheduled court hearings gave the appearance they were circumventing the court. She presented email exchanges to illustrate that the defense team had intended to confer with Overstreet.We had not had time to seek leave of the court,Ž Anderson said. It was our intention as defense counsel ƒ to bring the matter up at pretrial. Due to ƒ how quickly things occurred, we lost that opportunity to bring it before the court.ŽHowever, Overstreet pointed out, the subpoenas had been issued before the court hearing referenced by Andersonwould have takenplace as scheduled.One of the developments Anderson cited was a filing to suppress the subpoenas from pros-ecutor Jack Campbell, claiming that as constitutional officers, Hess, Ford and Eddins are generally exempt from testifying in these cases. Campbell reiterated the point that taking the testimonies was outside the scope of the criminal allegations against Wilson.Going and asking who they asked advice from is completely beyond the scope of discovery and it is a fishing expedition,Ž Campbell told the court. ƒ There has been no evi-dence or even an assertion that they were witnesses to any criminal activity. Their personal conclusions as to the admissibility of evi-dence have no bearing.ŽAnderson laid out the case that she sought the depositions because Hess had been contacted by the Bay County Sheriffs Office to review phone recordings between an inmate and her attorney, determined to be Wilson. Wilson previously worked as Hess No. 2 pros-ecutor before resigning for an unsuccessful run against his former boss in 2016.Overstreet: No sanctions for defenseDavis

PAGE 4

** A4 Saturday, July 14, 2018 | Washington County News OPINION Have something to say?Letters to the editor and comments on Web versions of news stories are welcomed. Letters are edited only for grammar, spelling, clarity, space and consistency, but we ask that they be limited to 300 words where possible. Letter writers are asked to provide a home address and daytime telephone number (neither is printed) for veri“ cation purposes. Letters may be sent to 1364 N. Railroad Ave., Chipley, FL 32428 or emailed to news@chipleypaper. com. Please specify if the letter should be printed in the Washington County News or Holmes County Times-Advertiser. Questions? Call 638-0212. The News is published every Wednesday and Saturday by GateHouse Media LLC at 1364 N. Railroad Ave., Chipley, FL 32428. Periodicals postage paid at Chipley, Florida. Copyright 2018, GateHouse Media LLC. All Rights Reserved. Copyright Notice: The entire contents of the Washington County News are fully protected by copyright and cannot be reproduced in any form for any purpose without the expressed permission of GateHouse Media LLC. The views expressed here are not necessarily those of this paper or GateHouse Media. Postmaster: Send address change to Washington County News, P.O. Box 627, Chipley, FL 32428, USPS 667-360 SUBSCRIPTION RATES In county Out of county 13 weeks: $20 $24.30 26 weeks: $28.70 $36.40 52 weeks: $48.60 $60.70 Home delivery subscribers may be charged a higher rate for holiday editions. CONTACT US Publisher: Nicole Bare“ eld nbare“ eld@chipleypaper.com Interim Editor: Jacqueline Bostick jbostick@chipleypaper.com, 850-638-0212 News, sports, opinion: news@chipleypaper.com Classi“ ed: 850-638-0212, clamb@chipleypaper.com Circulation Customer Service: 1-850-522-5197 Washington CountyPUBLISHER Nicole P. Bare“ eld INTERIM EDITOR Jacqueline Bostick PRODUCTION SUPERVISOR Cameron Everett ANOTHER VIEW We can all exhale now. Theyre out, all of them, safe and sound. Twelve boys „ soccer players ranging in age from 11 to 16 „ and their 25-year-old coach had been trapped in a flooded cave in Thailand since June 23. In what has been described as the most challenging underground rescue in history, the last of the group emerged from their dark, damp prison Tuesday. It was a remarkable achievement made possible by the cooperation and coordination of several countries, and the bravery of a multinational team of divers. Suspenseful rescues of people trapped for days or even weeks underground or beneath the sea have long captured the publics attention. Theyre cinematic escapades made real life. But few have ever been as compelling as the unfolding drama in Thailand. No doubt the youth of rescuees and their extraordinary surroundings contributed to that. Divers navigated muddy passages in darkness, some as narrow as 16 inches, to reach the children huddled in a small chamber 2 miles from the caves entrance. Then the kids, several of whom couldnt swim, had to receive a crash course in diving to make the return trip out. For those following the story, the description of the conditions and the nature of the rescue were enough to trigger phobias. Its terrifying to imagine enduring that. The dangers involved in getting were made stark July 5 when a retired Thai Navy diver, Saman Gunan, died when he ran out of air during a mission to deliver oxygen tanks to the trapped soccer team. He was mourned around the globe as a hero, and rightly so. His was the ultimate sacrifice that was not made in vain, thanks to an international effort that numbered more than 1,000 people from dozens of countries. They included divers, military personnel and civilian volunteers. Their selflessness was both inspiring and humbling. I dive for passion and always wondered if it had purpose. Last two weeks is what I prepared for my entire life,Ž said John Volanthen, a British lead diver. He and fellow Brit Rick Stanton discovered the boys and their coach trapped in an air pocket and shot the now-famous video of their first encounter. Then theres Dr. Park Loharachun, a Thai doctor/diver who stayed with the children after they were found, and was among the last out. Perhaps the rescue resonated for another reason. In a world roiled with political conflict, seeing people of different nationalities, creeds and colors put their differences aside and work toward a common, humanitarian goal reminds us of how much stronger we are when we cooperate. The joy and satisfaction evoked by that successful mission should inspire us to overcome other obstacles, solve other problems. We need to escape our factional caverns that isolate us. Hopefully, that story eventually will have as happy an ending as the one in Thailand. This editorial first appeared in sister paper The News Herald.Joy, inspiration from ThailandThe Black Justice. The First Female. The Wise Latina. The Rumored Lesbian. The Catholic. The Other Catholic. Liberals have had a tendency to label possible Supreme Court picks based upon their identities, not their brains. Thurgood Marshall was the first African American on the bench, and it was understood that he'd have to be replaced with another Justice of Color. He was, but unfortunately, Clarence Thomas wasn't exactly what Marshall fans had hoped for. Sandra Day O'Connor was the first woman on the court, but her conservative credentials annoyed the type of women who didn't think she was feminist enough. Ultimately, they warmed up to her when she protected abortion rights against attacks from her male colleagues. Sonia Sotomayor made that famous statement about how a "wise Latina" might be able to bring something to deliberations that her Caucasian male brethren could not, riding the identity wave straight to the bench. Elena Kagan was rumored to be gay in some sort of wishful thinking campaign from the LGBT community and as a subversive sort of criticism from homophobic opponents, but ultimately her sexual orientation became irrelevant. I've often criticized using identity politics to make legal decisions, but now that President Trump has nominated Brett Kavanaugh to the bench, I've changed my tune. I'm not afraid to