<%BANNER%>
Venice gondolier sun.
ALL ISSUES CITATION MAP IT! DOWNLOADS
Full Citation
STANDARD VIEW MARC VIEW
Permanent Link: http://ufdc.ufl.edu/UF00028295/00936
 Material Information
Title: Venice gondolier sun.
Uniform Title: Venice gondolier sun
Added title page title: Venice gondolier
Gondolier
Physical Description: v. : ill. (some col.) ; 58 cm.
Language: English
Creator: Venice Gondolier Sun
Publisher: Venice Gondolier Sun,
Venice Gondolier Sun
Publication Date: 09-25-2011
 Subjects
Subjects / Keywords: Newspapers. -- Venice (Fla.)
Newspapers. -- Sarasota County (Fla.)
Genre: newspaper   ( marcgt )
newspaper   ( sobekcm )
Spatial Coverage: United States -- Florida -- Sarasota -- Venice
Coordinates: 27.098611 x -82.438889 ( Place of Publication )
 Notes
General Note: Issue for April 4-6, 2001 also called April 4, 2001.
General Note: Also available on microfilm from the University of Florida.
 Record Information
Source Institution: University of Florida
Holding Location: University of Florida
Rights Management: All rights reserved by the source institution and holding location.
Resource Identifier: aleph - 002730652
notis - ANK8420
oclc - 47264140
issn - 1536-1063
Classification:
System ID: UF00028295:00936

Downloads

This item is only available as the following downloads:

( PDF )


Full Text

PAGE 1

rfnn rfntfbfnntftrfnttbfnnnnbnbnnn nbnbfnbnbrn nnrnrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrf ntrrrrrrrrrrrrrrrrrrrrrrrrrrb rrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrb rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrb rrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr trrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrf trrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr n t rrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr nrrrrrrrrrr nrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrr trrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrb rfn tb t nf f tr tf tfr fnf nr rrb rnn rtff tt tfn nrb r r nf t frfn b n t bbr b trfn fb rr rr b tn tntf b r r fr ntt b rrt rb n b rt t ft fff t f t frfft rt nf tb btt tb tt rt f nf tf ftr bb rrb t ffb n fft ft fftrt ff n r ntr f tb fr nbrt ftt rt f ff ff bb t tfrfntb rfn tbnn b nr r tnr nr fb rn bnn f f nf r nr n tn t trt nt trnr r f rf n tbn nnr nf fftt tt t tr t tb nbttf rb nrb rftt trrb t b b r ttf ff trfb b f fbf trt f ntfb f rf fb t rfr rrff rr f ftr n rrb tnrf tfr t rttrr ttftft tnr rt t tfn f tnbbfr br ftf fntb nfbb br ttt fbt f bb rtff ntf trr f r t tfrt rffr t nfr f nf ff fr f ftn brnt tr f n fbnfrb tftfr nf ftrtt t t bb nr trtfr t trfrtn tfrfrnftbrtrrb bnnn btnnnb n nb )-4(uJGtiYdolierd SCHOOL BUS blobefthelrt II: L)Tj0 0.502 0 rg0.54 0 Td(c .OLIN)26(. i* Iitt \ \7 05252 10075 0

PAGE 2

r rf ntbbr br fr rfnnftbftnrnnt b tnftnnbb t fttrn nrnnntt n fbn rf ffffb ffffb rfrr bfrr f nn nn f ntb tb r ff br bf ff brr b r f r r b r f b t tt r ttb fb ff nnf bf rf rfff rbf frfnnfnfntt nrbfff tt t r tt t tnbnnt rfnttb nnfffr ff bfr fnrtb ntn nt rbn brtt rn ntb nnnt ttrnt tnttn nntrtt t tbrnn bt rtn nb tt nnnt ntb rtr nn t ntrbnb trbntnt tr tt rtt ttr nn rn nntnn nr tn nntr nntb nttn nt br tbtn ttb n nntt rnt nnntb ntn rtr n ttt nbbt tbr bt r rffn tbbt ntbnnnnt btbt rnnrnnt bnb ntbnn t nbn nnrrnt r tt tbtt ttnr fr ntnn nbnt nn tnrt rttn bt rf r frnftbf n ffr rff f nff ftf bnft ft ff brb r b rfntbnf bn bb nnbnntbn n n f nf bnbbbnbn )Tj/TT1 1 Tf-0.2991 Tc 37.2436 0 0 6 555.921 770.0965 Tm(S UN----lotte NE ,WSPAPER DcSoto b:nglcx and No th Port VcmecEy0UTH OfRor t & Joan LeeBoys & Girls ClubSarasota County Parks & Recreation it d' "-, )Tj-0.0117 Tc 7.3009 0 0 7 432.329 434.9675 Tm(Venice YMCAVenice Main Street AM,Venice Library FREE Door Prizes!for teens Games!and their familiesPre-Registration suggested for this event call 922-5126 or register online at cydonline.orgFF7V r..... ...................................SrAutumn treats & prizes!? 0 11 Explore with exclusive f aaccess to nature experts. f T" p -!;+ f' Customize your schedule of events.Girdingr` Butterflies,,..S' `A/' Kayaking 4AfeettheArtistRecePtionV Vat er, Wings 2 2r) Y IrIlt/ 1 / ling` Hiking featuring an exhibitbWildlife g a byAir Boat Rides Sponsoredb Artist asBroolcs,and Fri Y k credit UnionWildflowers ends of the the Parks FoundationExperience why Nature Viewingis in our Nature. visit: )-116(* sCentral Florida/,, October 6-9, 2011 )Tj/TT3 1 Tf-0.0262 Tc 10.9051 0 0 10 503.5218 62.0054 Tm[(800-828-7655 Follow us onRegister online atwww.V*isitCentralFlorida.org/naturefestk -, .. .. _.... r :ca)dr.rtl.'_ :,.r.,r:.t,14, uf1.i.,k _11.1.b41c 1

PAGE 3

rff n rfnrtf b fn nn n fn r n n f nf f n f nfn nn n nnn fnfn nfn fn nfnnf nnrrb nfnf nn ffff f fnf fnff fnf fnfn nff ff nff f fnn f fnfn f nntff nfnf fn nn nfnf nnn n ffn nff n nnf nfff fn nfn nn nff rrbnf f nf nnn n f fnn fnnf fnff n rrbnrf nf nfffn ff nf nnn nfn fnfn fn nf nnn nnnnnf fnn nffffnf nft tff n nnnn nfnfn fnff fn fnf n nnn nf nn fn nfn frrbn rf nn nn nf nnn rfn f f nf nrrb f tf n n f fn fn nn ff ffn nn fnfn ffn f f rff ff n f f n ffn n nnf nnf n f nr n rff fnnff ntf f nr ffn nf nnf fn ff nf nn r fnnn nnn nf nftt nn ft ffn nf fnf ff nnftf ffff ntf nf fnnf f nfr fffn fn ffnf n nrfn rtfbfn nnfnfn nfn n nn ffn n rn rfntbr rrrrr rfntb rfntbr rf ffffrff rfnntbbbbtbbbb frtbbb tbttbfrntb rffrb frnrtrb fftbftbb f rrrtbbb ffr r ttbbb ff rr tbbrfrt rfrrr frrrrfrff r fntbnrn r rf rff f r fntbtrt ntbrn btr r r tbtntb trb b rrtrtrtbr btrrrr frbtrbtrb n tr tr rb rb rttrttrbtr rrrf r rr fntb f rfr n rtbfttr 44 -s A-)Tj/TT2 1 Tf-0.2778 Tc 27.6667 0 0 6 36.3624 469.8639 Tm(Il e -i vAji,' )Tj-0.3663 Tc 13.5116 0 0 4 487.3624 175.8728 Tm()Tj/TT1 1 Tf-0.1209 Tc 18.8247 0 0 12 243.8624 172.373 Tm(OF AA)-125(',) r., y,Z

PAGE 4

rffn rfn tb bn r rrrrb rtrrr rb n b b r r ft r rb r rtrtn rr t b frn br r bt rr rrrn r tr rtrn rrr n f rb t f t t rn f rfnnt bnbn t fb nnb n t rrr f t t f f tfr rrn rrr rtrn rb f t r rrrrr rtr f t rn f r tt r r rb f b tr r t f tr r r r rrrr rtr ff bt rrr brb rtb n bfftb rn rrb b ftrtt brr r b r tb b rr rtbt f brn rrn rtbrt b rb t f ftrn br rtb rr tn trtb r rt b b t ftrn br b rr b rn rrn rrb n rbt b rr r f r rr bb n rtb r rfrntnbnbnnnnbbffnbbnfrf rrrnnffntnbrrfn r fbrn rfntbbbnrfnfffnbnfffnbbnrfntbbb nfnfffnb nnfbnb ffbfnnb rrf ffbfnnbr ;fr,. IR1 )Tj-0.0273 Tc 7.5455 0 0 10 209.124 1083.867 Tm(" .)-32()]TJ-0.0419 Tc 7.2625 0 0 11 251.624 1085.3669 Tm[(Ilill r IlhI'1 n ii...... .I,.;1I'awn i iprsw907I I 1 I:J. tqVORTEC5.3LV8 AUTOLOCKING LOWESTCOSTOF+ REAR OWNERSHIP OFDIFFERENTIAL ANY FULL-SIZEPICKUPson )105(. 24 MPG HWY SEATS UP 116.4 CUBIC FEETTO EIGHT OF CARGO SPACE

PAGE 5

rff n r fntb rftf fffr ffrff fftf btfff fttfrr t ffn rrn fb fn fftf b ffr tttf fftf nftffr b fnffnfftrff frffrftt ff trftfrf nffrftf ffb r frf fftfftffftn frfttfnbr frfff brf tff frfftrb ffnft rff fnt bt n frrfff frrffb rftff ntrf rffb n fffr ftfffb rfff b nf nfff rf fn rf ftt frftf bfbtb btbff btbbtbb frbftb frftfff ffb r rfntbbrfbtrbrfnt rrbrb ttrbbf r frrnr tbb rfntbnrr fntb b r fttt ftttt fntb b rfntnb f ntnbtftftfftfr ftfrf frffntnb r fn rfnrtbr nrfr rfntbr f rfrnt b b b b b b rfr rfnnbtn r rfntb b r btb fntbrb b t b fbb rffntbfnfrnf n rf frntbbfnfnt fntb b )Tj-0.3809 Tc 23.7143 0 0 3 160.3624 1431.5616 Tm(' e-\ it IIIf I -'-rfr r I1 \aineeenou t yI! ti_a-csDIVINECONSIGNc(lheu2E 7l/zc .CIilcl-, 1 c I>>zcl CT I fNIF----------i---------

PAGE 6

rffn rr fr nt brr nr n tbr rrrrrt br tbr t rrrr rtr n t rr brrrn rr r t bn rtbr rr rrrt rr rrnrt r rr t b tb rt frrr rnrrrt nr rr rr rrr rrt n rrrr rb rr rt rr r rrb r rrt r rr rrt brrr r rr r rr rt rr rrb rnr r r rt brr nr rr rr tb rrrt rn rrrr rr rnt rrr r rr nr rrr r rrt r t rr rrr tr brrt r r rrrt rrttr rr r rr rr rt rr rr rrr t r rn r t r r rr rrr n nt rrr rr rrrt rr b rrr r r rrr rr rt r rrrrr rt t br rrr nt rrr rr r r rrt rr r n rr rr r t rrr rr r rr rr nr rr r btrr rt rr nr rr rt r rr r t r r tr r r rrr nt b rrrt r rt rr rr rr r rrr rrt rr rrtrf r fntb f rfntbftbnbf fbfrtbfttrfn bbbrtf bf rf f bf b t bfftnbtntb fbbbtbfn nbftnbn ftt nb nbbt f rf nt t bbtbf nnfr bbfn f fffr tff f f fffr fff f bftfbbftr frnnrbntn rnnbffttb fbfnnfr tnttbtn n n fnnn fbnbbf bnbtrn bb n fb ntnbfbbf nnbbnn b b b b f btb b bt r b b b rn rbtn n bbfbtbff ntrbf n fnnbr nfb rbtnn r f f rf t brf f bfbtnbft tt tft tbtrnbfrnbtbt fbfbfbnrbrnn f rfnbnbbtbf nttbbt f b ftfntttntf nntfbfntfnn tfbtnfntn nbntffn ntftbfbtnft bftfttf btfbbtnrbn tnrtbbnbtbbt rn f frf f frf b nnbntff nntftbfbtnft bftfttrtbbn btbbtrn f frf r b f rff fb r b f rff f f fb bntrbbfbt bbt f r fb tfb rtn r bffb bffrbb nbn rbbnb nn fbbfbfnrttrff f f rf bf t brf r f bfbtnbft bf tt t n fttbtnrnbfrnbt btfbfbfbnrb rnn f rfnbn bbtbfnttbbt nfrtbfnnn f rbbf b ftfntt tntfnntfbf ntfnntfbtnfnt n b nbntffn ntftbfbtnft bftfttf r btfbbtnrbn tnrtbbnbtbbt rn f frf f frf b nnbntff nntftbfbtnft bftfttrtbbn btbbtrn f frf b f rff fb r b f rf f f fb bntrbbfbt fbbt fb ntfntfb bffn ntfttfbbf nfnntf ntfb nbrn nfn nbn nfbf f f rff ff rf rbfb brnf r f bfbtnbft r rbfb t tt btfbfbfbnrbrnn f rfnbnbb tbfnttbbt rbb f ftfntttntf nntfbfntfnn tfbtnfntn nbntff nntftbfbtnft bftffttf btfbbtnrbn tnrtbbnbtbbt rn f frf f fr fb nnbntf fnntftbfbtn ftbftfttrt bbnbtbbtrn f frf b f rff fb r b f rff f f fb bntrbbfbt fbbt fb r tt r fb nbn bn bbnb fb f rff rf rfntb rf rnrtr bb rfnt bb rf n t b t b b f rrr rf ntb rfrntbtf tfrt ffftrrffntbtrbrffrr r ttbtrfnfnbttbrffbtnfffrb rfb b ftrb rfntfbbfrfrnrftffbb bnb rnr n b b rfr M,QMTGQMERoY'S -)]TJ/TT1 1 Tf0.0003 Tc 31.946 0 0 33 389.999 1245.1514 Tm[(rCar etsPlusf L,925 I f0 Y em,c Ave. o velm e o hog f Vem,c e 200)Tj/TT4 1 Tf-0.0333 Tc 6.9167 0 0 5 353.1921 788.8541 Tm(TIitl)-500(IIIIIIIIII IIIIIII IIIIIli lilljlll llllll I [IIIIIIIIIIIIIIIIIII,IIIIIIIIIIIIII,llt,,,aootooooooooooooJftI

PAGE 7

rff n r ffnt bfn t t n tf f n rtt r r f f t tt rtff rf ffn f ff nr fn f b f r fft rn tf r rtf n r tn f n r rn nr r t n f f t tff f nt f nn t n t f f t t nt n n n n n rfntb fn ff rfrfnnftbn fbffffbffnnf bffnf bfffffbf rfrrfb fbnffff nfrb f ffffbffnnfb fbfffr frrfbfbn ffff nfrf f fbffffbffnnfb ffnfbf ffffbfr frrfbfbn ffff nfr ffbffbffnnf bfbfffr frrfbf bnffff bfrfftbb f f f ffrfbbfbffnnbtrr f f rfr rfnrtbrrtr rfntb rntttnrfnfrtrnftfbr r fff rtrfr f frfnfnrr rnnbtrnftfbrtfr rrnrnnrnnffrfrr nrrrfrrrr nrnr ft n fnfffrnf fnfnrnf rrfrrffn nn fbb n tt bbbtffrnfrf trnrrrrnr rnrttrn n bfrrrtrnrrftf trftrrfrf tffnrfrnfftff ftfftrrtft tfbf nf tffrnntr nrftrrnf bnrrfff tfnrnrrf f rfffftrfn fffntrfntrfnf rfnrrrtrff frfrf rnrrbbrffrf trrfrtrtrr bbrrnfbbr nrrfr nf bbrfrrnrn nn fnnrnfrrnrrnr frfr tttfffnf ntfftr brfrrrrfrnfnff nfffnffrfn rrfrrnrrfr trrnrbbbrr rfrrnrrrrr bbrtrfnffnnr trnrrfffrfr rrfrrrrrrr rnrfrntffr frfffrnrbnrr fnnrrfnnrr rrfrrrrtrfr nfrffrtf tr rrfrrfnfnr trnrrffffnrnff fffrfftrrf nftrtr n trnf bfrrrf fnrfffnrrf trntfr brrrrtrnrfnf frf tfrrn bfffr rn trtrnfr trnrrfrfff ftrrnrfb tftrnrff nftrrnrfnrff rffnfntrnrrrrrf rftrnrrffnrfn frrnfrffnfrf frfrfrnfrffrfffrn nrnr rfntb n rf ntbnfr ff fffr n ttt btb btt ttt tt bbt r t bb ttb f f rnr LJ)Tj-0.0889 Tc 6.64 0 0 9 34.0218 1081.5606 Tm[()134(J ft f li A LCIS LLGA,I LIB! Lf 1J.^bm11)Tj-0.0772 Tc 14.7383 0 0 23 113.5218 913.0657 Tm(r 11Call 206-1200 to place your ad today.\ r)-191(j / 1r. )Tj/TT0 1 Tf-0.0926 Tc 6.9167 0 0 9 591.261 1258.4069 Tm()Tj-0.1111 Tc 11.8571 0 0 9 594.761 1257.907 Tm(;)210(TiHIV]',OzOPotS a -B000 O $24 99$7246 E................................... ....................................................................... ................................... .....)-319(........... .................. ....................... ..........S (Tl= S (R=...................... ............. .................................. .auion(TL ki Lo)-41()]TJ-0.053 Tc 8.803 0 0 4 22.5218 851.2751 Tm(J )57()]TJ-0.8928 Tc 29.6429 0 0 4 55.0218 844.7753 Tm()Tj-0.1458 Tc 6.9167 0 0 4 71.5218 851.2751 Tm(L)124(Y

PAGE 8

rr f fn tbrrrr tbrrr br rf rnrrrr tbbrrr rr rrrrr nrr rrr rf rnrrrr r r rrr rrrrr rfr r rr rr rrr rrrr rnr rf rtbbrr ttfrr r rftbbfr rrr rrf r rrr rrtrf rr rrnr rr frtbbrtr tbbfr rrrrr rrr rf rr rrr rrr rrr rrr rrr rfrr rr rrf rrnr rrr rrrr rrr rrf r rr rr rrrrnr r trtbbr rtbbfr r rf rr rr r frrbftrf r f rrr rrr rfrrfrf r rrrr rfr r rf nr rbr rrfr rnrr rrrf rrrnr rr rf rnrr rrr rrrr rnrr bfrrrf r r r rr frrr r rrrr rrrf rf r rr rrr rrr rf rr rr rrr rr f r rt r rr rrr r rf r r rrr rr f rrr rr rrr rfrr rr rr rrf r f r r rr f rrnr rr rf r r rrr rr rrr rr frr f rrr rr fr rr r r r rrrr rrf rr rr rrrrr rrr rr rrrrrr rrf rrrt rrrf rr rr rrrr rrf rrrr rrr rr rr r rfrr rrr rrrrr r rr rrr rrr rrr rrr rrf rr rrrrn rrr fr rrrf rrr fr brf rr r rr r rr rrrf r rr rrrf rr rrr f rrfff rrrr rrr rrr rrrr rr rrr rf rr rr ffrf rrf rr rrrr r rffr fr rrrr rrrrr f rr rffr rrr rrfr rbbr rf r rr rr frrr rnf rr rfnr rrrr rrrr f rrrr rr rfr r rr rrr f rrrr r rr f f r r rrrrrrf fntb r rrrrr rrr rrrf rrf rr rr f rrrr rr rr frnrrr rf rr rrrr rfrrf rrrf r rfr fr rf r rrnr rrr rrf rf r rrn rr rr rrrr f rr rrr rr r rrrr rr rr rrn ffn rr rf rrrf rfr r rfrrr rrrf r rrf r r r r rbrrr rr r rrbf r rrrf r r r rrrr rrrf rrf rrrr rrrnr rrrr rr rr rf rrrf rfntbr rf rrrnr rrrr rrr rrrf rrrr rr rr rrr rfr rrrr rrnrrr rrf nrrf nrbr r fr rrrrr frnr rrrr nrf rrrrf rnrr rrrr ff rr rrr fn rrr rrr f rrr rrrr rr ffrr bb rr rrrf nr rrrrr rrfr rrr r rf rfrr rr rrrfn r rrf rrr rr rrr f tt n rrr frr rf rrr rr rr rr rf rfntb CAPTAIN QUINN, WE JUST NIT THAT ICEBERG.WHAT DO WE DO?RELAX. WE'RE UN5IN4cABLE!OPPOSITION TO )Tj0.0944 Tc 9.5502 0 0 11 478 804.0222 Tm[(NAME CHANGE.r/r

PAGE 9

rff n rfnttb f frb ft tt fr t t t t ft f t tr ft bttt rtt brft rttb ft tttf ttbtt ttbtf rt tr tttf tbbtt b tb bf rb tfft t ftttrt f rffntfb fb f rtfb ftf nfbft tft ff b f b f f t r rt b f rtt nf ff b f r r tt f f ttf f rf tttrf bftr bfb tbf ttr f b fttft f t b ff t rb bftf f tb fr f nf fft ft f ff fttt rtrftt rf ntt ft fnftt bftrtt f ftnf bb t f b r rf nrtb nrffff fff nfr fff rr fff rfnff rfrfntbb nffnnrrn rfrfntbntbtbbbbb rf r r r r nt nbf bf nftf ff r rfnttbt rr t fb ft nf nf bt nbr rfnttbb tn rr tf bf nf fr rfntt n r fft n f tf bfb nnt fr rfnttbt bn r bt fb bf r ff ffr rfnttbn ff ff ft fff r rfnttb n r f fn f ffr rfntb n fb fr ftff b nbf rfnttt r nt nb ff bt ff ffr rfnttbt n fb nf ff fb f nbr rfnttb bn r rr nt nbtf ffb f nfr r rfntt b r tbt nt n f ft f rfnttbn t r ntnt nbfbbr fnbfr rfnttt rfntb n rfb nt nbff fbnb frrfnttb n r r f ft bft n f fr rfntt n r f ft nt nbt bf f rfntt b fb r rb fb bnr rfnttbb r f f rf fft nt f f fr rfnttb bn r r nt nb fbf fft ff r rfnttbn r rff nt fbn rfnttbn t rf b f r ffr r rfnttbbb n rr r nb bfff tn b ff bb fr nn n r fbt f fffr rfnttb n VENICE ISWU.w www.veniceisparadise.com I!III;,Ire. i r!IIIl,)-807(!j* b rjai )-11(. I`1 f rsG+)Tj-0.0281 Tc 5.2979 0 0 6 418.329 979.8646 Tm(lltlll0lijljaia,-o1wIN)]TJ-0.0225 Tc 3.1125 0 0 5 530.829 870.368 Tm(+lii+nr' JkL Allooolp? I IIBeachxc I ps.ari41 :Sx..c4r3Sla'N.F'm)87(IP a)]TJ-0.0394 Tc 2.9225 0 0 5 697.829 533.3783 Tm(,.')]TJ/TT4 1 Tf0.006 Tc 13.401 0 0 16 564.829 170.8893 Tm(AS I SEE 1T!_ ttry' Vy)186(J )5(JlfJ J)-83()]TJ0.0508 Tc 10.8073 0 0 12 237.3624 912.1915 Tm(TTSarasota County GovernmentAta wMr sa,exCOUNTY CALENDAR Developmental Disabilities StrikeTeam Sept. 29, 8:30 a.m., RoomBoard of County Commissioners 227, Health and Human Services, WORKSHOP TO CONSIDERSecond Budget Public Hearing 2200 Ringling Blvd., Sarasota. COMPREHENSIVE PLANSept. 26, 7 p.m., Commission Call 941-861-2558 AMENDMENT ON RETAIL USEChamber, Robert L. Anderson Sarasota County Planning ServicesFacility, 4000 S. Tamiami Trail, Early Learning Coalition Budget SVenice. Call 941-861-5344 and Finance Sept. 30, 8 a.m., will hold a the public workshop tooLIVE TV and Webcast Conference Room, discuss possibility S allowingCavanaugh and Company, LLP, retail uses in Major EmploymentBoard of County Commissioners 2381 Fruitville Road, Sarasota. Center areas already zoned forSept. 27, 9 a.m., Commission Call 941-954-4830 Industrial Light Warehousing (ILW).Chamber, First Floor, Administration begin at 6 p.m.Center, 1660 Ringling Blvd., Family Safety Alliance Sept. 22, The shopSarasota. Call 941-861-5344 4 p.m., Large Conference Room Tuesday, w wowoSept. till ill bet 27, at ColonialCol OaksLIVE TV and Webcast United Way of Manatee County Oaks Park,Building, McClure Center, 4215 Blvd., Sarasota.Board of County Commissioners Concept Court, Lakewood Ranch. It will cover a Sarasota CountySept. 28, 9 a,m., Commission Call 941-861-2882amendmentPlan amendmentChamber, First Floor, Administration Comprehensive omprehensive redevelopmentCenter, 1660 Ringing Blvd., Historic Preservation Board allow theSarasota. Call 941-861-5344 Sept. 27, 4:30 p.m. Think Tank, of existing ILW within MajorLIVE TV and Webcast Third Floor, Administration Center, Employment Centers with more1660 Ringling Blvd., Sarasota. retail opportunities, without turningCommunity Alliance Aging in Call 941-861-6883 the centers into CommercialPlace Action Team, Sept. 28, Centers. The workshop will focus on3 p.m., Second Floor Conference Human Services Advisory options for including retail uses inRoom, Center for Healthy Aging, Council Sept. 30, 3 p.m., Health these areas. Planning Services willCampus of Senior Friendship and Human Services Building, present findings about the marketCenters, 1900 Brother Geenen Second Floor, 2200 Ringling Blvd., impact of allowing retail uses inWay, Sarasota. Room 226, Sarasota. Major Employment Centers withCall 941-861-2564 Call 941-861-2882 significant amounts of ILW zoning.Community Alliance Nominating Sarasota Partnership for Children For additional information aboutand Membership Committee Kick-off Event-Sept 77,5:30 pm., the workshop or the proposedSept. 28, 1 p.m., Room 2063, Lee Wetherington Boys and Comprehensive Plan amendment,Health and Human Services, 2200 Girls Club, 3100 Fruitville Road, contact Planning Services atRingling Blvd., Sarasota. Sarasota. Call 941-861-1410 941-861-5140.Call 941-861-2561Criminal Justice Commission NATIONAL NIGHT OUT COMING BUSINESS TAXES DUE BY SEPT. 30Sept. 26, Noon, Think Tank, TO URFER FAMILY PARK OCT. 4 Formerly known as an occupationalThird Floor, 1660 Ringling Blvd.,Administration Neighborhoods throughout Sarasota license, this business tax mustCall 1-861-Center, 2882 S. County will join communities be paid by Sept. 30. ExistingLIVE TV and Webcast nationwide for the 28th annual businesses may pay online atcrime and drug prevention event. www.SarasotaTaxCollector.com.Want to know more? Scan this. New businesses should call theTax Collector at 941-861-8300ADVISORYBOARD VACANCIES (select option 3), or visitVistwww, v.netladviso Info@SarasotaTaxCollector.com.scgo ryboards or EA contact the Sarasota County Call Center at861.5000 for latest vacancies and information about Sarasota County isory Boards. Indbiduals wt disabilities who need assrctance to participate in any of these proceedings should roitad the roanty admnistntion at least Net (3) business dap before the meeting time and due at 941-861.5344.Fantastic San2soYOUR STYLE AWAITST"----------------1,Fq-----------------, ,1)Tj1 0.502 0 rg/TT0 1 Tf0.193 Tc 64.0702 0 0 4 94.8624 656.2922 Tm(A, ,------------------,

PAGE 10

rfrf ntbntntn r rf rrfnt br r rr ntfnt trrrn brrr rrn nrn r rr r rnt nb nrr fr nnrfnt ntrrn rn r nr rrr n rrn rttrn r nr nr nrrnrrr n r n ntrr rr rf rntbnntbtn nn ntntbtbbt tbbt ntbtntnb bnnt nbtnnt n ntbnnbt bbtnt btnt ntnnbb tbnntnt nbnnbtnn tbnn ntbtbtbtn b fr ntntn tntnnbb tntbbtnn ntbnnnt ntnntbn b ntbt nntbntnt nbnnnn rntbnnb nntbt bnftfbn bntnbtntntn nttfnn tbtntt ntbt ntnnbtn ftbtn fbnbnbbt nbtn nbtntbnnnbt bnttnbb ntntbn nt nbtnt ftfnn ntbnnft tnt nntbnt rfnntb rrfnt brtrbr fbf rtrntr nrrr ff nnr r fbnf rr fr nrr r tbnnr rrbrr nt tnr rrnr nrn trtn rrrn bnn rtnrnr rnrtn rrtr rrnt rfn n rnr rrr rt rrrbn rtnnrt tr tnbbr trtnnr ntn rn rtn b trbrtn nrrrtn rn tn rbnnnr rtrb rnnr nfrt rntn bn rrrrn nnn n rnrn rtrrnn rnn tr tn rtn rnnrrn nnbn tnbn rn nnrr trr nt nbt rrrbrn rbr bnnr trnr nn nrnr tnrtr nr nnrrt rnr brr nn rtbnr ntbrrn nrtr brnr nrrn rrrr nr ttrr nrrnr rnnnrn rr ntnr rnr nrr rtrbb rn r rrn rr rrrn bb n rnrrrn brrtn rr nrn rtnr brn nn rntbb bttn nntn rtrr rrn nrtrrtn rn nt rrbnn rrrn rn nrb bnrnr r rr brrr nn r fr frr nnrnn r bnr ntn rn tr r ntfr fr r nrnn n rnr fr rnnn rbnrt n rrr nrrnr r rrrn trrr rnrrnnr nr rr bbr r bb t rn rt trt t r bnr rrnnn rbn t rr nr br rtb rrn rr rttrr rrn ttrr rrr nrrr tnr rrrn fr rn rnn nb nrrr ntnr rtn r rr nn r bnr r r nr rr rtn r b brn rn r bn nr nt nnrr rnr tnrt rnr rr nntrt n rr nrn nrr nrtr nr ntfrtn r rn rr brn r rn r nnb rntr n r r r nf rrr n rbr tr trn t r n tn n rr nrr nrrrr rn tr rntrtr rtr trt brn n rr rntnrrfntbtrntbtr tbtbbttbbbtbtttbtbt tnbtttbbtttbr r tbttbtbtbtt ttttbbtttb btttftbtbtbtn tttfn rf nt bt tn n rrf ntbb rfntnbtb bnt nff bbbt rr b r b f ff f ffrf tn t n r rr b n r rr b

PAGE 11

rff n rf rntb b f f bt fn f ffrf rf b f ff f f f f f r fr rf fn rf fb nf f rf r f n f n f f ff f f f ff n rfnr rff rfr b n fn f f f n ff f f r n rr t rrf r n n f rfb f n f f f f r ff r f f n f rff ff t f f f f f r ff n rf r f f f f br f r f f tn rf ntb rf nrtnb f fnrtnb ntb nrtnrb tb rrtr rb f rr tnrtnb ttt t n tn n t rr rt rrbrt rr bfnrrb t rt r r r rtfnrnr r rf rn ffn f r n ff ffr b f f ff n r rr rffr f ff nf ffr b ff n rff r bfr r f r f f f nr b fffb b f f f ffr f f n f f f t n tn fr f f n f r bf f b f f r tn ffb fr fn fnf f ff f f r fnb t ff nbrf t f ff b n f n f fnb fn rfntbfnntft r fntbtn fntbtnnrfntnrfntbftbbn rfnrtrbtbr rrr rfntbbbrfntnbf nntntn frtttt tf rr rfrntb rfr rfntbftnbnr rbrbfnt rfrfntbbfbfbbt rfrfrntb tftrt rf ntfbnrbrtfb nbnrrbrbfnt

PAGE 12

rffn rf rn tb n tb rf f f b t r r r ff f r t r f t r r f t rr n r f r trf rr rr b r tf r ff tf f r f r rr r r f r r tf f t t r rr r rf r r t t t rr rrfntbtnnb rfrfntbrf rffn tfrbbff f fff fn ffffrfrr fff rrbn ffffn rfff rnffrn t r fff f nf rfntbnbtnr rfrntbbfbfnnrbnbrn bbbbntbbfbbbbtbtbbntbtb rfntbn nn h 1 I I I Ijam' x ,)Tj-0.2976 Tc 14.8214 0 0 6 464.0327 560.6114 Tm( )Tj/TT1 1 Tf0.0087 Tc 4.3229 0 0 6 480.0327 542.112 Tm(_ )Tj-0.2568 Tc 10.6163 0 0 6 567.5327 554.6116 Tm( .r ,F. _V!S!t OurFabulous NewModels!Visit Arlington Cove Today.abulous Florida Living WhereEverything i Close to Home.Close to Manasota Beach and Englewood BeachMinutes from fishing and boating access to Lemon Bay and the GulfIn close proximity to a variety of shopping in Englewood and VeniceF, ceze 1 557 5F The proven quality service and integrity of Neal CommunitiesNew M inte n e-I I eP ire Will s Fr m Ml $1 Os)154(_I Bohan Ar :r, MD E Dea.born Stirgeon S.McCa Rd 27201 psw ch Dr ve Eng ewood FL 342239 175-1 98www nea commun t es comCENTER FOR SIG NEEFTFT qCSC 1256375 SOUTHWEST FLORIDA'S MOST EXPERIENCED BUILDER1AVOW--N-00'rAW-N iA A ho iCosmetics ImplantsGeneral Dentistry Facial EstheticsDr. Jill Morris Dr. Burr Bakke No Prep Veneers and Affordable ImplantsLumineersTM Implant Surgery Smile Makeovers Teeth Today Implant System Headaches and TMJ Pain Extractions and Bone Grafts Six Month BracesTM Implant Restorations Facial Rejuvination with Cat Scan in OfficeBotox, Dermal Fillers, and Lasers Non-Surgical Treatment forGum DiseaseSEMINAR: October 27, 201 1Learn more about the newest techniques in general dentistry,smile makeovers and implants. Call to reserve 914-9344fillMorrisCosmetic & Imp'anti.-.-iRestorative Dentistry Rest,,3951 Swift RoadSarasota Florida 34231941.914.9344www.SarasotaDentist.com Use your smart phone to scanhere to visit our website

PAGE 13

rff n rfnftb rnf brf nnt tbt nf rtbbr tb fbrf tbntb bn tbn rtbr t tb ffn tbr tt bnn r fr n f rt b r tbb bntbbtn bt bnb nn r f n bbb bn tbbtnbt bntt r r bbb bn tbbtnbt bnb r f r rn fr f r t bbb bn tbbtnbt bnn r r ff bbfb bn tbbtnbt bnn r n r r t bbb bn tbbtnbt bnn nf r frt bbb bn tbbtnbt r ftbttttttttrr tftbtttttttttttttttttrfrntn rftbtttttttttttttttttttttttttrbtf rbtttttttttttttttttttttttttttttttr tbtttttttttttttttttttttttttttttrf ntftbtttttttttttrr btttttttttttttttttttttttrfrn ftb f n ftfnbrf bt b t t t t t t t t rfntbnbbbbnbbbbnbbbbnnbbb nnbbnbbrrnbbbbbnbn rrrrrfrrrrrnrtr rfrntnbfrbntff bbb b trr t tr rt b b trr t tr rt brrfntb rfntbbb b bbb bbbb bb rtft rf nntrnttb -Av JIMk to OD D LM1AJVILILI U LILTTot4NowS77 sIlk)-127(V 'YYM1 1 'IIfit -:\.Nod= )163(') ; -. (0 (0 1-)-16(, (0 (I) )Tj-0.0496 Tc 11.6719 0 0 17 653.5327 125.9313 Tm[(') '? 1Ia (I iii"' // /