call myself out for hypocrisy and inconsistency. I want a conservative woman on the Supreme Court. After years of hearing minority groups demand representation and push the idea that they need to see their faces and voices reflected in our political institutions, and then watching those institutions yield to the idea that color, gender and sexual orientation actually matter, I realize that they might be right about one thing: whining loudly enough gets results. So if you can't beat 'em, join 'em. Here is my whine, for the next time that Trump gets to appoint a justice (though it won't be to replace the Notorious RBG because she's attached to that seat with Gorilla Glue.) The next person on that court should look like me, sound like me, think like me, act like me and do it fearlessly. The president should've chosen a conservative woman. I'm not talking about some safe Republican from the purplish suburbs who won't rock the boat and will hang with the feminists at lunchtime, eating granola and drinking oat milk lattes. We need a real conservative woman, someone who believes that justices do not legislate from the bench and create rights based on her own desires, untethered to any constitutional basis. Yes, I'm talking about abortion. I want a conservative woman justice who won't adjudicate cases by consulting her reproductive organs for their opinions.She'll look at the law and try to determine if there is anything in the Constitution that justifies legalizing the termination of pregnancies.She won't listen to the ridiculous, overheated rhetoric about coat hangers. I want a conservative woman justice who won't impose her conception of "privacy," and "equal protection," "religious freedom" and "speech" on the rest of us.She won't allow others to tell her that opposition to same-sex marriage is religious bigotry, if she believes that there is nothing in the equal protection clause of the 14th Amendment that requires carving out a special privilege for Adam and Steve, while denying that same privilege to Bob, Carol, Ted and Alice. I want a conservative woman justice who won't allow people to question her ability to be fair because she worships at a certain altar. I want a conservative woman justice who will teach all of us that women think with their brains, and not their vaginas, and that they do not mistake loyalty to the sisterhood for loyalty to the law. The Black Justice. The First Female. The Wise Latina. The Rumored Lesbian. The Catholic. The Other Catholic. Liberals have had a tendency to label possible Supreme Court picks based upon their identities, not their brains. Thurgood Marshall was the first African American on the bench, and it was understood that he'd have to be replaced with another Justice of Color. He was, but unfortunately, Clarence Thomas wasn't exactly what Marshall fans had hoped for. Sandra Day O'Connor was the first woman on the court, but her conservative credentials annoyed the type of women who didn't think she was feminist enough. Ultimately, they warmed up to her when she protected abortion rights against attacks from her male colleagues. Sonia Sotomayor made that famous statement about how a "wise Latina" might be able to bring something to deliberations that her Caucasian male brethren could not, riding the identity wave straight to the bench. Elena Kagan was rumored to be gay in some sort of wishful thinking campaign from the LGBT community and as a subversive sort of criticism from homophobic opponents, but ultimately her sexual orientation became irrelevant. I've often criticized using identity politics to make legal decisions, but now that President Trump has nominated Brett Kavanaugh to the bench, I've changed my tune. I'm not afraid to call myself out for hypocrisy and inconsistency. I want a conservative woman on the Supreme Court. After years of hearing minority groups demand representation and push the idea that they need to see their faces and voices reflected in our political institutions, and then watching those institutions yield to the idea that color, gender and sexual orientation actually matter, I realize that they might be right about one thing: whining loudly enough gets results. So if you can't beat 'em, join 'em. Here is my whine, for the next time that Trump gets to appoint a justice (though it won't be to replace the Notorious RBG because she's attached to that seat with Gorilla Glue.) The next person on that court should look like me, sound like me, think like me, act like me and do it fearlessly. The president should've chosen a conservative woman. I'm not talking about some safe Republican from the purplish suburbs who won't rock the boat and will hang with the feminists at lunchtime, eating granola and drinking oat milk lattes. We need a real conservative woman, someone who believes that justices do not legislate from the bench and create rights based on her own desires, untethered to any constitutional basis. Yes, I'm talking about abortion. I want a conservative woman justice who won't adjudicate cases by consulting her reproductive organs for their opinions. She'll look at the law and try to determine if there is anything in the Constitution that justifies legalizing the termination of pregnancies. She won't listen to the ridiculous, overheated rhetoric about coat hangers. I want a conservative woman justice who won't impose her conception of "privacy," and "equal protection," "religious freedom" and "speech" on the rest of us.She won't allow others to tell her that opposition to same-sex marriage is religious bigotry, if she believes that there is nothing in the equal protection clause of the 14th Amendment that requires carving out a special privilege for Adam and Steve, while denying that same privilege to Bob, Carol, Ted and Alice. I want a conservative woman justice who won't allow people to question her ability to be fair because she worships at a certain altar. I want a conservative woman justice who will teach all of us that women think with their brains, and not their vaginas, and that they do not mistake loyalty to the sisterhood for loyalty to the law.When will there be a supreme court justice who looks and thinks like me? Christine Flowers

PAGE 5

** Washington County News | Saturday, July 14, 2018 A5

PAGE 6

** A6 Saturday, July 14, 2018 | Washington County News COMMUNITYTrivia FunŽ with Wilson Casey, Guinness World Record Holder from Woodruff, S.C., is published in more than 500 newspapers across the country. Comments, questions or suggestions? WC@TriviaGuy.com 1. Whose quotes included,  It does not make sense to hire smart people and tell them what to do; we hire smart people to tell us what to do.Ž? Henry Ford, Steve Jobs, Dave Thomas, George Eastman 2. Whats the focus of the famed Patterson/Gimlin short film clip? JFK assassination, Loch Ness monster, Alien being, Bigfoot 3. In 2017, the Postal Service ordered more than how many million rubber bands? 18, 235, 412, 660 4. What was the first regular-appearing TV series of the late Dennis Hopper? JAG,Ž E-Ring,Ž 24,Ž NCISŽ 5. Which state has the town with the highest ZIP code number? Alaska, Hawaii, New York, Oregon 6. What does the makeŽ of a vehicle mean? Rating, VIN, Manufacturer, Driver ANSWERS: 1 .Steve Jobs, 2. Bigfoot, 3. 