PAGE 14

rffn rfn tbbr rbbfnrn fnnn f bfnrn fn rffntffb bnrfft f ffnrn fnnrrn frf fnnrr rnfn r fntbb rbn rfntbnftb b bnnf n bnf n n rfnf ntntn nnf tffn ftntnnbfbnnn tntn fnn ffn nbfbnnn ttf tntn ttbttbnb r r r nbt r ffrbbfnrn fn ftt nnn r r rf r r r nnb nbn t t Ru1' )Tj-0.0952 Tc 11.8571 0 0 6 137.5327 1453.5609 Tm(' )Tj-0.0198 Tc 0.9881 0 0 6 142.0327 1464.5606 Tm( 42 yJ. m p o a o 0irkH0 IIHUIDU HERSfl11311 E II K i DO HIMENEHam?,Domma 1LmttIII_-.LF)]TJ/TT3 1 Tf-0.0066 Tc 2.1842 0 0 4 528.5327 558.5882 Tm(yyll^ Ws,y' `I

PAGE 15

rr r f ntb rrr bt rf n trb r nn rn n fnn n frn rn tn n nr t n nn n nt tn n nt nttn rrn n nn n nn rn n nnrr nr nt nn r n r nt t n ntn rr ntrn rn fn n n t ftn t nr n fr n n t n n nt n n f n n tn r n nr tfr nttn nn nr nnn tnn rrn nnn t n rt n n n nn n rf n t r nt n nnt n ft tntn t tr ft tnf tn nrr nn nr tnr n rntr r nt nrn fnn trr nn f n nn n r r nn nn rrntn r nn n r n t nr r n rtn n n tr nr n f tr rrnt t nnt nn f n fn n n n n ftrn nrn frt n r nftn n n t rn n fn rn r nn nn nnn nnt n n tn n nn n nnn n r nr nt nn n nnrn fn tr nn r r tnr r r nr nn t fn nt tn nnt nt n t r n n f tn t nn r ftn nn nt n n fn r n n rn r t f rnf n n rnnn n r t f r nn nnr nr f nf nnn nn nn nt t tr nr fr r r n t r r nn fnn t tn rrrr nrn n t n r rnt nr r n t tn n nr nt ttr n n rf tn rr t n t n tnnn n t tr n n rtn nt n n nn r n tnt n n nnr rt tn tnn r tn nn rrtr n t n n n t nn rtn nnn rrtf tn n n n n nr rtn t r nr tn f tr ftn b r n nn fn r rnn r n n rr tnn nn n n tn r tnt r ft n rn n r r n rb r b rn rffffnt bfn ffff rf f rfr fbf brf nfrff rfrnrtbtbr r bb fbr rf rffn tbr bn t b rfrntb rfntbr rfntbnrfrrrnnnn rfntbbtnffr rrfn rfntbbfr tnb fr trrb nr bn b mj (iw.; nvRiehs,r sl

PAGE 16

rffn rfrntb ffn rrrb fb nn rnf br nn bf t nr rnnr t ff nn nff rnftf nfr rb n nbn rnnr fbn rb tf rr ff nfff rnn bff fnb fbfffr rn rr r fnn nb rtff rrr btffb fnfrnb f f tfrn t nnfr tf f n nfb b f nff t tf tr btb ff fff f rf rf rrbff t tf fbf ffb ff rnn tft tft nfrfr f bf fbnf r f n n frnf nn ffbbt r tbn fb f n r rf n fbrn rnfr nft rnfr rntfnn n fbnff fn f nfr nf nfr r fr nrfb n n nfbr ff frnnfft r nfrb f frr r fb rffbfb r nr nfrfffn trt rtntr nr rtn rntbrt b n fr tb tn fb rffb bnffb fb fr n tnr rn tf tf frn rff rb ftrf f n nrnrb br brr bb f rbn rb nrf fr bnn r n tfr r r tnr fr n nn fffr n f nn fn nftrr rbn r f fff fr rn r nf f nfn nrn b bnf rrnr ffnfr nfr nrfn rf nrf r nfb nf f nr nffbfr rtf nrnb fr rnrf rrffbr f nrn n b fb fnnf r ff fbn t n nf ff fn bffnb bf nb nt n ff nffn rff rfrffnrrtbntbb rff n rffrntrbff r f n n t b r r f f f b rnrrtnrn rfntbrfntbnb ttftn rfnttbnnnbnrbnnbb rffntfttbrf rftff f f rftrf fttbf rr tr r fntrbrrbr frbrf rrrn rrrr rrrrr rrrrrn rrrrrrr brrrr fbnrrr rrrn frrrf brrn rfrrrr rrbrnb brrrrr rrnrrbb frrf ntbrf rbrrn rrb rrn r rfntb b b n n 1SupS)-14()119(t _601' ^N,110160')Tj-0.0714 Tc 0.506 -0.286 Td(.} W)49(rt)49(' 8)-50(f)72('0:)-26()]TJ-0.1137 Tc 7.9468 0 0 8 549.8447 980.0141 Tm[(:o[i'Advertising with the-4 bPAPERSreally works.af,d CH)94(ISEHORSE Manor.' Hcnwtr and PropeWe are donating 100% of fees for comprehensiveexams and x-rays performed on aill new patientsthrough 10/31/11to the AmericanCancer Society.

PAGE 17

rrrf rfntbn rfnrtbb rb rrfb rbbrn rrbb rbrnbb bb r r frnntnftrr rb rr b rbr bfbbrr bbbb brrrr brnb tbbrf rbr rrrfb n r nnftrr brb rrn rr bfrr rr rfftftft b rrbrrb tt rfrb rb b nntt rtbr rbbb rrb ffrr b rrb r rbnrr rrrbfr brfrbbr ftf nff r b bbfbr bbnbfrrf brnb rb rrbbn bb nbrnb nnfrr tbnb rrb rrb rnf rbn tf btrnr b rbfrbrnr bbbrrr bbr f ftt bbr r bb rbfr n bb ftff fnr brf b rb rbrr bff bn r brr tt bbr r bb tr brfrn rbrnbr rb trrrrr rrbf bn ftf nffr r rb r b bbfbr bbnbfrrf brnb rb rrbbn bb nbrnb nt f rb rb n rrrbb rnfrr b frrr fr nbb bb rrr rfbb bn tr tnfbt tftf r nbbn rrb nbbbb rrbbb brnbbr brtbf rbnf rffffn tfnt rr r b br bbr brrrbr fbrrb bbrb frrb r rrfr bb bbr brb rnfr n bt tbnb rrb rrb b rrbrrb nft rb b b frr frr r tnfrf b rbb bb rbrb rrrbb rrbnrr t nfffnr bbnb r rr rr rftf nff r b bbfbr bbnbfrrf brnb rb rrbbn bb nbrnb nfnftr r b bfrnb bb nbrnb ntttr b b nrrr b rrf br r rfr rnrrrr brrr rb tfttnfr r frrbrb b rb btrn ttnr nrb rfrfrntrnbrrf rnrrrtrrrrrrr rfrntrtrrnrrfrnr rrrtrrnrtr brrrrtr trr ftff nf b rrbbb b r btrfr brbr brrbb btrrbr trrfrbrb bfrbrf rbbbnbb b bbrr fttnr bb b tbbb bbrrrb bnrr rf bbbb fbrfr trbrbr tfb nr brfrn brfntbb brfrb nrbbn bnnrr rbnf bb b tbrb r tt ttfrr brb rrbb bbbrb rfrrr bbnbr bbrb brbbrr nr rr r nrnr b b rfntb rrt ttb trr b b rr frnr tbbbt

PAGE 18

rffn rfrnt btn r rnnr rrt nrn rrr r nr rn t r nrr n t r rrnt rn r r n rft n rnr rr rrnnr n t rrr fr t ntbbn n rbrn t n nnr rfn nnnnn br n r rr rn nrr brr rn r nfn r r r rr rn nr r r tn rnrnr rrrnr r nrnnn rnrn rnt r nrn rn nrr rn nr r rt trnn nnnnrrtrrn nr rn r rr rn nrrr rr tn rrft t r n rr nnr r r nrr rnr rrrn nrr nrn rrr trr r nnfnrr r brn t n nnr rfrn fnrnrt rfrn r r rfrn fnrn rtr rrn rfrn r rr n rrrr rnrrnt rn b r n nrr rfrn rrt nrf r nrr n t r rrnt rn r bf rrbrrf rt nnrn r nrr n t r nn nn rt rnrn nr r rrfn t t r r r nn nnnr n t r r r n n nr nn r t rnr tn nrrr nr rrn rtnnn n rrnr n nr rnn n nnnrr nt n nrnnf tnrn nnnn rrnn nntn nr n rb r rn nr r tn rnrnn rrnn tnfn rnnn rrf nn rn nrrnr b rfrn t rn rrnn nnnr rrtnnr nnnrn rnnrn r frnrr r rf ntbr fffftbr b rr bb f bbrfnf r bt b bnb bn rb bb tbf b t bfb tb bnb bb f rffntb f ff bt b nr r b brntbfbf ff br f r n tbftr rtrrfr fbnb rfff tr rr fn fn rff tbr ntbrb nnb rrb ntb rbfr rrbr nbb tnt rb rrfn f rftfb bff nnn rb tb rfn rff tn ffnb fb bf f fbf fftt nf nrn f nb tbt t brbb b f r b fff bb bt b bt fff t tb t bff tn ffn rf br rfnttb rrfn tbf ttnrf rrrfrnfrtb rf nf tt tfb t r frntfbtr nfr btt frbbnb bftfn bbbnrbttb bbfrtb fb rbbn nbb nntn b nbbf n nrbf nffbf brn rbnntnfr f rfrnrntbbfrrf rrfnbnrbtrf rfn tfb r tfbrb rfrftnrr rf rfrrrf The Power of One presentsAn [vening w> \VtndDancerfooor1 )Tj-13.41 -0.917 Td( )Tj-0.1587 Tc 7.9048 0 0 6 19.4535 205.1748 Tm( )Tj-0.1587 Tc 7.9048 0 0 6 19.4535 199.675 Tm( )Tj-0.136 Tc 7.9048 0 0 7 19.4535 193.6752 Tm( )Tj-13.41 -0.786 Td( )Tj/TT0 1 Tf-0.1395 Tc 7.7209 0 0 6 19.4535 78.6787 Tm( I1)Tj14.642 0 Td[(-)]TJ-0.1587 Tc 7.9048 0 0 6 19.4535 55.1794 Tm( )Tj-13.41 -0.917 Td( )Tj-13.41 -1 Td( )Tj-13.41 -0.917 Td( )Tj-13.41 -1 Td( )Tj-0.1587 Tc 7.9048 0 0 6 19.4535 26.6803 Tm( )Tj-0.1667 Tc 13.8333 0 0 10 164.3899 145.6766 Tm()TjEMC ET

PAGE 19

rff n rf ntbtttt t t f ttbt tt r f tbb bbtt bt tfntbb nnb t t tt bt tnt ff b bt tb b nttt tbb tt tt bt t ft ttbt btt ttb ntt r t tt t ttbnt rf tt ttt tnnbtnrff bt ttbb frfrf rf bt tt tnntrf rb t ttt tt t bttt tt ttt b r rfn tntnrttn ft fbrf nnr tr nr ft n ttttt frt ntt fnn nn nnrtr nbr rr r rfntn nnn r nnnr tnr nt r ntn tb fnn n t tntf r f ttt nnf tbf fn nn rr nrnt f r tt fn rfntbfrf nnbfb nn ftrn nn t n n n f n f ttt nnbn n frtn n nr ttntn nn n f rn tf f nn nt t b r nf tnn nr t t n nrnb nr n r f nntn r n rfn rfntrbftrffftfrrfttftrftfrf ftftftftfrtftfbtttb rftfbfrfffrbbfbb fttrrffbfttrt ftftb trftfr ftfrrf t tftrf btrftr f fftf rrf ttftr ftf t tft fbb rffbfttrtftfbf rrfttfbtfttrrftfb ftffftffrf ftfffftftb rffntb rr r f f rrrrrrr ntrr bnrfnnrrrrf nfnr fnf n rfnfnfnff rff ntbn rrfr ntrbr rn rtt f nrb tntrntt ttrtrn tr frnr trt rrfrr fr rtfrr nrt rnr rtrn rfntb rfnn ftnb ffrt nffntnb r fnnrtbttrn fnt brt btnnfnnfttrfntbb rtbftbbftrfntft rfntnbrf ttbrnbrrbbrrft i mmmommomiter,` M.4. ras)-152()]TJ/TT2 1 Tf0.0352 Tc 31.9754 0 0 32 492.7161 497.1462 Tm[(tom g3 'Bella Vita HORIZON BAYIndependent & Assisted Living

PAGE 20

rr f ntb rrr bt rf ntb rf bftt ntnt fn bfttt nrn rfnt rf rrn rtnb tnb b nb r rn b rb n tn b rr r b rnb b tn b r r t tn tn rb r tnr rr b r tnbn ntn b r r b nb nb rnb rrn brb rn n rb nr n n rrrrn b n r rrn rr n n n r t n b n n tn r n r n r r r ff r bnb rr r b nn nbn n br r f f rr r rrr n r nr n n n rn r b n n rr r nbn tn n t rrff rfntfbbbfb b ff ntfb bffrf rbbnf bfrbbf ntf ffrb fbnntbn b b n nbr rn nrb n rr rr n r bb r nb n b r rrrn rb r r nrrr nn n br nr n br n rnrr r n rn rnb n r br r rrrr r r b rrb r nr rb rrn n nrr rnb nr nrfbrr rf rffn tb ffff fff rfntbf ff f fn rfrntbr fntntbnr tr nrrtr bfntb ttttrbftrtnt ntf tbnt rnnrtnnr nt bbnnrtbfn rnrrn bbrftbfff btt nnrtbtrttrr trt ntr ff ntbtntbnttttn trrtftr trtt nnt rf ntb

PAGE 21

rff n rrfnt ff bb f rf bff n r rt rbbr fr nn b b n t r rn ff rbbr f t fr bfr r b n rt f ft nn bfr b bbr br br rnf rr fbb bb rb n ntnf bb f f n ff r bf t bf bbb nbn r bfr bbn n tff br rr f nb rn r nrb b ffrr bn rf nrr nn bb b f b tn ntn r n bbn ff bnf n r ff b bf f r n f ff ntr f fb bf f bbnn fn nf n nrtn r b tn n b r br tnt r rt tnff rbb fr ft br bf rr n n nbb fr f rfnn rn ff r nn b fbr fn bb brf nff bb fb rr bb t bn bbn r fb b r r bn r fb bf n nf f t fnb b n rrf n ff b f tnt b btt bbn bbn ftr fn bb b bt bt f fnf nt n ntf bb nb fbb btt nbn n f f n rrn nb nrb n bn bbt f f bt tt fb bb b bf nb f b bfb f n nb bn rf f ntb n nb tf rr bb bf r f bfn bbn b t b nb n bbn n b f bn ff bbbb rn bnrf nf fnn fbfb bn nb r b f nff b ntn rn rt nfb f nff bfb nn n rn b nt rf ntbrff ntnt t t rf rf r fffnntbfbb tffbbf r fntrntb t n fb t f f r t tt n f nt rn f t t t t t n n t tn rt t n n n fn n t n fn t t r rfntfb bnr rfffntbt rf rrrfntbrnf tfnnnntbbtf f F 7I II I II. JVENICE REGIONAL,MEDICAL CENTERThe best healthcare under the sun.Idiamonds : goldMurphy Beds, Custom Closets, PantriesHome Offices, Garages & Laundry Roomsmores laceSarasota: 7418 South Tamiami Trail 9270807Bmdetore 1847 Lakewood Ranch Blvd 53&6574Port Charlotte 1808 Tamian,i Tail 613-2797sales?Mores ace8eds.com www.MoreSpaceP[ace.com=O-El

PAGE 22

rffn rf ffntnbnfn ffnntf nn fnf fnnrf ntbt tn ntbt rf ntfb f t nb t f b r bt rft r tt t rft r rr ttf r r b nt rt t f t nft tf f t t t bt r tbt r t t r f brr f t ft r r r n t r t tf rt r f t fnb t tb tr b trf t ft nft ff t frr b r rf ntbr rrr r r rrr rr r frrrr r rrr rf rn rrrntbnnn tbtnt bnn ttrt r r nr b rrtr bt t t ft brr n rrr t r rr rfrt tr ft rfnttt br tt trbt t tr ttbf trr bbbfrbtff r tfn r trr t rbttf ttr tt r rbtt tf b rt rr tb ttbtt f r tttt bbbfrf ttr tt b t rf r fntnnb t r t rrfntbf btf rfntb t bt btfntbbrrfntbn rfn ntb rfntbr rf ntbfrfrrfntrfb ft fnft rrfnbr fnfrrtrb rfnftbfbrfrfrtr ffftffft rfftrbbtrfffbtf ffffftftfr tfrfbtfrrbfr btffrtff frfbtrftfbrtff rffbffr rfnt b rfntbb HARBORCHASEAssiscc fig, & Ski led NLrsin,Qa_.Si

PAGE 23

rff n rf ntnnb tt b b tr b bb bbtr t tttb tbr ft t rb nttb bn r b n br b rb tn n brf r n tbr t nnn r brrn rn n r bt ft r ft rftb nt bb nnb bn bbt b br bbt rn tt nrt b r tbt t trtn tnt t br bb n trbb nb tn bbr n nt tn b ft brr nn b n r b b btnbn r t tn nr tnnn r t t n r nt t n n r n ntn nn tbn bt br tt nt tbr brr r tb btb rr nt t ntb n ntn nfnn fr rfnt bnnrfnn fnnfffnt fnrfnffnnt fnfnnff ntt fb nttb nttnr brrn r fnn t ntr fntbt nn r tr n n btn tr nnt tnt tnt n b r nbn n brr brt brr fb n bbbn t r n nr bbb nb nbtn btb nt br bbbtt tt bn nntbbn tr n rbrr nnnb tt nnb tb nn bn r b br fn br fnb n tn nbttn n nrnrr fn br nbb ntn tnr ftr b n nr fb nr trr fnn nbtn ntr n nn nrnn nb nr nrn nb b bbnb tt ftrrbrr ttrr brr n nn n rrfnftbnrtf Thousands Rebates and Credits Tax still available!Buy now and also receive a$1,500 Sarasota Get Energy Smart REE 3-year Maintenance Plan.$1,000 Maytag Rebate 0&x$300 Federal Tax Credits$1,510 FP&L RebateUp to$4,310.00 OFFa new system purchase.IIIIIIIIIIIIJIIIIIIIIP'lllll''llllll II NIIIIIIIIIIIIIJllllllllllllllilIIIIIIIIIIIIIIIIIIIIIIIIIIIIIillllllllllllldllli I.IIIIIIIIIIIIIfllllllllllllllllllllllllllllllllllllllllJANaERSON IIIIIIIIIIIIIIII IIIIII1111111111111111111111111111111116Service for Home & Business 111111111111111111111111111111111111111611111111111111111111')Tj/TT3 1 Tf-0.0126 Tc 27.949 0 0 28 291.7798 62.5501 Tm[((94 1 ) 488-9633 Manufactured under license by NORDYNE, O'Fallon. MORegistered Trademark/TM Trademark of Maytag CorporationWWW.AndersonAir.com or its related companies. 2009. All rights reserved.CAC1814718 CFC048275 F:R0014451 CBC1253491 CODE: SUN

PAGE 24

rr frnrrr tbt rfn tb bb rf rfnt brr tr rf f tr r f f r f f r rt r rt r fr rrt r f rrf r t r r f t t f nt brr t rf rr rf t t r f rt f rrr r f rt t r r rt t bfrff t rtr f tb t rbf rt rrf b rf rtf rrfr rfr rrt bt t r ff tbff f bfr r ffbtrft bf rf rffr rt ftt r fftb r rffr t f rt rtt rt fr f r tf ft rr ff b rt rf bttr t f rtb t r ff bf rtr f rf tb tr fft b f nt b rtfr ft r fft t f f r rr r f r trr t rtrr ff fft rt rf r rrf rrf f ff rtfr ftr fr t rf ft r rt ff ffr t r r f f r f r rt bt rr t r t tt t t fn ff ff ffn rtb t tr tr rf rt rt rtrt nrtr bt ff rrt ff f b ff rt f rrf r r t tff tfff tb f r fft ffff b rt ff ff r rt tf f frf t rt rt r r t ff rt bf t frfr f r ff r ff r r rtb fr ff t tr trr bff frr rr rrf rtr f rf t fr ft r fftbft r nt r nfb r t f rr r rr ff f tr f ntbt t r rr r rbt bfft r f f f t rtr tff ffr r rbft rr rf ft b rr ff r ffb bft f r ntt t r r ff rf tr f r ft bt tt ffbf rr f t tb t ff r f rf r tr t rff r t bf rf f rrf fn f ft fft r r rr r t ff ft bftr ffr btr nr rf tbft ffff n f t rf t t r f rr r f rt f f tf tn tff frr r f rf rt f t rf rrr rffntbn rffntbn rffntbn rffntbn rffntbn rffntbn rffntbn rffntbn tbn tbn tbn tbn tbn tbn tbn tbn t tt t t tt t r r r r r r r r r fntbnf r r nr br bnn bnr fntbrnn n rf ntb f r rfrntbr r fr ntbbbbn rtrt rtrt nrnnnrnn nrnnrfnrnnr rfntnbrnr rnrrnrttrrr nnbfrr rfntbr rnrfbfbt r rf fnr r fntnrrb rfr nfrfnfb n rnn bbfr rbrnn nr r rfntrbrrbrffffnbrbrbrffbbbr bb rfntfbtfrtr rnnrb r fntbnnnrrnnrfnt bfn rfntbrbnb bb rf ntbrff fftff rf ntbbtnfrf I II IEm BMW "Venice United Church of Chest-New LifeCOMMUNITY CENTERhome oP 9?ew -46e j4ssemb/y of r?odI IVENICE BIBLECHURCHLoving God, Loving People, Making DisciplesThere's somethingfor every member of the family!SUNDAYS9:00 a.m. Bible Classes10:30 a.m. WorshipCHILDREN YOUTH SMALL GROUPS493-2788www.VeniceBibleChurch.com2393 W. Shamrock Dr. (2 bucks webY of US 41)

PAGE 25

rff n r f n r f f tttttttttttrfnrff rf fn ftb r r fr nfr frt f ff f nfft f rr nt r fn rt nfn nr nn ffrf nt bf n t f rf ntnr fr fn f frnt fn n rr fn frtb frn n fn fr ft rfn tbtt rffntbbbf fnff ntnff rnftrfrntbrbn bnf nn nfr nt bf ffr ff fnnf ff ffff rfrt ft frfn r ff f f tntf tb f t tnttnttnt tntn tbfrfn ft f fn ff tntbft f ffn tff ff r n frnt bff nf ft f ff ff ff fnf r ntbfr r fff ftb f ff f n tntbtt bfrfnft bnf rn r tntbtt bfrfnft tnt bft f tn rfr f fftb frfnft rffnf f f frn ft f tbntrbbn nnn rrn r fn f r fnff tf ft ff t bfn ff f f bn rff ff ff ffr f nn fnft f fr n nff ffn frf tf n nn rff ff nf fntt f fnf fnt fbf tt bf f frf f bft rfntb r f r f r rfrfrrfntbrttn tnn trtnttn r rfntb f n rfntbr nr nr frr rrrfntb rfffrntrbfff bbb rfr rf r ntb rf ffr nrtbb rf ntbrftrf rffrnttbb rfffntbntnnn n rfn tbn bbfn bbbbn n rfnf tbfrrf ntb frbn rfrtnb n bbn V4 )27()]TJ-0.0216 Tc 3.9524 0 0 22 138.9535 443.7989 Tm()Tj-0.0519 Tc 23.7143 0 0 22 146.9535 445.2988 Tm[('.0 0ANNE TII I N THE CLAOSIREDO CALL (91) MUMAUTO DR ECTOIRYAmodam AuW40-ae1 a1i )Tj-0.6428 Tc 35.5714 0 0 4 398.4222 273.6203 Tm(l )Tj-0.1733 Tc 21.58 0 0 3 711.01 763.6873 Tm(f1

PAGE 26

rr frnrr tbt rfntrn bnnnf nn rfnrbnbfrnbnnrnnnbfnn nbnnnnnbnn fbfnntbffnbnnbnr nnnnnbn nnn frbnnnbn nn nbnfn nnnnbnnf nbnrrrnbnn nnnnbrfn nnfrn nbn nrnnnnbn fnbnnnnnnb rfnfbnfr ff ffnbf nnnn nnrnrfrrr fnrbnnbrbnnr bnnrn f nrrfnnnrnbbnrbbnbrrr rrbnbrnfnbfnb nrfnnnnbbnnnnbn n rfnbn rrnbnrnrnb nnbnnf t nbnnfnnf rfntnb nnbnnn n rfntb rrrfnt b n n r nnnt 'Addmmbkhhhh,,O 0 1000 00o00 0ON THE ISLEEVERYDAY'S A NEW DAYJVILLAGE

PAGE 27

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 1 Ends9/26/11. Allpricesandpaymentsinclude$598.50dealerfee,plustax,license,titleandaccqustionfee.Allpreownedwith$5000down72months4.9%APRwithapprovedcredit.*Leasebased on36months12,000milesperyearwith$0downpaymentsubjecttoAHFprogramchanges.Basedon2010EPAmileageestimates,reectingnewEPAfueleconomymethodsbeginningwith2008 models.Useforcomparisonpurposesonly.Donotcomparetomodelsbefore2008.Youractualmileagewillvarydependingonhowyoudriveandmaintainyourvehicle.Allofferswithapprovedcredit. 800-507-1256985S.41BY-PASSEnds9/26/11. Allprices&leasesexcludestax,tag,registrationandtitleandincludedealerfees.Leasesbasedon36month12KMilesyear,$3000down. Prices/DiscountsnetofallFactoryRebates/Incentives&FactoryValuePackagediscounts.*Allpreownedwith$5000down72months4.9%APRwithapprovedcredit.**0%APRonselectmodelsinlieuofrebates,termsmayvary.Allpicturesforillustrativepurposesonly.Allofferswithapprovedcredit. 900S.41BY-PASSTOLL FREE 800-507-1498 CramerHonda .com CramerToyota.com TheBestNewCarsMakeTheBestUsedCars! SHOWROOMHOURS:Mon.-Thurs.9am-8pm Fri.&Sat.9am-6pm SUNDAY11am-5pm PAR TS/SERVICE/BODYMon.-Fri.7:30am-5:30pmSaturday.7:30am-1pm SHOWROOMHOURS:Mon.-Thurs.9am-8pm Fri.&Sat.9am-6pm SUNDAY11am-5pm PAR TS/SERVICE/BODYMon.-Fri.7:15am-6pm Saturday.7:15am-4pm SIGN Drive!& 2WD,AUTOMATIC,A/C, POWERWINDOWS/ LOCKS,CRUISE,KEYLESS, VIN#7645 28 MPGHWY $249/mo.*LEASE FOR SIGN Drive!& 2011 Honda CRVLXOPENSUNDAY11AM-5PMOPENSUNDAY11AM-5PM AUTOMATIC 34 MPGHWY ALLREMAINING2011TOYOTA INSTOCK! CAMRY XLE s 0%APR**VIN#9356 COROLLA LENEW2011TOYOTAAUTO,4CYL, VIN#6899 0%APR** OR $ 99 /mo 39 MPGHWYLEASE FOR $ 4500 OFF MSRP! OR 8527508 $2,000 36 25% Ford 500 SEL Aut o, Fu ll Power, A lloy Wh eels. Leather, Power Seats, Premi um St ereo. $ 6,988 Toyota Venza V6, Fu ll Power, Aloy Wh eels, Local One Owner Trade, Wholes ale Pri ce! $ 21,988 Or $ 259 per mo* Nissan Pathfinder SE 2wd, Aut o, Power Wi ndows, Locks & Mi rrors, A lloy Wh eels. $ SAVE $ $ 12,988 or $ 129 per mo* Toyota RAV4 Limited 34 MPG! Leather, Premi um St ereo, A lloy Wh eels, Li ke New, One Owner. $ 16,988 or $ 189 per mo* Honda Accord LXP Only 4K Mi les! A ll Power, A lloy Wh eels, Li ke New, One Owner Trade. $ 18,988 or $ 229 per mo* Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 Toyota Matrix 36MPG! Aut o, Fu ll Power. Local one owner Trade, only 17K mi les. $ 15,988 or $ 179 per mo* Pontiac Solstice 5 Sp eed, Leather, A ll avai lable options, only 18K mi les. $ 16,988 or $ 189 per mo* Honda Odyssey EX Dual Ai r, Fu ll Power, Local one owner Trade. 42K mi les. Great Fami ly Vehi cle! $ 17,988 or $ 209 per mo* Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 Nissan Versa S Only 42k Mi les! 35 MPG Aut omati c, Ai r, AM/ FM/ CD Af f ordable Versati li ty. $ 11,988 Or $ 109 per mo* 0 Honda Civic LX 36 MPG! Aut o, Fu ll Power, Local One Owner Trade. $ 15,988 or $ 179 per Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 mo* Nissan Murano SL Leather, a ll power, premi um st ereo, a ll servi ce records, below wholes ale! $ 17,988 or $ 209 per mo* Toyota Highlander 4WD V6, Leather, Fu ll Power, A ll Servi ce Records, One Owner $ 8,988 Honda CRV EXL Only 25K Mi les! Leather, Power Sunr oof and Seats, A lloy Wh eels, One Owner Trade $ 19,588 or $ 239 per mo* Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 Buick Century Custom Aut o, Power Wi ndows, Locks And Mi rrors, Great Bui ck Ri de! $ 5,988 Dodge Dakota Crew Cab SLT Only 19K mi les! V6, a ll power, a lloy wh eels, one owner. $ 16,988 or $ 189 per mo* Dodge Caliber SXT 34 MPG! Aut omati c, A ll Power, Af f ordable Versati li ty! $ 12,988 or $ 129 per mo* ALTIMA SEL NISSAN $ 15,990 Auto, air, alloys, leather, loaded. T AHOE LTD CHEVY $ 30,990 Nav., DVD, sunroof, leather. Below book value. GRAND CHEROKEE JEEP $ 7,990 Only 82K miles! 4x4. Auto, air, leather, sunroof. HHR LT CHEVY $ 15,990 Only 38 K Miles! Auto, leather, sunroof, chrome pkg. TUNDRA TOYOTA $ 12,990 Only 47 K Miles! V8, longbed, auto, air. T OYO TA CERTIFIED T ACOMA SR5 TOYOTA $ 20,990 V 6, auto, all power. P riced to sell. SIENNA XLE TOYOTA $ 19,990 Dual air, dual power doors, leather, loaded. RAV4 TOYOTA $ 19,990 Only 18K miles! Auto, air, all power. Factory Warranty CAMRY TOYOTA $ 14,990 Auto, air, all power, priced to sell. T OYO TA CERTIFIED SEDONA LX KIA $ 12,990 Auto, air, leather, loaded. HIGHLANDER HYBRID TOYOTA $ 30,990 Leather, alloys, sunroof, loaded. T OYO TA CERTIFIED VERSA S NISSAN $ 9,990 Auto, air, all power. Priced to sell! AVEO LT CHEVY $ 11,990 Auto, air, AM/FM/CD, 35 MPG. ACCENT GLS HYUNDAI $ 10,990 Auto, air, power pkg., clean BEETLE VW $ 8,990 Auto, air, leather, loaded. 5 SPEED, Jeep Commander LTD Only 33K Mi les! Leat her, Power Seat s, Premi um St ereo, A ll Servi ce Records, Rare Fi nd! $ 16,988 or $ 189 per mo* 0 Honda Fit Sport 35 MPG! Aut o, Fu ll Power, A lloy Wh eels, Loaded! $ 15,988 or $ 179 per mo* Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 Arcadia Englewood North Port Port Charlotte Punta Gorda Venice Classifieds & Automotive TM 866-463-1638 866-949-1426 Fax SP27196 INSIDE THIS CLASSIFIED/AUTO SECTION LOOK FOR: Classifieds: Employment 2000, Notices 3000, Financial 4000, Garage Sales/ Merchandise 6000, Business & Service 5000, Automotive/Boats 7000 Advertising: Automotive, Business & Service Directory, Employment Columnists: Don Royston, Click and Clack 2-Q 11 c RV'LK---------------'ROWwa 1111111+ -r)Tj/TT1 1 Tf-0.3208 Tc 7.6083 0 0 4 727.3603 303.7008 Tm[(19HO DA It if

PAGE 28

The Sun Classified-Section A Page 2E/N/C/VSaturday, September 24, 2011 LowMilesL001T-1A2: Lea ther,Bose, ExtraClean! $ 8,984 LowMilesK182TA: 4x4,DURAMAX Diesel!Fullpower, topper. $ 22,984 2003ChevyMalibuK169T-1A: On eo wner,V6, PowerPack. $ 7,984 2008MercuryGrandMarquisOnly30KMiles2566P: Silver, Exceptional! $ 12,984 2004ChevyImpala 2006PontiacTorrentLowMiles2588P: Cer tied,one owner. $ 12,984 2007GMCYukonSLEOnly37KMiles2553P: 1o wner,Certied, showroomnew. $ 23,984 2006ChevyHHRLTLowMiles2599PA: Cer tied,Leather, Sunroof,all theextras! $ 13,984 2006ChevySilveradoLTOnly56KMilesK010TA: ExtendedCab, leather,loaded. $ 12,984 2009CorvetteConvertible3,200oneadult ownerMilesK244A: Cer tied,still smellsnew! $ 45,984 US41&SR776SouthVenice1-800-448-2825or493-5000 1996ChevyCorvetteOnly33KMiles2424MA: Aut omatic. Red/Black! $ 15,984 2009PontiacVibeK215A: Cer tiedw/ warranty,1owner trade-in!. $ 14,984 2008ChevyCobalt2drOnly10KMiles2451MA1: On eo wner, Cer tied! $ 12,9 84 2005GMCSierra4x4LowMilesK208T-1A2: V8power,sharp truck. $ 14,984 2008DodgeDakotaClubCabOnly33KMiles!2616P: V6,custom wheels,sharp! $ 14,984 NEVERADEALERFEE *SalePriceincludesallincentivesanddiscountsplustaxesandlicensefees.Youmayqualifyforadditionalincentives,pleaseseedealerfordetails.Picturesofnewvehiclesforillustrationpurposesonlyandmaynotbetheactualvehicleoered. 2003ChevySilveradoExtCabLowMilesK214TA: On eo wner trade-in,serviced, immaculate! $ 9,984 www.BillBuckChevrolet.com 1999MazdaMiataMX5 MALIBULS $ 19,990Stk#K066 MSRP $23,749 IMPALALS $ 21,760Stk#K241-1 MSRP $25,709 NOWINSTOCK! BILLBUCKCHEVROLETHAS O VER20NEWEQUINOX TO CHOOSEFROM!Getsupto32mpgHwy FuelEconomy100,000MilePowertrain W arrantyUpto64CubicFeetof CargoVolume!NowStartingat$23,500 orLess!!Stk#K155-1 8527509 Todays column features two unusual convertibles owned by very interesting people. The Presidential B lue 1966 Thunderbird, known as Thelma, is the property of Rotonda W est residents G len and Donna Alton. They gave it that name because its the same year, make and model of the car used in the movie Thelma & Louise that the main characters drove off a cliff. Even though the picture was a B ick, more people, certainly those in the hobby, remember it well. This bird came to Alton as a result of playing golf at the Pinemoor West Golf C ourse near his home. He struck up a conversation with an employee who said he had a T-Bird for sale. They went to the mans home for a looksee, and it was love at rst sight for Glen. S eems it had belonged to the gentleman for about four years. He had liked it enough to have the fancy paint job done in same color as original, however he used it very little afterward. Soon a deal was made and the big bird was in Altons garage. That was 14 months ago. Since then, Thelma has been driven 4,000 miles, bringing the odometer up to 82,000. Along the way there have been many new parts and repairs, totaling over $4,000. Wi th everything xed, shes back in good graces with Mr. and Mrs. Alton. Theyve been in the Rotonda Christmas parade and the recent Pioneer Da ys parade, top-down and smiling, plus several cruise-ins and shows. The soft top is original, so Glen has the boot on almost all the time. Bo th Glen and Donna we re Ca nadians in Markdale, Ontario. His parents own ed a Pontiac/Buick dealership and Glen grew up pumping gas, cleaning new cars and actually sold a brand new Buick at age 12. The business overhead was too high to be protable, and it closed in 1998. Donna, a registered nurse, qualied for a gr een card and the family had a discussion with daughter Gracie Thelma the T-B i rd and Mean Green the F i reb i rd C ARS TODAY AT BATTERIES PLUST he Veteran Motor Car Club of America will exhibit antique autos 10 a.m. to 1 p.m. today at Ba tteries Plus, 1690 Tamiami Trail, Port Charlotte. P erhaps you saw the national advertising in this paper during the w eek. The public is invited to attend. Call 941-639-8448 for information. Collector Car Events Info Larry Day of Lee County has cruise-in and show information from Naples to Sarasota. Email him at lwnkday@aol.com to get his free email newsletter with all the details. Also visit www.Flacarshows.com or www.musclecarcity.net. Call the DJs T ommys Traveling Tunes, 941-240-5799 Lance Cruisin to the Hop, 941-371-1061. You Auto KnowDon Royston SUN PHOTOS BY LEE ROYSTONGlen Alton and his 1966 Presidential Blue Thunderbird, Thelma. Ga ry Mruz and his lime green 1969 Firebird 400 convertible.ROYSTON | 3 LLfZ !\ )18()-11()]TJ-0.1701 Tc 32.2778 0 0 16 390.4695 523.5948 Tm(L!\LLZ f LLNew 201,1 NSW 2011f 6 )Tj-0.0028 Tc 9.2222 0 0 10 463.9695 370.5994 Tm[(SPt PRICE SALt ,'RICEr.,, i =Y)188(_o )142(^ rte.. -6jawlA&M

PAGE 29

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 3 Interior of the T-Bird. Interior of the Firebird. The 400-cubic-inch, 330-horsepower engine of the Firebird.and agreed to get out of the cold by moving to F lorida. They purchased a house three days after arriving here. Donna worked for Bon SecoursS t. Joseph H ospital in Port Charlotte and now is one of the four nursing directors at Englewood Community Hospital. G len became an employee of Crest Cadillac for several years, then moved on to become a sales agent for Coldwell B anker Sunstar Realty in Englewood, where hes been for the past six years. D aughter Gracie attends college in Gainesville. They have dual citizenship in the United States and C anada, but call the USA their home. W atch for Thelma out and about at community and old car events. Glen will be glad to answer any questions about specication and the Birds complete background.Mean GreenThe unique lime green 1969 Firebird 400 series convertible, Mean Green is owned by Gary and Kay Mruz, of Osprey for the past 38 months. Its the latest of 50 yes, 50 P ontiacs Gary has had in the past 30 years, mostly Tr ans Ams, Grand Ams, Fir ebirds and Fieros. Star ting at age 16 he and Miss Kay Kirby, now Mrs. Mruz, were in high school courting in cars of that brand. During college, marriage and becoming parents, the name Po ntiac was a household name. Gary would locate, buy and x them up to earn get ahead money! That was back in Forsyth, central Illinois, where the winters were very cold and snowy. However the employment situation was good, enabling Gary to secure a position with Archer Daniels Midland, a For tune 500 company as In formation Technology Ofcer in Decatur. Now, 28 years later hes still employed by ADM, operating mainly from his home in the Sunshine Sta te after moving south in 2008. Kay is a semi-professional photographer. Their daughter, 24-yearold Beth, lives and works in central Illinois as a computer programmer. Of all Garys Pontiacs, Fir ebirds are his favorite. The one featured today was purchased three years ago over the Internet from a dealer in Ohio. This couple also owns a white-with-blue-stripes 1969 Firebird under r estoration. You can meet the Mruzes alongside the gleaming convertible at antique car events in Charlotte and Sarasota counties. On Nov. 12, one of these Birds will be on display at the Sun Newspapers Fifth Annual Welcome Ba ck Collector Car Show and Open House. Look for more details regarding this affair in the near future! Some specications are: Basi c cost new, $3,045 plus A/C, power brakes and steering; production, 11,649; wheelbase, 108 inches; weight (basic) 3,330 pounds; engine 400 cubic inches, 330 horsepower; AT Turb o; rear, Posi Trac. Tip of the WeekK eeping tires fully inated will give you up to two more miles per gallon. Don Ro yston is president and co-founder of the Veteran Motor Car Club of America SW Florida Region. Call 941-5750202 or email leekr42@ embarqmail.com.ROYSTONFROM PAGE 1 Dear Tom and Ray: I live in a gated community with lots of speed bumps to deter speeding. I am always amazed at the ingenious techniques people use when they go over speed bumps. There is the one-wheel technique, the diagonal technique and, of course, the oldman (3 mph) technique. I prefer the straight-onat-20-mph technique. Which way is best for y our car? Frank Tom: W ell, the straighton-at-20-mph technique is best for US, Frank. We sell a lot of suspension parts that way. Ray: B ut whats best for the car? No question about it: The old-man (3 mph) technique. In fact, we r e going to rename that approach the genius technique. Tom: When you hit bumps hard, like you do, Frank, you jolt every part of the suspension system. Its like whacking every part in the car with a hammer. And even though cars are built to take a certain amount of punishment, the more they take and the harder they take it, the sooner their parts wear out. Ray: And what happens to older cars that have taken more than their share of hard knocks like that? They tend to squeak and rattle and chatter their way down the road, dropping occasional parts along the way (see also: any of my brothers heaps). Tom: Whereas using the genius technique and going over a bump like that at 3 mph does practically no damage. The springs and shocks compress gently and absorb the bump, and then they decompress. Ray: And theres certainly nothing wrong with staying to the right and avoiding the speed bump with your rightside wheels, as long as you combine it with the genius 3 mph approach. Tom: And as long as you dont drive too far to the right, jump the curb and run over someones prized tulips. Ray: The same is true for the diagonal approach. It cant hurt, as long as youre going very slowly. Tom: And besides, when you go 20 mph ov er speed bumps, yo u re defeating their whole purpose to stop knuckleheads from driving too fast in a pedestrian-heavy area. Theyre slowing you down for a re ason so that kids and older folks and everyone else who walks or crosses the street is safer. Ray: So because of the damage you can do to y our car, and to innocent pedestrians, were renaming the straight-on-at-20mph approach the moro n approach, Frank. So well leave it up to you to decide which technique y ou want to be associated with from now on.Whats the real story with timing-belt claim?D ear Tom and Ray: Abo ut a year ago, I had the timing belt replaced on my 2003 Subaru O utback. Then, last week, I had the head gasket replaced at a different shop. When they replaced the head gasket, they looked at my timing belt and said I needed a new one! The re ason was because they could not see any writing on the belt, and they said if it was replaced last year there would still be writing visible, as it takes 40,000-50,000 miles to wear th e writing off a belt, even an aftermarket one. So, now I am wondering, Did they really replace my timing belt last year, or did they rip me off? Jim Ray: Ive heard of seeing the writing on the wall, but seeing the writing on the timing belt is not as well-known a phrase for good re ason, Jim. Its not a reliable indicator. Tom: We v e seen belts with different amounts of writing on them. The factory belts often have white marks that line up with the timing marks on the cylinder heads and cam sprockets. But not all aftermarket belts do. So me have just the part number written on the belt, and thats it. Ray: So, its possible that the rst mechanic used an aftermarket timing belt that had very little writing on it. And it may have worn off after just a year. Tom: Weve never studied the wear patterns in the writing on timing belts and how they corr espond with mileage in an Subaru. But well put the next graduatestudent intern at the garage right on it. Ray: So now there are three possibilities: One, the original guys didnt change your timing belt and ripped you off. Two, the original guys changed the timing belt, and the second guys made an honest mistake because they think all timing belts have long-lasting writing on them. Or three, the second guys ripped you of f, which you hadnt considered yet. Tom: Lets say the second guys tried to pad their bill by selling you a timing belt, and you surprised them by saying: Whadda ya mean? I just had it replaced! Then maybe they did a song and dance with this whole writing thing, even though they knew better. Ray: Heres o ne clue: When the second guys r eplaced your timing belt, did they charge you just for the part, or did they charge you for labor, too? Tom: He re s why we ask. When you replace a head gasket, you have to remove and replace the timing belt anyway. So theres no additional labor re quired to change it. If theyre honest guys, they would have told you that yo u needed a new timing belt and it would just cost yo u $75 for the part. Ra y: On the other hand, if they tried to charge you an additional $300 in labor which is what it would cost if the timing belt were not ALREADY off then that would suggest that theyre ripoff artists, and it would lead us to question their credibility about everything. Tom: And it would lead us to study their methods to see if we could learn anything useful! Good luck, Jim. Dont get stuck with a lemon. Be an informed shopper. Read Tom and Rays guide How to Buy a Great Used Ca r: S ecrets Only Your M echanic Knows. Send $4.75 (check or money order) to Used Car, P.O. Bo x 536475, Orlando, FL 32853-6475. G et more Click and Clack in their new book, A sk Click and Clack: Answers from Car Talk. Got a question about cars? Wri te to Click and Clack in care of this newspaper, or email them by visiting the Car Talk website at www.cartalk.com.Slow i s best for speed bumps CLICK and CLACKTALK CARSby Tom & Ray Magliotht'i rte,14)33(i;i'Mid

PAGE 30

The Sun Classified-Section A Page 4E/N/C/VSaturday, September 24, 2011 RESTAURANT/ HOTEL2040 SERVER, PART TIME, golf course server, days & evenings, flex hrs, Apply in person The Palms at Rotonda Golf & Country Club on Tues, Wed, Fri, or Sat. Ask for Cathy. SKILLED TRADES2050 A/C TECH, for maintenance and installs experienced and clean DL required, Franks Htg. & Clg. 941-484-0058 AUTO TECH NEEDED Must have some Certs. Current or expired. Apply in person to: Gene Gorman Tire & Auto Repair 4396 Tamiami Trl., P.C. (941)-629-TIRE (8473) ELECTRICIANS AND ELECTRICIAN HELPERS with Commercial experience needed. Please call Jenny (941)-429-4900 MAINTENANCE MECHANIC, Min 5 yr exp. Electrical, welding & gen mechanical knowledge Ability to speak, read & write English. Fax resume to 239-332-3514 EEO/DFWP MARINE TECHNICIAN Palm Island Marina Service Dept. is taking applications for a Technician who will compliment our team. Neat, organized, with own tools & knowledge of outboard, stern drive & inboard engines & various plumbing & electrical systems. Certification is not required but would be a plus. Salary based on knowledge & exp. Contact Bob @ 941697-3778 or fax r esume to 941828-1087 MECHANIC EXPERIENCED Arcadia Business Call for more inform 863-494-2601 RESTAURANT/ HOTEL2040 BARTENDERS/SERVERS needed for busy restaurant experienced and great personality a must. Apply in person 24 Boca Lupo Coal Fired Pizza Murdock Carrousel Plaza, (next to Lowe`s) 941-2351404 FINE DININGrestaurant in Englewood/Pt charlotte area requires SOUS CHEF, SERVERS & BAR PERSON. Send resume & details to Cathybur gess99@gmail.com THE GASPARILLA INN & CLUB We currently have openings within the following areas:Restaurant Counter Help Bakers Pastry Cooks Line Cooks Baristas Dishwashers Overnight Front Desk Porter Grounds Laborer Group Fitness InstructorsFor more details please call 941-964-4570. Resumes can be sent directly via email to smoore@gasparillainn.com or via fax to 941-964-4571 Pre-employment drug test and background check r equired. RESTAURANT/ HOTEL2040 A+ BARTENDER & POKER DEALER TRAININGAges 18+ 1+ week programsJob Assistance 24 Years in SW Florida Day, Eve & Saturday classes $35/week Payment Plans(941) 564-9633 All Restuarant Positions Now Hiring, plus laundry and cleaning crew apply in person 1601 Englewood Rd. GENERAL MANAGERSmall busy Keys style Bar & Grill. Must have marketing and promotion knowledge PLUS willingness to learn and grow. Take charge personality a must. Port Charlotte area. Please Send Resume to: NGM PO BOX 511223 PUNTA GORDA, FL 33951 A Bargain Hunters Delight Check the Classifieds first! A Whole Marketplace of shopping is right at your fingertips! Call The Sun Classifieds T oday! From Venice, Englewood, North Port Areas Call 941-207-1200From Pt. Charlotte Areas Call 941-206-1200 NEEDCASH? MEDICAL2030 Www.HorizonTechInstitute.ComADVANCEYOURCAREER Licensed & Accredited School Corner of 41 & Toledo Blade YOUcan become a MEDICAL ASSISTANT in just 8-10 months CLASSES START Nov 7 Start Working In 2-5 wks! CLASSES START Oct 3r d & Oct 24 Nursing Assistant (120hrs) Home Health Aide (75hrs) Phlebotomy Tech (165hrs) EKG Tech (165hrs) Patient Care Tech (600hrs) LPN Board Review ( 200hrs) Job Assist. & Pymt. Plans Call Now to Register!941-889-7506Corner of 41 & Toledo Blade NIGHTCLASSES MEDICAL ASSISTANT Open House every Thurs 9am-7pm MUSICAL2035 Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week NEEDAJOB? CHECKTHE CLASSIFIEDS! MEDICAL2030 Billing Manager for Internal Medical Cardiology Practice. Exp. only need apply, please send your resume to 941-629-1737 BECOME A CNA $250. HHA, MED TECH, CPR & CNA CLASSES. 941-255-0675 www.bestchancecpr.com CNAS, HHAS. WORK NOW! FT/PT in-home care. Exp required. Top Pay! (941)-257-4452 PUTCLASSIFIEDS TOWORK FORYOU! FIND A JOB! BUY A HOME! BUY A CAR! DeSoto Health & Rehab has the following job opportunities available: LPNs CNAs PT or PTA PRN Fax resume to (863)-4949470 For questions call: (863)-494-5766 EXPERIENCED CNA/HHAs Needed for immediate placement in V enice, Englewood, Port Charlotte, Punta Gorda & Arcadia, Competitive Wages. Health plan & 401K available. Call today, work tomorrow Call Mon. Fri., 8am-4pm. 941-764-0880 or 941-480-0880 ALL STAT HOME HEALTH Licensed Echo TechPlease fax resume and salary r equirements to 941-629-1737 LPNMon. Fri. Busy Family Practice Office Seeking FT LPN. 2+ Years Experience in Family Practice Required. Must be Able to Multi-task in a Busy Medical Office. Fax Resume to Dr. Shell: 941-7433313 LPN/CNA/MA FTMon-Fri. Looking for self starter, team player, multi-tasking professional w/ cardiology experience. Great benefits. EOE/DFWP/smoke free. Email resume to doctorsoffice1@yahoo.com Massage Therapist for busy PT patient clinic: LMTresume@yahoo.com MEDICAL RECEPTIONIST FT position for busy Physicians office. Experience a must. Fax resume to (941)-624-0941 MEDICAL RECEPTIONIST, MEDICAL RECEPTIONIST. FT position available immediately. Port Charlotte Allergist seeking experienced medical r eceptionist. MEDICAL OFFICE EXPERIENCE IS A MUST! Email CV with salary r equirements to: PORTCHARLOTTEMD@GMAIL.COM. Physical Therapist/Assistant P/T for Busy PT Clinic Send Resume to PTAresume@yahoo.com RNS HOME Health, Medicare Home Health Agency hiring PRN RNs for the Charlotte/Sarasota area. Competitive Pay & 401K. 941-244-2590 ST HOME Health, Medicare Agency hiring PRN STs for the Charlotte/Sarasota areas. Must have 1 yr exp. Competitive Salary & 401K 941-244-2590 ULTRASOUND TECH Part Time. Experienced only, Days, no W/E or holidays. Fax r esume to 941-629-1737 2000EMPLOYMENT EMPLOYMENT 2005 Services 2010 Professional 2015 Banking 2020 Clerical 2025 Computer 2030 Medical 2035 Musical 2040 Restaurant/Hotel2050 SkilledTrades 2060 Management 2070 Sales 2090 Child/Adult Care Needed 2100 General 2110 Part-time/ Temp 2115 Home Based Business 2120 Seeking Employment PROFESSIONAL2010 ADMIN ASST, Must have Series 65 and get life ins. lic. Fax resume: -888-453-0089 ASKUS HOW you can place a PICTURE of your item for sale in your classified ad! BARBER, experience, needed immed. in busy Pt. Charlotte shop 941-457-9348 HAIR DRESSER/STYLIST NEEDED, APPLY ALL IN ONE HAIR, CALL: 941-637-3839 CLERICAL/OFFICE2020 HR PERSON Home Health agency seeking outgoing HR person. Must have exp. in HRexp. w/ Medicare HH a plus. Must be able to multi task and work independently with a positive attitude. Competitive salary and 401k. 941-244-2590 MEDICAL2030 CERTIFIED NURSING ASSISTANTS FULL TIME / PART TIME ALL SHIFTSTired of being just a number at HARBORCHASE we care about our employees as much as our residents. ****************** ****************** HarborChase offers competitive wages and an excellent benefits package such as Medical, Dental, Vision & 401K Part-time team members receive benefits at 20+ hours. FOR CONSIDERATION PLEASE APPLY IN PERSON TO:HARBORCHASE OF VENICE ASSISTED LIVING AND SKILLED NURSING950 PINEBROOK ROAD VENICE, FL 34285 (941) 484-8801 PH (941) 484-3450 FAX EOE M/F/D/V GET RESULTS USE CLASSIFIED! Are your )Tj/TT0 1 Tf-0.0313 Tc 72.6642 0 0 88 272.4832 235.3181 Tm(PAYING FORYou are if you subcribe to the Sun Newspapers.In your Sun Newspaper, you get morelocal, national and world news than you willget from any other newspaper in town.,J y )Tj-0.0819 Tc 30.5789 0 0 9 546.9832 73.823 Tm(lSUN :'(mrrica'. B1 S I (..mmuniiv I)a11V

PAGE 31

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 5 EXERCISE CLASSES3095 400 W Retta Esplanade Saturdays at 9:30am. TA I CHI QIGONG Curves with Zumba Classes Zumba & Yoga Classes Line Dancing and Pilates Silver Sneakers Welcome Open to Public 941-639-8525 for Times. NEEDCASH? GULF COAST ACUPUNCTURE 151 Center Rd. We dnesdays 5:30pm Thursdays 9:00 am Saturdays 8:30am YOGA FOR BEGINNERS Proceeds to V enice Wildlife Center Call Rick or Mary 941-488-1769 KRIY A YOGA MEDIT A TION 1250 Rutledge St. Unity Church of Peace Mondays at 7pm. 941-423-0029 YOGACLASS FREE FREE Hatha Yoga Class Thursdays at 8:30am to New Students with Yoga for Every Age. Instructor Ilse Mindling RYT This class is suitable for those with little or no experience. Proper alignment, movement and breath will be emphasized. Relaxation/meditation is part of every class.Beginners welcome. Punta Gorda Isles Civic Assoc. 2001 Shreeve St. Seehttp://www.yogaforeveryage.comor call 941-204-0095 for more info. Pls. bring your own yoga mat. RELIGION CLASSES3096 BEGINYOURDAYIN DEVOTIONALSTUDY Christ the King Lutheran Church, 23456 Olean Blvd. TUES & FRI 9:00-9:30 am. For more info 941-766-9357 Port Charlotte F AITH LUTHERAN CHURCH 4005 Palm Drive, Punta Gorda Various Days & Times CONFIRMATION/BIBLE STUDY Classes for Youth and Adult 941-639-6309 OTHER CLASSES3097 CONCENTRATIVE MEDITATION with Linda Weser, 7 p.m. every Monday at Unity Church of Peace, 1250 Rutledge Street, off Veterans Boulevard between Orlando Boulevard and Torrington Street, Port Charlotte/North Port line. Free; open to the public. 941-423-8171 or 9416292077 4000FINANCIAL BUSINESS OPPORTUNITIES4010 BLADEZ BARBERSHO P KIOSK FRANCHISE FOR SALE In the PORT CHARLOTT E TOWN MALL. FINANCING AVAILABLE $55K total. John @ 800-851-8160 o r j ohn@bladezbarbershop.com BIBLE STUDY & CHURCHES3065 F AITH BUILDERS A Basic Study to Build your Christian Faith. Call Pastor Parsons at Christ the King Lutheran Church for times. 941-766-9357 Port Charlotte F AITH LUTHERAN CHURCH 4005 Palm Drive, PG Thursdays 7-8pm. Adult information classes Open to anyone interested in becoming a Lutheran or joining the church. 941-639-6309 FIRST BAPTIST CHURCH 278 S. Mango St. Englewood Mondays & Thursdays at 9am. Offering chair exercise classes For more info. Call 941-474-2473 LOST& FOUND3090 FOUND DOG: Found in Burnt Store Meadows area. Call with discription. 941-639-9600 LOST: Barnes & Noble Nook Color. Vicinity of Marion Ave, Punta Gorda. Near Jacks & Thomas Ryan Real Estate. Reward... 941-380-2089 ADVERTISEWITHTHE SUNCLASSIFIEDS $$ REWARD $$Missing English Bulldog1 year old female lost off Biscayne in North Port Estates Tuesday morning, Sept. 14th. Black, white, and pink collar with no tags. Bella is a part of a large family with children and they r eally want her to come home. Please call if you have seen her. 941-2232475 or 941-915-6480 REWARD: FISHING GIRL Statute, please call if you see her, missing from front yard, Gulf Cove area. 941-457-2573 ARTS CLASSES3091 ACRYLICPAINTING T uesdays 1-4pm & Thursdays 9-Noon Call Barb at 941-497-1395 MOSAICS Thursdays 6 9pm Call Rosemary at 941-6977888 PG BOA T CLUB 802 Retta Esplanade. T ues. 8am. WOODCARVING 941-505-4246 941-5754276 DANCE CLASSES3093 BELL Y DANCING Charlotte Cultural Center Saturdays, 11am. 941-276-0935 EDUCATION3094 TM PROGRAM W arm Mineral Springs Every Saturday at 11am LECTURE Reduce stress, Improve health. 3000 NOTICES HAPPYADS3015 Place your Happy Ad for only $8.75 3 lines 1 day. Add a photo for only $10.00! Please call (866)-463-1638 PERSONALS3020 ADORABLE TASHA. Stretch & Relax Therapy 941-497-1307 PUTCLASSIFIEDS TOW ORKFORYOUV enice,Englewood, North Port 2 2 0 0 7 7 1 1 2 2 0 0 0 0Pt.Charlotte Areas Call 2 2 0 0 6 6 1 1 2 2 0 0 0 0 ALEXIS SOOTHING SESSIONS! 941-549-3804 RELAXATION Located in Englewood Call Stormy 941-549-5520 SINGLE LADY hair stylist,44 yrs old looking for man 4260 for relationship. 941-201-9853. SINGLE WOMAN LOOKING FOR SINGLE MAN. 941-6232386 SCHOOLS & INSTRUCTION3060 ED KLOPFER SCHOOLS OF CNA TRAINING-1 wk class $250. Locations: Sarasota, Port Charlotte, Ft. Myers 800-370-1570 FLA CNA.COMCNA $300 HHA $125 CEUs $50. Phlebotomy $300 State testing onsite. 941-822-2290 Heat & Air JOBS Ready to work? 3 week accelerated program. Hands on environment. Nationwide certifications and Local Job Placement Assistance! (877)359-1690. BIBLE STUDY & CHURCHES3065 BIBLE STUDY First Resurrection Call Tom (941)-423-5458 CAL VAR Y BIBLE CHURCH 1936 E. Venice Ave. V enice Friday at 9am. Study features video teachings of noted Bible Scholars on various subjects. For more info. Call Rev. Jones at: 941-485-7070 or visit www.CBCVenice.com COMMUNITY CENTER 4PM 7PM each Wednesday. Christ the King Lutheran Church, 23456 Olean Blvd. PC Open to All Ages. For more info 941-766-9357 GENERAL2100 GROWING RETAIL business needs mgnt. trainee. exp a + Send resume: jnqcr@hotmail.com Medical Billing T rainees Needed! Hospitals & Insurance Companies hiring now! No Experience ? Local training & Job Placement available! HS Diploma or GED & PC needed. 1-888-528-5176 Interested in working 6 weeks four times a year?Nielsen (the TV ratings people) is looking for quality focused individuals to interpert and input TVDiaries fourTV sweeps a year. Basic computer skills. Apply on line at Nielsen.com Search job number: Day shift 1103992Night shift 1103994 Paid training begins Monday October 24th 1080 Knights Trail Nokomis, FL 34275941-488-9658EOE/M/F/D/V TV DIARY EDITOR POSITIONS Day Shift 7:45AM 4:00PM $8.50 Hr. Night Shift 4:30PM-12:45 AM $8.50 Hr. WANTED someone who can build an outdoor brick oven. 941-740-2152 WANTED: RELIABLE, trustworthy lawn care service. Must take pride in your work, willing to get paid at end of month after work is done. Willing to do as customer requests without an attitude problem? If so, please call 423-4252 in North Port. PA RT TIME/ TEMPORARY2110 P ART TIME WEEKEND POSITION CUSTOMER SERVICECHARLOTTE SUNMust be 18 years or older. Reliable, flexible, pleasant personality and ability to handle customer relations. Computer literate a must. W eekends 6AM-1PM plus holidays & vacation coverage Please Apply at: 23170 Harborview Rd. Charlotte Harbor, FL Mon.-Fri. 9AM-4PM only Applicants, please fill out application ATTN: L ynda Toner We will contact you for an interview. No phone calls, please. SCMG is a drug free and nicotine free company Pre-employment testing is required EOE SEEKING EMPLOYMENT2120 DRIVER with Clean CDLA Lic. looking for employment. Call (941)-743-7747 Classified = Sales CHILD/ADULT CARE NEEDED2090 CHILD CARE TEACHER Redeemer Lutheran Child Care in Englewood now hiring a full time teacher. CDA is required. 941-475-2631 Ask for Wendy. T eacher for 3 yr olds. FT, Exp. Call 941-743-0016 or apply at 2733 Tamiami Trail,PC ADVERTISE In The Classifieds! GENERAL2100 29 Serious People to Work From Home using a computer. Up to $1500-$5000 PT/FT Free info www.pticoncepts.com CUSTOMER SERVICE REPRESENTATITIVE (CSR): Good phone etiquette and professional demeanor r equired for high volume call center Computer proficiency in MS Word, Excel & Outlook Data Entry using proprietary software Attention to detail -hour work week, Monday-Friday. Rolling on-call for week end CSR coverage Hourly rate of $10.25 per hour plus incentive. Send r esume only to: hradmin@tricountyair.com No phone calls or office visits please. We are a Drug Free W orkplace. T ri County AC Heating, Inc DANCERS WANTED Emerald City Gentlemans Club $1,000 bonus 941-766-1161 DRIVERS TEAMS: $6,000 T eam Sign-On Bonus when you team drive for Werner Enterprises! Call Now for details! 1-888-567-4856 FLORAL DESIGNER, PT to start, potential FT, min 5 yrs exp. Ref. req. 941-475-3358 GARDEN CENTER Must have exp. PT/FT DFWP 941-662-8733 GENERAL LABOR, Must be able to speak, read & write English. Fax resume to 239332-3514. EEO/DFWP MAINTENANCE full time, knowledge in electrical, plumbing, & carpentry apply M-F 8-12 at: Bird Bay Management Office 606 Bird Bay Dr So., Venice P ART TIME WEEKEND POSITION CUSTOMER SERVICECHARLOTTE SUNMust be 18 years or older. Reliable, flexible, pleasant personality and ability to handle customer relations. Computer literate a must. W eekends 6AM-1PM plus holidays & vacation coverage Please Apply at: 23170 Harborview Rd. Charlotte Harbor, FL Mon.-Fri. 9AM-4PM only Applicants, please fill out application ATTN: L ynda Toner We will contact you for an interview. No phone calls, please. SCMG is a drug free and nicotine free company Pre-employment testing is required EOE SKILLED TRADES2050 PLUMBERSExpd in all phases of NEW CONSTRUCTION and/or remodel. Must be willing to work. F AX RESUME TO 941-488-4693 OR E-MAIL TO josh@babesplumbing.com DFWP EOE Press OperatorSUN COAST PRESS Commercial Print Operation is looking for an experienced web Press Operator to work in the Venice Pressr oom running a color lead on a Goss Community press. Candidates must have at least 3 years experience running a color lead on a Goss Community or Urbanite press. The Sun Coast Press commercial print operation is located in V enice Florida. This position is for the night shift, Monday through Friday, 5:00 pm to 2:00 am. Pre-employment drug testing required. Applications accepted at the V enice Gondolier, 200 E. Venice Ave., V enice. Please put the attention of Mark Wilson, V enice Operations Manager, Sun Coast Press. MANAGEMENT2060 AARONS NOW HIRING Retail Mgr. for Arcadia Store 1735 E. Oak St. Salary + BENETITS, Sundays off, 45hrs. wk. Must pass criminal & drug test, 21 yrs. +, clean MVR. Apply to www aar ons.com/car eers type in Arcadia in keywords and apply or stop by store and apply! SALES2070 Be a Real Estate Agent!Earn $30-$50K 1ST YEAR!Busy Real Estate office is expanding & needs local real estate agent. No exp. nec., leads provided, training avail. Comm. base. Limited Positions. Call Today! 941-915-1297 orcareer@listingservicesdirect.com RV SALES.RV, Auto or Real Estate sales experience preferred but will train the right person. NonSmoker, DFW. Full time, benefits. Excellent income potential. Call Steve Erdman @(941) 966-2182, fax to (941) 966-7421 or jobs@rvworldinc.com SALESposition available for fast growing Plumbing company. Previous sales experience with proven record. Must be well groomed and have a clean driving r ecord. We offer a Competitive compensation package including base salary with commission and benefits. This is a drug free work place. Please call 941-468-2949 SALES PROFESSIONALS NEEDED IMMEDIATELYGreat Pay! 3 Locations! Benefits Available. Gene Gorman`s Auto Sales3305 Tamiami Trail Punta Gorda(941)-639-1601 Illll llliiii iiillllll lIIIII IIIIIIII llllll%fto0*woooo)Tj/TT2 1 Tf0.0736 Tc 23.466 0 0 26 270 950.5072 Tm[(.--------,rte)Tj-0.1875 Tc 17.7857 0 0 8 564.5 634.0169 Tm(,r wv-t"

PAGE 32

The Sun Classified-Section APage 6E/N/C/VSaturday, September 24, 2011 Aluminum BUSINESS & SERVICE DIRECTORYbtntnftbtrtttnrbttrnrrbfInclude Your Business in This Directory. Call 866.463.1638 Edward Ross Construction Services, Inc.No Job Too Big Or Too Small Over 30 Yrs Exp in Venice Area(941) 408-8500Lic#CBC059107 Bobcat Services Bobcat Services Air Conditioning Bush Hog & Lot MulchingLicensed & Insured 941-697-3116 or 802-417-7650 by Fred Immaculate Cleaning Service, LLC 941-879-2348Lic./Bondedbtn fbrfbtn rrn nfFree Estimates AIRBOATRIDESONTHEPEACERIVERNAV-A-GATOR 941-627-3474 $5 OFF w/ad W ith Capt. Kirk P eace River Wilderness Eco-Tours Guided Fishing Trips Museum & Gift Shops Cozy Cottage Rentals Boat Slip, Canoe & Kayak Rentals 941-627-FISH (3474)HOME OF THE BIG FISH Vot ed #1 T rop RockVenue in the U.S. 3 Years in a Row! www .Nav-A-Gator.com info@Nav-A-Gator.com 9700 SW Riverview Circle Lake Suzy, FL 34269 Additions Builders ONSITECOMPUTER SERVICES Virus, Spyw are Removal Data Back-Up & Recovery Wired/Wireless Networking Aordable Rates WeComeToYour HomeorBusiness! www .fastteks.com 941-484-1511 Certif iedTechnicians New Clients Receive$25 OFF btn ftbrCOMPUTER & LAPTOP REPAIR COMPUTERS S D Jbtbnf Certi ed941.764.34002270-F Tamiami Tr., P.C. Free Estimates Lic. / Ins941-626-0622 A-STAR CLEANING SERVICESM ove-Ins M ove-Outs We ekly, Bi-Weekly, Monthly HOME & OFFICE CLEANINGSeniorcaregiver & organizerbtnftrttt ttntnt ftnfnt ftn! tn nffrfnbf941-421-9232 Information Rogers Auto ElectricSpecializingin ElectricalProblemsHomeofthe $25ACCharge941-916-9098btntfr tnfrbtn Lic# MV82675 Beths Sparkling Cleaning Call for Summer Specials! 941-993-4375Residential Of ce ttnft Professional Reasonable Rates Prompt Thorough D riveways Pavers Sidewalks U tilityPads Culverts BobcatServices V egetationGrinding/ Mulching Bush Hog Computers Computers Call 429-3110 Electrify Your Service Business! Blinds/Wiindow Treatments Concrete Alleviate Debt Cleaning Cleaning Cleaning Cleaning Aluminum Im Cleaning Up!withmyadinthe Business & Service Directory YouCanT oo! CallToday toreserve yourspace 941-429-3110 "#tnt$n t%tfnnft Registered or Certi e d. &tnft#t'(tft )tf*##tntbn+ !"##t,tn my oridalicense.com Place Your Ad Here! Call 429-3110 Your Ad Here BILL JACOBSEN ENTERPRISESNoJobTooBigorSmall941-391-0694Driveways Pavers Sidewalks UtilityPads Culverts BobcatServicesPou-Jac, Inc. 0010641 New Home Construction Additions Remodeling Detached Garages Window & Door ReplacementLic. & Ins. CBC1258602btnnfrfbt $rt rtr%t ft And Inspection&rt'trt Go GREEN!("# Sr. Discount &bt# ) *Over 30 Years ExperienceGARY DRAKE Insured Your Ad Here Attractions Auto Air Cond Concrete SCHULTE CONCRETE J.D. Schulte 941-493-1803 Cell 941-416-3092b !b"#$%n&# tft#$ttb %"#rbtn 't(t)tt*bbb Your Ad Here Construction Contractor Curbing Dog Grooming Dryer Vent Cleaning KUSTOMIZED KURBINGWeCanT ossYourRocksDecorativeRocks Starting @ $29.99Limited Supply We install941-623-6192Lic./11-00002010/Ins AC/DC+,-.'%,,.','FREE $39941-716-1476tfbfn&-bb!/+n01 bDuring Reg. Bus. Hours 941-544-3256 Cell 941-486-9104 PhonetffPoolCages ScreenedEnclosures FrontEntries CustomScreenDoors 6SeamlessGutter Soft&FaciaFacelift bttnfrOutsideSales Commercial Residential Aluminum of Venice, Inc. Appliance Repair Affordable, Honest 2 4/7 Same Day Appliance RepairAdvanced Appliance Repair 941-412-6783fbnbn 20% OFFLic. 990010102590/Ins Pawprints* individual appointments *s pecializingintoybreedsandsmalldogs 17 years ExperienceVanda lia Avenue North Port, FL 34286dog grooming(941) 257-8463 8528965 SUN-NiEL-Ill' LSPERSIlk-R&L Building Contractor, Inc. Money Problems941-743-8858 Got You FeelingGeneral Contracting ` OverwhelmedROOM ADDITIONS GARAGES h 1 and All Alone?CONCRETE DECKS -CARPORTS POOL CAGES Don't go it alone!LANAIS -ACCORDION SHUTTERS Non-profit agency can help!STORM PROTECTIONS CONSUMER DEBT COUNSELORSFREE, CONFIDENTIAL andQuality Work Competitive Pricing NON-JUDGEMENTALReferences CONSULTATION941-255-3236 or 800-801-3325C: 1254660 L www.debtreduction.org )Tj/TT1 1 Tf-0.5682 Tc 56.5909 0 0 6 63.4695 707.9323 Tm(' Pool Cages ScreenLanais Acrylic RoomsScreen Entries Rescreens Garage ScreensHandrail Hurricane Shutters Window Replacement $sILawn= )]TJ/TT2 1 Tf-0.0964 Tc 17.1413 0 0 15 45.4695 556.4369 Tm(HORIZONTALS HALL'S TRUCKING B'JACOBSEN Specializing i,r:I TO & BOBCAT SERVICES ENTERPRISES Additions Kitchens & BathsConcrete Removal Remodeling Interior Trim WorkStone Washed Shell Custom Hones BURNFill Dirt Mulch LeVasseurShell Driveway Installed Building & Remodeling. Ince cal Bli (115 1 it Yo ait Inc M ch ore! Small Tree & Brush Removal eeStave LeVae ur, {'residentS tt rs, h es BI id To T a e is D aperies Commercial & Residential Clean-Ups For i your conetr.,ction natl., cell e todayReasonable Rates & Reliable Service 941-698-9045t p n ft o s ur S o% r (941) 485-5717 No Job TooBigorSma11 www,levasseurbuildinq.com AS)]TJ-0.0449 Tc 7.4487 0 0 6 39.4695 441.9404 Tm(2 Ta i mi l ) 444 )Tj0 0.502 0 rg/TT2 1 Tf0.0504 Tc 11.5814 0 0 8 145.4695 441.9404 Tm(62, 1P rt h rl tt w s lu b n s.com Cell (941) 716-3650 941-391-0694POU-Jac, Inc. 0010641 7.71tc t.urwt a ir,enrodr -1 1I I 1 1[LI)Tj/TT3 1 Tf-0.0595 Tc 4.9405 0 0 10 208.9695 334.9437 Tm( 9 1 11 11 11 11 1 ttA & Sdkd ft1 1 "I-4804M1 1 Fast vteks m1 1 .,xe=, x. H
PAGE 33