660, 4. E-Ring,Ž 5. Alaska (Ketchikan 99950), 6. ManufacturerTRIVIA BY WILSON CASEY Wilson CaseyBy Jacqueline BostickThe News 850-630-6167 | @_JBostick jbostick@chipleypaper.comCHIPLEY When one local girl learned of the devastation caused by the brush fire in Eastpoint, she committed herself to bake-away some of the victims' troubles.Brenlea Thornton's Sprin-kled with Love bake sale, held Wednesday at Brick-yard Market, contributed a little more than $2,000 to the cause."Brenlea said she raised more than she thought she would," said Brenlea's mother Kristen Thornton. "She said it felt great to have a huge success."With the help of her family, and word-of-mouth throughout the community and social media sphere, the 10-year-old baked and sold about 660 cupcakes.All of the proceeds went to help the more than 100 men, women and children displaced by the June 24 fire which consumed about 820 acres including the homes of about 35 families.Efforts won't stop there. Brenlea's family is still accepting cash donations for the victims through a PayPal account, using email address tlt_1231@yahoo.com."I'm thankful for the sup-port of the community," Thornton said.Cupcake sale a successBrenlea Thornton (right) and her little sister Teddi, stand at a bake sale table Wednesday during the Sprinkle with Love bake sale. The event raised more than $2,000 for Eastpoint “ re victims. [SPECIAL TO THE NEWS] If you would like your events included in this list, email information to: news@chipleypaper.com HCCOA to host political rallyBONIFAY … The Holmes County Council on Aging will host a political rally at 11 a.m. Saturday, July 14 at the senior center. This will be a chance to meet the Holmes County candidates. There will be a cake auction and plates for sale to bene“ t the senior center. Kolmetz family reunion to be heldVERNON The Kolmetz family reunion will be held a noon Saturday, July 14 at Hinsons Crossroads Fire Department. The “ re department is located on Douglas Ferry Road in Vernon. Tickets on Sale for George M. Cohan Tonight!CHIPLEY Tickets are now on sale for George M. Cohan Tonight! This one man show starring Kevin Russell and directed by Mil Cox will take the stage Saturday, July 14 and Sunday, July 15 at the Spanish Trail Playhouse located at 680 Second Street in Chipley. Show times are at 7 p.m. Saturday and 2 p.m. Sunday. Tickets are available at The Spanish Trail Playhouse Theatre box of“ ce located at 680 Second Street, Chipley. The ticket of“ ce will be open Monday through Thursday 8 a.m. to noon and until 1 p.m. the week of the show. For more information or to reserve you tickets call 850-638-9113 or 850-326-3685.Library to host Dr. Magical BalloonsCHIPLEY … The Washington County Library will host Dr. Magical Balloons at 10 a.m. Monday, July 16 at the Washington County Agriculture Center. This show is a mix of balloon shenanigans, magic and comedy. This program is designed for all ages. For more information call 850-638-1314. UF/IFAS to host an Introduction to Fermentation classCHIPLEY UF/IFAS will hold a Introduction to Fermentation class from 6 p.m. to 8:30 p.m. Tuesday, July 17 at the Washington County Ag Center located at1424 Jackson Avenue, Chipley. What do sourdough, yogurt, and pickles have in common? They are all fermented foods. In addition to tasting yummy, fermented foods offer a number of health bene“ ts as well. Participants will learn the science behind the fermentation process. Registration fee is $5 and includes materials. Space is limited. Pre-registration is required by contacting the Washington County Extension Of“ ce, 850-638-6265, or the Holmes County Extension Of“ ce, 850-547-1108. University of Florida is an Equal Opportunity Institution. For persons with disabilities requiring special accommodations, please contact 850-638-6265 (TDD, via Florida Relay Service, 1-800-955-8771) at least 5 working days prior to the class so proper consideration may be given to the request. Kids-only Flea Market to be heldCHIPLEY … T & B Treasures will hold a Kids Only Flea Market Saturday, July 21 in the T & B Treasures parking lot. The ” ea market is for kids ages six through 16 to sell their collections. There is no charge for the event. T&B Treasures is located at 1215 Jackson Avenue in Chipley. For more information or to reserve a spot call 850-768-0272. Bonifay Womans Club to host political rallyBONIFAY … The Bonifay Womans Club will hold a political rally Saturday, July 28. Hamburger plates consisting of grilled hamburgers, chips, cookies/brownie will be sold beginning at 5 p.m. with candidates speaking at 6 p.m. Any candidate is welcome to come speak. There will also be a cake auction. This is a free event. The Bonifay Womans Club has been in existence since 1910. The club sponsors a scholarship and also makes donation to various school clubs. This past year the club also supported the Backpack Program and the 24/7 Ministries. For more information contact Shirley Owens at shirleyowens52@yahoo.com WCCS sets orientation dateCHIPLEY … Washington County Christian School will hold orientation Friday, August 3. Preschool, pre-Kindergarten and Kindergarten will meet at 9 a.m. 1st grade through 12th grade will meet at 3 p.m. Spanish Trail Playhouse to Present Charlottes WebCHIPLEY The Spanish Trail Playhouse will hold performances of Charlottes Web at 7 p.m. Friday, August 3 and Saturday, August 4 and at 2 p.m. Sunday, August 5. The playhouse is in the Historic Chipley High School, located at 680 Second Street in Chipley. Tickets go on sale soon and will be available online at www.spanishtrailplayhouse. com, and the Spanish Trail Playhouse of“ ce by calling 850-638-9113. The ticket of“ ce is open Monday through Thursday from 8 a.m. to noon. For more information email spanishtrailplayhouse@gmail. com.CHS orientation scheduledCHIPLEY Chipley High School will hold 9th Grade orientation will from 1 p.m. to 1:30 p.m. Tuesday, August 7. Open house will follow from 1:30 p.m. to 2:30 p.m. VES sets orientation dateVERNON … Vernon Elementary School will hold orientations Wednesday, August 8. Orientation for grade 3 through 5 will be held noon, grades 1 and 2 will be held at 1 p.m. and Pre K and Kindergarten will be held at 2 p.m.PDL orientation and schedule pick-up setPONCE DE LEON … Ponce De Leon High school will hold 6th grade orientation at 1 p.m. Thursday, August 9. Grades 7-12 will also be able to pick up their schedules at this time. Ponce de Leon Elementary announced orientationPONCE DE LEON … Ponce de Leon Elementary School will hold orientation for all grades from 9 a.m. to 11 a.m. Thursday, August 9.Roulhac Middle School announced orientation datesCHIPLEY … Roulhac Middle School will hold orientations Thursday, August 9. Orientation for 6th grade will be at 11:30 a.m. and 7th and 8th grade orientation will be held at 12:15 p.m. KMS sets orientation dateCHIPLEY … Kate M. Smith Elementary School will hold orientations Thursday, August 9 in the KMS cafeteria. Orientation for grade 3 through 5 will be held at 8 a.m., grades 1 and 2 will be held at 10 a.m. and VPK/Pre K and Kindergarten will be held at 1 p.m. Poplar Springs to hold open houseBONIFAY … Poplar Springs High School will hold open house from 1 p.m. to 2:30 p.m. Thursday, August 9. HOSO to offer concealed weapons classBONIFAY … The Holmes County Sheriffs Of“ ce will present a Concealed Weapons Class at 10 a.m., Saturday, August 18, in the Holmes County Jail classroom, located at 3207 Lonny Lindsey Drive in Bonifay. Sheriff John Tate will instruct the class, which is expected to last about two hours. This class will meet the “ rearms training class requirement mandated by the Florida Department of Agriculture concealed weapon permit application. The class is open to ages 18 and up; however the minimum age to be granted a permit from the state is 21. Participants ages 21 and up may bring their own gun and rounds or use those provided by the sheriffs of“ ce. Participants under the age of 21 are asked to use the provided gun and rounds. No pre-registration is required, and the cost is $25 per person. All proceeds will bene“ t Holmes County High School Project Graduation.PDL “ re to host RTIC raf” ePONCE DE LEON … Ponce De Leon Volunteer Fire Department will host