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 7 Landscaping Landscape/Lawn Landscape/Lawn Furniture Restoration Grab Bars Handyman Hauling BUSINESS & SERVICE DIRECTORYbtnbfrfbnbtrbfbrbnrbbbtfrttrbbrrtnInclude Your Business in This Directory. Call 866.463.1638 Im Cleaning Up! 941-429-3110with my ad in the Business & Service Directory You Ca n Too! Call Today to reserve your space btnt fr btt fr btfPalmer Builders Inc.( 941 ) 474-1473Licensed/Insured CBC054517 Hauling Construction Clean-Out Garage Clean-Out Yard Clean-Up Garbage Clean-Up Free Estimates! Same Day Service! 24 Hours a Day!No Job Too Large or Too Small!t941-764-0982 941-883-1231 Home Improvement 941-780-3346grabbarguy.com Licensed & Insured HANDYMAN941-539-1694 PalmTreeLandscaping,Inc PalmTreeLandscaping,Inc 9 4 1 5 8 5 2 3 0 1 o r 2 3 9 2 2 2 5 1 2 7 9 4 1 5 8 5 2 3 0 1 o r 2 3 9 2 2 2 5 1 2 7 941-585-2301or239-222-5127 1 2 5 9 4 T a m i a m i T r a i l P u n t a G o r d a 1 2 5 9 4 T a m i a m i T r a i l P u n t a G o r d a 12594TamiamiTrail,PuntaGorda L i c + I n c F r e e E s t i m a t e s L i c + I n c F r e e E s t i m a t e s Lic+Inc.-FreeEstimates W h o l e s a l e & W h o l e s a l e & Wholesale& R e t a i l R e t a i l Retail S p e c i a l i s t i n S p e c i a l i s t i n Specia listin C o l d H a r d y C o l d H a r d y Cold, Hardy P a l m T r e e s P a l m T r e e s Palm Tr ees S y l v e s t e r S y l v e s t e r Sylvester P i n e a p p l e P i n e a p p l e Pineapple Q u e e n Q u e e n Queen F o x t a i l F o x t a i l Foxtail R o y a l R o y a l RoyalPalms: Palms: C h r i s t m a s C h r i s t m a s Christmas P y g m y P y g m y Pygmy C o c o n u t C o c o n u t Coconut F r u i t T r e e s F r u i t T r e e s FruitTrees Landscaping & Lawn Lawn Care btnfr btntfff *Re nishing* Repair *On-Site Touch Up *Antiques rbtn nftrtb nfnbnnbf n Ga tor Building & Design, Inc.btrrC ell: 941-916-5526Military Discount Free EstimatesNo Job Too Small! R esidential & CommercialR emodeling Additions Kitchen &Bat hsLicensed&Insured License#CBC1254945 Refere nces Available PressureWashing WindowsCarpets ANDMORE! My Friend Handyman ServiceLic./ Bonded tttt t !tt"941-321-4348 Lawn Care Lawn/Garden/Trees Kitchen & Baths btnfrttfttttn !" #$"$%%& !"&' "!$$#B ushHogging B rushMowing T ree,Lot&Vegetation Mulching T ree,StumpRemoval S electiveClearingLic. & Ins. Hoops Lawn Servicet#t $t!rLawn Cutting Weeding Trim ming Mulching Sod Palms Landscaping 941-258-8175Res./Com. Lic./Ins. 941-426-7844btnfrtr r rt rtf!""#n$bn%!$ Venice Englewood North Port Pt. Charlotte Rotonda Gulf Cove bt Mowing Mulch Stone Design Installation Trees Shrubs Great Equipment Great Work Ethic Satis ed CustomersLic. Ins. btnt frfbtbbt tb CALL TIM ( 941 ) 492-517116YEARSEXPERIENCE LICENSED&INSURED TJ MILAZO SR. 941-475-0058 LAWN CUTTING MOST LAWNS $20 $25 TRIM BUSHES PLANT DESIGN WEEDING & MULCHINGServing Englewood, Cape Haze Rotonda, S. Venice and North PortPROMPT, DEPENDABLE SERVICE 45 YEARS EXPERIENCE LIC. & INSURED (941) 255-3834 STEVENSCUSTOM PAINTINGFREEESTIMATESReferencesAvailableResidential,Commercial InteriorsandExteriorsQUALITYWORK AFFORDABLEPRICESFreePressureWashingwith ext.painting.26yrs.exp.Lic#10-00007724&Insured 1/2 PRICE HAULING & TREE SERVICE805-252-3452MovingLarge&SmallJobsFurniture,Appliance& ConstructionRemoval Demolition DeliveryService!tt %!!t&t 't( Licensed&Insured Gutter Cleaning/Handyman Handyman Handyman Handyman Handyman btntfr btf b trb t ttrt ftftt 941-223-7186 Full service lawn and landscape company on Venicesince1992 Burtons Lawn and Landscape HAUL AWAY POSSIBLY FREE(941) 268-0796 Aluminum Appliances Bicycles Hot Water Heaters Scrap Metal Any Others Free Estimates TW O MEN AND A TRUCK U .S. DOT No. 1915800 F ully Licensed and InsuredMovers Who Care 359-1904We sell boxes! MOVING HELPSave $PackingLoading DrivingJIM 223-687030 Years Exp. Itsyour move... LetstalkJFRich1@comcast.net Handyman Handyman Cutters (Masonry JR MASONRY & TILESTUCCO,CONCRETE, BRICK,BLOCK,STONE PRESSUREWASHING VETERANSANDSENIOR DISCOUNTSNoJobTooSmallYOUR REPAIR RESTORATION SPECIALIST(941) 716-0872 Moving ( Movers ( Moving & Hauling ( Painting ) (Mold "!& Testing Inspection Complete Build Back Wat er Damage Odor Removal Pressure Washing for House, Boat, RV, Business 941-244-0319 Vete rans Mold Services f'()((*+ Ken Violette, Inc. 941-240-6699 6 Seamless Gutters CALL FOR A FREE ESTIMATE Lic.&FullyInsured 941-525-7967 941-493-6736 James M. Okell%%,%% Remodel & Finish Work Cabinet, Door, Window & "!""! Full Handyman Services%$ft-../f$b%$A Carpenter Around The House941-270-1693 BillsHandyman Service941-661-8585 CeilingFans Lights Faucets Clogged Drains T oilets Appliances 15+YrsExperienceLicensedSP28235 BLUE PARROT,INC.AllInterior/ Exteri orWork NorthernCustomBuilderCALLBLAINE: 941-662-0266withexcellent references onquality,cost and professionalism. Li censed&I nsured Interior/Exterior Work Just Call and Ask! Excellent references onquality,cost and professionalism Y ourTotalHome MaintenanceProvider CALDWELLS HANDYMAN SERVICES CALDWELLS HANDYMAN SERVICES25+Years ExperienceLicensed FREEESTIMATESCALLDON941-585-3760Courteous, Prompt, Dependable & Affordable Service Handyman (Movers HandymanDONT FALL! G U Y GRAB BAR T H E Your Ad Here Land Clearing *0!%, Handyman Handyman Handyman SP29201 PleaseSupportOurTroopsBasic Landscaping Dependability Accessability CustomerSatisfaction(941)504-3307 StartingAt$80* 50%inWinter Askaboutour specialoffers*(Restrictions Apply)per monthLic.&Ins. 8528966 P-A rJ )-216( _. )Tj/TT3 1 Tf-0.0177 Tc 15.6729 0 0 19 239.9695 927.1287 Tm[(Menis Sw1df'ur' ,)Tj-0.1354 Tc 17.3721 0 0 17 212.9695 910.1292 Tm[()154(_ _' handyman Seviee' LIC IINA 9Rescreening PeUy MJble Sealing P eswre Cleaning -s RooJCoating PlambingFirtares t(obDe& vReiair 1l A I f'y1IA )68(1Drywall Repair aul&t PalI ing Eel fiuurs ; 1 IGutter Cleaning Mat Wood Repairs Drger Vent ClewwgVenice NativeServing Sarasota County941.485.2172 )Tj/TT4 1 Tf-0.016 Tc 26.6026 0 0 20 129.9695 743.6343 Tm(J & J Mike a Vicki'sHANDYMAN Handyman Services DAN JE Painting )156(Yard Work: mowing, Dave Beck HAND Pressure trimming, all landscaping The Handyman, ,.r DO Washing Pressure Washing: Kitchen & Bath JUSHouses, pool deck. Countertops and Much Moret driveways Drywall BathrOver 30 Years Small Repair inside/ Texturing/Painting RemoExperience & Ceramic TileSatisfied outside your home Aluminum Screens Painting1 Customers No job too big 941-766-1767 AnnMythingor small! CRC 1327942 \ 941-697-(941) 623-3408 Licensed & InsuredCall For FREE Estimate Lic/ins Member BBB )Tj1 0.502 0 rg/TT1 1 Tf-0.3947 Tc 32.7632 0 0 4 501.4695 537.6406 Tm(QDave BeckThe Handyman,u,cKitchen &Bath RemodelsCeramic Tile941.766.1767CRC 1327942LM I Licensed & InsuredMember BBB )Tj/TT1 1 Tf-0.2833 Tc 19.2317 0 0 13 494.9695 168.1519 Tm(110131 Mill C1,9 X,AM ON THE NON,MOVE, INC.loving & Delivery `iHonest, Reliable,1 Courteous,C p I l Very Low Rates )Tj0.0174 Tc 7.6852 0 0 8 480.4695 82.1545 Tm(15 yrs. ExperienceLic. & Ins.941-237-1823FL. Miner Reg. No.1M1647

PAGE 34

The Sun Classified-Section A Page 8E/N/C/VSaturday, September 24, 2011 Let us clean & repair your outside living area FREE Evaluation(941) 979-0922Custom Rescreen Repair & Pressure Washing Get ready for Summer!Lic#RR0067695Insured Rescreening Rescreening Rescreening Rescreening btn frttwescreen o rida.comLic# SA37, AL0511993X 941-876-4779 SPECIALIZINGIN SCREENROOMS NEWANDRE-SCREENS 20+YEARSEXPERIENCE ALL ABOUT ALUMINUM &, I N C .Screen ROOFING& REPAIRS,LLC941-625-1894 ShinglesMetal T ileFlatRoofsGetaGreatRoofataLow PriceforRoofRepairsor T otalRoofReplacement Ca rpentryWork* Free Estimates Over25yrsExp.inSWFla Lic.CCC-13326838Ins. BondedSTEVES Roo ng Rescreening Roo ng Painting BUSINESS & SERVICE DIRECTORYbtnnfrntnnbfnnftfnnbfbbfffbtrInclude Your Business in This Directory. Call 866.463.1638 MyadinTheBusinessand ServiceDirectoryhasbroughtme loadsofsuccess! Call429-3110toplace anadforyourbusiness! Thanksto myadImBusy AllTheTime! Youcan betoo! Call429-3110 Your Ad Here Painting Baileys Pain ting and Pressure CleaningServing the area since 1983Ext erior/InteriorPainting SoftandFaciaRepairLic.& Insured in Sarasota, No. Port & Charlotte CountiesCHAMBERMEMBER941-497-1736 Aztech P ools btb nfrbbrb Bi-weekly Chemical Service Leak Detection Licensed & Insured Owner Operated 941.585.1711 Pool Decks Bensons Soft Wash Cleaning941-697-1749 941-587-5007 Roofs P oolCages Lanais Driveways...ETC!BensonsSoftRoofWash.comb btnt frVENICE PRESSURE CLEANINGbtbn tbfrttb tb Pressure Cleaning JUMP IN! Call 429-3110 Reachthousandsof customers withyouradinthe BusinessandServiceDirectory Pressure Cleaning Mark Hunter Painting941-475-2695Call Mark Fine Interior & Exterior Painting My 32nd year in business Perfect work, prompt service Pay nothing until work complete Over 1,200 Jobs Completed Free Estimates, Bonded, Insured btn Painting Painting Painting LARRYS PLUMBING941-484-5796R e-Pipes Mostin1Day WeW illBeat AnyEstimates CompleteServiceLic.#CFC1425943 1-941-204-4286 NEED A PLUMBER ?Call Local Experts 423-3700 btnrrfrnn rrnnrnBack ow TestingONLY $19.95fr rrbSwift Plumbers.com Aaron Swift, Inc. Utility Department Charges $35.00State license # QB42652 Plumbing/ Leak Detection Pool Cleaning Pressure Cleaning RECISION LUMB ING 423-3058 tnfrrnState Certi ed Master Plumber Lic. & Ins CFC1427378REPIPES Slab&WallLeaks Replace,Repairs & Remodels Backow FULL SERVICE PLUMBING !"#$ %&'(f%)'n frnbnnnn%*'+& ,bf*&''-.b/"fnnnn.f%*''btbn fbrnfn,3fr.rrff.*'b/btnbFREEESTIMATES,+5*/+8)*)9Lic.# 22454 & Ins. Residential& CommercialFREEESTIMATESLicensed&Insured 01036730405875ServingSouthwestFlorida941-474-9091FullSer vicePaintingCompany F urnitureRenishing FullSpr ayShop P owerWashingSuperior P ainting,Inc. AAA009837 Plumbing bb !"#t$% &'()*(+)*(*'b New Construction Custom Home/ Repaints Interior Exterior Pressure Washing fffrrbt (+,"b Plumbing Remodeling Painting Painting t nbnbn ftn CALLALFormer Fire ghter941-468-266025 Years Experience Licensed & insured 50% OFFLic. # AAA00101266 No Job Too Small 30+ Years Experience Respectful Clean WorkGUY CORICACustom PaintingInterior Exterior Quality Work Honest Prices Drywall Repair Wallpaper RemovalFREE ESTIMATES Prompt, courteous serviceCall Guy,+5*/*:85*+5 Mike DymondQuality Painting941544-0764 Interior/ExteriorRepaints Residential/Commercial Pressure Cleaning 27YearsExp-ManyRef. Free EstimatesSENIORDISCOUNTSLic#990010072743&Insured frtt WE INSTALLConcrete & PaverFREE Estimates We AcceptCreditCardsP atios PoolDecks Sidewalks DrivewayExtensions941-623-6192Lic./11-00002010/InsKUSTOMIZED KURBING Pool deck Driveway designs Garage oors Patios Senior Discounts 941-375-1103Lic.Ins Quality DecksFree Crack Repair with Complete Renovation Painting Painting Plumbing Your Ad Here Pavers Put this ad space to work for you! 8528967 Alexander's Larry's PaintingAndpaper V U L OisPainting Etc. Waif15 Year Pro Interior/Ext(941) 228.6747Drive/Garage/Deck FREE ESTIMATESRemovePressure Wash/Re it No Job Too SmallllPre-Rent/Sale Spec NortheastFree Est, Ref, Uc, Ins. Workmanship and941-496-9131 Reasonable Pricesor Fully Licensed941-223-0941 and Insured IFSwe 1 B apit1 B 1 1will) Ali it0% OFF t o ,hot)Ulan] )Tj/TT5 1 Tf0.0047 Tc 6.7974 0 0 13 564.2664 551.3431 Tm[(`'Retired but not tired"Faucets, Sinks, Stools, GarbageDisposals, Pressure Tanks,)Tj-0.0166 Tc 4.15 0 0 9 157.2664 525.8439 Tm(aWater Sofeners/Filters Elc.aTa Most Anything,lust Ask AtRossMaster PlumberRF11067393 )Tj/TT3 1 Tf-0.0293 Tc 5.7462 0 0 8 479.2664 328.3499 Tm(Our Cvd } h 100 $aidadian 1 fSpectailzin In t )Tj-0.1428 Tc 5.9286 0 0 6 713.7664 316.8503 Tm('Lungin Place.Modifications I Iq -ResidentialOput airsInside-.. -Small RemodelingProjects .:y ,)Tj/TT6 1 Tf-0.0714 Tc 5.9286 0 0 6 473.7664 257.8521 Tm(l v, .., u ire a -)46()98(s' ..941-493-813830 years experienceOwter:. Walt Eros)Sarasota County Only )Tj/TT0 1 Tf-0.0233 Tc 13.551 0 0 14 317.2664 168.3548 Tm(E & F Randy Haskett Re-Roofing & Repair Specialists;tescreens Screening LEONARD'S ROOFING,amlyOwned &Opeated & INSULATION INC.)1(Pool ea es Licensed & Full Insure d Family owned andFl )Tj-0.0684 Tc 10.0841 0 0 8 307.2664 126.3561 Tm[(Lanals 9 25 yrs. of experience 9ertified operated since 1969' II I )130(Earr ry ysdErs SPECIALIZING IN ` nRESCREENING Shingle Sir Mle Metal PlyHonest, )144(pe,da lE, POOL CAGES Tile Full CarpentryReferences Available. & LANAIS Built-up Service AvailableAlso Repairs, Entryway.,=REE ESTIMATES Garage, Sliders-icensed &. Insured. No Job Too Small Reagan Leonard 488-74789or I -9 493-4 -457570 809-1171 93 Lic.lt RC 0066574o

PAGE 35

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 9 Tile Trailers Your Ad Here BUSINESS & SERVICE DIRECTORYbtntnftbtrtttnrbttrnrrbfInclude Your Business in This Directory. Call 866.463.1638 Place Your Ad Here! Call 429-3110 CERAMIC TILE Installed from$1 per sq ft.CALL NOW!941-979-9902 A JAMISON TREE SERVICE 941-423-0020 btbnfrr bbrbtbr bbbb r 475-6611 PC 539-2644 Prof. Arborist FREE Estimate! Expert Tree Trimming & Tree Removal All Phases of Lawn Care 941-408-8654 Dietrich Tree ServiceLICENSED & INSURED Ware house Bay Rentals(941) 485-8402F or small businesses starting at $200 per/mo Zoning is ILW for most types of businessesSizes 325 sq. ft. to 4,000 sq. ft.V enice Warehouse Complex Warehouse Rentals Well Drilling Window Cleaning PROFESSIONAL TREE SERVICE941-624-4204 Stump Removal Palm Trimming Removals Hedge TrimmingFr ee Estimates 10% Senior Discount 25 Years ExperienceLic. #001053 Insured Tree Service Call 429-3110 Electrify Your Service Business! JUMP IN! Call 429-3110 Reach thousands of customers with your ad in the Business and Service Directory 941-815-212615 Years Exp. In Charlotte, Sarasota & Desoto Counties10% Senior Discount Palms / Hedges Trimmed Removals Trees Planted Stump GrindingOaks Thinned & Raised UpDPs ABILITY TREE SERVICELic. #0000006131 / Insured Tree Service Windows Sliding Glass Door941-706-6445Wheel RepairsWindows, Doors & Home Repairs Lic. / Insuredbtn bfr Windows Tree Service RESCREENING by NORTHSTAR941-460-8500 863-221-9037Licensed Fr ee Estimates 25 Years Experience Call MikeLic#CC20597 Roof Maintenance Screening Stucco Tile Tile Your Ad Here Tree Service Roo ngRoofing Roo ng R.L. TEEL R OOFING941-473-7781Rer oofs & Repairs W orkmanship Guaranteed Insurance Inspections !"#$% Family Owned Since 1961 Tomado Co. DBA R eliant Roo ng 941.586.5564New Roofs, Re-Roofs, Repairs All Types of Roo ngFL Lic #CCC1326751 Lic # CRC1328045 GAF ELK Certi edSteve Gabor Roofing Roofing Roo ng AnyColor-EvenClearR24RValueShingles Built-upTileFoamPolyesterMetalFlatRoofs&More. A-1 COATINGSWhy replace it when you can save it!12YearWarrantyPreserves&Rejuvenates IncreasesWindProtectionMildewResistant426-9354423-5458800-221-6751Lic#AAA771910% Discount Roof Coatings SP30896941-628-5912 LEAKINGROOF?LeakSpecialistCallTheRICHARDTHOMPSONROOFINGHUMANCONTACT NOW40YearsOwnerOperatorLic#RC29027056&Insured941-637-6555 Roo ng Your Ad Here 8528968 CLEANING SERVICES5060 LuLusCleaning & Landscaping Relax, let me do your Fall Cleaning 22 yrs. exp. 941-416-0975 Cheryls Sparkling Clean Service, Reasonable, Reliable 30 yrs. exp. 941-426-8401 ADVERTISE In The Classifieds! Classified = Sales CHILD CARE5051 ALL CHILDCARE F ACILITIES MUST INCLUDE, WITH ADVERTISEMENT, STATE OR LOCAL AGENCY LICENSE NUMBER. COMPUTERSERVICE5053 COMPUTER TUTOR (Your home or mine) ONLY $25.00 an hour! Please call Steve at: 941-445-4285 GET RESULTS USE CLASSIFIED! ADULTCARE5050 ALTERNATIVE TO NURSING Hm Beautiful Rm & bath avail. in Priv. hm in Venice. Lic. CNA will provide care. 941-493-1879 CHILD CARE5051 FLORIDA STATE LAW r equires all child care centers and day care businesses to r egister with the State of Florida. The Sun Newspapers will not knowingly accept advertising which is in violation of the law 5000 B USINESS SERVICES AN OCCUPATIONAL LIC. may be required by the City and/or County. Please call the appropriate occupational licensing bureau to verify. BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! BUSINESS OPPORTUNITIES4010 VENICE MINI STORAGE F ACILITY, 425 Units, $1.1M. MaryBeth, Preferred Properties, Realtors 941-416-3829 ASKUS HOW you can place a PICTURE of your item for sale in your classified ad! DO IT THE EASY WAY! F AX IT!!For your convenience you can fax us your classified ad.North Port 207-1200 Englewood 426-3576 Port Charlotte 629-7740 Arcadia 494-3533 f afill )Tj-0.1111 Tc 101.4445 0 0 33 144.7664 744.3345 Tm(s )]TJ/TT4 1 Tf0.0009 Tc 11.2511 0 0 16 27.7664 718.3353 Tm(James Weaver ENGLEWOODRoofing ROOFING Shirelles, Slate, Family )Tj-0.0657 Tc 6.7755 0 0 8 123.2664 686.8363 Tm[(L100K Us,iiepaksOwned & Old Roof RemovalOperated Otr SpecWtySince 1984 FullCwpw*y426-8946 NEW ROOFSFr~ weenum RE-ROOFS REPAIRSFree Estimates Pub Insured Commercial & ResidentialState Lit.e0001325679Metal, shingles, flat roofs. Re-roofs Are Our SpecialtyReplace & Repair ,AiftIttNYZ Sus: 941-474-5487Lice & at r `-ax: 941-475-079.' .:all Ron Call doh )Tj/TT8 1 Tf-0.0247 Tc 27.6667 0 0 27 73.2664 522.3413 Tm( RICH LANDBRS CE10IIC TILE LEMON BAY TILESALES AND/OR )Tj/TT4 1 Tf-0.0088 Tc 10.0688 0 0 23 299.7664 505.3418 Tm(STUCCO, INC, INSTILL/ 'ION When Quality CountsNew Constriction Convert bath tub to easy& Remodels 35 YRS EXP. access showerRusted bands & NO JOB T00 SMALL Handicap access shower 20x20 Porcelain Shower repair/Replace from $3.69Wire Lath Repair. Free In-Home Shopping12 yrs. In Rotondo West. Licensed & Insured ProfessionallySpraycrete & Free estimates. -Owner/Install InstalledDry-wall repair. Installer/Owner. Over 20 Years in Englewood948 474-1000 .,.visa 1(941)497-4553 941-697m )Tj/TT4 1 Tf-0.024 Tc 12.4299 0 0 13 117.2664 346.3467 Tm[(Trailer Repair momMajor & MinorBoat/UtilityTrailersSprings, AxlesBearings, Tires 101Lights & WiringEnglewood ""' v V eTrailer Center On941-460-9700 )]TJ-0.057 Tc 15.3619 0 0 12 217.7664 160.3524 Tm[(Mater Works Well Drillirg WE DO Custom jfom6 e(/)(W rs, .Inc.re 9 WINDOWSPRESSURE Windows, Doors &WASHING More...)-408(,O 41-484-3634 NewCustomer Jeff Reinhardt,:_c Specials Replacement Windows Interior DoorsPackage Deals a,PS nSIII cd 1 Hurricane Protection Garage Doors & Patio Doors" IrriF:dien In?tolled )13(, Repiire
PAGE 36

The Sun Classified-Section A Page 10E/N/C/VSaturday, September 24, 2011 HOUSEHOLD GOODS6030 STEMWARE HAND cut sets of 8/wine, water, etc. $15, OBO 941-624-0364 T ABLE 16x20 wood tbl. top 6 adj. hgts. 3 adj. angles. Folds. NEW $15 941-6255211 TABL E LAMBS 2 big 3ft.end table lamps $25 941-4732150 T ABLE TOP burner Ruffoni, copper, never used $125 941-380-3000 TURKEY FRYER 36 qt. complete outdoor propane NIB. $60 941-380-3000 TV CONSOLE Black, 55long. 2 shelves. Like new. $95 941-240-2848 TV TRAYS PECAN TRAYS ON SWIVEL STAND $50, OBO 941-447-8149 UTILITY CART folding utility cart still in package $30 941237-1085 VACUUM DYSON dc-25 Animal w/warranty $295 941698-1039 VACUUM,BISSELL VGC Clean, Bagless, all attachments $35 941-894-4115 WALL ART 48x60blk & gold, Manhattan skyline w/ T win Towers. Lv. msg. $100. 941-255-0237 WINE SET 16 piece La Virgina, Wine opener & accessorizes. $15 941-276-0271 HOLIDAYITEMS6031 1992 XMAS Quilt 48x64 W/pillow 14x14.J.L.Hudsons.dated ex.cond. $35 941-625-5211 BYERS CHOICE V ictorian Carriage 15h 30l $150 941637-6474 GOEBEL DATED WHT CHINA ORN VINTAGE PCS W/BOXES EA $15 941-639-1517 VICTORIAN FAMILY House of Hatten Victorian Family $75 941-637-6474 FURNITURE6035 1) SET movie seats,seats fold up great for kids $65 941623-3496 A FURNITURE SHOPPE Selling QUALITY Used Furniture 941-473-1986 BAKERS RACK Cream metal,4 glass shelves exc. cond. $150 941-492-7198 ADVERTISEWITHTHE SUNCLASSIFIEDS BAKERS RACK V ery decorative, metal, exc cond. $125 941-468-3252 BAR & Game Table Marble tops, like new! 2 stools, wood. $375, OBO 941-716-9912 BAR STOOLS (4) wooden, 25 H, $20/ea or $70/all, OBO 941-979-7112 BAR STOOLS 2 beige swivel stools 24 $120 941-2551255 BARSTOOLS 2 metal bases, fabric swivel seat. Exc cond. $100 941-468-3252 BED MATTRESS/BOX. New will sell $100. 941-629-5550 BED Queen,headboard, footboard, frame, med dark wood, a beauty $250 941-255-0275 BEDTWIN Adjustable,new mattress, has massage & heat $395, OBO 941-423-2091 BEDROOM SET, King, 7 pcs. solid oak, med. finish. Exc. cond. $575. 941-445-5533 BEDS, LOVESEAT dressers, endtables lamps Kitchen /chairs, more $100/all 941-740-4769 HOUSEHOLD GOODS6030 DRAGON MIRROR Beautiful,18in.round $50, OBO 941258-5698 ELECTRIC FIREPLACE Antique White $150, OBO 941-637-7032 FLOOR LAMP TIFFANY STYLE$65 941-716-9912 FONDUE SET Stainless Steel. 6 forks. Like new. $25 941240-2848 GOLD & SILVER SILVERWARE serv.12 dbl.serv pcs. wd.case $115, OBO 941-624-5211 HALLMARK TABLE Covers:(5)New. Great for fall gatherings. $5 941-276-1881 HEADBOARDS (2) T win size, Brass-plated $75 941-9238715 HEATER STOVE V intage $495 941-496-9252 HOME INTERIOR print new r ooster framed print 24x28 $35 941-228-1745 I BUYFURNITURE Or anything of value! 941-485-4964 Kenmore Grill, Good Condition, Plus Extras! $100. 941-460-1756 KEURIG COFFEE POD HOLDER EC, holds 30 pods $12 941-505-1492 LIGHT FIXTURE (w/bulb+cord) 4 fluorescent $7 941-629-8955 LIGHT FIXTURE (w/bulb+cord) 4 fluorescent $7 941-629-8955 LUGGAGE 3 piece with wheels $30, OBO 941-6251328 MATTRESS, QUEEN AND BOX. Brand New will sell $175. Also have KING. 941-629-5550 MATTRESS/BOX. New Will sell $100. 941-629-5550 MATTRESS & BOX SPRING -2 sets Twin, Exc. Cond., Clean $350 941-923-8715 MATTRESS + frame QNNO BOXSPRING NP-area $50 941-544-1128 MATTRESS SET King, Sealy Posturepedic Firm 4 years old XLNT $395 941-258-0472 MICROWAVES 3 sm counter top used $18 941-475-7507 Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week OUTSIDE GRILL George Foreman pedestal electric bar b q $40 941-564-8770 PICTURE, LIGHT UP with sound. Northern autumn scene. $40 941-235-2330 PICTURE, LIGHTED motion fish swimming, 11by19 mirr or brder. $20 941-423-2585 REVEREWARE 10 pc set Made in USA Exc cond $40 941-423-9371 SHEET SET, king USA made blu.2xtra lg.towels 3blankets brn.All for $25 941-625-5211 SHELL PICTURE 36x48 Signed $50 941-492-7198 SHOPPING BAG: Giant Mall of America, zippered pouch. $5 941-276-1881 SHOWTIME ROTISSERIE by Ronco, like new $30 941-2559788 HOUSEHOLD GOODS6030 AREA RUG 5x8.new.never used.oriental design.brown. $79, OBO 941-235-2203 BEDSPREADKING w/shams, multi-colors, new. $85 941473-9773 BEDSPREAD QUEEN white bkgd w/blue,pink,green flowers. $10 859-466-9572 BEDSPREAD TWIN & Pillow tan,blue&rust.Smoke/Pet free home. $25 954-809-5325 BLANKET/SHEETS:KING Monets Water Lilies Nice. $45 941-276-1881 CARPET-ORIENTAL NAVY w/Blush-Slate Blue floral border $80 813-240-0844 CEILING FAN beautiful hand carved elephant and leaf detail $300 941-429-8507 CLASSIFIED ADSSELL CHAMPAGNE GLASSES Mikasa new set of 4 black. $20 941-228-1745 CHINA SANGO majesty r omanica platinum collection 64pc. $250 941-473-2150 COMFORTER SET King Pretty floral with piping. $25 941-698-0154 COMFORTER SET Queen Reversible blue dolphin with curtain $20 941-698-0154 COMFORTER SET Queen Reversible cheetah with 2 dec. pillows. $20 941-698-0154 COMFORTET SET twin 6pc,solid or blue/biege stripe new cond $20 941-575-1393 COMPLETE BATH:BROWNS w/white.Linens/accessories.N EW. $45 941-276-1881 DEHUMIDIFIER LG brand 45pint capacity. NEW COND. $100 941-423-2585 DESIGNER AREA Carpets 2 124x96 and 90x69 $300 941-505-0920 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** 6000 MERCHANDISE AUCTIONS6020 SATURDAY September 24, 2011 10 AM Preview at 9:00 amOil Painting and Frame Warehouse23196 Fr 23196 Fr eedom Ave. eedom Ave. Charlotte Harbor Charlotte Harbor , Florida 33980 Florida 33980Auction Location: Auction Location: From Peace River Bridge in Charlotte Harbor, travel HWY 41 north approximately 1/2 mile to Touch of Class Car W ash. Oil Painting and Frame War ehouse is located right behind Touch of Class Car W ash. __________________________Partial list of items for sale: Office Equipment, HYSTER FORK LIFT, Briggs and Stratton power washer, Almost new T ran A/C system with ducts, BLACK MAX 5 hp Air Compressor, 16 ft extension ladder, 16 foot utility trailer, 27 ft 1987 Class C Holiday Rambler Camper, pallets of Frames of all sizes and so many more items. EQUIPMENT: Fletcher 1100 Oval Mat Cutter, Vacuseal 4366M Combination Vacuum Press, C&H Advantage Pro 60" Straight Line Mat Cutter,Fletcher 3,000 Wall Mount Cutter, Morso Chopper, 24" Paper Dispenser, 30" Paper Dispenser, 36" Paper Dispenser, 48" Paper Dispenser, Mitre Mite VN42 Under Pinner, Coner Vises, Print De Roller, 10" Frame Square Mitre Saw, 12" Boseo Double Head Mitre Saw, Avery Microtach Tool (Large and Small), Release Boards for Vacuum Press, Roll Adhesive Tissue for V acuum Press, Rolls Print Guard for Vacuum Press, 44" Canon IPF 8100 Printer, Lowel Tota Hot Lights, Rolls-various sizesart papers for printer, Delta Dust CollectorAB 2321 AU 1191Please visit our web site for additional information about this auction.W eb:www.PhillipWilsonAuctioneer.com AUCTION ARTS AND CRAFTS6025 EASEL V lrg on casters w ratchet adj only $88 941-6971102 FRAMED PRINT, JIM HARRISON39X23/signed SC Artist41/975 $499 941-6981039 DOLLS6027 BARBIE ROSE SPLENDOR Collector edition w/box, stand, cert. $15 941-258-2016 BARBIE DOLLS 22 all new in boxes Special Editions $400, OBO 941-467-5716 STEIFF BEARS MIB Tea Set 4 Bears $495 941-637-6474 STROLLER VICTORIAN Doll Stroller Orig. Paint $225 941637-6474 HOUSEHOLD GOODS6030 1970S OSTER Kitchen Center 5units in 1,Gold like New $125 941-698-1039 AIR CONDITIONER, Sharp, r emote control, 6200 BTU, Newer $80 941-637-6374 PLUMBING5160 THINK PLUMBERS are too high? Give me a try! Retired master plumber. Lic. RF11067393 Ross (941)-204-4286 POOLSERVICES5165 AZTECH POOLS Personalized Complete Pool Serv. & Repair Lic/Ins. 941-585-1711 CLASSIFIED SELLSCALLTODAY!941-207-1200 V enice/Englewood Nor th Port areas OR 941-206-1200P t. Charlotte Areas PRESSURE CLEANING5180 DIRT BUSTERS PRESSURE CLEANING LLC. W alls, Driveways, Sidewalks, Roofs...ETC. No Job Too Big or Too Small 941-286-4671 or 628-8326 Lic./Ins. ROOFING5185 KETTERS ROOFING. Specializing in Re-Roofing & Repairs #CCC1325663 (941)-815-8633 Lic./Ins. 6000 MERCHANDISE GARAGE SALES 6001Arcadia 6002Englewood 6003Lake Suzy 6004Nokomis 6005North Port 6006Port Charlotte Deep Creek 6007Punta Gorda 6008Rotonda 6009Sarasota 6010South Venice 6011Venice 6012 Out Of Area 6015Flea Market 6020Auctions MERCHANDISE 6013 Moving Sales 6025Arts & Crafts 6027Dolls 6030Household Goods6035 Furniture 6038 Electronics 6040TV/Stereo/Radio6060Computer Equip6065Clothing/Jewelry/ Accessories6070Antiques & Collectibles 6075Fruits/Veges 6090Musical 6095Medical 6100Health/Beauty 6110 Trees & Plants 6120Baby Items6125Golf Accessories6128Exercise/Fitness6130Sporting Goods 6131 Firearms6132 Firearm Access. 6135Bikes/Trikes 6138Toys 6140Photography/Video 6145Pool/ Spa & Supplies6160Lawn & Garden6165Storage Sheds/ Buildings6170Building Supplies6180Heavy Constr. Equipment 6190Tools/Machinery6220Office/Business Equip & Supplies6225Restaurant Supplies 6250Appliances 6260Misc. Merchandise 6270W anted to Buy/T rade HEATING& AIR5090 FRESH AIRCooling is offering $500.00 off the purchase of a new A/C system with the mention of Promo #2468. A 10 point inspection of your existing A/C system for only $29.95 with the mention of Promo #3690. Call: 941-429-6200 to schedule your appointment. Coupons expire 10/31/2011. HOME / COMM. IMPROVEMENT5100 CARPENTER, INC. Handyman Rotten wood, window, doors, cabinet repair, soffit, facia. Phil 941-626-9021lic. & ins. CERAMIC TILE installed from $1 per sq ft Call now! 941-979-9902 DAN THEHANDYMAN Bath rm & kitchen remodels Painting, Carpentry, Anything? 941-697-1642 DA VE`S HANDYMAN Honest, Knowledgeable & Reliable. Call for all your needs, Sm/Lg 941-628-8326 Lic/Ins FCI CONSTRUCTION Concrete, Masonry and Demolition. Driveways, Additions, Commercial Buildings. Lc./Ins. 941-628-5965 HANDYMAN 25 Years Exp. Quality Assured.Handy Randys Home Improvement Svcs. (941)-268-3522 PUTCLASSIFIEDS TOW ORKFORYOUV enice,Englewood, North Port 2 2 0 0 7 7 1 1 2 2 0 0 0 0Pt.Charlotte Areas Call 2 2 0 0 6 6 1 1 2 2 0 0 0 0 HURRICANE PROTECTION W indow Replacements & Installations. Installed or Do-it-yourself 941-769-1679 QUALITY DECKS Pool Decks, Garage floors, Patios & more. FREE crack Repair with renovation. 941-375-1103 LAWN/GARDEN & TREE5110 AN OCCUPATIONAL LICENSE may be required by the City and/or County. Please call the appropriate occupational licensing bureau to verify AFFORDABLE MOWING by the cut or by the month 941-623-3297 BASIC LANDSCAPING *Dependability *Accessability *Customer Satification STARTING AT $80/per mo Some restrictions apply. Lic/Ins 941-504-3307 BURTONS LAWN & Landscape Full service since 1992 Accepting new act. 941-223-7186 HOME MAINTENANCE, mowing & trimming Serving Charlotte Co. 941-916-8504 P AINTING/ W ALLPAPERING5140 BEST PRICE FOR QUALITY JOB! Best Coast Painting Residential/Commercial Handyman services also! V isa/MC/Disc accepted 941-815-8184 AAA00101254 illillillillilllllllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIillillillilliililillkftwooooooD0 )Tj-0.1541 Tc 234.475 0 0 55 18 96.0333 Tm(a G

PAGE 37

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 11 YEARENDMODEL US41BypassBusiness41 Buick-GMC T ake41Bypassto Business41.Justover thebridgeonyourright. 20MinutesNorthof To wnCenterMall btnnfbrbnbnfn BUICKGMC b !"n #$%f" &"'('))'* bnnf++, On ly37KMiles St#1B308A Was................$17,955 Discount..........$3,105 Tr ade................ $3,000 2008BuickLucerneCX SalePrice$11,8500%FINANCINGFOR60MONTHS...PLUS$1,000REBATE* ONALLNEWGMCVEHICLESINSTOCKEXCLUDINGTERRAINSt#1GT388 NEW 2011GMCSierra CrewCab 25MPG M.S.R.P.................. $33,746 Fa ct oryRebate...... $4,505 DarbyDiscount..... $2,250 CashorTrade......... $3,000U .S.A.A.PrivateOer... $750 $ 23,241SALE PRICE $ 285/ moORLEASEFOR 0%FINANCINGFOR60MONTHSSt#1011 NEW 2011GMCSierraDenali H.D25004WheelDriveCrewCab 0%FINANCINGFOR60MONTHS NEW 2011GMCSierraExtCabSLESt#1G561 JUSTANNOUNCEDSt#1B381B Was...............$21,975 Discount.........$3,010 Tr ade...............$3,000 2008GMCEnvoySLT SalePrice$15,965 On ly49KMiles St#CP353 Was...............$20,965 Discount.........$2,000 Tr ade...............$3,000 2008PontiacG6GTConv. SalePrice$15,965 On ly44KMiles St#CP366 Was...............$25,899 Discount.........$1,000 Tr ade...............$3,000 2008CadillacCTS SalePrice$21,899 On ly21KMiles Was..............$12,965 Discount........$850 Tr ade..............$3,000 2002ChevySuburbanLT4x4 SalePrice$9,115 On ly85KMiles St#1B512A St#1BT583A Was...............$13,900 Discount.........$900 Tr ade...............$3,000 2006BuickLaCrosseCXL SalePrice$10,000 On ly55KMiles St#TP185A Was................$5,999 Discount..........$850 Tr ade................$3,000 2002ChevyVenture SalePrice$2,149 F amilyVan St#1G518A Was...............$28,495 Discount.........$1,500 Tr ade...............$3,000 2008LexusES350 SalePrice$23,995 On ly31KMiles St#1B308A Was.................$8.985 Discount...........$2,000 Tr ade.................$3,000 2005DodgeCaravan SalePrice$3,995 On ly88KMiles St#TP184 Was................$15,725 Discount..........$1,000 Tr ade................$3,000 2008KiaSedona SalePrice$11,725 On ly44KMiles St#CP358 Was.................$17,499 Discount...........$850 Tr ade.................$3,000 2008ChevyMalibuLT SalePrice$13,649 On ly22KMiles St#TP178 Was................$28,850 Discount..........$3,350 Tr ade................$3,000 2008CadillacSRX SalePrice$19,500 On ly38KMiles St#1BT504A Was................$10,975 Discount..........$1,000 Tr ade................$3,000 2002LincolnLS SalePrice$6,975 On ly71KMiles St#1B444A Was................$24,965 Discount..........$1,200...... Tr ade................$3,000 2008PontiacG8 SalePrice$20,765 On ly15KMilesbtnfttrfbbfbrfftbfbbbtnrfffbbtnf ffbrf!b "#tffbfbtnf$ffb%& n tt'fb(NavigationSystem,20Chrome Wheels,Heated&CooledSeats, FullPower,Loaded! $ 9,000!SAVE $ 23,358 24 MPG 24 MPG NEW 2011AcadiaSLEM.S.R.P.................. $35,942 Fa ct oryRebate...... $2,000 DarbyDiscount..... $2,340 CashorTrade......... $3,000U .S.A.A.PrivateOer....... $750 $ 27,852SALEPRICE 0%FINANCINGFOR60MONTHSSt#G1263 26MPG St#1GT543 NEW 2011GMCTerrainSLEM.S.R.P.................. $25,997 DarbyDiscount..... $1,366 CashorTrade......... $3,000U .S.A.A.PrivateOer... $750 $ 20,861SALEPRICE 32MPG 2.9%FINANCINGFOR36MONTHSM.S.R.P.................. $33,637 DarbyDiscount..... $2,524 Rebate..................... $4,005 CashorTrade......... $3,000U .S.A.A.PrivateOer... $750 SALEPRICE 8527510 0.9%APRASKUSABOUT WILDEHondainSarasota New|Used|Parts|Service CLICKgowildehonda.com CALL877-471-0088 GO7333STamiamiTr.SarasotaCarbuyingmadesimple! WILDESOCIALNETWORK F A F F N &FOLLOWER S PECIAL S*36mo./12,000milesperyearleaseplustaxtoapprovedpreferredcredit.Tax,title,license,acquisition,FLanddealerfeesextra.Securitydepositwaivedto approvedcredit.710+beaconscore.Vehiclemustbefromdealersstock.Buyersmustqualify.^0.9%forupto60monthsequals$17.05per$1000borrowed, nodownpaymenttoqualiedcustomers.**Basedon2010EPAmileageestimates,reectingnewepafueleconomymethodsbeginningwith2010models.Use forcomparisonpurposesonly.Donotcomparetomodelsbefore2009.Youractualmileagewillvarydependingonhowyoudriveandmaintainyourvehicle.Offer expires09/30/11. $269ZERODOWN! e r m o n t h 36months* Leasefor 2 0 1 1 A C C O R D L X 23/34CITYHWYMPG** 21/28CITYHWYMPG**$249 LeaseforZERODOWN!2011CRVLX2WD4DR AUTOMA TIC A A YES,WEHAVE INVENTORY,DRIVE A HONDATODAY! 8526961 FURNITURE6035 DINING SET Natural Rattan,4 chairs like new, from Leaders $295 941-627-6542 DINING SET Rattan, glass top, 4 caneback chairs.great cond. $200 941475997 DINING SET rattan, glass top, 4 caneback chairs. great condition. $200 941-475-9197 DINING SET Tbl.& 4Chairs + 5 more matching pcs. NICE $325 941-661-8117 DINING SET: black iron & glass top table w/ six chairs $300, OBO 941-716-9912 DINING TABLE set 6 chairs glass top stone base txt pic $150 941-286-1651 DRESSER 6 drawer,solid wood,masc. excl. $130, OBO 941-979-7112 END TABLES (2) & 2 lamps ceramic light beige glass tops $99 941-544-1128 NP ENTERTAIN. CTR/CABINET good cond. MUST SELL $499 856-381-8617 ENTERTAINMENT CENTE R cherry & maple. Also 44 LG projection tv. Both exc cond. Orig over 5000.00. Askin g $1200/both. Will sell sepa rately. Call 941-497-2310 ENTERTAINMENT CTR. Glass/chrome,4pc.lighted $300, OBO 941-456-2840 F ARM TABLE painted ivory, decorative legs $125, OBO 941-716-3259 FILE CABINET Home 3 dr, letter/legal Cherry finish, ornate dtl $60 941-624-0364 FUTON solid cherry wood, expensive plush mattress. New!$200 941-698-9467 FURNITURE6035 CORNER CURIO Off White could be used for sm dish display $150 941-249-0885 COUCH AND matching love seat $75 941-623-3496 COUCH, Sectional, 2 desks, china cab, ent. ctr,lanai (8pcs), APPLIANCES. (941)-764-8272 COUCH, LOVESEAT Leather, beige, Great condition $375 941-270-2199 DARK BLUE leather couch $110 941-623-3496 DAYBED W/TRUNDLE w/matching nitestand.ln. $375, OBO 941-235-2203 DESK AND Hutch w/chair, like new, cherry color $499 941429-8507 DESK CHAIR Dk green, w/arms & adjustable $30 941-698-6692 DESK, CHILDS wooden with chair good condition $25, OBO 941-256-6962 DINETTE SET 42 in round glass & metal table,4 chrs. Lovely! $225 941-468-3252 DINETTE SET 48 oak table 12leaf 4 Chairs Good condition $175 941-255-1255 DINETTE SET Round lt beige table,6 chairs $120, OBO 941-637-7032 DINING CHAIR Auth. Rachel Ashwell, lined, slipcover. $175 941-716-3259 DINING RM. Chairs American Drew,Oak, 2 Arm, 2 Side, Exc. Cond. $195 941-575-1942 DINING ROOM COMPLETE 11 PC.,EMAIL PICS $499 941-493-7238 DINING ROOM T ABLE 42X66 w/2 18 leaves, med wood $125 941-698-6692 DINING SET hidden leaf w/4 chrs & buffet. $410, OBO 941-979-7112 FURNITURE6035 BED DBL W/FRAME:CLEAN $85 941-661-8117 BEDS, with headboard Twin $30 & Queen $70 941-429-9122 BOOKCASE LIGHT wood 72X28 good condition $25 941-661-3775 BUFFET OFF white with custom glass top $150 941-249-0885 CHAIR AM. SIGN.FURN Kendall Stripe $200. 813240-0844 CHAIRS (4) brown wicker, black metal legs 33H x 16W $40 859-466-9572 CHINA CABINET Oak, 36x17x72. Glass doors. Leave message. $350 941255-0237 COFFEE TABLE Large 34x60in.,cherry,like new. $50 774-526-7538 COFFEE TABLE Matching end tables.Wrought iron w/ glass tops. $250 941-276-1956 COFFEE TABLE teak & inlaid tile 30x49 gorgeous exc cond $75, OBO 941-743-3321 COFFEE TABLE walnut color 47 x 22 x 24 inside storage $300 941-429-8507 COFFEE TABLE WALNUT/ WROUGHT Iron Base $50. 813-240-0844 COMPUTER CABINET Great cond. Brown. Opens up to a desk. $100 941-661-5480 COMPUTER CABINET Oak armoire style double door cabinet. $50 941-830-8739 COMPUTER DESK L-shaped chrome & glass. NICE! $129, OBO 941-505-5747 COMPUTER DESK Large work area. 46wx29 1/2h, on casters $40 941-914-1770 COMPUTER DESK White W ash. $40 941-764-8594 plus tax permonth,36 months")Tj/TT1 1 Tf0.1749 Tc 7.9338 0 0 7 105.5634 832.3496 Tm(IY4DR AUTOMATICplus tax ptmonth.O 0 nD D=7 )Tj-1.9428 Tc 65.2143 0 0 5 689.3603 383.7834 Tm(. )Tj0 0.502 0 rg/TT1 1 Tf-0.0768 Tc 15.3952 0 0 15 30.8603 203.2889 Tm(stwearw swrr rerr,r : rrr.r srr. srrrroffto tsr r srrr.e )Tj-0.1193 Tc 40.6644 0 0 18 339.8603 108.2918 Tm(srrrr r. srrrrw _I1i r)]TJ-0.0948 Tc 8.5862 0 0 5 111.3603 102.792 Tm('^ ..)]TJ-0.1 Tc 5.9286 0 0 5 193.8603 104.7919 Tm(,.liY.r 1.-'-_-' 7i/4}N7Si7-J / 1E} )Tj0 0.502 0 rg0.506 0 Td(' \x -rgya )Tj0 0.502 0 rg0.58 0 Td(_r sa

PAGE 38

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 13 The Sun Classified-Section A Page 12E/N/C/VSaturday, September 24, 2011 Get it all at PALM AU T O MALLOr lease for$330/MO.***Buy now$27,995 QUALITY PRE-OWNED VEHICLES New 2011 MITSUBISHIOUTLANDERSPORT ESOr lease for$209Buy now/MO.**$18,995STK#B1022 scan here to see a complete list of our mitsubishi inventory! scan here to see a complete list of our hyunDai inventory! New 2011 JEEPCOMPASSSTK#D11131Or lease for$249/MO.###Buy now$18,770 $289/MO.***OR buy for scan here to see a complete list of our chrysler DoDge Jeep ram inventory! scan here to see a complete list of our chevy, buick gmc inventory! scan here to see a complete list of our toyota inventory! scan here to see a complete list of our maZDa inventory! All New 2011 MAZDA3ISTK#M11083Or lease for$159Buy now/MO.^$14,986 New 2011 HYUNDAIELANTRA GLSOr lease for$159Buy for/MO.^$17,835STK#H20038 0% REBATESUP TO $ 4,500! ~0% FINANCING!~ PRIUSNEW 2011 TOYOTAStk#T1 1199$22,961$349/MO~~Or Lease For HYBRID! Sign & Drive!BUY NOW SIENNANEW 2011 TOYOTAStk#T68711$24,953$399/MO~Or Lease For AUTOMATICEQUIPPED NOT STRI PPED! Sign & Drive!BUY NOW NO PAYMENTS FOR90 DAYS! ~ New 2011 CHEVY SILVERADO CREWCABSTK#C11720Was$33,769Buy Now $ 25 995Or 0 % For Up To 60 Months I 888-534-1544^O% FOR 60 MONTHS ON ALL 2011 MODELS. LEASE IS FOR 36 MOS. 10KMI/YR WITH APPROVED CREDIT $3392DUE AT SIGNING. ^^LEASE IS FOR 36 MONTHS WITH 10K MI/YR $1895 DUE AT SIGNING. OFFERS MAY REQUIRE FINANCING THRU HYUNDAI CAPITAL WITH APPROVED CREDIT. *LEASE IS FOR 39 MONTHS, 12K MI/YR. WITH $1999 DOWN PLUS TAX, TAG, TITLE REGISTRATION, FIRST PAYMENT DUE AT SIGNING AND INCLUDES DEALER FEE. **ALL LEASES ARE FOR 36 MONTHS 10K MI/YR WITH $4618 DUE AT SIGNING WITH APPROVED CREDIT. #39 MONTHS WITH $1475 CASH OR TRADE EQUITY, WITH APPROVED CREDIT. 10K MI/YR. ***BASED ON 72 MOS @ 3.9% APR. ALL PRICES AND PAYMENTS INCLUDE ALL REBAT ES INCLUDING CHRYSLER LEASE LOYALTY AND MILITARY DISCOUNT. PAYMENTS AND PRICES ARE PLUS TAX, TAG AND $599 DEALER FEE. PalmAutomall.com###LEASE IS FOR 39 MOS, 10K MI/YR WITH $2500 DUE AT SIGNING. ^^^OFFERS MAY REQUIRE FINANCING THRU HYUNDAI CAPITAL WITH APPROVED CREDIT. LEASE IS FOR 36 MONTHS WITH 10K MI/YR $3618 DUE AT SIGNING. %SPECIALS ARE MUTUALLY EXCLUSIVE AND CANNOT BE COMBINED. MUST BE PRESENTED PRIOR TO PURCHASE. ALL PRICES ARE PLUS TAX, TAG, AND A $599 DEALER FEE. %% BASED ON 72 MOS @ 1.9% APR. ALL PRICES AND PAYMENTS INCLUDE ALL REBATES INCLUDING CHRYSLER LEASE LOYALTY AND MILITARY DISCOUNT. PAYMENTS AND PRICES ARE PLUS TAX, TAG AND $599 DEALER FEE. %%% $2198 DUE AT SIGNING 36 MO 12K MILES A YEAR. ~36 MONTHS 12K MILES/YR. WITH APPROVED CREDIT AND TAX, TAG, TITLE, AND DEALER FEE. ~~60 MONTHS 12K MILES/YR. WITH APPROVED CREDIT AND TAX, TAG, TITLE, AND DEALER FEE. LEASE IS FOR 36 MOS 12K MILES PER YEAR WITH $36 48 DUE AT SIGNING. scan here to see a complete list of our useD inventory! QUALITY CERTIFIED PRE-OWNED VEHICLES 2008 HONDA FIT$12,941HATCHBACK!4 door, Hatchback, Automatic With Overdrive, Ext. Color Vivid Blue Pearl. STK#M2022A 2005 MERCURY GRAND MARQUIS LS$12,991AUTOMA TIC!4 door, Sedan, Automatic With Overdrive, Ext. Color Light Ice Blue. STK#H12069BB 2007 HYUNDAI SONATA GLS$12,991LOW MI LES!4 door, Sedan, Automatic With Overdrive, Ext. Color Deepwater Blue. STK#PH5788 2005 DODGE DAKOTA SLT$13,581GREATSAVINGS!Pickup Truck, 4 door, Quad Cab, Automatic With Overdrive, Ext. ColorBright White. STK#PD5295B 2004 CHEVROLET TAHOE$13,941A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Black. Stk#C11422A 2009 TOYOTA COROLLA$14,941MANUAL!5 Speed Manual, Ext. Color Desert Sand Mica, STK#M2012A 2009 CHRYSLER SEBRING$14,754CONVERTIBLE!2 door, Convertible, Automatic With Overdrive, Ext. Color Silver Steel Clear Coat. Stk#D11572A 2006 TOYOTA TUNDRA X-SP$17,991GREAT PRICE!4 door, Double Cab, Automatic With Overdrive, Ext. Color Salsa Red Pearl. STK#CB11238B 2010 JEEP PATRIOT$18,891LOW MI LESONLY 23,994!4 door, SUV, Automatic With Overdrive, Ext. Color Brilliant Black Crystal. STK#T10855C 2009 FORD FUSION SE$14,941A MUSTSEE!V6, 4 door, Sedan, Automatic With Overdrive, Ext. Color Redre. STK#H20125A 2007 FORD F-150 FX2 SUPER CAB$22,591LOW MI LESONLY 14,535!Automatic With Overdrive Ext. Color Black, STK#D11468A 2007 HUMMER H3$22,991A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. ColorBirch White. STK#C11724A 2003 LEXUS RX 300$15,441A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Burnished Gold. STK#D11644BB 2006 DODGE MAGNUMRT$15,981AUTOMA TIC!4 door, Wagon, Automatic With Overdrive, Ext. Color Midnight Blue Pearlcoat. STK#D11601A 2006 FORD MUSTANG$16,491LOW MILESONLY 47,559!2 door Coupe Automatic With Overdrive Ext. Color Performance White. STK#H20165A 2003 INFINITI G35$16,941GREAT PRICE!2 door, Coupe, Automatic With Overdrive, Ext. Color Diamond Graphite. STK#H20180A 2010 DODGE CHARGER SXT$19,582A MUSTSEE!4 door, Sedan, Automatic With Overdrive, Ext. Color Bright Silver Clear Coat. STK#D11556AA 2009 HYUNDAI SANTA FE GLS$19,921LOW MILES!4 door, SUV, Automatic With Overdrive, Ext. Color Powder White Pearl. Stk#H20213A 2008 JEEP WRANGLER X$20,741AUTOMATIC!2 door, SUV, Automatic With Overdrive, Ext. Color Black. STK#D11099A 2010 JEEP WRANGLER SPORT$24,881LOW MI LESONLY 8,075!2 door SUV 6 Speed Manual Ext. Color Stone White Clear Coa. STK#D11316C 2011 HYUNDAI TUCSON$23,991LOW MI LES!4 door, Automatic With Overdrive, Ext. Color Garnet Red Mica Crossover, Stk#PH5800 2011 TOYOTA RAV4$24,941LOW MILES!Automatic With Overdrive Ext. Color Sandy Beach, STK#T10899A 2009 TOYOTA VENZA FWD$25,441LOW MILES!4 door, Wagon, Automatic With Overdrive, Ext. Color Blizzard Pearl. Stk#T10862A 2011 CHEVROLETTRAVERSE LT$27,941LOW MI LES!4 door, Automatic, Ext. Color Silver Ice, Crossover, STK#PC5798 2008 TOYOTAHIGHLANDER LTD$28,941A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Blizzard Pearl. STK#H12145A 2004 INFINITI Q45$17,991AUTOMATIC!4 door, Sedan, Automatic With Overdrive, Ext. Color Royal Pewter. STK#T10292A 2008 SATURN VUE XR$17,991LOW MI LES!4 door, SUV, Automatic With Overdrive, Ext. Color Sea Mist Green. Stk#PC5741A 2010 HONDA CIVIC LX-S$18,881GOOD GASSAVER!4 door, Sedan, Automatic With Overdrive, Ext. Color Polished Metal. STK#H20111A 2008 NISSAN XTERRA$19,541A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Night Armor. STK#C11683A 2010 KIA SPORTAGE LX$20,541LOW MILESO NLY 18,284!4 door, SUV, Automatic With Overdrive, Ext. Color Steel Silver. STK#H20061A 2011 HONDA CR-ZEX$23,781LOW MILESONLY 5,404!2 door, Hatchback, Automatic With Overdrive, Ext. Color Storm Silver. STK#CB11199A 2010 NISSAN XTERRA$24,98 1A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Night Armor. STK#T11048A 2000 NISSAN QUEST$5,941 AUTOMA TIC!Mini Van, 4 door, Automatic, Sunset Red STK#PD5528A 2000 MERCURY GRAND MARQUIS LS$7,991 LOW MI LES!4 door, Sedan, Automatic With Overdrive, Vi brant White. STK#T10507A 1999 PONTIAC FIREBIRD$9,753 CONVERTIBLE!2 door, Convertible, Automatic With Overdrive, Arctic White. STK#D11547A 2003 TOYOTA CAMRY XLE$9,991 GREAT PRICE!4 door, Sedan, Automatic With Overdrive, Ext. Color Black Walnut Pearl. Stk#C11705A 2006 HYUNDAI ELANTRA GLS$9,991 A MUSTSEE!4 door, Sedan, Automatic With Overdrive, Ext. Color Spruce Green. Stk#H20212A 1998 CADILLAC DEVILLE$5,991 GREAT PRICE!4 door, Sedan, Automatic With Overdrive, Ext. Color Gray. STK#T11141B 2003 CHEVROLET VENTURE$5,999 GREAT PRICE!4 door, Extended Mini Van, Automatic With Overdrive, Ext. Color Bronzemist. Stk#T11175A 2007 CHEVROLET IMPALA LT$9,997 AUTOMA TIC!4 door, Sedan, Automatic With Overdrive, Ext. Color Silverstone. STK#C11697B 2006 HYUNDAI SONATA$10,941A MUSTSEE!4 door, Sedan, Automatic With Overdrive, Powder White Pearl. STK#T11070B 2003 FORD F-150 XLT SUPER CAB$10,993GREAT PRICE!4 door, Super Cab Pickup, Automatic With Overdrive, Silver. STK#M11045B 2008 MITSUBISHI GALANT DE$11,591LOW MI LES!4 door, Sedan, Automatic With Overdrive, Ext. Color Liquid Silver. STK#H20084A 2003 CHEVROLETAVALANCHE 1500$11,991GREAT PRICE!4 door, SUV, Automatic With Overdrive, Ext. Color Summit White. Stk#T10469A 2010 GMC CANYON WORKTRUCK REGULAR CAB$16,551LOW MILES ONLY 24,105!2 door Regular Cab 5 Speed Manual Ext. Color Fire Red, STK#C11713A 2011 CHEVROLET IMPALA LT$18,954A MUSTSEE!Automatic With Overdrive Ext. Color Silver Ice, STK#PC5744 2007 CHRYSLER SEBRING$13,541A MUSTSEE!4 door, Sedan, Automatic With Overdrive, Ext. Color ModernBlue Pearlcoat. STK#D11635A 31 MPG! Now Thru September 30th Get Closeout Pricing on over 2,000 New and Used Vehicles! St op in and register to win one of 15 prizes given away! Dra wings each Thursday! PRIZEGIVEAWAYSEVERY THURSDAYTHROUGH SEPTEMBER30TH! PRICESSTARTING $ 5941AS LOW AS All New 2011 HYUNDAIACCENT GLSSTK#H20167, AUTOMATICOr lease for$139Buy now/MO.$15,986 51 MPG! New 2011 HYUNDAISONATA GLSOr lease for$179Buy now/MO.^$20,650STK#H20057 All New 2011 DODGEDURANGOSTK#D11141 O r for$369/MO.***Buy now$27,975With $2500 Down New 2011 RAM 1500 STBuy now $ 22 870STK#D11323 NO PAYMENTSFOR90 DAYS! ~ COROLLANEW 2011 TOYOTAStk#T11189$14,972$199/MO~Or Lease For AUTOMATIC! Sign & Drive!BUY NOW New 2011 GMC ACADIA STK#CG11172Was$35,279Buy Now $ 30 491Or 0 % For Up To 60 Months 2009 DODGE GRAND CARAVAN SE$18,991LOW MILES!4 door, Mini Van, Automatic With Overdrive, Ext. Color Stone White Clear Coat. Stk#D11610B 2008 CHEVROLET COBALT LS$11,991LOW MI LES!2 door, Coupe, Automatic With Overdrive, Ext. Color Summit White. Stk#PC5808 2009 FORD MUSTANG V6 DELUXE$18,941A MUSTSEE!2 door, Convertible, Automatic With Overdrive, Ext. Color Dark Candy Apple Red. Stk#H20136A 8518963 1 I i PIJLI111 I\UTO IlTtIJ\LL 3TOYOTA.4 )Tj-0.0395 Tc 13.1053 0 0 4 509.6725 1012.923 Tm(;i' Pu # i 1 '_-Nrlpr.F xid. f:thi ancrr1 1)Tj/TT0 1 Tf-0.2045 Tc 7.5455 0 0 4 1064.6725 1002.9233 Tm(1 1llll ")Tj-0.0262 Tc 1.9762 0 0 10 530.6725 988.9237 Tm()Tj-0.1333 Tc 18.4444 0 0 10 531.6725 986.9238 Tm(.' )l)-406(llllf i)-71(ll)15(ll)Tj/TT0 1 Tf0.1393 Tc 16.4271 0 0 4 447.6725 946.425 Tm(-f LJ 1I I I l I l l f l' l I S l '.III i)lt ) .J'1 l t l!J Jt ic.1R Z J a' 1! '1I 5.. -!! I _ -. )Tj/TT0 1 Tf-0.0485 Tc 10.0606 0 0 5 491.1725 877.9271 Tm(J G I l E)75( --THUR)16(SD)16(` THROUGHJaVl)64(wv 61 a)85(fflfUoaLDAu S'E:P1E: i61E:R OiS1 BTH, --sue.n0)]TJ-0.2551 Tc 29.6429 0 0 14 386.1725 732.4315 Tm( Dh. F J)-107()]TJ0.1355 Tc 7.0854 0 0 6 1248.6725 688.9329 Tm[()110(r.IJ .. ..)Tj-0.0652 Tc 7.2174 0 0 4 341.1725 578.4362 Tm(} + I I1'S 0 0 S'Tr i I lW(/: .)Tj0 0.502 0 rg0.0046 Tc 3.4583 0 0 9 1152.6725 496.9387 Tm(_ o 0,)Tj-0.4762 Tc 27.6667 0 0 7 1162.1725 485.4391 Tm(. .)Tj/TT0 1 Tf-0.1403 Tc 8.7368 0 0 3 1223.1725 464.9397 Tm(O Tti. : )Tj0 0.502 0 rg/TT0 1 Tf-0.0149 Tc 0.9881 0 0 8 218.1725 445.4403 Tm()Tj0.506 0.187 Td()Tj-0.3631 Tc 21.7381 0 0 8 257.1725 430.4408 Tm(::,1 rq: d o )-135(f )Tj1 0.502 0 rg0.585 0 Td()Tj0 0.502 0 rg-0.1358 Tc 16.9074 0 0 9 776.6725 366.9427 Tm(r 1)72(4: ./1`111: II03 i .)Tj-0.15 Tc 10.375 0 0 5 397.1725 243.9465 Tm(ivu [ S mazalip I .rn1r a iL___...................................... .. ........................................