a raf” e for a 65 Quart RTic cooler. The raf” e will run through Thursday, August 23. Tickets are $5 each or 3 for $12. There are only 300 tickets available. All proceeds go to bene“ t the “ re department. Contact any member of the PDL “ re department or contact the department on Facebook.Holmes County UF/IFAS to host Outdoor ExpoBONIFAY … The Holmes County UF/IFAS Extension Of“ ce will host an Outdoor Expo Friday, September 7 and Saturday, September 8 at the Holmes County Agriculture Center in Bonifay. There will be a concert, improved outdoor venue, NWFT Grand National Turkey Calling Contest and vendors. For more information on the event or becoming a vendor visit www.hcoutdoorexpo. com or call Kayla Welch at 850-547-1108. Open auditions announced for Grease: The MusicalThe Spanish Trail Playhouse will hold open auditions for Grease: The Musical at 6 p.m. Monday, September 10 and Tuesday, September 11. Auditions will be held at The Spanish Trail Playhouse (Historic Chipley High School) located at 680 Second Street in Chipley. Grease: The Musical will take the stage Thursday, November 8 through Monday, November 12. Audition packets will be available two weeks prior to auditions on the Spanish Trail Playhouse website: www. spanishtrailplayhouse.com, the Spanish Trail Playhouse of“ ce and at the Washington County Public Library. To inquire about a certain role or about volunteering or with other questions pertaining to production email spanishtrailplayhouse@gmail. com.COMMUNITY EVENTS CHIPLEYPAPER.COM

PAGE 7

** Washington County News | Saturday, July 14, 2018 A7 NATION & WORLD DATELINESMOSCOW COLUMBUS,OHIORyandefendscongressman JordanasmanofintegrityHouseSpeakerPaulRyan onWednesdaydefendedanOhiocongressmanaccusedof ignoringex-collegewrestlersallegationsofsexualabuse,callinghimamanofhonesty,amanofintegrity.ŽRyan,aRepublican,also suggestedtheHouseEthics CommitteedoesntneedtoexaminetheallegationsagainstfellowGOPRep.JimJordan.RyansaidthatpanelisntsupposedtoinvestigateallegationsfromacoupleofdecadesagowhentheywerentinCongress.ŽSomeex-wrestlersatOhio Statefromthelate1980sand early1990shavesaidthey wereinappropriatelygroped b ydoctorRichardStrauss. SomeclaimJordanknewatthetimeaboutStrauss.LOUISVILLE,KYFeds:Coalminesupervisors cheatedondustsamplesEightformersupervisorsandsafetyofficersata coalcompanywereindictedWednesdayonfederalchargesthattheyriggeddustmoni-toringinundergroundmines,forcingminerstoworkinthe kindofdirtyconditionsthatcanleadtoblacklungdisease.Theeightofficialswho workedatthenow-bankrupt ArmstrongCoalinwestern Kentuckywerechargedwith onecounteachofconspiracytodefraudthegovernmentbydeceit,trickeryanddishonestmeans,Žaccordingtotheindictment.Theindictmentalleges companyofficialsorderedworkerstoremovedustsam-plingequipmentandplaceitincleanairportionsoftheminetogetdesirablereadings.SANJUAN,PUERTORICOCEOofPuertoRicosbankrupt powercompanyresignsTheCEOofPuertoRicos bankruptpowercompany resignedonWednesdayjust monthsafterhewaschosen tooverseeitsprivatizationastheU.S.territorystrugglestorestoreelectricitytothelastofthosewhoremaininthedarknearlyafterHurricaneMaria.TheresignationofWalterHigginsaddstochallengesfor acompanythatis$9billionindebtandhasseenaturnover ofleaderssincetheCategory4stormhitPuertoRico. HigginswasnamedCEOofPuertoRicosElectricPower AuthorityinlateMarch andwasexpectedtohelp strengthenthepowergrid andsupervisedealstoprivatizethegenerationofenergy andawardconcessionsfortransmissionanddistribution.MUNICHWomangetslifeinprisonin neo-NazikillingsinGermanyAGermancourtfound themaindefendantguilty onWednesdayinastring ofneo-Nazikillingsmorethanadecadeag o„ahigh-profiletrialthatraisedfreshquestionsaboutthetreatmentofmigrantsatatime whenGermanyisgrapplingwithanunprecedentedinfluxofrefugeesandsurgingsup-portforafar-rightpartybentonkeepingthecountrywhite.TheMunichcourtsentencedBeateZschaepe,the onlyknownsurvivorofthe NationalSocialistUndergroundgroup,tolifein prisoninthekillingsof10 people„mostofthem migrants„whoweregunneddownbetween2000and2007.LOSANGELESCardiBannouncesbirthof daughteronInstagramCardiBiscelebratingth e birthofherfirstchild.The25-year-oldrappe r welcomedKultureKiar i Cephusduringaposto n InstagramWednesday, whichherrepresentativ e confirmed.Thegirlwasbor n Tuesday.Theannouncementcome s twoweeksafterCardiB, whoserealnameisBelcali s Almanzar,confirmedsh e andrapperOffset,ofth e hip-hopgroupMigos,ha d secretlymarriedinSeptember2017. Thisisthefourthchildfo r 26-year-oldrapperOffset, whoserealnameisKiar i Cephus. TheAssociatedPressRussianPresidentVladimirPutin,right,shakeshands withIsraeliPrimeMinisterBenjaminNetanyahu duringtheirmeetingWednesdayattheKremlinin Moscow.ThetalksfocusedontheIranianpresencein Syria„anissuethatisexpectedtotoptheagenda oftheupcomingU.S.-Russiansummit.Israelhas repeatedlysaiditwillnotallowIran,oritsShiite proxies,toestablishapermanentpresenceina postwarSyria.[YURIKADOBNOV/THEASSOCIATEDPRESS]JUNEAU,ALASKACoastGuardAirStationSitkaMH-60Jayhawk helicoptercrewsrescuepeopleaftera”oatplane crashedTuesdaysouthwestofKetchikan,Alaska, onPrinceofWalesIsland.Allthepeopleaboardthe planethatcrashedTuesdaywererescued.Coast GuardPettyOf“cerCharlyHengensaidWednesday thedownedaircrafthadanemergencylocatorthat aidedasearcheffortcomplicatedbyvisibilityof roughlyone-quartermile.[U.S.COASTGUARDVIAAP]PESHAWAR,PAKISTANPeoplecarrythecof“nofavictimofasuicide bombingatanelectionrallyforburialWednesday inPeshawar,Pakistan.ThePakistaniTalibanon Wednesdayclaimedresponsibilityforthebombing thatkilledasecularpoliticianand20others,two weeksbeforethecountryselections.Thebombing killedHaroonAhmedBilour,acandidateforaseat intheprovinciallegislature.Another65peoplewere wounded.[MUHAMMADSAJJAD/THEASSOCIATEDPRESS]LeaderofAmerican contingentdetails operationtoextract 12Thaiboysandtheir soccercoachwhowere trappedinsideacaveByStephenWrightTheAssociatedPressMAESAI,Thailand„ TheThaiboyssavedfroma floodedcaveendureddivesinzerovisibilitylastinguptohalfanhour.Inplaces,they wereputintoharnessesandhigh-linedacrossrockycav-erns,saidaleaderoftheU.S.contingentinvolvedinthe operation,callingitaonceinalifetimerescue.ŽDerekAnderson,a 32-year-oldrescuespecialistwiththeU.S.AirForce b asedinOkinawa,Japan,saidthedozenboys,ranginginagefrom11to16,andtheir coach,whoweretrappedformorethantwoweeksbefore b eingrescuedthisweek,wereincrediblyresilient.ŽWhatwasreallyimportantwasthecoachandthe b oysallcametogetherand discussedstayingstrong,havingthewilltolive,havingthewilltosurvive,ŽAndersontoldTheAssociatedPressinaninterviewonWednesday.Thescaleofthechallenge confrontingrescuersfrom Thailand,Britain,AustraliaandothercountriesonlytrulydawnedontheU.S.team afteritarrivedatthecave intheearlyhoursofJune28 asrainpoureddownontheregioninnorthernThailand.TheThaigovernmenthadrequestedU.S.assistance.Thecavewasdrywhen wearrived,andwithinan hourandhalfithadalready filledupby2to3feetand wewerebeingpushedout,Ž saidAnderson,thesonof missionaries,whowasborn inSyracuse,NewYork,andgrewupinEcuador.Thatwasjustinthevery beginningofthecaveand atthatpointwerealized thisproblemisgoingtobemuchmorecomplexthanwethought,Žhesaid.Thailandsdecisionto divetheboysoutdespite theirweakconditionand lackofdivingexperience wasmadewhenawindowofopportunitywasprovidedbyrelativelymildweather. Amassiveoperationto pumpwateroutalsomeant airpocketswerecreatedat crucialpointsofthecave,makingarescuepossible.Fallingoxygenlevels,risk ofsicknessandtheimminentprospectofmorerain floodingthecavecomplexformonthsmeantthelong-termsurvivabilityoftheboysinthecavewasbecomingalessandlessfeasibleoption,ŽAndersonsaid.Diverspracticedtheirrescuetechniquesinaswimmingpoolwithlocalchildrenaboutthesameheightand weightasthemembersof theWildBoarssoccerteamtrappedinthecave.Theaim,Andersonsaid,wastomakeeachoftheboys tightlypackagedŽsodiverscouldkeepcontrolofthem andadjusttheirairsupply asneeded.Theprocess lastedhoursforeachboy, andinvolvedthemgetting throughlongpassageways barelybiggerthananadultbody.Buoyancycompensatorsthatestablishneutralbuoy-ancyunderwater,hooded wetsuits,bungeecordsandspecialfacemaskswerecar-riedbydiverstothecrampedpatchofdryelevatedgroundwheretheboyswerehuddled.Thepositivepressuremaskswerereallycrucial,ŽAndersonsaid.Theirusemeantthatevenifaboypan-icked„perhapsbecauseof gettingsnaggedinanarrow passage„andgotwaterinsidehismask,thepressure wouldexpelit.Thecomplicatedopera-tiontobringtheboysoutofthecavebeganonSunday, whenfourwereextracted.FourmorewerebroughtoutonMonday,andtheopera-tionendedTuesdaywiththerescueofthelastfourboysandtheir25-year-oldcoach.The18-dayordealrivetedmuchoftheworld„fromtheawfulnewsthatthe13weremissing,tothefirstflickeringvideoofthehuddleofanxiousyetsmilingboyswhentheywerefoundbyapairofBritishdiversnearly10dayslater.Thegrouphadentered thesprawlingThamLuang cavetogoexploringafter soccerpracticeonJune23,butmonsoonrainsfilledthetightpassageways,blockingtheirescape,andpushingthemdeeperinsideinsearch ofarefuge. Onceinalifetimerescue U.S.AirForceMasterSergeantDerekAndersontalksabouttheriskyoperationofextractingthe trappedboysandtheirsoccercoachduringaninterviewWednesdayinChiangRaiprovince,northern Thailand.[VINCENTTHIAN/THEASSOCIATEDPRESS]

PAGE 8

** A8 Saturday, July 14, 2018 | Washington County News FAITHSubmit your sign of faith at photos@ chipleypaper.com. Washington County News StaffWASHINGTON COUNTY While driving on the long country roads, youre bound to see a sign of faith some-thing that can take away the Mondays, remind you of your many blessings or give inspiration to you for some-one else.Washington County News wants to share this positivity with our readers!Weve launched Signs of Faith, which runs in each Saturdays edition. We want you to send in your Signs of Faith to us to share with the community!In the photo, a marquee at Northwest Florida Reception Center, 4455 Sam Mitchell Drive, in Chipley, reads: Optimism is the faith that leads to achievement.Ž And weve now shared that message with you.Send in your photos to photos@chipleypaper.com. Be sure to include a statement that tells the name of your faith organization and address.Signs of FaithNorthwest Florida Reception Center, 4455 Sam Mitchell Drive Some days, I just have an inordinate need for grace.Ž And by grace,Ž I mean the theological concept, but even more so, I mean my grandmother. A tiny, rather squishy woman, GannyŽ gave hugs that felt like being pressed into a fluffy feather pillow. I called her GannyŽ because I had trouble pronouncing all three syllables of grand-mo-ther.Ž That was ironic, given that my other grandmother, a woman of German and Scots-Irish descent required all three syllables to be pronounced along with her last name: Grand-mo-ther Whit-mire.Ž (While I adored them both, their naming preference should tell you something about the difference in the two women). Ganny lived with GranddadŽ (I could manage those two syllables) in a modest little house next to the A&P Grocery in Gaffney, South Carolina. And thanks to that grocery, Ill always remember the weekly visits we made to their home. Upon our arrival, Ganny would grab me up in an inordinately long, squishy hug and call me her precious little thingŽ (even though there were many days my parents would disagree with that title). Then she would scurry me off to the kitchen to enjoy some kind of treat. My favorite was the cherry pie filling from the A&P. Ganny knew that I didnt like pie crust, so she would peel away the shell and feed me spoonfuls of the cherry insides. (And no, I was not spoiled. OK, maybe a little.) While her nickname was Ganny,Ž my grandmothers real name was Grace „ Grace Foster Sparks. And while the great theologians like Martin Luther and St. Augustine have attempted to describe grace in powerful ways, I believe the home of Grace Foster Sparks provides the best image of all. To me, grace is not necessarily a thing, but a place „ a place of grounding and belonging where you feel special, like you are wrapped in an inordinately long, squishy hug, eating the filling out of a pie. We all need to find that place. Every day we are bombarded by corrosive voices from the world outside and from inside our own hearts. We are assaulted by words that slowly tear us down, bend us over in shame, make us feel less than the beloved children of God that we are. We need to find that place called grace. One of the best places to find it is in scripture. In fact, Ive put together a list of what I like to call squishy scripturesŽ „ Bible verses that make me feel like I am wrapped in an inordinately long, squishy hug, eating the filling out of a pie. I have included a few examples below. I hope that you will take a moment throughout your week to pause and read them, reminding yourself that you are called as Gods precious one. Then spread that joy. This week, think about three people who need to hear from you. Perhaps a family member, friend, or spouse needs your words. Maybe its someone you havent spoken to in a while, or maybe its a stranger on the street. Share a hug or a some piefilling-eatingŽ kindness with someone to remind them of their divinity as a child of God. While I miss sitting in Gannys kitchen eating A&P pie, her legacy lives on. And through that memory, I learned that living a life of love and beauty is not that hard, even in these difficult times. Its all about recalling who we are. Its all about remembering from whence we came. Its all about finding a place called grace. Psalm 57:1 Be merciful to me, O God, be merciful to me, for in you my soul takes refuge; in the shadow of your wings I will take refuge, until the destroying storms pass by. Squishy Scriptures:Ž Isaiah 41:10, 2 Timothy 1:7, Psalm 55:22, Isaiah 43:1-2, Exodus 23:20, and Isaiah 40:31. (Id love to hear about your own squishy scriptures.Ž Please share them with me via my email below!) A trial lawyer turned standup comedian and Baptist minister, Rev. Susan Sparks is the senior pastor of Madison Avenue Baptist Church in New York City and the author of Laugh Your Way to Grace. Contact her through her email at revssparks@ gmail.com, or her website, www.SusanSparks.comThe need for a place called grace S u s a n S p a r k s Susan Sparks If you would like to include an event in this list, email information to: news@chipleypaper.com Klondyke Gospel Music Center to host concerts in July OZARK, ALABAMA … The following gospel music min-istries will appear in concert during the month of July as indicated, at the Klondyke Gospel Music Center. All concerts begin at 7 p.m. There is no admission charge. Saturday, July 14, James P Hear and The Amazing Gospel Songbirds from Headland, Alabama; Friday, July 20, Heart to Heart from Knoxville, Ten-nessee; Saturday, July 21, Chosen Witness Quartet from Alabaster, Alabama and Saturday, July 28, Rickey Ward of the 4 Calvary Quar-tet from Bonifay. The center is located half way between Newton, Ala-bama and Ozark, Alabama at 3885 Highway 123 South.For more information call Ron Jeffers at 334-797-9862. Victory Tabernacle to host revivalHARTFORD, ALABAMA … Victory Tabernacle in Hartford, Alabama will host a revival through Sunday, July 15. The revival will be at 7 p.m. Thursday through Saturday and at 10:45 a.m. and 6 p.m. on Sunday. The revival will be led by Missionary/Evangelist Fred Wynn. The church is located at 10005 East State Highway 52 in Hartford, Ala-bama. For more information visit victory tabernacle.com Otter Creek Methodist to host The StaffordsPONCE DE LEON … Otter Creek Methodist Church will host The Staffords in concert at 7 p.m. Saturday, July 21. The church is located four