PAGE 39

The Sun Classified-Section A Page 14E/N/C/VSaturday, September 24, 2011 South Floridas Volvo DealerVolvo of Fort Myers 2600 COLONIAL BLVD FT MYERS, FL 33907Sales 877.865.86 76 Ser vice 239.313.4412 les 877. 8 8 6 5 5 .8676 Serv ice 239.313.44 ON LINE AT www.volvoftmyers.com Monday Thursday 9am-7pm Friday 9am-6pm Saturday 9am-5pm Sunday 12pm-4pm2600 COLONIAL BLVD FT MYERS, FL 33907Sales 877.865.86 76 Ser vice 239.313.4412 PLUS... Special Financing Available All Month!CHOOSE FROM DOZENS OF PRE-OWNED VEHICLES 4 YEAR A nniversary E vent! VOLVO OF FORT MYERS invites you to join the celebration! Save thousands on every new or pre-owned vehicle in stock!Plus Tax, Tag and Dealer Fees. STOCK #R1928 2006 Volvo S60LEATHER, SUNROOF 11311B$1 0,887 ONLY2009 Ford FocusSE, ALLOYS, GAS SAVER R1863$11,995 ONLY2007 Jeep Wrangler R18232 DOOR, 4 X 4 AUTO, LEATHER, REDUCED!2009 Mini Cooper R1887$17,995$18,999 ONLY ONLY2008 Audi A4 R1886TURBO, SUNROOF, LOADED!2010 Hyundai Sante FeLIMITED, 18,000 MILES, LOADED! R1872W$19 ,986$22,783 ONLY ONLY2006 Jeep LibertySPORT MODEL, LOW MILES! 12035B$9,995 ONLY CLEAN!2005 Ram 1500 R1920A$14, 995 ONLY R1875 $13,9742011 Suzuki SX4AWD, 3500 MILES! ONLY R1835A 2009 Dodge Caliber SXTALLOYS, AUTO$1 3,995 ONLY2006 Toyota CorollaS MODEL. ALLOYS, AUTO R1828A2006 Pontiac TorrentEXTRA CLEAN SUV R1892A$9,995$9,995 ONLY ONLY 2009 Volkswagen JettaLOW MILES, AUTO, SPORTY R1888$13,884 ONLY ALLOYS, AUTO2007 Mazda 6 R1792$13 ,895 ONLYAll vehicles are Plus Tax, Tag and Dealer Fees. Pictures are for illustration purposes only. See dealer for complete details. ONLY $ 33,995 2011 Volvo XC60 All vehicles are Plus Tax, Tag and Dealer Fees. Pictures are for illustration purposes only. See dealer for complete details. 8529010 WILDESOCIALNETWORK FA N&FOLLOWERSPECIALS Pre-OwnedEmployee PricingSaleSALEENDSSUNDAY,OCTOBER2ND!**1.9%APRfor48months,$21.65per$1000borrowed,2.9APRfor60months,$17.92per$1000borrowedonallCertiedPre-OwnedVehicles. Buyersmustqualify.Offerends10/2/11.87 7211-8041 4883CLARKROAD,SARASOTA WILDELEXUS.COM38RXSUVS INSTOCKONALLPRE-OWNEDRXSUVS ANDALLPRE-OWNEDESSEDANS35ESSEDANS INSTOCKBUYLIKEOUREMPLOYEESAT$500OVERCOST!PLUSCERTIFICATION,TAX,TAGSANDDOC.1.9%Av ailableonallCertied Pr e-OwnedVehicles.** FURNITURE6035 MATTRESS Pillow top, Full $30 941-743-7747 SLEEPER SOFA queen size thick 5in.matress like new $295 941-473-2150 SOFA & loveseat Clean and excellent condition. $130 941-240-0123 SOFA & loveseat Tommy Bahama style, in good condition. $850 941-276-1956 SOFA BEIGE microfiber. Like new. Lv. msg $300 941-2550237 SOFA BLUE/GRAY, r eclines good condition $50 941-4265875 SOFA like new, beige sofa, 2 glass end tables & coffee table $595, OBO 941-284-2414 SOFA New Beige leather Sofabed, Queensize & Electric Recliner. Must Sell, Best offer $900 941-492-6011 SOFA SET Red microfiber can txt pics $200 941-286-1651 SOFA SLEEPER queen size sofa sleeper good cond r ose color $25 941-548-8299 SOFA YELLOW/RED/GRN Floral HAVERTY $200 813240-0844 SWIVEL ROCKER Rattan w stool excellent condition $95 941-766-1582 SWIVEL/ROCKER CHAIRS (2) EXCELLENT CONDITION $250 941-460-8528 T ABLE, OAK pedestal, 54round, beautiful. $375 941-639-3887 TRUNDLE BED Excellent condition $150, OBO 941-2551255 WICKER BAR LN,sturdy 44x40H w/3 stls, glass shlvs & top. $325 941-698-1042 WROUGHT IRON Barstools (3) Pretty. sturdy. Lt Copper clr $300 941-716-3259 FURNITURE6035 DARK BROWN leather couch $110 941-623-3496 PA TIO SET large table 6 chairs umbrella. $95, OBO 941-629-5576 PA TIO SET lg.hvy stone like table 6chairs w/cushions $200 941-830-8778 PA TIO SET: Hampton Bay r ound table 4 mesh chairs tile top exc.cond $200 954-8095325 PA TIO TABLE w/4 chrs, rattan & faux bamboo, 42sq. 37h. $450 941-639-3887 POKER TABLE w/6 chairs, never used, asking $650 obo. James $650. 941-391-3362 POOL TABLE 4x8,slate,LN cond. w/acc. Buyer removes. $495 941-698-1042 QUEEN BED serta w/frame nice $100 941-624-5725 QUEEN HEADBOARD w/nightstand, Tropical/walnut color $200 941-429-8507 RATTAN DINETTE FOUR CHAIRS,GLASS TOP TABLE $135 941-626-5501 RECLINER & Loveseat Blue Gd Cond. Non smkng home. $125, OBO 941-544-5755 RECLINER LA-Z-BOY Burg., full, very comfy, good cond. $45 941-743-0348 ROLLTOP DESK Dbl pedestal, 7 drawer, early Am. style, gd cond. $175 941-474-6912 SLEEPER SOFA NEUTRAL COLORS N/S $100 941-4937238 SLEEPER SOFA QUEEN LOVELY, CAN DELIVER $200 941-493-7238 FURNITURE6035 GUN CABINET WOOD Glass front, storage space on bottom. $150 941-626-7452 HEADBOARD FULL size, dark antique brass finish new condition $30 941-575-1393 HEADBOARD KING great cond light wood $15 941548-8299 HUTCH & T ABLE SET CAN EMAIL PICS. NICE $250 941493-7238 LADIES 9 Drawer Desk Dark wood 8 side drawers 1 middle $75 941-457-6034 LANAI FURNITURE 2 round tables w 4 chairs $50/set; One alum. glider and one wooden loveseat $40/ea 941-468-1146 SOFALEATHER 3 cushions. Lt Tan. Like new. $125 941637-7032 LOVESEAT & matching chair exc. cond $350 941-492-7198 LOVESEAT, ROBIN Bruce ivory slipcovered, like new $325 941-716-3259 NIGHTSTAND SOLID mahogany, 4 drawers, traditional $40 941-627-6542 OCCASIONAL TABLE w/ magazine rack. Solid wood. V enice $15. 941-544-5755 OFFICE DESK metal, light beige, 30 X 60, 2 dwrs. on left $49 941-662-0063 ORIENTAL ROOM Divider black, bamboo both sides, very good cond. $125 941662-0063 PA TIO FURNITURE table 4 chairs and a glider nice set $50 941-473-2150 PA TIO LOUNGE chair w/ottoman, rattan,very nice. $150 941-639-3887 PA TIO SET 48GLASS TABLE 4 SWIVEL SLINGBACKS $175 941-447-8149 I o1Uvoof FT. MYERSDnRr ep AN Avg a on" Ar7LEXUS OF SARASOTAi -'CERTIFIED PRE-OWNED-ONLY AT YOUR LEXUS DEALER-

PAGE 40

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 15 MEDICAL6095 WALKER FOLDING 2 FRONT WHEELS NEW CONDITION. $15 941-627-9736 Pt Char WHEELCHAIR LIGHTWEIGHT Invacare(new)SX5 $125, OBO 941-391-4628 WHEELCHAIR LIKE New $75 941-629-7880 HEALTH / BEAUTY6100 CERAMIC FLAT Iron Tool Science. Barely used $20 941-628-6371 CG OUTLAST Smoothwear lipcolor&moisturize #865 have 11 ea. $6 941-628-6371 WIG LONG WITH ORANGE HIGHLIGHTS $14 941-6395966 TREES & PLANTS6110 CROWN OF THORNS PLANT IN 3 GAL. POT. RED. $5 941258-2016 ORCHID TREE ONLY ONE, WHITE 3-4 FT. TALL IN POT $10 941-258-2016 P ALM TREE Six foot tall specimen quality. $25 941-8333326 PAPAYA PLANT in 1 gallon pot $4 941-697-0794 ROYAL PALM 7-8 $15 or 2/$25 941-380-7146 BABYITEMS6120 BABY MONITOR Safety 1st Brand 2 channel exec cond $8, OBO 941-698-9304 CRIB MATTRESS SEALY ULTRA BABY,NEVER USED $40 941-624-5725 CRIB, DELTA, PERFECT, CHERRY,NEW,3IN 1 $125 941-624-5725 DIAPER BAG/BACKPACK, COLUMBIA navy blue, $18 941-769-1771 JOGGING STROLLER JEEP jogging stroller great condition 1 year old $55 941-916-1657 STROLLER BABY Tr end T an/Pink exc. cond! like new! $45 954-809-5325 GOLFACCESSORIES6125 BATTERIES (6) 6VOLT Golf Cart batteries. New, Leading brand, 12mo warr. Limited Qtys. Exchange/cash&carry $399 941-769-1431 GOLF CARTEZ-GO Golf cart brand new batteries,cart in r eal good shape $1,200 941-468-4110 GOLF CART, Club Car, 2003, new windshield, roof, lights, & batt. Spare tire, fold down rear seat for storage, good cond. Charger incl. $2,700. 941255-9953 or 440-897-7440 GOLF CLUBS Mens set of clubs with bag $35 941-6244617 GOLF POLO shirts Heron Creek Pro shop name brands. L & XL $7 941-626-0680 PUTTER NIKE ignite like new. $50 941-286-2602 TITELIST CART pull cart ex cond $20 941-575-1393 EXERCISE/ FITNESS6128 BOWFLEX EXTREME hardly used, excellent condition, mat included $450 941-662-0063 MEDICAL6095 2-WHEEL WALKER or Bedside Commode, Nice Condition, each $20 941-629-7880 BLOOD PRESS. Kit Auto/dig/Homedics/dual. $10 941-624-2105 BLOOD PRESSURE MONITOR AUTOMATIC NEW IN BOX COST 75 SELL $50 941-2689029 EMSI-2001 ELECTRIC Stim.Mobile unit(back) $499, OBO 941-235-9885 FOLDING WALKER Medline 2-button, 2-wheel, brand new $30, OBO 941-587-5512 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** LIFT CHAIR BRAND NEW, brown $450. OBO. 941-764-1725 LIFT CHAIR BY PRIDE, BRAND NEW, NEVER USED, W/FACTORY WARRANTY $499 941757-9049 LIFT CHAIR Electric,recliner, works great, comfortable $395 941-580-1921 LIFT FOR scooter Power lift fits 1 1/4 hitch on vehicle $499 941-639-5611 NEEDAJOB? CHECKTHE CLASSIFIEDS! MATTRESS CYCLO PEDIC single, adjustable bed,Great Condition $50 941-629-7880 POOLLIFT Aquacreek, great condition $800 941-474-7252 POWER WHEELCHAIR Golden Technologies Compass (new). $275 941-391-4628 SCOOTER MERIT 4 wheel scooter, red, charger and basket used on 2 cruises $499 941-639-5611 SHOWER BENCH Like New $40 941-629-7880 WALKER 4-LEGGED with food table $50 941-237-1085 WALKER BLUE Hugo Walker with front wheels and back skids $30 941-457-6034 ANTIQUES COLLECTIBLES6070 HESS TRUCKS 27 trks ,,86-2010 LN take all $270 941-474-4550 HESS TRUCKS All new in boxes 1994 and up $475, OBO 941-467-5716 HESS TRUCKS, 12 trucks from 1988 to 2006. NIB. Each $50, OBO 941-626-5099 HOT WHEEL COLLECTION and BOOKS 941-875-0078 HUMMELL&ROCKWELL PLATES $10, OBO 941-6233723 IRON SKILLET V intage 8 $20, OBO 941-408-4596 JEFF GORDON 1999 Nascar stars of racing figure and card still sealed $10 941-2352330 MEMORIAL COIN 9-11 Twin T owers engraved on it, w/ case. $15 941-423-2585 MILK GLASS VINTAGE GOBLETS 6 mint s footed COLLECTIBLE $40 941-639-1517 MUSIC CARDS 1991 proset still sealed box of 36 packs $5 941-235-2330 NORMAN ROCKWELL VINT AGE PLATES orig boxes-bargain! Ea $15 941-639-1517 PUNCH BOWL Set Jeanette Glass Co. $15 941-6242105 PYREX CASSEROLE white with green $15, OBO 941-408-4596 SOFA, beautiful Victorian, beautifully carved, 1st $100 takes it. 941-769-2389 TEA POT Lenox butlers pantry tea pot new in box $20 941-766-0464 TV 1950S Philco Predicta w/orig. stand. $350, OBO 914-626-5099 VAN BRIGGLE Indian Plaques, brave and squaw, beautiful aqua, both $250 941-6620063 VICTORIAN FLOOR Lamp wrought iron with marble base $100, OBO 941-255-9788 YELLOW BOWL Oxford Stoneware no chips or marks $15, OBO 941-698-9304 FRUITS & VEGETABLES6075 HUGE ORGANIC MANGOS $1.50 AVACADOS $1.00 Rotonda. 941-214-0770 MUSICAL6090 ALTO SAX FE Olds & Sons Great Condition $150, OBO 941-883-1786 CDS, LPS BE-BOP,JAZZMint $3 941-421-9964 DEAN ACOUS./ELEC.PLAYS & sounds great. $120, OBO 941-258-5698 GIBSON LES Paul Cherry Mint. Cond. Great Action $490 941-883-1662 GUITAR ACCST. custom new pro.dreadnut,great $225 786306-6335 GUITAR FENDER Acoustic and case $75 941-625-5374 Guitar lessons platinum selling artist taking on new students 941-916-8040 PIANOBALDWIN Used. In good condition. Need tuning. $200 941-286-7229 PIANO KEYBOARD Casio CTK-720, w/ stand, Exc. Cond. $50 941-627-2192 RECORDS (105) 45RPM $75 941-496-9252 TURNTABLE STANTON ProDJ ex. cond $400, OBO 941626-2832 COMPUTER EQUIPMENT6060 WORD PROCESSOR Smith Corona $25 941-764-8594 CLOTHING/ JEWELRY/ ACCESSORIES 6065 BIRKIS SANDALS New in box size 6.5/7 Lille-Oak Linen $30, OBO 941-764-9100 CLOTHES JUNIORS szs3&5 s&m misc newer washed NP ANY6 $25 941-544-1128 CLOTHES LADIES, dresses, pants, tops, sweaters, S-M. $10, OBO 941-698-1039 HANDBAG D&GKnockoff sm striped, tan/oran/teal/wh. brnd new $25 941-628-6371 LADIES SCRUBS Nice small & x-tra small tops and bottoms $3 941-276-9580 LEATHER BIKER VESTXL w/fringe UNISEX, New..ONLY $25 941-493-3851 LEATHER COAT ladies small r ed knee length/waist length vgc $65, OBO 941-306-8650 LEATHER JACKET mens bomber style, like new w/zip-in lining $50 941-639-1517 MENS ALPACA sweaters Six sweaters, solid colors-Sz. L & XL. Each: $39 941-505-5747 MENS SPORT coats Size 42R, like new (3)coats. Each: $59 941-505-5747 MOTORCYCLE JACKET Alpine, fully padded, red-black $80 941-929-5432 SNEAKERS LL Bean Mary Jane sz 8.blue/white worn once $20 941-628-6371 WEDDING DRESS JESSICA McCLINTOCK Ivory, Sz 11 $40 941-460-8189 ANTIQUES COLLECTIBLES6070 2 PC stepback cupboard 4x7.storage.glassdoors.exc. $350, OBO 941-235-2203 80S COLLECTION r ock bands full color embroid. emblems $20 941-743-0348 ALWAYS BUYING ANTIQUES, ART, SILVER NEW ENGLAND ANTIQUES (941) 639 -9338 ANTIQUE CLOCK Clean TELECHRON 7H133 $20 941-544-0042 ANTIQUE TRUNK-BERBER Wa rdrobe-From 1890-1920s $400 941-276-8970 A VON CAPE Cod ruby collection. Cup and saucer. $24 941-764-5804 BALD EAGLE Freedom signed Paul Rankin, $499 ask for Pat 941-429-2037 BED IRON V intage full size $150, OBO 941-408-4596 BENTWOOD ROCKER ornate design, needs new seat $35, OBO 941-255-9788 BOOKS VINTAGE hard cover $5, OBO 941-408-4596 CASH PAID**any old military items, swords, medals, uniforms, old guns. Dom (941)-416-3280 CEDAR CHEST exc. cond. cedar & walnut chest $275 941-380-3000 CUCKOO CLOCK $60 239481-2832 DELFT WINDMILL music box ec $50, OBO 941-306-8650 FRIENDS MEMORABILIA trivia game & commemorative mags Exc $25 941-629-7449 HALL DOUBLE Boiler Copper and pottery. $15 941-6242105 HESS TRUCK 1994 Rescue T ruck NIB $50, OBO 941-6989304 TV/STEREO/RADIO6040 20 T.V. $10, OBO 941623-3723 CDS ROCK&ROLL 60s &70s $6, OBO 941-2585698 DIRECTV REMOTE RC24. great shape. $10 941-2352330 RECORD ALBUMS $299 941-549-0475 STEREO older fisher receiev sonyCDplayer cabnt speakers $99 941-544-1128 TELEVISION 32 T oshiba, older table top, great picture $40 941-929-5432 TV 13 SANYO color tv w/ r emote, exc.cond $20 954809-5325 TV 20 ORION w/remote looks and works like new. $20 941-627-9736 Pt Char TV 21 SYMPHONIC W/remote just like new. $25 941-627-9736 Pt Char TV 25 Sanyo perfect color $35, OBO 941-421-9964 TV 37 LCD TV, 3 month warranty $300 941-627-1647 TV 55 Samsung w/custom table. Needs color wheel. $200 941-456-4135 TV MAGNAVOX 20 built in DVD & game ports $30 941475-7507 TV RCA 32 console, good picture & sound $50, OBO 941-256-6962 PUTCLASSIFIEDS TOWORK FORYOU! FIND A JOB! BUY A HOME! BUY A CAR! TV RCA, 24 in, w/matching DVD/VCR. $75 941-7648594 TV SANYO 25 works fine $40, OBO 941-626-2832 TV SONY 42 projection LCD, New Lamp. Works good $175 941-475-2861 TVSONY 53 projection tv. Good picture, good shape. $150 941-276-1956 TV SONY 55 grand weega $250 941-493-0133 TV, Sony 50 needs color adj., r ear proj. $250 941-6973754 COMPUTER EQUIPMENT6060 COMPUTER APPLE G3 with monitor & printer. $300 941-697-3754 COMPUTER CHAIR Gray fabric, adj seat and arms, like new $35 951-624-5745 DAVEIN-HOUSE-OFFICE computer repair, set-up Serving Charlotte Co. 10+yrs 941-629-6337 DESKTOP PC tower XP sys.up2date, 1yr antivirus (refub) $80 941-639-1113 LAPTOP COMPAC with windows xp exc condition $135, OBO 941-306-8650 MONITOR 19 inch. $20 941764-8594 MOUSE,KEYBOARD,SPEAKERS, OFF brand.New in box. $19 941-276-1881 PRINTER HP Color Laserjet 3600N like new $225 941380-3000 PRINTER LEXMARK new in box $70, OBO 941-626-2832 ROUTER, LINKSYS WRT54G V3 w/latest DDWRT installed, good condition $30 6970794 ELECTRONICS6038 60GB HARDDRIVE 60gb Hard drive for Xbox360. $35 941-276-0271 AMPLIFIER 75W 12V 5ch amp+1.0 Farad Capacitor $100, OBO 941-629-4940 BBERRY 8530 clean ESN. case, home & car chrgr. Exc. Cond. $50 941-544-5755 BLU-RAY & DVD Player SONY HD 5.1 Dolby Clean BDP-S300 $40 941-544-0042 CELL PHONE METRO PCS-1 week oldincludes charger$40 941-237-1085 CELL PHONE MOTOROLA CITRUS NEW IN BOXLIST 249.00 ASKING$150, OBO 941-429-1591 CELL PHONE Samsung Reality $35 941-256-1037 CONSOLE STEREO black 6 disc, dual cassette $250, OBO 941-429-8507 ELECTRIC TYPEWRITER dictionary.w/bbok&cover. 169.00 new. $55 941-235-2203 FRANKLIN ELECTRONIC scoring arcade basketball game $58 941-697-1102 GPS MIO Moov 300 hardly used $125 941-564-8770 PS2 GAMES (6) MORTAL KOMBAT&MORE,GREAT COND. $20 941-460-8189 QUARTZ TUNER/AMPLIFIER/RECEIVER Onkyo a steal @ $78 941-697-1102 TV/STEREO/RADIO6040 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** illill illilli lllllllll 11111111 1111111111111*40000000 Lwm 111111111111111111111IIIIIIIIIIIIIIIIIIIIIIilllllllllllllllllllllilillillilillillillilliftmoooooooooDO ODDOD00 0 c )Tj-0.3572 Tc 244.6316 0 0 33 504 72.0341 Tm(0

PAGE 41

The Sun Classified-Section A Page 16E/N/C/VSaturday, September 24, 2011 DOGS6233 NOTICE: Statute 585.195 states that all dogs and cats sold in Florida must be at least eight weeks old, have an official health certificate and proper shots, and be free of intestinal and external parasites. BORDER COLLIEPUPS Reg, Working parents, 941-624-0355 or 875-5253 CHIHUAHUA PUPPIES FOR SALE Call 941-623-8926 GERMAN SHEPHERD Pups. CKC Cert. $600-$700 OBO. Can work on $ Male/ Female. Mom on-site. (941)256-4883 MALTESE PUPPIES 8wks, Adorable, Tiny, shots, health cert $450 863-7734308 RARE BRUSSELS GRIFFON 9wks 1F 2M Health cert $20 0 each 941-661-9081 SHIH TZUS8WKS OLD $499 2 FEMALES 941-681-1016 SHIH-TZU PUPPIES Registered 941-276-9498 YORKIE-POO PUPPY, Black & Gold, 3.5 lbs, DOB 5/12/11 $1100 call 863-244-4182 PETSUPPLIES & SERVICES6236 AQUARIUM 10 GAL WITH GRAVEL ONLY $5, OBO 941268-9029 AQUARIUM 72GAL Salt Wtr live rock and lots of accessories. $495 941-698-1042 DOG CAGE black wire w/tray 24x18x21 high like new $29 941-627-9736 Pt Char FISH TANK 5gal hexagon tank, stand, filter, hood & decorations. $25 941-276-0271 PET CARRIER/CAGE 16W23L-17H exc cond $25, OBO 941-423-2875 PET CARRIER: Canvas Print T ote for travel,etc.Unused.Nice. $25 941-276-1881 APPLIANCES6250 $40 SERVICE CALL The Areas most trusted Appliance Repair Service. We can fix it! 941-473-9484 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** ADVERTISE In The Classifieds! T OOLS/ MACHINERY6190 PVC FITTINGS 850 ASST.PIECES $200 941-4757577 RACHET 1/2 NEW CRAFTSMAN COST OVER 30 SELL $15 941-268-9029 RAMPS & CHOCKS HD car ramps for oil chg. etc $20 941-575-1393 SCROLL SAW Dremel 16 2 speed $45 941-423-9371 STATIONARY MITRE saw B&D, new spare carbon steel blade $60 941-423-2585 T ABLE SAW 12 Full Size table $250, OBO 941-2140453 T ABLE SAW Craftsman 10 in. T able Saw $200 941-7162493 T ABLE SAW Craftsman 10, stand, extras, North Port $250 941-769-2956 T ABLE SAW Craftsman 10, stand,extras. $225 North Port 941-769-2956 TOOL BOX SEARS 9 DRAWERS 2 SHELVES, COST 499. SELL $250 941-268-9029 TRANSIT DEWALT with case, tripod. good cond. $80 941929-5432 WANTED USED MECHANICAL PLATFORM SCALE 500lb capacity or more. Call 941-416-6293 WEEDWACKERECHO EXCELLENT MACHINE,RUNS GREAT $50 941-460-8189 WET TILE cutter Chicago $39 941-625-8956 WRENCHES, STD & METRIC NEW CRAFTSMAN. COST 80. SELL $50 941-268-9029 OFFICE/BUSINESS EQUIP./SUPLIES6220 OFFICE OUTFITTERSPre-owned & new office furniture. VENICE 941-485-7015 FILE CABINET 2 drawer lateral $45 941-698-6692 STORE SHELVES & Stands Like new formica different size $100, OBO 941-629-4444 RESTAURANT SUPPLIES6225 CANDY VEND Machine V endesign 4 section takes quarters $65 941-629-7449 LOBSTER TANK $450 941-697-6666 BIRDS6231 B&G Macaw pd.$1800.00 First $395 cash takes it Illness forced to sell 941-740-2152 EXOTIC BIRD EXPO At Charlotte CountyFair Grounds Sun. Sept 25, 9am-4pm 941-276-1561 info at: companionbirdclub.com CATS6232 NOTICE: Statute 585.195 states that all dogs and cats sold in Florida must be at least eight weeks old, have an official health certificate and proper shots, and be free of intestinal and external parasites. BUILDING SUPPLIES6170 GARAGE STORAGE cabinets Old kitchen cab. used in garage. $50 941-661-5480 KITCHEN CABINET 4 white, dbl stnless steel sink gd cond. $60 941-474-6912 LUMBER: 5-2X6X12, 22X6X11, 1-2X6X5.$15, OBO 941-979-8730 SECURITY LOCK SCHLAGE key pad and handle NIB $110 941-697-8457 VANITY SINKS (2) Corian White Oval w/backsplash NEW IN BOX $50 941-624-0121 WATERSYSTEM KINETICO $495 941-496-9252 WINDOW ANDERSON Comp. made. Still in box. White vinyl double pane. $79. 941-6294444 WINDOWS, 17X34 TEMPERED GLASSwhiteframe fixed windows $50.00 each 941-697-3754 WOODColumbia Wood Prod (34 pcs.) 1/2x48x96 Walnut & Birch $375 941-624-0121 HEAVY/CONST. EQUIPMENT6180 WANTED USED MECHANICAL PLATFORM SCALE 500lb capacity or more. Call 941-416-6293 T OOLS/ MACHINERY6190 10 TILE W et Saw 2HP with stand like new. Call George $375 941-380-4464 ALL IN 1 CUTTING SYSTEM UNIQUE HAND HELD COST 150 SELL $70 941-268-9029 ASSORTMENT SCREWS, bolts, etc $10 941-564-8770 B&D 2-SIDE case w/asst.drill bits,driver heads.No handle. $8 941-276-1881 BAND SAW 12 2 wheel Craftsman. Extra blades Ex. cond. $125 941-475-9689 CHAINSAW & sawsall batt. Roybi,18volt,good $99 786306-6335 CHOP SAW Delta w/attachments Exc cond $45 941423-9371 CIRCULAR SAW Craftsman mdl#207.25530, vintage, $80 571-251-4101 COMPRESSORKOBALT 60 Gal. Compressor. In Great Condition. $335 941-716-2493 COMPRESSOR SPEEDAIR 3HP Briggs gas good cond $300. 941-639-7558 DETAIL HAND SANDER CRAFTSMAN NEW IN BOX W/ CASE $30 941-268-9029 DIAMOND TIP blade new 9 wet tile blade $20 941-2281745 ELECTRIC SANDER Craftsman H.D. $10 941-228-1745 GENERATER B&S 5550 watts 8550 starting 10Hp $385, OBO 941-475-7507 GENERATOR COLEMANPOWERMATE.6250 Wat ts, 10HP.Used very little. No r oom to store. $300 941426-2466 LAWNMOWER ENGINE 6.5 HP WITH BLADE,RUNS GREAT. $30 941-460-8189 PLANER DEWALT 735 Planer. Excellent Condition. $350 941-716-2493 PLANERRIDGID 13 Inch, Used but Excellent Condition. $250 941-716-2493 PULLING CART / dolly / hand truck, Greenlee 2 wheel wire $150 941-626-0680 LAWN & GARDEN6160 ANTI GRAVITY Recliner Blue very good shape $25 941429-9120 ANTI GRAVITY r ecliner camouflage pattern. $25 941-429-9120 BLW,VAC,MLCH CRFTMN, Exc.Cond. $75 941-3917531 CONCRETE BOARDERS FOR LAWN/GARDEN $2 941-237-1085 CUTTING PONY of a tractor, 42 craftsman w/owners manual. $450 941-412-1966 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad and the price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** HEDGE TRIMMER B&D Exc.Cond. $50 941-3917531 PUTCLASSIFIEDS TOW ORKFORYOUV enice,Englewood, North Port 2 2 0 0 7 7 1 1 2 2 0 0 0 0Pt.Charlotte Areas Call 2 2 0 0 6 6 1 1 2 2 0 0 0 0 LANAI SWING Call after 10:00 AM $50, OBO 941639-1228 LAWN MOWER Self Propelled, Toro 21 $70 941485-0681 USED LAWN MOWERS *Riders, Push & Parts. 941-268-0917 or 416-1109 NEW AD Push Mower $40, OBO 941-623-3723 PA TIO TABLE w/ large umbrella 4 chairs on casters $150 941-564-8770 PUSH MOWER Murray, exc. cond. $125 941-391-7531 TIKI BAR New, 3 x 6 U pick top color. $425 941-6612667 TRACTOR TIRES 8 CARLISLE TURFSAVER 13x5.006 brand new $130, OBO 941-6616941 WANTED: NON-RUNNING LAWN MOWERS, NO RIDERS CASH PAID! 941-286-3119 STORAGE SHEDS/ BUILDINGS6165 SHEDRUBBERMAID 6x6 storage missing panel txt pic $200 941-268-5413 BUILDING SUPPLIES6170 ALUM HURRICANE Panels 16 68X15, 5 86X15, 3 Clear 70X15 $300 941-276-8970 BR SINK w/ cabinet 24inch white drop in sink with white cabinet. $25 941-474-6912 COUNTER TOP CORIAN, gray, very clean, 4 different sizes. $235, OBO 941-6294444 FIREARMS6131 GLOCK 45 ca. Model 36 Concealed carry gun $500. 941-661-8953 SPRINGFIELD XD 9mm pistol, 3 mags, mint cond. in box. Concealed weapons permit r equired.$525. 941-492-4503 BICYCLES/ TRICYCLES6135 3 BICYCLES ladies for all $75 941-629-5576 BICYCLESTREK matching his/hers for trail/road $450 941-628-4520 BIKE 18 Girls Training wheels & knee pads incl. CASH $30 941-629-6850 Classified = Sales BIKE CARRIER RHODE GEAR 2 BIKE CARRIER USED ONCE $40, OBO 941-698-9899 BIKE, TREC GIRLSCoaster $325 941-496-9252 FRONT RIM NEW, ALUM, FOR 26 BIKE. SHOP CHARGE 53. SELL $35 941-268-9029 TRICYCLE MIAMI SUN Excellent condition Hardly used. $250, OBO 941-545-2176 TRICYCLE totallyrestored. Asking what was spent. Must see!!! $450 941-268-2147 T OYS6138 CHILDS SLIDE STURDY, SAFE, INDOOR/OUTDOOR. $15 941-258-2016 FISHER PRICE ride on /bouncing zebra, looks new, $20, OBO 941-769-1771 LITTLE TIKES outdoor gym/slide,faded $10 941769-1771 TOY CHEST Tiny Tykes bench $15, OBO 941-979-8730 TOY GIRAFFE 4 Ft. Stuffed Giraffe, Exc. Condition. $50 941-627-2192 PHOTOGRAPHY/ VIDEO6140 CAMERA CANON 35 mm sure shot max date /w 3 rolls of film $40. 941-628-6371 CAMERAPANASONIC lumix DMC-TZ3 10X ZM Call for details $75 941-625-1328 DIGITAL CAMERA ricoh RDC2E complete w/case&cables $50 941-697-3754 MOVIE SCREEN 38X39 Free standing, no wrinkles or tears. $20 941-475-2861 POOL/SPA/ & SUPPLIES6145 **SPAS & MORE**TRADE-INS WELCOME We buy used & move hottubs. Many used to choose from $100 and Up 941-625-6600 HUGE-A HOT TUB SAVINGS HOT TUB Fits in corner. Used 1 mo. Paid $3700 Asking $2,000 941-255-3831 HOT TUB SWIM SP AS 5 PERSON SPA W/ LOUNGER $1595 SWIM SPA LOADED $8995 941-462-0633 POOL BASKETBALL/VOLLEYBALL Set. New. $75 941-766-1582 PUMP, HAYWARD 1 1/2 HP Self priming. Like new. $200, OBO 941-830-8161 EXERCISE/ FITNESS6128 BOWFLEX POWER Pro 410 lbs rods+leg attachment $175, OBO 941-629-4940 BOWFLEX ULTIMATE, like new,W/manuals and film $450, OBO 941-759-2222 ELLIPTICAL A nice Pro Form elliptical machine great condition the newer model $70 941-916-1657 ELLIPTICAL WESLO exercise equipment, Like New. $200 941-475-9197 EXERCISE BIKE New Balance, fairly new $200 941-629-7225 KICK/PUNCH BAG W aveMaster by Century.Perfect shape $50, OBO 941-268-3034 MASSAGE TABLE w/bolster and stool Oakworks $240 941-627-1371 NORDIC TRACK Skier excellent cond, LED display $75, OBO 941-629-4940 TREADMILL PROFORM Crosswalk 405E Exc. $350 941-766-9305 WEIDER WEIGHTS bar bench & more over 200lbs only $74 941-697-1102 ZUMBA BASIC Custom DVD $20 941-276-8259 ZUMBA TOTAL Body Fitness CUSTOM DVD $40 941-2768259 SPORTINGGOODS6130 COMPOUND BOW GRIZZLY BEAR 40-45LB DRAW RH $80 941-493-3851 CORNHOLE GAME Custom made Fl. Gators with matching bags $165 941-628-4520 DARTBOARD ARACHNID Elect/wall 27x20 darts inc. gd cond. $35 941-575-7270 FISHING REELS 16 used dif sizes and brands $110 941661-6941 FISHING WAGON Metal,lrg wheels, folding sides, 8 rod holders $35 941-223-9800 KNIFE Hunting/throwing custom made (McEvoy) w/book $70 941-629-8955 MINI HELMET signed by Ben Roethlisberger $125, OBO 941-244-3387 REEL GAMEFISHER AUTO MANUAL internal trip, stainless ball bearing $7 941-2761881 RIDING HELMET SAVE $ Small,Blk., nice cond. $25 941-474-4550 ROD SHIMANO w/bait caster r eel $175, OBO 941-6262832 GET RESULTS USE CLASSIFIED! SUNCOAST GUN SHOWSept. 24th & 25th SAT. 9-5, SUN. 9-4 Lee Civic Center Bayshore Rd. N. Ft. Myers BUY SELL TRADE Concealed Weapon Class $45 10AM & 2PM daily WAKE BOARD-LIQUID Force w/LifeVest & Fins $150 941276-8970 FIREARMS6131 45 ACP 900 rnds, 230 grn. FMJ, Wolf ammo, $300, consider trades. (941)-769-1367 A COLLECTOR buys military guns, swords, etc. Old Colts & W inchesters. 941-705-5145 Lwa low,0000000000)-511(0 0