miles north of Ponce de Leon off Highway 81. Bonifay First United Methodist to host USDA Food Distribution BONIFAY … Bonifay First United Methodist Church will host a USDA Food Distribution at 9 30 a.m. at the church on the following Wednesdays: August 15, October 17 and December 19. This is for Holmes County residence only. The church is located at 202 N Okla-homa Street across from the courthouse.Faith Events If you would like to see your vacation bible school on this list email them to news@chipleypaper.com Blue Lake Baptist to host VBSCHIPLEY … Blue Lake Baptist Church will hold Vacation Bible School from 5:30 p.m. to 8 p.m. on Wednesday nights July 18, July 25 and August 1. Family day will be at 10:30 a.m. Sunday, August 5 during the regular service. A meal will follow with activities for the kids. The focus will be the importance of worship and the true meaning. For more information call the church office at 850-638-1034 Chipley First Presbyterian Church to host VBSCHIPLEY … Chipley First Presbyterian Church will hold an Art Day Camp Vacation Bible School Monday, July 23 through Friday, July 27. This is the 15th year this opportunity has been available to children 8-years old and up. This is a Bible based curricu-lum with many corresponding art activities. The classes are taught by Florida Certified Art and Classroom instruc-tor, Winona Vanlandingham. There is no charge. Students must pre-register by calling the church at 850-638-1629.Oak G rave Baptist to host VBSPONCE DE LEON … Oak Grove Baptist Church will hold Vacation Bible School from 6 p.m. to 8:30 p.m. Monday, July 16 through Friday, July 20. Oak Grove is located in Ponce de Leon.VACATION BIBLE SCHOOLS More Content NowA church in Indiana was recently evicted from its build-ing because of a sign criticizing homosexuality. The sign was posted by the Remnant Fellowship Church in Auburn, Indiana, after a local television station ran a story about the sign and the pushback from some in the community in June. Church officials later confirmed that the church had been evicted by the landlord earlier this month. Officials said the aim of the sing was to reach young people and steer them away from a lifestyle they believe is harmful to them.Ž The controversy began after a woman had changed the sign to read Stay Open Minded,Ž The church later changed the sign back to the original controversial message and then was evicted. Study saysYoung adults are less religious than their elders.Younger adults around the world are less religious than their elders, according to a recent survey by the Pew Research Center. According to the study, adults ages 18 to 39 are less likely than those ages 40 and older to say religion is very important to them in 46 out of 100 countries surveyed. Good book?The Spiritual Mandela: Faith and Religion in the Life of Nelson MandelaŽ by Dennis CruywagenJournalist Dennis Cruywagen traces the spiritual component of Nelson Mandelas life, from his youth in a traditional Thembu village to his education at Wesleyan and Methodist mission schools to his time as an activist to his period on Robben Island and the years thereafter. Based on interviews with some of Man-delas close colleagues, such as Ahmed Kathrada, as well as priests and other religious fig-ures with whom he interacted, this book unearths an unknown dimension of one of recent his-torys most respected men. The WordRapture: In Christian escha-tology, a term used to describe the sudden transportation of true Christians into heaven before other events associated with the end of the world take place. Religion around the world According to the CIA World Factbook, the religious makeup of Gabon is:„ Roman Catholic: 42.3 percent „ Protestant: 12.3 percent„ Other Christian: 27.4 percent „ Muslim: 9.8 percent „ Animist: 0.6 percent „ Other: 0.5 percent „ None: 7.1 percentWEEK IN RELIGION CHIPLEYPAPER.COM

PAGE 9

** Washington County News | Saturday, July 14, 2018 A9 G rabthatpicnic basketandletshead foramemorable timewiththefamily. Nomatterwhatmeat youhaveforyourpicnic,whetheritssliders oragrilledmeat,potato saladhasalwaysbeen afavoritesidedish. Inmyopinion,thereis nobetterdessertitemthan Southernteacakes.Itslike eatingcakewithacrunch andisgoodforanyoccasion,especiallyapicnic. SouthernPotatoSalad€4c.cubed,cookedpotatoes €2hard-boiledpotatoes, chopped €Saltandblackpepperto taste €c.choppedonion €c.sweetpicklerelish €c.choppedbellpepper €2Tbsp.choppedpimiento €11/3c.mayonnaise Inalargebowl,combinethe cookedpotatoes,eggs,salt, blackpepper,onion,relish, bellpepperandpimiento.Mix well.Addmayonnaiseandstir well.Refrigerate.Old-Fashioned SouthernTeaCakes€4c.self-rising”our €1c.sugar €1c.shortening €c.milk €2eggs €1tsp.vanillaextract Preheatovento425degreesF. Inlargemixingbowl,combine alltheingredientsandbeat untilwellmixed.Thiswillbe asticky,thickmixture.Itis easiertorollthedoughifit isdividedintotwoorthree portions.Spoonouteach portionofdoughandplace itonawell-”ouredsurface. Sprinklealittle”ourontop ofthedoughandcarefully formitintoadisk.Dontwork toomuch”ourintothedough becauseyouwantacrisp (short-type)cookie.Rollthe doughtoathicknessofaboutinch.Cutwitha3-inch cookiecutter.Placethecookiesonasmanyungreased cookiesheetsasareavailable, orlinethecookiesheetswith parchmentpaper.Spacethe cookiesabout2inchesapart. DontworryIfthecookiesare notexactlyroundbecause teacakesdonthavetobe uniforminshape.Repeat withtheremainingdough. Bakefor7to10minutes,until lightlybrownedontop.These cookieswillbeslightlydarker aroundtheedge.Remove toaracktocool.Storeinan airtightcontainer.PrudenceHilburnhaswon morethan30national cookingawardsandwrittenseveralcookbooks, including,SimplySouthernandMore.ŽWrite heratprudencehilburn@ aol.comorvisitwww. prudencehilburn.com. TIPOFTHEWEEKMEALPREP MADEEASYPrepareaweek ofhealthyfood withmealprep tipsfromnutrition bloggers,courtesy ofCookingLight. €Cookbatch grainslikebrown riceorquinoa. €Prepare ingredientsthat canbeusedin manyways,like grilledveggiesor chicken. €Stockupon essentials:protein sources,fruit, leafygreens,precutveggies,whole grainandcheese. EASYRECIPEFROS (FROZEN ROS)Trythisrefreshing recipefrom realsimple.com. €1(750ml.) bottleofdryros €10ouncesfresh strawberries (about2 cups,sliced) €1tablespoon granulatedsugar €1/4cupvodka €2tablespoons grenadine Pourrosinto icecubetrays andfreezeuntil solid,eighthours orovernight. Combine strawberriesand sugarinthebowl ofablenderand letsitatroom temperature forabout10 minutes,until theberriesbegin toreleasetheir juices.Addthe vodka,grenadine androscubes. Blendonhighuntil smooth.Pourinto glasses.Serves fourtosix. HEALTHYEATINGFOCUSON WELLNESSThefollowing wellnesstipsfrom onegreenplanet. orgoersmall, dailychoices thatcanlead tolifelong,big changes. €Eatberrieswith breakfast. €Eatonegreen foodperday. €Drinkaglassof waterwhenyou wakeup. €Ditchsugary foods. „Brandpoint INTHEKITCHEN Potatosaladandteacakesgreatforapicnic FOOD ByAriLeVauxMoreContentNow K alehasreachedthat pointonthepopularitycurvewherepeople arehatingitbecauseits popular.Once,itwaseasytofile awaythisdarkgreenleafyvegetableasjustsomehippiefood, butnowitseverywhere.Itson themenu,inthevegetarianentree andmeatloafalike.Yourfavoritecelebritiesaregushingabout theirdailygreensmoothie.Forget conspiracytheory:Theascendenceofkaleisaconspiracyfact. Iminonthekaleconspiracy,but Iagreethatitshouldntbeaddedto everything.Thosebitterfibersreally wouldntworkinadelicateflan, forexample.Ifkaleisovercooked orburnt,thetasteandsmellcanbe terrible.Andifkaleisaddedtoadish thatalreadysucks,itwillstillsuck. Andreally,alittlekalehereand alittlethereisntgoingtodoit. Youneedtoeatmorethantrace quantitiestogetthebenefits. Whetheryoureinitforthefiber, thecalcium,thesocialstatement orwhatever,youstillhavetoactuallyswallowit.Soitisntamatterofputtingkaleineverythingas muchasputtingeverything„or anything„intokalethatwillmake itmorepalatable.Becauseregardlessofwhatthehatersandthe trollswouldlikeyoutobelieve,the morekale(andleaveslikeit)that youeat,thehealthieryouwillbe. Intermsofhealthimpact,almost anythingthatcanbesaidaboutkale canbesaidaboutcollardgreens, chard,spinach,turnipgreens,broccolileavesandmanyothers.But thetacticsthatwewillnowexplore aretailoredtokalespecifically. Mybodyseemstofunction bestwhenIeatbetweenthree andsixkaleleavesperday.So thefollowing,whicharereally mini-recipes,aregearedtoward consumingthatamount. Salad Novicesmaywanttostartbymassagingtheirkale,forasoftersalad. Squeezingandrubbingtheleaves withyourhandswillbreakthecells, releasingenzymesthatbegincuttingupthosefiberchains.Massaging withsaltandlimejuiceincreasesthe effect,andsincebothofthosearein thedressingtheresnoreasonnotto. Unless,ofcourse,youwantyour kalecoarse.Onceuponatimemy wifethesaladwhispererwould massagethekalesalad,butnow shedoesntwanttheleavesso soft.Onceyoumassageitthey losetheirstructure,Žshesays. Ilikeastructurefulsalad.Ž Thedressingconsistsofolive oil,limeorlemonjuice,andsalt. Vinegar,whileacidic,makesaterriblesubstituteforlimeorlemon. Shetypicallydoublesdownonthe saltbyaddingfetaorparmesan cheesetothesalad.Andsheadds onion,becausesomethingneedsto standuptoallofthatfatandfiber. Striptheleafypartsfromthe stemandmincesixleavesofkale. Usehalfacupofoliveoil,aquartercupoflimejuice,andsaltto taste.Ifyouwanttomassageit, takeaquartercupofdressingand rubitin.Thentossintherest, andaddextraslikecheese,onion, olivesorsun-driedtomatoes. Withbacon Itskindofcheating,butatleast itscheatingwithhistoricalprecedent.Cookingkalewithbacon recallstheSoutherndishofcollards andhamhock,andthatsnocoincidence.IusuallytakeitinanEastern direction,bymakingamixofsoy sauce,fishsauce,oystersauce,sesameoilandricevinegarorlimejuice. Riptheleafypartsoffthestemof threeorsokaleleaves,andmince theleafyparts.Cutbaconinto littlepiecesandfry.Whenitshalfcookedaddthegarlic,andlaythe kaleontop.Whenitwiltsdown, stiritaround,seasonwithblack pepperandhotpepper,andfinally pourinyourlittlesauce.Those leaveswillshrinkwaydown.Hatersgonnahate, butthisleafis tastyifyouknow howtouseitFLASHINTHEPAN Theconspiracy PrudenceHilburn ofkale BIGSTOCK

PAGE 10

A A 1 1 0 0 Saturday, July 14, 2018 | Washington County News CLASSIFIEDS 7-3429 IN THE CIRCUIT COURT OF THE FOURTEENTH JUDICIAL CIRCUIT IN AND FOR WASHINGTON COUNTY, FLORIDA CIVIL DIVISION CASE NO. 18000028CAAXMX BANK OF AMERICA, N.A. Plaintiff, vs. JOHN E. CORBIN, et al, Defendants/ NOTICE OF ACTION FORECLOSURE PROCEEDINGS-PROP ERTY TO: KIMBERLY ANN CORBIN A/K/A KIMBERLY A. CORBIN WHOSE LAST KNOWN ADDRESS IS 439 CORBIN ROAD, COTTONDALE, FL 32431 UNKNOWN SPOUSE OF KIMBERLY ANN CORBIN A/K/A KIMBERLY A. CORBIN WHOSE LAST KNOWN ADDRESS IS 439 CORBIN ROAD, COTTONDALE, FL 32431 Residence unknown and if living, including any unknown spouse of the Defendant, if remarried and if said Defendant is dead, his/her respective unknown heirs, devisees, grantees, assignees, creditors, lienors, and trustees, and all other persons claiming by, through, under or against the named Defendant; and the aforementioned named Defendant and such of the aforementioned unknown Defendant and such of the unknown named Defendant as may be infants, incompetents or otherwise not sui juris. YOU ARE HEREBY NOTIFIED that an action to foreclose a mortgage on the following described property, to-wit: COMMENCE AT A POINT 86 FEET SOUTH OF THE NORTHWEST CORNER OF THE NORTHWEST QUARTER OF THE NORTHWEST QUARTER OF SECTION 29, TOWNSHIP 4 NORTH, RANGE 12 WEST, WASHINGTON COUNTY, FLORIDA; THENCE RUN EAST ALONG THE HIGHWAY RIGHT OF WAY 208.75 FEET TO THE POINT OF BEGINNING; THENCE CONTINUE EAST ALONG HIGHWAY RIGHT OF WAY 417.5 FEET; THENCE RUN SOUTH 208.75 FEET; THENCE RUN WEST 417.5 FEET; THENCE RUN NORTH 208.75 FEET TO THE POINT OF BEGINNING. BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS: COMMENCE AT THE NORTHWEST CORNER OF THE NORTHWEST OF THE NORTHWEST OF SECTION 29, TOWNSHIP 4 NORTH, RANGE 12 WEST, WASHINGTON COUNTY, FLORIDA. THENCE S0202`51”; E, 64.42 FEET TO THE SOUTHERLY RIGHT OF WAY OF COUNTY ROAD NO. 280; THENCE N 8902`00” E ALONG SAID RIGHT OF WAY 208.75 FEET TO THE POINT OF BEGINNING, THENCE CONTINUE N 8902`00” E ALONG SAID RIGHT OF WAY 417.50 FEET; THENCE S 0030`00” E, 208.75 FEET; THENCE SOUTH 8902`00” W 417.50 FEET; THENCE N0030`00” W, 208.75 FEET TO THE POINT OF BEGINNING. TOGETHER WITH A SINGLE-WIDE MOBILE HOME: MODEL YEAR: 2006 MAKE: DESTINY MODEL: SOUTHERN PINES 8803-17-96 WIDTH: 16 LENGTH: 76 VIN: DISH02015; TITLE # 96843082 “WHICH, BY INTENTION OF THE PARTIES AND UPON RETIREMENT OF THE CERTIFICATE OF TITLE AS PROVIDED IN 319.261 FLA. STAT., SHALL CONSTITUTE A PART OF THE REALTY AND SHALL PASS WITH IT.” more commonly known as 439 Corbin Road, Cottondale, FL 32431-0000 This action has been filed against you, and you are required to serve a copy of your written defense, if any, to it on Plaintiff’s attorney, GILBERT GARCIA GROUP, P.A., whose address is 2313 W. Violet St., Tampa, Florida 33603, on or before July 22, 2018 30 days after date of first publication and file the original with the Clerk of the Circuit Court either before service on Plaintiff’s attorney or immediately thereafter; otherwise a default will be entered against you for the relief demanded in the Complaint. WITNESS my hand and seal of this Court on the 22 day of June, 2018. Lora C. Bell WASHINGTON County, Florida By: Tamera Donjuan Deputy Clerk “In accordance with the Americans With Disabilities Act, persons in need of a special accommodation to participate in this proceeding shall, within seven (7) days prior to any proceeding, contact the Administrative Office of the Court, Washington County, 1293 Jackson Avenue, Chipley, Florida 32428, County Phone: (850) 638-6285 via Florida Relay Service” July 7 and 14, 2018 7-3466 IN THE CIRCUIT COURT OF THE FOURTEENTH JUDICIAL CIRCUIT, IN AND FOR WASHINGTON COUNTY, FLORIDA CASE NO: 18000019CAAXMX DIVISION: FIRST FEDERAL BANK OF FLORIDA, Plaintiff, vs. TIMOTHY T. CUNNINGHAM A/K/A TIMOTHY TRAVIS CUNNINGHAM; KYLA CUNNINGHAM; UNKNOWN TENANT IN POSSESSION 1; UNKNOWN TENANT IN POSSESSION 2, Defendant(s). NOTICE OF SALE NOTICE IS GIVEN that, in accordance with the Plaintiff’s Final Judgment of Foreclosure entered on July 9, 2018 in the above-styled cause, I will sell to the highest and best bidder for cash on August 22, 2018 at 11:00 a.m., at the Washington County Government Offices at 1293 W Jackson Ave., #100, Chipley, FL 32428. ALL THAT PARCEL OF LAND LYING AND BEING IN WASHINGTON COUNTY, FLORIDA, MORE PARTICULARLY DESCRIBED AS FOLLOWS: COMMENCE AT THE NORTHWEST CORNER OF SECTION 29, TOWNSHIP 2 NORTH, RANGE 14 WEST, THENCE RUN S 8908’51” E, 659.38 FEET TO THE WEST SIDE OF FLORIDA STATE ROAD #279, THENCE S 2053’30” W ALONG THE WESTERLY SIDE OF SAID ROAD 370 FEET; THENCE NORTHWESTERLY TO A POINT 173 FEET SOUTH OF THE POINT OF BEGINNING; THENCE N 0022’22” E, 173 FEET TO THE POINT OF BEGINNING. (BEING A PART OF PARCELS 1 & 2 OF SPANISH LAKE ESTATES.) Property Address: 3800 HOLLY HILLS ROAD, CHIPLEY, FL 32428 ANY PERSON CLAIMING AN INTEREST IN THE SURPLUS FROM THE SALE, IF ANY, OTHER THAN THE PROPERTY OWNER AS OF THE DATE OF THE LIS PENDENS MUST FILE A CLAIM WITHIN 60 DAYS AFTER THE SALE. Dated: July 9, 2018. LORA C. BELL, CLERK WASHINGTON COUNTY CIRCUIT COURT By: Tamara Donjuan Deputy Clerk AMERICANS WITH DISABILITIES ACT Persons with a disability needing special accommodation in order to access court facilities or participate in a court proceeding at any courthouse or court program, should within two (2) days of receipt of notice, contact Court Administration to request such an accommodation. Please