PAGE 42

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 17 6000 MERCHANDISE ENGLEWOOD GARAGE SALES6002 SAT 7 12 14242 Whi t comb Ln. SGC. TV, chick en coup, hockey equipt, doll house w furn, Cabagge Patch. SAT .SUN 8 1 410 So. McCall Rd. (Old Englewood, accross from Comm. Presbyterian Church) SAT .SUN 8 : 30 -2 : 30 1526 St. Clair Rd.. Tak e Overbrook Rd. go to stop sign, turn L & R on St. Clair. SAL E SALE SALE 2 families, John Deere mower, 6 mos. old, $1,450/ obo. Micro-wave, fur niture, man y old & new items. NORTH PORT GARAGE SALES6005 FRI.-SAT-SUN. 9-4 1611 Okolona St. ESTATE SALE ALL FURNITURE, household items & tools. FRI .SAT 8 4 3029 LOG CABIN RD. Lots of stuff, clothes, comput er desk, household, tools, etc PT. CHARLOTTE/DEEP CREEK GARAGE SALES6006 FRI SAT 8 2 1116 & 1128 Belmar Ave. Havin g two family garage sales. FRI.-SAT. 10-3 1264 Marke t Circle, Pt Charlotte. DDM Thrif t Store moving. Select M W Children clothes @ .25 ea. TVs Beds Dressers Household Medical -Clearance to 75% off FRI .SAT 7 2 27070 Curitiva Dr. Deep Creek MOVING SALE, Beds, chin a hutch, Sofas, etc... Too much PT. CHARLOTTE/DEEP CREEK GARAGE SALES6006 FRI .SAT 8 ? 22114 M a lone Ave. INSIDE SALE. Fur niture, washer, dryer, 198 0 Corvette, TOOLS & lots mor e BIG SALE! FRI.-SAT. 8-2 167 Oldenburgh Ct NE. Music equip., tools & books. Call for directions 941 391-5448 FRI .SAT 8 2 754 Seabold Ave. Furniture lap top house items lamps kid s stuff shed decor unique items FRI .SAT 8 3 1549 Abscott St. 3 families, Bikes, large outdoor swing, tools incl. air compressor, household & clothes. FRI.-SAT. 8-3 701 Jarvis St. Multi-family, low prices,tools,household,etc FRI .SAT 9 4 226 B angs burg (off Edgewater).Hug e 2 family sale, new household items,decor.,furn.,lamps,rugs, child clothes & toys FRI.-SUN. 8-3 14229 Marli n A ve. ALL CONTENTS, El Camino, EVEN THE HOME CINDY SPIRK, CENTURY21 ALMAR & ASSOC. 941-429-2727 FRI.-SUN. 8-5 3495 Drance St (off Harborview) Huge warehouse sale. T ons of tools. SAT. 7:30AM 12:30 2321 Sofia Lane. Deep Creek, No presales. No early birds. furniture Christian items, tapes, books, VHS movies, cd's. household Scents y warmers & wax at 20%of f r etail. Collector items, Avon plates 1973-1981. Air tan k costume jewelry.Just too much SAT 8 1 501 Sh aron Ci r. Mixed clothing, kitch, toys, fooseball table, & lots of misc. SAT. 8-1 57 Rosemary St.. Lots of toys and misc. items. SAT 8 2 2403 Ald a L n. 2 family loads of tool s antiques clothing household items. Something for everyon e PT. CHARLOTTE/DEEP CREEK GARAGE SALES6006 SAT. 8-3 17131 Horizon Lane. Collectibles, art, bronze, eletronics, nautical SAT ONLY 8 1 4206 W inona St. No Early birds. Elect. scooter, refrigerator, T v & stands, Much more. THU .SAT 8 2 26169 Rampart Blvd. Moving Sale! Tools, Furniture, Housewares, Crafts, A lot of stuff! THURS.,FRI..& SAT. 9A-4P 25793 Aysen Dr, Deep Creek ESTATE SALELots of vintage & decorativ e items, lovely furnitue, loads o f j ewelry and household full. PUNTAGORDA GARAGE SALES6007 CONSIGNING WOMAN 6188 Elliott St. Up to 20% off. Large selection of furniture & access. (941)-505-9701 FRI .SAT 7 : 30 12 7513 S Blue Sage, Burnt Stor e Meadows, Baby items, lots o f DVDs, misc. FRI .SAT 7 : 30 2 : 30 6035 Acline. (& Sun) of f T aylor past Walmart. huge sal e something for everyone FRI .SAT 8 3 6040 Grove Blvd. Punta Gorda. Estate Sale all in house/garg e must go 2 mi. down Bermon t from Rt 17.1st house on Grov e SAT 9 3 3886 B or d eaux Off Madrid ESTATE SALE SAT 8 NOON 25477 Marion Ave. (Located on corner of Marion Ave and Flori da St.) Antiques, clothes for whole family, baby & kids stuff, bed frames, dishes & MORE!! THUR SUN 8 2 1471 Appian Dr. MUL TI F AMIL Y SALE: Outdoor & inside art, household items & much mor e THUR-SUN. 8-2 1471 Appian Dr. MUL TI F AMIL Y SALE: Out door & inside art, household items & much more ROTONDAAREA GARAGE SALES6008 FRI.-SAT. 7:30-2 4 Pine V alley Ln. Misc items SAT ONLY 8 2 250 ROTONDA CIRCLE. Lots of great stuff. Household items and much more. S. VENICE AREA GARAGE SALES6010 FRI .SAT 8 1 380 S Qunicy Road. Moving Sale Everything must go! Furniture, TVs, etc. SAT. 7AM 4129 Hibiscus Rd. Antiques from Asia, 1960 s winchester rifle, assorted gun s and household items. SAT 8 1 S un 8 12 3436 Rosyln Rd. No Early Birds. Holiday ornaments, electronics, outdoor equip, misc. Must see VENICE AREA GARAGE SALES6011 FRI .SAT 7 : 30 3 2601 Ellis Blvd. Venice Ranch between Pinebrook & Jacaranda off Venice Ave. FRI .SUN 8 1 429 E as t Shade Dr. off Center Rd. Lawn furniture, figurines, pots, bicycle, lots of housewares. PUTCLASSIFIEDS TOWORK FORYOU! FIND A JOB! BUY A HOME! BUY A CAR! SAT 8 2 4521 C rysta l Rd. Tools & supplies fo r the do it yourselfer, wor k bench, ladders, & much more SAT 9 4 1239 W aters ide La.: Collectables, Kimball piano, housewares, books, CDs, holiday items, handbags, kitchen items & much more!! SAT OCTOBER 1 8 3 492 E Shade Dr. Larg e Furniture, Tree with staghorn ferns!! & some lawn equip ment, 941-716-3260 SARASOTA COUNTY DESOTO COUNTY CHARLOTTE COUNTY 31 74 70 72 Arcadia Nokomis Ven ice Nor th Po rt Murdock Gu lf Cove D eep Creek Bur nt Store Punta Go rda Osprey Laurel Bo ca Grande Grove City En glew ood P lacida R otonda W est 6001 6006 6002 6005 6004 6007 6011 V enice Ave. C enter Rd. Port Charlotte El J obean S o. Ven ice 6001 Arcadia Area 6002 Englewood Area 6003 Lake Suzy 6004 Nokomis/Osprey Area 6005 North Port Area 6006 Port Charlotte Area 6007 Punta Gorda Area 6008 Rotunda 6009 Sarasota Area 6010 South Venice 6011 Venice GARAGE SALE LOCATOR RATES 1 day $ 11.95 4 lines ($5.00 ea. addl line) 2 days $ 18.25 4 lines ($5.00 ea. addl line) 3 days $ 23.40 4 lines ($5.00 ea addl line) 7 days $ 29.65 4 lines ($5.00 ea addl line) To place your ad call: 8664631638 GARAGE & YARD SALES FREE GARAGE SALE SIGN WITH ANY AD 776 771 775 776 75 41 41 75 17 41 6008 6010 6003 6009 APPLIANCES6250 WASHER WHITE Whirlpool $125 586-216-4084 MISCELLANEOUS6260 AIR CONDITIONER Kenmore window 5050 BTU New $80 941-423-9371 BOOKS,CHILDREN-TEENS Over 100, exc.cond. $40 941-268-3010 CAR TOP CARRIER HIGHLAND KARPAK WATERPROOF $30, OBO 941-698-9899 CHRYSLER SEBRING Top Boot Cover #OQG88TRM Tan $100 941-539-7468 CIGAR HUMIDOR Glass lid, Rosewood w/cedar, holds 100 cigars. $50 941-258-0472 CORAL STAGHORN 15H X 20W cost 350.00, sell $150 941-629-8955 DVDS, 35 plus new, ask for Patrick $75, OBO 941-4292037 E-Z UP 10 X 10 commercial 600 Denier, roll bag new in box $450 941-624-0121 FIREWOOD SEASONED split oak 1/2 facecord $120 941526-7589 HURRICANE LAMPS Matching set need top glass globes $20, OBO 941-698-9304 LADIESblouses, Mens shirts, Childrens clothing. Overstocked jewelry, Christmas items and more. 941-623-6302 NEON BEER sign German SPATEN 16x18 $70 941-6257900 POKER TABLE Top Roulette/Craps w/carry case $20 941-628-6371 W ANTED TO BUY/TRADE6270 BUYING gold, silver and vintage costume jewelry. 941-769-8561 CASH PAID FOR WWI WWII KOREAN, VIETNAM GERMAN,JAPANESE, ETC. Military items (941)-416-3280 COLLECTOR BUYING Jewelry, gold, silver, coins, watches, costume jewelry, silverware, antiques collectibles, firearms, anything old and interesting. House calls. V enice (941) 445-9002 ADVERTISEWITHTHE SUNCLASSIFIEDS WANTED USED MECHANICAL PLATFORM SCALE 500lb capacity or more. Call 941-416-6293 WASHER/DRYER WANTED. Fast Pick up. Cash Paid $75 941-301-3928 Y amaha Acoustic wanted nylon strings, Must be in good cond. 941-445-1274 7000TRANSPORTATION BUICK7020 1999 BUICK PARK AVE ULTRA 52,000 mi. white w/grey leather int. Mint! $6,700 OBO KBB $7,055 941-661-1399 PC APPLIANCES6250 A/C 4 ton Trane central split outside $475 786-306-6335 COOKTOP KENMORE 30 glass touch control $300, OBO 941-525-3429 DRYER AMANA HD 6 cycles, white, needs heating element $25 941-629-7449 DRYERELECTRIC WHITE WHIRLPOOL H.D. $100, OBO 941-585-8778 DRYER KENMORE, looksgood, works good $50 941624-4758 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** FREEZER SANYO 48Hx22W 25D like new. Call George $75 941-380-4464 FRIDGE GE White SxS 36x68 25cf water ice on door Ex Cond $295 941-766-7545 FRIDGE, GEside by side 22cf $200; 10cf Magic Chef fridge $100; GE dishwasher $50 All EXCELLENT Cond. 941-228-2454 MICROWAVE GE Profile White Convect/bake overstove $100 941-639-3760 MOST WASHERS, Dryers & Fridges repaired for $65 or less. 941460 0763 BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! PEPSI COLA Drink Cooler 18D x 40W X 36 H indoor/outdoor $275 941-625-6646 RANGE GE Electric SC black glass door $128 941-6256646 RANGE GLASS top Frigidaire, SS $375, OBO 941-585-8778 REFRIGERATOR GE, Top freezer. Excellent condition, white. $125 941-629-7670 REFRIGERATOR KITCHEN Aid s/s water/ice white $299 941-639-3074 REFRIGERATOR MAYTAG 18cf freezer on top $150, OBO 941-625-2779 STOVE GE Spectra 30 Glass T op White $200 941-6393760 WALL OVEN Kenmore 30 self cleaning, stainless steel $400, OBO 941-423-2235 WASHER & DRYERmatching set, approx 2-3 yrs old, like new! $350 941-286-9001 WASHER & DRYER Whirlpool Estate White. Venice $250 941-492-5331 WASHER & Dryer Whirlpool Set, white, excellent Condition $250 941-257-8405 WASHER ANDDryer Roper $195 916619752 WASHERS/DRYERS $149. each or $290. Set 1 Year Warranty. 941-766-0226 WHPL WASHER $100, 3.5 ton cond $399, 18,000 BTU a/c 220v $225, mower 4.5 hp $65. 941-764-7377. 1 it ^)Tj-0.2083 Tc 6.9167 0 0 4 148.5 997.5058 Tm()Tj1 0.502 0 rg/TT1 1 Tf-0.1474 Tc 45.8684 0 0 15 54.5 644.0166 Tm(Q X El EElF ElEl El El LoweaEl El El El ElLlm)]TJ-0.1389 Tc 20.3431 0 0 15 262.5 322.5264 Tm(El ElEl ElEl )Tj/TT2 1 Tf-0.1389 Tc 20.3431 0 0 15 262.5 193.0304 Tm(ElLOOMIS )Tj/TT2 1 Tf-0.1333 Tc 19.5294 0 0 15 141.5 119.0326 Tm(ElEl ElEl El )TjEMC ET

PAGE 43

The Sun Classified-Section A Page 18E/N/C/VSaturday, September 24, 2011 HONDA7160 2010 HONDA ACCORD LX, 4 door, white, 17,689 mi. $19,875 877-219-9139 dlr 2010 HONDA ACCORD LXP, 4 door, red, 17,014 mi. $19,875 877-219-9139 dlr CLASSIFIED ADSSELL 2010 HONDA CIVIC Certified LX, 4 door, silver, 25,107 mi. $17,245 877-219-9139 dlr 2010 HONDA CIVIC Certified LX, 4 door, white, 12,960 mi. $17,540 877-219-9139 dlr 2010 HONDA CIVIC LX, 4 door, silver, 24,547 mi. $17,854 877-219-9139 dlr 2010 HONDA CIVIC LXS, 4 door, blue, 20,346 mi. $17,992 877-219-9139 dlr 2010 HONDA CIVIC LXS, 4 door, polished metal, 13,836 mi. $17,854 877-219-9139 dlr 2011 HONDA ACCORD Certified EXL, coupe, red, 5,548 mi. $24,975 877-219-9139 dlr 2011 HONDA ACCORD SDN Interior : gray, cloth Exterior : Gray. #: 11366A CALL 888-690-8667 2011 HONDA CIVIC Certified EX, 4 door, silver, 3,248 mi. $20,458 877-219-9139 dlr 2011 HONDA CIVIC Certified LX, 4 door, white, 7,076 mi. $16,950 877-219-9139 dlr 2011 HONDA CIVIC LX, 4 door, blue, 5,732 mi. $18,245 877-219-9139 dlr HYUNDAI7163 2002 HYUNDAI XG350 4 door, black, 109,696 mi. $6,875 (877)-219-9139 dlr 2004 HYUNDAI TIBURON dark blue, 49,282 mi. $9,875 877-219-9139 dlr 2008 HYUNDAI ACCENT GS, coupe, blue, 71,773 mi. $7,985 877-219-9139 dlr 2009 HYUNDAI ELANTRA Interior :Beige,Exterior Merlot #: CHARRONA CALL 888-690-8667 DLR 2010 Hyundai Elantra Interior : Exterior : Black #:92629, 888-690-8667 Dlr 2010 HYUNDAI ELANTRA Interior : Exterior : Beige #: 59251-1 CALL 888-690-8667 dlr. 2010 HYUNDAI ELANTRA Interior : Gray Exterior : Blue #:92668. 888-690-8667 dlr. 2010 HYUNDAI ELANTRA Interior : Gray Exterior : Silver #:92669 CALL 888-690-8667 Dlr. 2010 HYUNDAI ELANTRA Interior : Tan Exterior : White #:92665. 888-690-8667 DLR. 2010 HYUNDAI GENESIS coupe, 2.0, silver, 11,023 mi. $21,458 877-219-9139 dlr INFINITI7165 2008 INFINITI G35 4 door, black, 43,156 mi. $24,950 877-219-9139 dlr 2008 INFINITI G35 nav, 4 door, 41,489 mi. $25,693 877-219-9139 dlr JAGUAR7175 1999 JAGUAR XJ V ANDEN PLAS BRITISH GREEN W TAN L TH LOW MILES CHROME WHEELS & MORE $9,988 WILDE JAGUAR 877-216-8292 2003 JAGUAR S-TYPE 4 door, silver, 79,437 mi. $12,587 877-219-9139 dlr HONDA7160 2009 HONDA ACCORD Certified LX, 4 door, red, 7,817 mi. $19,875 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, beige, 35,337 mi. $22,458 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, black, 22,799 mi. $22,875 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, blue, 20,086 mi. $21,588 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, green, 22,374 mi. $19,950 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, polished metal, 16,444 mi. $24,547 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, red, 35,655 mi. $23,875 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, silver, 39,984 mi. $20,987 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, white, 48,607 mi. $18,950 877-219-9139 dlr 2009 HONDA ACCORD Interior : Exterior : White #: 92588-1 CALL 888-690-8667 DLR 2009 Honda Accord Interior : Exterior : Silver #: 15526-1 CALL 888-690-8667 2009 HONDA ACCORD LX, 4 door, polished metal, 40,299 mi. $16,987 877-219-9139 dlr 2009 HONDA ACCORD LX, 4 door, silver, 21,758 mi. $16,950 877-219-9139 dlr 2009 HONDA ACCORD LX, 4 door, silver, 39,215 mi. $16,875 877-219-9139 dlr 2009 HONDA ACCORD LXP, 4 door, black, 10,046 mi. $19,875 877-219-9139 dlr 2009 HONDA ACCORD LXP, 4 dr, polished metal, 20,081 mi. $19,245 877-219-9139 dlr 2009 HONDA CIVIC EX, 4 door, silver, 47,313 mi. $18,754 877-219-9139 dlr 2009 HONDA CIVIC LX, 4 door, auto, red, 31,659 mi. $17,248 877-219-9139 dlr 2009 HONDA CIVIC LX, 4 door, red, 37,981 mi. $16,697 877-219-9139 dlr 2009 HONDA CIVIC LX, 4 door, royal blue, 38,910 mi. $15,950 877-219-9139 dlr 2009 HONDA CIVIC LXS, 4 door, silver, 38,542 mi. $16,875 877-219-9139 dlr 2009 HONDA FIT base, auto, silver, 36,469 mi. $13,950 877-219-9139 dlr 2009 HONDA FIT base, silver, 16,579 mi. $15,877 877-219-9139 dlr 2009 HONDA FIT Sport, blue, 29,743 mi. $15,950 877-219-9139 dlr 2009 HONDA FIT Sport, blue, 39,521 mi. $14,950 877-219-9139 dlr 2009 HONDA FIT Sport, silver, 29,307 mi. $15,875 877-219-9139 dlr 2010 HONDA ACCORD Certified EX, 4 door, gray, 13,711 mi. $18,950 877-219-9139 dlr 2010 HONDA ACCORD Certified EXL, silver, 12,650 mi. $22,950 877-219-9139 dlr 2010 HONDA ACCORD EX, 4 door, blue, 26,969 mi. $21,470 877-219-9139 dlr 2010 HONDA ACCORD EXL, 2 door, polished metal, 26,363 mi. $21,785 877-219-9139 dlr 2010 HONDA ACCORD EXL, 4 dr, polished metal, 23,135 mi. $23,458 877-219-9139 dlr NEEDAJOB? CHECKTHE CLASSIFIEDS! 2010 HONDA ACCORD LX, 4 door, beige, 16,415 mi. $19,875 877-219-9139 dlr ACURA7145 2005 ACURA TL 3.2 4 door, gray, 70,988 mi. $16,875 877-219-9139 dlr BMW7148 2001 BMW 740I GRAY 79K MILES MUST SEE $12,988 WILDE JAGUAR 877-216-8292 2006 BMW 330CI 2 door, manual, red, 54,904 mi. $20,478 877-219-9139 dlr GET RESULTS USE CLASSIFIED! 2007 BMW 335I 4 door, gold, 72,529 mi. $17,950 877-219-9139 dlr 2008 BMW M3 CONVT GRAY 6 SPEED 28K MILES $49,988 WILDE JAGUAR 877-216-8292 HONDA7160 1999 HONDA CIVIC VP, 4 door, green/beige, 86,804 mi. $6,987 877-219-9139 dlr 2003 HONDA CIVIC SI, white, 95,581 mi. $7,985 877-219-9139 dlr 2004 HONDA ODYSSEY EXL, blue, 67,609 mi. $12,950 877-219-9139 dlr 2006 HONDA ACCORD EXL, 4 door, silver, 94,547 mi. $11,487 877-219-9139 dlr 2006 HONDA ACCORD EXL, V6, 4 dr, nav, silver, 65,093 mi. $13,875 877-219-9139 dlr 2006 HONDA ACCORD LX, 4 door, gray, 105,015 mi. $9,875 877-219-9139 dlr 2006 Honda Accord, 4-door. $13,990 Gorman Premier 941-639-7300 2007 HONDA ACCORD EXL, 4 door, bronze, 43,529 mi. $17,245 877-219-9139 dlr 2007 HONDA ACCORD EXL, 4 door, silver, 38,487 mi. $18,754 877-219-9139 dlr 2007 HONDA CIVIC EX, red, 69,726 mi. $13,879 877219-9139 dlr 2007 HONDA TIBURON, V6, MINT, $11,488 $10,988941625-2141 Gorman Family 2008 HONDA ACCORD CPE Interior : Black, cloth, Exterior : Black. #: 7206P CALL 888-690-8667 DLR 2008 HONDA ACCORD EX, 4 door, green, 33,287 mi. $17,950 877-219-9139 dlr 2008 HONDA ACCORD EXL, gray, 45,262 mi. $18,950 877-219-9139 dlr 2008 HONDA ACCORD EXL, nav, 4 dr, black, 25,522 mi. $21,487 877-219-9139 dlr 2008 HONDA ACCORD EXL, r ed, 29,444mi. $17,950 877219-9139 dlr 2008 HONDA ACCORD EXL, V6, 4 dr, polished metal, 40,887 mi. $18,950 877-219-9139 dlr 2008 HONDA ACCORD EXL, V6, black, 35,209 mi. $20,986 877-219-9139 dlr 2008 HONDA ACCORD EXL, V6, white, 37,416 mi. $21,487 877-219-9139 dlr 2008 HONDA CIVIC LX SEDAN WHITE/TAN PERFECT FLORIDA CAR $15,988 WILDE JAGUAR 877-216-8292 2008 HONDA CIVIC LX, 4 door, black, 52,005 mi. $15,847 877-219-9139 dlr 2008 HONDA FIT base, silver, 34,352 mi. $13,875 877-219-9139 dlr 2008 HONDA FIT Sport, black, 78,157 mi. $11,547 877-219-9139 dlr JEEP7080 2005 JEEP WRANGLER X, white, 68,878 mi. $15,478 877-219-9139 dlr 2006 JEEP WRANGLER Unlimited, yellow, 53,518 mi. $15,897 877-219-9139 dlr 2007 Jeep Wrangler $16,990 941-639-7300 P.G. 2008 JEEP LIBERTY Limited, silver, 56,147 mi. $16,950 877-219-9139 dlr 2010 JEEP GRAND CHEROKEELaredo, black, 24,538 mi. $21,487 877-219-9139 dlr LINCOLN7090 2008 LINCOLN MKZ 4 door, white, 39,574 mi. $18,950 877-219-9139 dlr MERCURY7100 2002 MERCURY GRAND MARQUISLS, 1 ownr, 57K mi. Beautiful. $7,995. Charlotte Motor Cars 941-979-9331 2002 MERCURY SABLELS. 61K mi. Leather. Loaded. Cln Car Fax.$6,895 941-9799331 Charlotte Motor Cars ADVERTISE In The Classifieds! PONTIAC7130 2001 PONTIAC Firebird Convertible, cln Car Fax. FL car. Leather. Must see. 80K. $7,695. Charlotte Motor Cars 941-979-9331 SATURN7135 2002 SATURN L200 4 door, blue, 70,260 mi. $5,950 (877)-219-9139 dlr 2002 SATURN LW200 wagon, silver, 45,424 mi. $6,987 (877)-219-9139 dlr 2004 SATURN W agon low mileage, exc. cond.$5,000 OBO N. Eng. 941-460-9456 PRO-POWER AUTO SALES(941)-627-8822USED SATURN SALES P ARTS & SER VICE THE SATURN GUYS 98 SL2 Sedan..........$2495 98 SL1 Sedan..........$2695 99 SL2 Sedan.........$3,299 98 SW2 Wagon........$3,399 00 SL2 Sedan..........$3495 01 SW 1 Wagon.......$3,999 03 VUE SUV.............$5,995 03 VUE SUV.............$5,999 03 ION Sedan..........$6,299 02 VUE V6 AWD.......$7,399 07 ION Sedan..........$8,29908 Astra XR Sedan..$11,995Why Pay US 41 Prices? SCION7136 2006 SCION XB 60,150 mi, torched penny, auto, r elease series 4.0, $8,500, OBO 941-639-8741 2011 SCION XB green, 10,225 mi. $16,875 877219-9139 dlr ACURA7145 2000 ACURA TL 3.2, base, 4 door, beige, 133,449 mi. $5,988 (877)-219-9139 dlr CHRYSLER7050 2007 CHRYSLER SEBRING 4 door, gray. 73,123 mi. $9,950 877-219-9139 dlr 2008 CHRYSLER PT CRUISER Auto, Air. Loaded. Clean Ready to go. 50K mi. $9,499. Pro Power Auto Sales 941-627-8822 2008 PT CRUISER $9990. Gorman Premier 941-639-7300 DODGE7060 2001 Dodge Dakota, Super cab, all power low miles, $6988. 941-639-1601 Dlr. 2001 DODGE NEON 4 DR Sedan, 163,000 mi, 4 cyl., automatic, silver, pwr locks, pwr win, $2,900, 941-468-4915 ADVERTISEWITHTHE SUNCLASSIFIEDS 2007 DODGE Caliber, $11,990 Gorman Premier 941-639-7300 2008 Dodge Magnum $15,990. Gorman Premier 941-639-7300 2010 DODGE CHALLENGER 200 MILE NEW CAR $39,988 WILDE JAGUAR 877-216-8292 FORD7070 1991 FORD MUSTANG convt, 2 dr, silver, 82,981 mi. $5,986 (877)-219-9139 dlr 2004 Mustang Convertible GT. $12,990 Gorman Premier 941-639-7300 2005 FORD THUNDERBIRD 2 dr, convt, blue, 31,465 mi. $24,587 877-219-9139 dlr 2006 FORD Freestyle 4-door, low mi. $12,990. Gorman Premier 941-639-7300 2006 MUSTANG 2-dr Coupe GT, many extras. $17,990.Gorman Premier 941-639-7300 P.G. 2008 FORD EDGE, LOADED, MUST SEE, $18,988 941-6252141 Gorman Family 2008 FORD FUSION SEL V6, loaded, 64k mi, Must Sell. $13,500 obo 219-575-3770 2008 FORD MUSTANG convertible, 2 dr, white, 34,886 mi. $20,950 877-219-9139 dlr 2009 FORD TAURUS white, 26,238 mi. $18,975 877219-9139 dlr Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week BUICK7020 2000 BUICK PARK AVENUE 69k miles, All power options, Very good cond. $4800. 941-473-1587 CADILLAC7030 1995 CADILLACSEDAN DEVILLE, Leather. Full Power! $2,988. 941-639-1601 Dlr. 1999 CADILLAC DEVILLE 94K miles, white, nice, $4,500 941-575-2425 2002 CADILLACELDORADO, Lthr, Moonroof!Loaded! $6,988. 941-639-1601 Dlr. 2003 CADILLAC CTS beige, 32,882 mi. $14,875 877-2199139 dlr 2003 CADILLAC DEVILLE 4 door, beige, 80,968 mi. $9,987 877-219-9139 dlr 2007 CADILLAC STS SILVER 43K MILES GRAY LEATHER PREMIUM SOUND $21,988 WILDE JAGUAR 877-216-8292 2008 CADILLAC DTS WHITE W IVORY LEATHER 34K MILES BEAUTIFUL FLORIDA CAR $26,988 WILDE JAGUAR 877-216-8292 2009 CADILLAC XLR SILVER NAV CAR ONLY 14K MILES $54,988 WILDE JAGUAR 877-216-8292 2011 CADILLAC STS Int : LIGHT GRAY, LEATHER Exterior : SILVER, #:7195P 888-690-8667 DLR CHEVY7040 1987 CHEVROLET CORVETTE Must sell or trade New grandkids 91k miles 95% show ready Over 20k invested Appt. Only, $8,000 941-623-8392 1999 CHEVYMALIBU, 4 Dr. LS, All Power! Low Miles! $3,988. 941-639-1601 Dlr. 2000 CHEV CAVALIER Convertible, auto, leather, low mi. $4988 941-639-1601 Dlr. 2006 CHEVY UPLANDER 43K MI, LIKE NEW $10,988 941-625-2141 Gorman Family 2006 HHR, 44k mi, like new, $9,988941-625-2141 Gorman Family 2007 CHEVY IMPALA LS, gold, 106,102 mi. $7,855 (877)-219-9139 dlr 2008 CHEVY COBALT silver, 51,185 mi. $11,785 877-2199139 dlr 2010 CHEVY IMPALA LT, 4 dr, leather, black, 30,901 mi. $15,950 877-219-9139 dlr CHRYSLER7050 1968 CHRYSLER Newport2 dr, 383 motor, new exhaust, tires and wheels, needs paint. $2800. Call 863-494-0839. 1999 CHRYSLER SEBRING LXI, Coupe, 108k miles, Exc cond. $2600/obo 941-7630608 2005 CHRYSLER CROSSFIRE ROADSTER WHITE 38K MILES L TH LOADED LIKE NEW $17,988 WILDE JAGUAR 877-216-8292 2006 CHRYSLER PTCRUISER T ouring, silver, 77,861 mi. $7,859 877-219-9139 dlr 2007 CHRYSLER 300C HEMI POWER SITTING ON 22 CHROME WHEELS MUST SEE $21,988 WILDE JAGUAR 877-216-8292 0 )Tj/TT0 1 Tf-0.2901 Tc 246.8158 0 0 41 139 932.0078 Tm(0 )Tj0 0.502 0 rg/TT2 1 Tf-0.0306 Tc 157.5593 0 0 62 18 684.0154 Tm(ADD a D0 )Tj-0.1367 Tc 234.475 0 0 62 18 255.0285 Tm(a )Tj-0.1367 Tc 234.475 0 0 62 261 184.0306 Tm(aCD )TjEMC ET