contact the following: Court Administration, P.O. Box 826, Marianna, Florida 32447; Phone: 850-718-0026; Hearing & Voice Impaired: 1-800-955-8771; Email: ADARequest@jud14.flc ourts.org July 14, 21, 2018 7-3470 NOTICE OF SHERIFF’S SALE NOTICE IS HEREBY GIVEN THAT PURSUANT TO A WRIT OF EXECUTION issued by the County Court of Leon County, Florida on the 9th day of July 2018, in the cause wherein Florida State University Credit Union is Plaintiff, and Ashley Deal Porter a/k/a Ashley Porter & Christopher Lucas Porter a/k/a Christopher Porter, in and to the following described property lying and situated in Washington County, Florida, to-wit: 2008 Dodge Charger VIN#2B3KA43R58H168 832 and sell to the highest and best bidder for cash, at the Washington County Sheriff’s Office, 711 Third St. Chipley, Washington County, Florida on 08/09/18, the same being a legal sales date at 9:00 a.m. or as soon thereafter as possible. The sale is a public auction to the highest bidder for cash in hand or local certified bank checks only No per sonal checks, money orders, or credit cards are accepted as payment. Should the highest bidder not have the cash in hand, the second highest bidder wins the bid at their bid price. Please note that there is no minimum bid. Dated July 11, 2018, Kevin Crews, Sheriff, Washington County By: Lisa K. Pitts, Court Process Section In accordance with the American Disabilities Act, persons with disabilities needing special accommodations to participate at this proceeding should contact Lisa Pitts at the Washington County Sheriff’s Office, at 850-638-6129, no later than seven (7) days prior to date of the proceeding. July 14, 21, 28, August 4, 2018 7-3469 ADVERTISEMENT FOR BIDS BID NAME: City of Chipley Harrell Avenue Resurfacing Project BID NUMBER: 18-07 Notice is hereby given to all interested persons or firms that sealed bids, submitted in triplicate, will be accepted by the City of Chipley, located at the Chipley City Hall, 1442 Jackson Avenue, Chipley, Florida 32428, until 2:00 p.m., local time on August 1, 2018 for the following item or items: Resurface Harrell Avenue, between 5th Street and Chestnut Hill Bids will be opened in the Meeting Room in the City of Chipley City Hall located at 1442 Jackson Avenue, Chipley, Florida 32428 at 2:05 p.m., local time on August 1, 2018. Detailed specifications and a bid sheet may be obtained from: Guy Lane, Public Works Director Public Works Office 671 Rustin Drive (850) 638-6346 IMPORTANT: Bids shall be submitted in a sealed envelope marked: “CPW Harrell Resurfacing Bid” and identified by the Name of the Company, Name and Number of the Bid, along with the Date and Time of Opening. Bids will be received by either hand delivery to the City Clerk’s Office located at 1442 Jackson Avenue, Chipley, Florida or by mail at City of Chipley, Post Office Box 1007, Chipley, Florida 32428 by the Bid closing deadline. SPECIAL NOTE: The City requires an occupational license tax be paid for the privilege of engaging in any business within the city limits. Please contact the City Clerk’s Office for a fee schedule. No bid may be withdrawn for a period of fifteen days after the scheduled closing time for receipt of bids. Bid award will be made to the lowest responsive bidder, but the right is reserved to reject any or all bids. EQUAL OPPORTUNITY EMPLOYER HANDICAP ACCESSIBLE/FAIR HOUSING JURISDICTION July 11 and 18, 2018 7-3468 LEGAL ADVERTISEMENT The Washington County School Board is accepting bids for Speech Language Therapy and/or Occupational Therapy Services. Bids are to be sealed and marked “Bid for Speech Language and/or Occupational Therapy Services”, Bid # 18-01” and delivered or mailed to the Superintendent’s Office, Attention: Troy Peoples, Director of ESE. Bids must be received on or before July 30, 2018 at 9:00 a.m. Bids will be opened at this time for review and presentation to the Washington County School Board will be August 13, 2018 at the regularly scheduled board meeting beginning at 5:00 p.m. Bid forms and specifications may be picked up at the Superintendent’s Office, 652 Third Street, Chipley, FL 32428 anytime Monday through Thursday, 8:00 a.m. until 4:00 p.m. The Washington County School Board reserves the right to accept or reject any/or all bids. July 14, 21, 2018 AKC Lab RetreiversBlack, male and female puppies. Home raised, vet checked and health certificate. $500 -$550. 8 Weeks June 1st! Call: 850-547-9291 Garage Sale, Multi Family. Fri & Sat, July 13&14, 8am-until. 3067 Main St., Vernon. Rain or shine. Ice machine, household, baby items & more! Estate Sale of Mr. John Curtis1744 Sorrells Rd Chipley, FL Fri & Sat July 13 & 14 8 AM -4 PM Directions : From Hwy 90 in Chipley, FL -take Hwy 277 South to Sorrells Rd, follow signs, 2nd house on rightThis is the 2nd phase of the Curtis Estate.Lots of mens stuff don’t miss out. Some furniture is available as well as linens, kitchen glassware, dishes and lots of misc. Everything needs to go! Please be prepared to load and move your items. Hope to see you there. T&C Estate Sales Looking for Laborers and Painters with at least 2 years experience. Call (850)849-07 36 or (850)849-79 82 Executive OfficeSpace for rent downtown Chipley. (850)638-1918 Retail Store Space available.Main Street. Downtown Chipley. 850-638-1918 For Rent 1, 2, and 3 bedroom apartments in Vernon. Clean, stove, refrigerator, central heat/air, convenient to Panama City Beach, section 8, Rental assistance. 850-638-4640 For Rent One Bedroom apartments for rent in Chipley. Convenient location. Stove and refrigerator furnished. No Pets. Smoke free environment. Call 850-638-4640. Publisher’s NoticeAll real estate advertising in this newspaper is subject to the Fair Housing Act which makes it illegal to advertise “any preference, limitation or discrimination based on race, color, religion, sex, handicap, familial status or national origin, or an intention, to make any such preference, limitation or discrimination” Familial status includes children under the age of 18 living with parents or legal custodians, pregnant women and people securing custody of children under 18. This newspaper will not knowingly accept any advertising for real estate which is in violation of the law. Our readers are hereby informed that all dwellings advertised in this newspaper are available on a equal opportunity basis. To complain of discrimination call HUD toll-free at 1-800-669-9777. The toll-free number for the hearing impaired is 1-800-927-9275. Nice cleanhouses, apartments & mobile homesfor rent in Bonifay area. HUD approved. Also, homes for sale, owner financing with good credit. Call Martha (850)547-5085, (850)547-2531. Rooms For Rent By Week.Comfortable rooms with microwave & refrigerator. All utilities paid. Cable and internet. Pet friendly at extra charge. Economy Lodge, Bonifay. 850-547-4167. 2/3/BR Mobile Homes For Rent $500/MO up. Cottondale area. Includes Garbage/ sewage/ lawn service. Electric $57 turn on fee. www.charloscountryliving.com 850-209-8847 For Sale Two acre plot and one acre plot in Jacob City, FL. Call 850-849-9338. Highway 77 2 miles south of Chipley 4-8 acre tract Bedie Road. Call Milton Peel at 850-638-1858 or 326-9109 For Rent First in Chipley, Mini Warehouses. If you don’t have the room, “We Do” Lamar Townsend (850)638-4539, north of Townsend’s. These tiny ads sell, hire, rent and inform for thousands of families each week.Let a little Classified ad do a big job for you. Buy it! Classified. Make your move to the medium that’s your number one source of information about homes for sale! For all your housing needs consult Classified when it’s time to buy, it’s the resource on which to rely. Need a helping hand? Advertise in the Help Wanted Section in the Classifieds!