PAGE 44

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 19 V ANS7290 1993 OLDSMOBILE SILHOUETTEV6, 3.6 fuel injected, $1000. 941-456-5999 1997 DODGEGrandCaravan 89000 mi. Good cond. $3500.obo 941-474-5293 1999 CHEVROLET VENTURE no a/c. $1,500, OBO 941-661-8842 1999 FORD ECONOLINE E150/runs great/new tires, ladder rack $1,800 941-237-1051 1999 TOYOTA SIENNA LE, r ed, 74,164 mi. $7,895 877219-9139 dlr 2001 FORD WINDSTAR SEL trim, All power options, Good Mechanical, paint and interior. 126k miles, $2800. 941-473-1587 2006 CHEVY EXPRESS white, 36,665 mi. $14,987 877-219-9139 dlr 2006 HONDA ODYSSEY EXL, nav, RES, slate, 103,943 mi. $15,987 877-219-9139 dlr 2006 TOWN & COUNTRY L TD, MUST SEE, $13,988 941-625-2141 Gorman Family 2007 HONDA ODYSSEY EXL, blue, 40,435 mi. $23,785 877-219-9139 dlr 2008 HONDA ODYSSEY EXL, green, 44,420 mi. $25,478 877-219-9139 dlr 2009 HONDA CIVIC LX, 4 door, royal blue, 38,910 mi. $15,950 877-219-9139 dlr 2009 HONDA ODYSSEY EX, gray, 40,877 mi. $23,547 877-219-9139 dlr 2010 KIA SEDONA LX, white, 21,179 mi. $16,950 877-219-9139 dlr TRUCKS/ PICK-UPS7300 1997 DODGE RAM 1500, Quad cab 4 x4, $1,800 239370-5212 1997 FORD F-150, 4x4, lift tip, 36,000 original miles. $6,995. 941-979-9331 DLR CLASSIFIED W ORKS! 1997 FORD RANGER XLT Air Con, stick shift, w/ OD Nice! $3,500 941-426-8660 1998 CHEVROLET TAHOE LT cold AC, rear AC, leather, loaded. many new parts, $4,000 941-625-2252 1999 DODGE RAM 1500 WHITE/GRAY GREAT WORK TRUCK EXCELLENT CONDITION 56K MILES $6,988 WILDE JAGUAR 877-216-8292 2000 CHEVY S10 gray, 74,732 mi. $5,988 (877)-2199139 dlr 2002 NISSAN FRONTIER silver, 78,571 mi. $9,975 877219-9139 dlr 2003 DODGE RAM 1500 4x4, 95K, long bed, a/c, runs great, REDUCED MUST SELL! $5,995. OBO. 941-206-1262 2003 FORD F150 gold, 55,495 mi. $12,875 877219-9139 dlr 2003 FORD F250, AUTO, COLD AC, BEDLINER, $6988. 941-639-1601 Dlr. 2004 CHEVY SILVERADO 1500, quad cab, green, 87,448 mi. $11,987 877-219-9139 dlr 2004 CHEVY SSR SILVER/BLACK SUPER CLEAN 34K MILES $23,988 WILDE JAGUAR 877-216-8292 2004 NISSAN FRONTIER XE, power, bedliner, 4 cyl, 96K miles, $6,900 941-639-1843 2004 NISSAN FRONTIER, quad cab, all power, bedliner, $7988. 941-639-1601 Dlr. AUTO PARTS/ ACCESSORIES7270 ALLOY RIMS Set of 4 15 3 w/tires.great shape! $350 941-735-7360 BMW E38 740IL Parts all parts 98-01 740il seats engine etc $100 941-268-5413 CORVETTE WHEELS 17 5 spoke alloy P245/45ZR1789W tires $495 941-625-6646 COVETTE RIMS 16 set aluminum,80s good $125 786306-6335 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** JEEP FACTORY aluminum alloy wheels 15X7 5 spoke nice! $175 941-626-0680 PONTIAC GTO Motor: 67,400, lower-end $499 941-235-9885 PONTIAC GTO T runk lid $499 941-235-9885 POWER MIRROR fits 0108 Chrysler minivan drivers side. NIB $100/obo 941-626-5099 RIMS BLACK Giovanni 20 Fit various vehicles Tires avail. $395, OBO 941-716-9912 RIMSNASCAR (4) w/tires fit Chevy truck 5 lug. Clean no rust! $80 941-544-0042 TIRE 225-60-17 $20, OBO 941-623-3723 TIRES KUMHO 245/45-17 $80, OBO 941-255-1923 TOW BAR Blue Ox Aventa ll includes Tow Kit $350 201390-9544 TOW HITCH Heavy Duty Valley T owing Hitch $125 941-6272192 TRUCK BOX Mid Sized, Aluminum, Exc. Condition. $85 941-627-2192 TRUCK TIRE LIKE NEW 5,000 MILES ON IT 245-75R16 $25 941-268-9029 WATER PUMP housing for big block Chrysler, excellent cond. $75 941-626-5099 WHEELS AND tires (4) Off a 2002 Firebird, good shape $325 941-697-6456 AUTO SERVICE & REPAIR7280 Steves T owing T owing Fuel Jump starts LockoutsSteves Towing is a family owned business service serving Southwest Florida for over a decade. 941-769-4187 GET RESULTS USE CLASSIFIED! ANTIQUES/ COLLECTIBLES7250 1948 CHEVROLET 2 dr. Fleetline in storage 40+ yrs. Some disassembly. Straight body complete, shows $69K. $4,500. 941-769-2579 1963 FORD FALCON for r estoration only. Best Offer Original Title. 941-637-1369 1977 GMC Sprint (El Camino) 350/350 AT/PS/PB/Cruise. Cold air. Runs excellent. $3250. 941-204-2505 1987 MERCEDES-BENZ 560-SEL, black, 139K looks & runs great asking $6,400 941-627-0688 BUDGETBUYS7252 WE NEED USED VEHICLES TOP CASH PAID (941)-650-5785 AUTOS WANTED7260 I BUY SCRAP CARS,TRUCKS AND WRECKS 941-456-1342 WE BUY CARS $500 CASH +UP Frank 276-0204 JUNK CARSWANTED24/7 Fair $$ Paid941-286-3122, 623-5550 ALL VEHICLES WantedDead or Alive, Top $$ Paid, Starting at $400/$5000 Free pick up 941-623-2428 NEEDCASH? We Really Want Your Car, Van, SUV. No Title...No Problem!Junk to Gems! Flatbed Service.(941)-524-2448 $$ TOP CASH $$ FOR CARS & TRUCKS. DEAD OR ALIVE.4857515 AUTO PARTS/ ACCESSORIES7270 1967 PONTIAC GTO bumper,brackets,plate,Rear., $499 941-235-9885 AIR FILTER K&N Fits Carolla, V ibe, Matrix $25, OBO 941255-1923 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! NISSAN7200 2009 NISSAN 370Z Exterior : Platinum Stock #: 15698-1 CALL 888-690-8667 DLR. 2010 NISSAN MAXIMA 4 door convt, V6, 28,165 mi. $25,874 877-219-9139 dlr 2010 NISSAN SENTRA, LIKE NEW 14K MI, $14,988 941625-2141 Gorman Family SUBARU7207 1995 SUBARU LEGACY r ebuilt motor, needs air $1200 OBO 941-815-4350 leave msg SUZUKI7208 2004 SUZUKI XL-7 one owner, 6 CD changer, LOADED ex cond, 53K mi. $10,500 941-223-5691 2008 SUZUKI SX4 4 door, manual, gray, 66,276 mi. $10,950 877-219-9139 dlr TOYOTA7210 1998 TOYOTA AVALON XLS, leather, moon roof cold AC $4988. 941-639-1601 Dlr. 2005 TOYOTA PRIUS Interior : Gray, Exterior : Silver #: 60175-1 CALL 888-690-8667 2007 TOYOTA CAMRY 4 door, gray, 68,394 mi. $15,478 877-219-9139 dlr 2007 TOYOTA PRIUS 4 dr hybrid, silver, 67,060 mi. $13,875 877-219-9139 dlr 2008 TOYOTA CAMRY 4 door, white, 66,570 mi. $14,875 877-219-9139 dlr 2008 TOYOTA CAMRY gray, 38,779 mi. $15,950 877219-9139 dlr 2008 TOYOTA COROLLA CE, gray, 38,338 mi. $13,475 877-219-9139 dlr 2008 TOYOTA COROLLA LE White, 10,500 miles, $12,375. 941-456-0651 2008 TOYOTA PRIUS gray, 23,858 mi. $19,758 877219-9139 dlr 2009 TOYOTA COROLLA CE, 4 dr, manual, green, 38,498 mi. $11,950 877-219-9139 dlr 2009 TOYOTA COROLLA Interior Gray, exterior silver. #:7105P CALL 888-690-8667 DLR 2009 TOYOTA PRIUS Interior : Gray, Exterior : Blue #: 60322-1 CALL 888-690-8667 2010 TOYOTA PRIUS black, 36,116 mi. $22,950 877219-9139 dlr 2010 Toyota Prius, Hybred, 5dr. HB, extras. $20,990 Gorman Premier 941-639-7300 P.G. V OLKSWAGEN7220 2001 VW BEETLE GLX, leather, moon roof, 50K mi., $7988. 941-639-1601 Dlr. 2008 Jetta 4-dr. Sedan, $14,990 Gorman Premier 941-639-7300 ADVERTISEWITHTHE SUNCLASSIFIEDS 2010 VOLKSWAGEN CC 4 door, gold, 11,613 mi. $25,950 877-219-9139 dlr 2010 VOLKSWAGEN JETTA black, 32,246 mi. $17,950 877-219-9139 dlr 2010 VW GOLF HATCHBACK AUTO BEAUTIFUL BLUE ONLY 3,700 MILES $18,988 WILDE JAGUAR 877-216-8292 MAZDA7180 2010 MAZDA 3 Sport, manual, black, 15,208 mi. $21,987 877-219-9139 dlr MERCEDES7190 2001 MERCEDES E430 70K miles, 1 owner. $10,988. 941-639-1601 Dlr. 2006 Mercedes Benz C Class $14,990 941-639-7300 P.G. MINICOOPER7192 2004 MINI COOPER S loaded, 59kmi, mint, $14,988 941-625-2141 Gorman Family 2004 MINI COOPER S, 2 dr hardtop, red, 14,114 mi. $18,875 877-219-9139 dlr MITSUBISHI7195 2001 MITSUBISHI GALANT very well maintianed, $2,900 obo 941-916-2109 Classified = Sales 2004 MITSUBISHIECLIPSE SPYDER Conv. Low Mi! $8,988. 941-639-1601 Dlr. 2008 MITSUBISHI LANCER DE, 4 door, gray, 55,582 mi. $13,875 877-219-9139 dlr NISSAN7200 2005 NISSAN 350Z BLACK EXTERIOR : SILVER #: 11455A CALL 888-690-8667 2005 NISSAN 350Z Interior: Light camel leather, Exterior : SILVER #: 7262P CALL 888-690-8667 DLR 2005 NISSAN 350Z TWO-TONE Exterior : GRAY #: 7035P CALL 888-690-8667 2006 NISSAN 350Z BLACK, CLOTH EXTERIOR : BLACK. #: 10136A CALL 888-690-8667 2006 NISSAN ALTIMA Gray Exterior : Green #: 18059-1 CALL 888-690-8667 DLR. 2007 NISSAN 350Z TOURING ROADSTER GRAY/GRAY ONLY 19K MILES JUST $27,988 WILDE JAGUAR 877-216-8292 2007 NISSAN ALTIMA GRAY EXTERIOR : GREY #: 7045PB CALL 888-690-8667 2007 NISSAN ALTIMA GRAY Exterior : SILVER #: 7178P CALL 888-690-8667 2007 NISSAN ALTIMA Interior : Gray Exterior : Silver #: 7178P 888-690-8667 Dlr 2007 Nissan Sentra $12,990 Gorman Premier 941-639-7300 P.G. 2008 FORD FUSION, must see, $14,988 941-625-2141 Gorman Family 2008 NISSAN ALTIMA 255 4 door, white, 45,112 mi. $14,587 877-219-9139 dlr 2008 NISSAN ALTIMA 4 door, black, 49,427 mi. $17,950 877-219-9139 dlr 2008 NISSAN ALTIMA r ed, 24,996 mi. $18,950 877-2199139 dlr 2008 NISSAN MAXIMA 3.5 SL, 4 door, black, 37,287 mi. $21,857 877-219-9139 dlr 2009 NISSAN 370Z BLACK EXTERIOR : BLUE #: 11568A CALL 888-690-8667 JAGUAR7175 2004 JAGUAR X-TYPE 4 door, green, 79,124 mi. $10,987 877-219-9139 dlr 2004 Jaguar XJR, $17,990 Gorman Premier 941-639-7300 2005 JAGUAR S TYPE BLACK WITH ONLY 44K MILES $15,988 WILDE JAGUAR 877-216-8292 KIA7177 2007 KIA RONDO LX, FWD, black, 43,866 mi. $11,478 877-219-9139 dlr 2007 KIA RONDO LX, FWD, black, 43,866 mi. $10,950 877-219-9139 dlr 2008 KIA RIO 5SX like new 35kmi $10,988 941-6252141 Gorman Family PC 2009 KIA OPTIMA Interior : Exterior : Red #:15236-6 888-690-8667 DLR. 2009 KIA RIO Interior : BLACK Exterior : BLUE, #:7124P CALL 888-690-8667 DLR. 2009 KIA RIO Interior : GRAY Exterior : RED Dealer Stock #: 7224P CALL 888-690-8667 DLR. 2009 KIA RIO INTERIOR : GRAY EXTERIOR : WHITE#: 7223P 888-690-8667 DLR. 2009 KIA SEDONA Interior: TAN Exterior WHITE #: 7169 CALL 888-690-8667 2010 KIA FORTE INTERIOR : GRAY EXTERIOR : BLACK #: 7129P 888-690-8667 DLR. LEXUS7178 1997 LEXUS LS400 BEIGE/BEIGE $9,988 WILDE JAGUAR 877-216-8292 2005 LEXUS RX330 $20,990 941-639-7300 P.G. 2008 LEXUS ES350 4 door, tungsten, 43,256 mi. $24,578 877-219-9139 dlr 2008 LEXUS RX 350 Interior : Camel Leather Exterior : GOLD #:7094P CALL 888-690-8667 DLR 2010 LEXUS Interior : Beige, Exterior: Black #: 15631-1 CALL 888-690-8667 MAZDA7180 2002 MAZDA MIATA MX-5 Convert. 9,000 miles, loaded, like new. Green /Tan, $13,000 firm. 941-268-5544 2007 MAZDA 6 4 door, silver, 61,780 mi. $10,987 877219-9139 dlr 2008 MAZDA MIATA MX 5 TOURING CVT WOW 7K MILES AUTOMATIC RED/BLACK $20,988 WILDE JAGUAR 877-216-8292 2011 MAZDA 3 Maroon, 500 miles! $21,500. 941-764-7670 illillillillilllllllllIIIIIIIIIIIIIIIIIIIIINonooooooooo [IIIIIIIIIIIIIIIIIIIIilli llililllllllll llllIIIIIIIIII IIIIIIIIIIII1111111111111illillilliftooo0 0LwIllaL4wla 0 a00 )Tj/TT1 1 Tf-0.1901 Tc 244.6316 0 0 62 504 447.0226 Tm(0aLWIIO` a aB OO

PAGE 45

The Sun Classified-Section APage 20E/N/C/VSaturday, September 24, 2011 SUNCOAST BOATING BOATSPOWERED7327 09/24/11 11X60 2010 SUN DOLPHIN PRO 120Minn Kota Traxis trollin g motor, 55 lbs. thrust, 36 shaft, Hummingbird Fish Finder, color, side scan, 2 deep cycle batterie s $1,600. Call 941-625-8652. 14 CAROLINA SKIFF J14,trailer, 18HP Tohatsu eng.,bimini top, fully eqpd, elec. trling motor $1,800, OBO 941-629-5744 15 FIBERGLASS CENTE R CONSOLE 48HP Evinrude, S S prop, 2 live wells, depth finder, 40 lb. thrust, runs like new. Must sell due to health. $2,500. Call 941-575-2613. 15 KEY WEST 05, 60hp Yama ha, alum. trailer. Bimini top. Tr olling motor. Fish & depth find er. VHF radio. Fishing seat. S S props. $8,000. 941-323-0704 15 CLASSIC JET CRAF T 1996, Merc 120HP jet drive, Mich boat $4,500 248-613-8955 16 2009 CAROLINA Skif f J16, 25 HPYamaha, bimini, trailer $6,000 941-423-8156 16 SEA-N-SPORT 2009, 30HP Tohatsu, 2 bait wells, off-set helm, bimini top, accessories, flat bow for fishing. $5,900 941-538-8236 17 BASS BOAT200hp Merc Black Max 70+mph, Fresh water used, 100sx ff, elect. trolling motor, no rust trailer, garage kept perfect cond. $3,950 941-497-6615 18 6 Aggressor 88 Bass Boa t w/150 Johnson with many extras. $4,850 941-626-5481 18 BOWRIDER 110HP motor overheats, boat & trailer nice. $1,700 941-474-9821 19 REDFISHER Hewes 175 Merc Pwr Plt, Jack Plt, T rm Tbs, 2 wls, New Trailer, The One youve wanted! $14,500 863-781-2001 20 PRO SPORT 115 Yamaha, orig pack. all acc. low hrs. bimini. $5,500 941-505-5520 BOATSPOWERED7327 18 SEAARK MOD-V JON CG eqpt. E-Tec 60 Jet drive. Will Seperate. Boat or Motor $5,50 0 Both for $9,900 941-625-4456 18 WELLCRAFT SPORTSMAN 180 YAMAHA 150HP 2 STROKE VMAX, CUSTOM BIMINI TOP, VHF, GARMIN FF / CHART PLOTTER, VERY LOW HOURS. 2004. 941627-5777 19 HURRICANE 2006, 115 Y ahama 4 stroke, under 50 hr, Mint cond. $17,000 Neg 941-374-3744 or 941-286-3793 19 TROPHY BAYLINER Outboard, 1999, alum trlr, 2002 rolls, man y extras $10,000 941-698-4271 NEEDCASH? 20 1994 BAYLINER Needs Starter. Make Reasonable Offer. 5262 Lovett. NP 941268-2121 20 ANGLER centerconsule 2001 Yamaha 150 HPDI, low hours. $12,500 941-6273221 20 HURRICANE DECK BOA T 2003, 115 Yamaha 2 stk. EFI, Loaded w/options. $11,50 0 Call Chris 941-321-3110 22 CRESTLINERPONTOO N 2002 Superfish 115HP Yamaha 4 stroke, 190 hrs., bimini top. Reduced! $8,900 941-475-1275 23 1969 SCOTTIE CRAFT w / 1996 Karavan trailer. $1,20 0 Call Bob 941-429-8178 or Jess e 908-675-0501 23 CRIST CRAFT Amerospor t 1988, less than 100 orig hours, MI boat, no saltwater, DF, ship to shor e radio, stove, refrigerator, stand u p head, Chevy 260 IB/OB, trailer, $7,800, 941-697-6782 23 WELLCRAFT 2000 Sport Fisherman Tournament, 225 Y amaha 0X66 $8,995. 941474-1704 BOATSPOWERED7327 24 BAYLINER, BRAVO 3 300 HP, F/I, full cabin, lift kept, nice, $14,900 941-613-1903 24 DORAL 1999 WALK AROUND CUTTY CABIN HEAD SINK TABLE SLEEPS 2 TWIN 150 HP MERCS EFI OB OO9 NEW CONTINENTAL TRAILER VERY LOW HOURS, GREAT COND. FISH FINDER VHF RADIO $17,900 941456-8304 PUNTA GORDA REDUCED 24 STRATOS, cuddy, head, 2 150HP E-Tec (2007), 39 hrs. ne w gauges, controls and canvas, 1 owner, lift kept. Excellent. $33,900. 941-460-9698 24.5 AQUASPORT 1994, Cain &fiberglass top, 225 Evinrude, anchor winch, trim tabs, radio, fish finder, live bait well, large cockpit, cover & more. Great fishing boat, professionally maint. $10,000 941-697-7029 26 PENNYAN Flying Bridge, New Eng. Turn key, Under 100h r $10,200. 941-223-4368 CLASSIFIED SELLSCALLTODAY!941-207-1200 V enice/Englewood Nor th Port areas OR 941-206-1200P t. Charlotte Areas 26 REGAL EXPRESS 2007 lo a 29, air/heat, vacuflush toilet, glass top burner, microwave, r efrig., flat scrn. tv, sleeps 4, alum arch w/rod hldrs, GPS, elect. windlass, camper canvas, 5.7 Volvo w/new composite out drive. $49,000. 941-637-0147 27 BURPEE Pocket Cruiser, 1986, 165 Volvo Diesel, Custom Interior, $49,000 919-247-2482 26ft 1986 sea ox twin 200 merc efi,tri axle trl, stainless props new batterys,recent engine service,full bimini encloser $8500 tell 941 629-4777 27 MAYCRAFT DUAL station, fully rigged, twin Johnson O/bs. + Many extras Alum tripple axel trailer $42,000 941-575-7589 BOATSPOWERED7327 27.55 FT BAYLINER 1991,toi let, shower, fridge, stove, ho t H2O, lift kept, built-in batter y charger, fully equip, very low hrs. 941-627-5777 27.6 2000 TROPHY W alk-a r ound 225HP Merc. cuddy with sink, burner & cooler, head/mac erator, water sys., dual batteries, very good fishing boat, bait well, fishboxes, lots of storage, onl y $14,900. 941-698-5722. REDUCED 28 2001 SEA SPRITE aft cabin, 310 dual prop AC, GPS, bridg e encl. elec. head, full galley, 45 mph, only 90 hrs. lift kept, exc. cond. $28,500. 941-639-7890. 28 BOSTON WHALER CON QUEST 2000, T -250HP, Yama has, top electronics, A-C, Gen., pristine, $69,000 941-966-540 0 28' HYDRA-SPORTS Twin 225hp Yamaha 4-strokes, LOADED, 5Kw Generator, GPS, Radar, AutoPilo t $69,500. 513-659-2025 ADVERTISEWITHTHE SUNCLASSIFIEDS 28 RAMPAGE Sport Fisherman, 1989 (Nokomis), T/270 Chrysle r I/B,Garmin color plotter, V birth & pilot birth, enc. head. $26,900. Bob Nordstrom CPYB. 978-852 4844 World Class Yacht Sales 29 6 REGAL COMMODOR E 2002 Twin IO Radar, GPS, AC, Loaded. $41,000 508-942-4600 30 MAKO 2001 282cc, twin 225 Merc Optimax, 46 hrs on r ebuilds, 1 yr warr. Triaxle trail er. Many extras $39,900.w ould consider partial trad e down for a 1975-85 criscraf t commander 31or 1975-85 31 34silverton 941-473-2150 Reduced!! 30 PURSUIT 3000 Offshor e 2001. Great All-around Boat $110,000. Tower w/controls, twin Volvo diesels, low hours, 5k w W esterbeke gen., head w/show er, galley w/microwave & ele c stove, sleeps 4. Call 941-697 5808 for more info. BOATSPOWERED7327 32 GLACIER BAY Cat 200 7 Center Console, loaded, twin 250HP Suzuki 4 strokes w/war ranty, Raymarine electronics. $149,000 941-628-3712 32 WELLCRAFT3200 ST TROPEZ 1987, UPDATED TWIN 454 MERCRUISERS. GOING NORTH, MUST SELL! $12,900, OBO 941-223-6844 32, TROJAN, new 350/26 0 hp engines, hardtop, A/C, Heat, new GPS. Great value a t $26,900! 941-697-6258 33 CRUISERSINC. ESPIRIT 1987, Twin Merc Cruiser/ Inboards, Shallow Draft, Recent Risers, New Canvas, New Upholstery, GPS..ETC! Nice Vessel. Lif t Kept. Professionally Maintained. A Must See Boat! $22,900 941-685-2399 Port Charlotte. 34 2001 BAYLINER MY T/250hp/Cummins diesels (900 hrs.), thrusters, CLEAN W ell-equipped Great Cond. Kept on a Lift. $93,500 941-697-0940 ck70@embarqmail.com 35 CONTENDER, 1998, sid e console, T-250, air & generator, loaded, $75,000 941-575-786 7 NEEDAJOB? CHECKTHE CLASSIFIEDS! 35 SEA RAY 350 Sundance r 1990 (Venice). T/340 Merc. I/B. Lg. open cock pit & spa cious int. Sleeps 6, 6.5 K W gen. Full electronics,*SOLD* Bob Nordstrom CPYB 978 852-4844 World Class Yach t Sales 35 SUNDANCER 310 2001, 2 350 gas inboard engines, camper top, fully equiped w / extras. $79,900. 972-569-7661 38 SEA RAY 2003 Sundance r T/370 Mercs, 325 hrs, top elec tronics, gen, 2 TVs, Central vac, Icemaker, new batts, camper can vas, new bottom 7/10, and much more, $139,900 OBO, PG, owne r motivated, 941-380-7077 BOATSPOWERED7327 40 EAGLE TRAWLER 1972 T otally Refurbished with rebuil t diesel Ford Lehman, fiberglas s hull. Full new tanks. Askin g $75,000. Call 941-408-9572 52 VISTA MOTORYACHT 15.5 beam, diesel, live-aboard/cruiser. Excellent Condition. $115,000 Englewood 941-266-6321 JUST REDUCED BEST DEAL IN TOWN, MUST SELL! 1986 Mako Fisherman 25'6"',Twin 1992 200 HP Y amaha Engines, AM/FM CD Player, GPS Garmin Map/185 Sounder,Solara VHS Radio, Lenco Trim Tabs, Outriggers,Two new batteries, Located in Venice. $18,000. Contact Mike @ 941-650-4895 PUTCLASSIFIEDS TOW ORKFORYOUV enice,Englewood, North Port 2 2 0 0 7 7 1 1 2 2 0 0 0 0Pt.Charlotte Areas Call 2 2 0 0 6 6 1 1 2 2 0 0 0 0 Charlotte RV & Marine Sales & RepairsFloridas largest indoor pre-owned boat showroom! Consignments wanted: W ell sell your boat for FREE! Full-service Repairs: insurance claims, engine, electrical, hull, trailers. US 41 at Kings Hwy, Port Charlotte 941-883-5555 www.CharlotteMarine.com SELLING YOUR BOAT??? Let us help YOU!!! HURRY LIMITED TIME OFFER!!!Selling your boat for UNDER $5,000.??? For ONLY $60. we will run a 3 line classified ad & a black & white photo of your boat, IN OUR NEWSPAPERS & OUR WEBSITE EVERY OTHER DAY & INCLUDE a 1 1/2 x 2 1/4 BOATER`S BARGAINS AD with a COLOR Photo to appear in Thursday`s Waterline! FOR 90 DAYS!! HURRY....THIS IS A LIMITED PROMOTION!!! Selling your boat for $5,000. or OVER??? For ONLY $90. we will run a 3 line classified ad & a black & white photo of your boat, IN OUR NEWSPAPERS & OUR WEBSITE EVERY OTHER DAY & INCLUDE a 1 1/2 x 2 1/4 BOATER`S BARGAINS AD with a COLOR Photo to appear in Thursday`s Waterline! FOR 90 DAYS!! HURRY....THIS IS A LIMITED PROMOTION!!! Let US help YOU sell YOUR boat!! Call the Sun at 866-463-1638 and ask about our NEWRUNMY BOAT PROGRAM 1ALOwl,MPT-MO IL70106-614pi g ,THMM061O%AWice.-)143(` -,,;: i _---_.. __ Y T1 )Tj/TT2 1 Tf0.0581 Tc 12.5861 0 0 6 334 576.5187 Tm[(twoPOW,a1 4.' 7 M

PAGE 46

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 21 SAILBOATS7328 32 CATALINA 320, 1994, Grea t weekend cruising sailboat. Details a t httt://birdsnbugs.wordpress.com/v oyager $52,000 941-639-4138 MISC. BOATS7329 PONTOON BOAT self-made fiberglass.w/ Fl. title. must see $499 941-661-2667 PERSONAL WA TER VEHICLES7332 1998 YAMAHA 760 great shape,needs batt,trailer needs work $2700 941-627-5797 OUTBOARD/ MARINE ENGINES7334 6HP NISSAN like new outboard.maybe 50 hrs. $425 941-661-2667 BOATSTORAGE/ DOCKING7336 50 Dock in PG on 70 seawall, no bridges, 20 min to Charlotte Harbor. $200/mo 941-286-5618 MARINE SUPPLY & EQUIP.7338 BOAT (2) Battery Charger GUEST 10 amp 5/5 Trolling Motor $45 941-575-7270 DAVIT by Ace,works, harness and remote $500 OBO Randy 941-493-1215 ENGINE OIL 2.5 gallon 2 stroke, sealed jug. West Marine $30 941-626-0680 EPIRBw/RapidDitch bag Battery date: 03/2014 $400 941-637-0712 NORTHERN LTS P ARTS 8kw M753K new starter & alt $149 941-505-7272 OUTBRD TILLER Ext. Helmsmate U-Joint,never used. $15 941-624-2105 MARINE SUPPLY & EQUIP.7338 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** NEEDCASH? Have A Garage Sale! WHISKER POLE 6 ft. -11 ft 6 $60, OBO 941-764-9100 CANOES/ KAYAKS7339 12 MALIBU MINI X kayak, used 3 times, $400 845-3099065 IN THE SUN CLASSIFIED YOU CAN..... Find a Pet Find a Car Find a Job Find Garage Sales Find A New Employee Sell Your Home Sell Your Unwanted Merchandise Advertise Your Business or ServiceClassified its the reliable source for the right results SUNCOAST BOATING CAMPERS/ TRAVELTRAILERS7370 2005 DUTCHMENClassic 26F, 26 TT w/super slide, sleeps 6, $7950. (941)-3477171 DLR 2005 LUXURYBy Design 42 5th wheel, 3 slides, W/D, fireplace, DW, 3 axles, very spacious, $17,950. 941-3477171 DLR 2005 TIMBERLAND 27BHS, 28 TT w/slide, hardwood floors, sleeps 10, $7950. (941)-347-7171 DLR GET RESULTS USE CLASSIFIED! 2006 FOREST RIVER Flagstaff 829BHSS, 30 TT w/ slide, $6,950. (941)-347-7171 DLR 2006 JAYCO FEATHER 197, 19TT, super light weight, under 3000 lbs. $6395. (941)347-7171 DLR 2006 ROCKWOOD 8317 SS, 33 TT, 1 slide, 2 bedrm, sleeps 12, $10,500. (941)347-7171 DLR 2009 KZ Coyote Lite, 282, 29 TT w/slide, power awning, like new, sleeps 6, $13,950. (941)-347-7171 DLR Charlotte RV CenterGreat selection of pre-owned RVs! Buy-Sell-Trade-Financing W ell sell your RV FREE! Ask about our marketing. Repairs Maintenance-Parts-Body Shop US41 at Kings Hwy. Pt Charlotte (941) 883-5555www .CharlotteRVcenter .com WANTED All TTs, Motor Homes, 5th whls, Pop-Ups, V an conversion & passenger vans. Cash paid on the spot. for quick sale. 941347-7171 MOTOR HOMES/ RVs7380 1986 FLEETWOOD Jamboree, good condition, many extras, $2,900 941-255-1916 1999 UPGRADED BOUNDER Motor Home, 34, slide out, 1 owner, smoke free. $15,000. 941-916-0589 I WANT YOUR RV W ell sell it! FREE SKIP EPPERS RVs(941)-639-6969 Punta Gorda Closed Sun. & Mon. PLATINUM MOTOR HOMES Locally Manufactured Since 1985 Free tours Factory Direct T rades welcome Financing availableCOACH HOUSE, INC 3480 Technology Drive Nokomis, FL34275800-235-0984www.coachhouserv.com RV Collision RepairsModern shop, quality work! FREE ESTIMA TES RV WORLD Inc. of Nokomis 2110 US 41Nokomis 941-966-2182 RVS WANTED CASH/CONSIGN/TRADE Call: Mark RV WO RLD INC OF NOKOMIS 2110 US 41 Nokomis 941-966-2182 SATURN TOW-CARS From $2,899 CHEVY HHRs Many to choose from Blue-Ox Tow hitches. THE SATURN GUYS PRO-POWER AUTO SALES (941) 627-8822 P.C. SCHOOL BUS, 72 passgr, International 3800, 1995, white $5000 941-255-5544 TRAILER & ACCESSORIES7341 GALV. BOAT TRAILER 12 to 15 boats $350 941-7434674 or 941-585-1265 OPEN & ENCLOSED Utility T railers, Trailer Hitches & Wiring. T wo-Morrows Enterprises, 941-460-9700. ROYS TRAILER COUNTRY NewPre-Owned Storage Cargo-Utility-Trailers Parts Repairs-Tires-CustomBuilt-Trailers-Hitches/Wiring 9415752214. 4760Taylor Rd. P.G. TAN DEM AXLE heavy duty trailer 5X10 built in ramps, $500 obo 941-234-2396 TRAILERHAULMARK like new never used. $500 941-255-9788 TRAILER JACK 1000lb. capacity, swivel mt., new in box. $75, OBO 941-6265099 UTILITY TRAILER 4X8 LIGHTWEIGHT $200, OBO 863-241-9512 UTILITY TRAILERS Great Prices WEST COAST TRAILER (941)698-9902 CYCLES/MOPEDS/ SCOOTERS7360 HARLEY Road King, 63K, loaded, super clean. $9,000. 941-6503912 150CC SCOOTER, Like new, 254miles,100mpg,65mph(24 00new)$1100 941-456-5059 1995 HONDA 1100 Shadow 15K mi. Shaft dr. Wtr cooled. $2500/obo. (941)-266-7121 2002 HARLEY SPORTSTER, 1200 Custom, 8K mi. $4,900. Englewood (941)-769-1071 2007 BACCIO BX-150 Scooter 2 pass. Ex cond. $700. (941)-475-0068 2010 SCOOTER 49cc 40mph, 1200mi. Gar. kept. Like new. $800 941-623-7387 GOCART, 6.5HP, w/power band, too much to list. Asking $550. John, 941-661-4437 MOTORCYCLE HELMET cranberry red; Med; DOT approved. $35 941-474-3056 SCOOTER 49CC $499 Ken@ 941-549-0475 SMALL TRAILER: for use behind motorcycle. $499 941-474-3056 ADVERTISEWITHTHE SUNCLASSIFIEDS SPAULDING MOTORCYCLE SIDE-CAR set up for Harley $4000. View via internet. (941)-743-2161 ATV7365 2008 RANGER 700, Exc. cond. Adult driven. Loaded $7800/obo (941)-456-8571 CAMPERS/ TRAVELTRAILERS7370 2001 COLEMANTAOS popup, sleeps 6, cold air, $2695. (941)-347-7171 DLR 2001 PROWLER 25W, 26 TT w/slide, sleeps 6, $4295. (941)-347-7171 DLR 2002 SIX PACex cond. stove, r efrig, AC, fits toyota tondra, $2,700 obo 941-460-8504 2005 COACHMENCapri 27DS, Ruby edition, 27 TT w/slide, ultra light, weighs 4500 lbs. $8,450. (941)-3477171 DLR 2005 KEYSTONE HIDEOUT T oy Hauler 29FBH, Exc. condition, LOADED, Gen., Fuel Station, MUCH MORE! $14,500 941-697-6592 SPORTUTILITY/ VEHICLES7305 2008 JEEP LIBERTY 4-dr, 4x4, many extras. $17,990 Gorman Premier 941-639-7300 P.G. 2009 HONDA CRV 5 dr, LX, borrego, 29,910 mi. $18,975 877-219-9139 dlr 2009 HONDA CRV LX, black, 23,330 mi. $19,875 877-2199139 dlr 2009 HONDA CRV silver, 11,387 mi. $19,785 877219-9139 dlr 2009 HONDA CRV silver, 52,591 mi. $20,458 877219-9139 dlr 2009 KIA SEDONA Interior : GRAY Exterior BLUE #:7152P 888-690-8667 DLR 2010 HONDA CRV Certified r oyal blue, 8,174 mi. $19,875 877-219-9139 dlr 2010 HONDA CRV LX, urban titan, 24,479 mi. $18,977 877-219-9139 dlr 2010 NISSAN PATHFINDER black, 52,591 mi. $19,875 877-219-9139 dlr 2010 TOYOTA FJ CRUISER Interior :Black Exterior : Black #11461A 888-690-8667 Dlr 2011 HONDA CRV Certified LX, gray, 5,140 mi. $20,950 877-219-9139 dlr PRO-POWER AUTO SALES(941) 627-882203 Hyundai Santa Fe ..............................$4,499 03 Saturn Vue.........$5,999 02 Saturn Vue AWD..$7,399 08 Chrysler Pt Cruiser ..............................$9,499 04 Toyota Rave 4...$11,999 08 Saturn Vue 3 to choose from............. $12,999 & up 10 Chevy HHR 2 to choose from..............$12,999 & up Why Pay US 41 Prices? 4 X 4'S7310 1985 GMC SUBURBAN 4x4 3 lift, new motor, $2295/obo 941-639-0338 SPORTUTILITY/ VEHICLES7305 2007 FORD ESCAPE Interior : GRAY, CLOTH, Exterior : RED. #: 7240P CALL 888-690-8667 DLR. 2007 HONDA CRV EXL, green, 56,724 mi. $18,950 877-219-9139 dlr 2007 HONDA ELEMENT SC, silver, 37,748 mi. $17,950 877-219-9139 dlr 2007 KIA SEDONA Interior : Tan Exterior : Red #:15631-5 CALL 888-690-8667 DLR. 2007 MAZDA CX7 silver, 68,856 mi. $14,245 877-2199139 dlr 2007 SATURN OUTLOOK XE, white, 40,244 mi. $19,875 877-219-9139 dlr 2008 FORD ESCAPE Interior : TAN Exterior : RED #: 11064A CALL 888-690-8667 DLR 2008 FORD TAURUS SUV, black, 61,754 mi. $15,874 877-219-9139 dlr 2008 HONDA CRV EXL, black, 54,483 mi. $19,722 877-219-9139 dlr 2008 HONDA CRV LX, red, 29,470 mi. $16,950 877219-9139 dlr 2008 HONDA ELEMENT LX, silver, 33,152 mi. $15,878 877-219-9139 dlr 2008 HONDA ELEMENT SC, silver, 45,503 mi. $18,950 877-219-9139 dlr 2008 INFINITI EX35 brown, 37,750 mi. $25,687 877-2199139 dlr 2008 KIA RONDO Interior : TAN Exterior : BLUE #:7194P. 888-690-8667 DLR 2008 NISSAN PATHFINDER LE, blue, 29,680 mi. $23,950 877-219-9139 dlr 2008 TOYOTA HIGHLANDER LIMITED LT BLUE/TAN LTH FULLY LOADED ONLY 25K MILES $28,988 WILDE JAGUAR 877-216-8292 2008 TOYOTA RAV4 STD, gray, 69,581 mi. $17,325 877-219-9139 dlr SPORTUTILITY/ VEHICLES7305 2001 TOYOTA RAV4 SUPER LOW MILEAGE SPORT UTE $10,988 WILDE JAGUAR 877-216-8292 2003 CHEVY Suburban 4x4 LT $12,990 Gorman Premier 941-639-7300 2003 HONDA PILOT EX, silver, 154,020 mi. $8,970 877219-9139 dlr 2003 LINCOLN NAVIGATOR $13,990. Gorman Premier 941-639-7300 2003 TOYOTA RAV 4, low miles, PW/PL, auto, $10,988 941-639-1601 Dlr. 2004 GMC ENVOY black, 79,700 miles, very good condition. $7,800 941-875-4699 2004 HONDA ELEMENT EX, silver, 160,074 mi. $7,950 877-219-9139 dlr 2004 HUMMER H2 80K mi. Luxury Edition. BABIED. FL vehicle. Wholesale $17,900. Must See. Charlotte Motor Cars 941-979-9331 2004 JEEP Grand Cherokee Laredo, leather, all pwer, $9988. 941-639-1601 Dlr. 2004 NISSAN XTERRA XE, silver, 79,815 mi. $10,754 877-219-9139 dlr 2005 Expedition Limited $13,990 941-639-7300 P.G. 2005 FORD EXPEDITION Eddie Bauer, carbon, 65,457 mi. $16,358 877-219-9139 dlr 2006 ACURA MDX nav, gray, 65,726 mi. $22,458 877-2199139 dlr 2006 CHRYSLER PACIFICA leather, DVD, 3rd row, $11,988. 941-639-1601 Dlr. 2006 FORD EXPLORER EDDIE BAUER DK BROWN/TAN 51K $17,988 WILDE JAGUAR 877-216-8292 NEEDAJOB? CHECKTHE CLASSIFIEDS! 2006 HUMMER H3, 4 dr AWD, many extras. $18,990 Gorman Premier 941-639-7300 P.G. 2006 TOYOTA SEQUOIA Limited 4X4, silver, 77,035 mi. $24,875 877-219-9139 dlr TRUCKS/ PICK-UPS7300 2005 DODGE DAKOTA Quad cab, $13,990Gorman Premier 941-639-7300 P.G. 2006 FORD F150 XLT, black 46,810 mi. $16,950 877-2199139 dlr 2007 TOYOTA TUNDRA SR5, 2WD, EXT, black, 96,331 mi. $16,875 877-219-9139 dlr 2008 CHEVROLET COLORADO T ruck, 25,600 mi, 4 cyl., FWD, automatic, 4 seat, AM/FM Cassette, All season tires, Z85, champagne, auto, a/c, alarm, pwr brakes, pwr locks, pwr steering, pwr win, air bag, ABS, alloy wheels, tilt, Like new condition with low mileage. Has rear sliding window. $15,500 941-391-5805 Classified = Sales 2008 CHEVY SILVERADO Silver, 6cyl, auto, radio, 62,400 mi, New tires Asking $13,900 941-698-1053 2008 NISSAN TITAN crewcab, gray, 58,980 mi. $21,875 877-219-9139 dlr Mattas Motors 941-916-9222Buy Here Pay Here SPORTUTILITY/ VEHICLES7305 1996 FORD EXPLORER 4X4, 4 new all terrain tires, lthr, sunroof, JBL premium stereo with subwoofer, all options, extremely clean interior, mint cond. $2,200 941-468-5342 1998 FORD EXPLORER Interior : GRAY Exterior : WHITE#: 11578B CALL 888-690-8667 DLR. 1999 CHEV TAHOE, LT, leather, cold AC, all power, $4988. 941-639-1601 Dlr. 2000 EXPEDITIONEddie Bauer, tow pkg., 4X4, exc. cond$6,500. 941-661-3399 2001 Ford Expedition, leather, dual air, full power, $5988. 941-639-1601 Dlr. Yom-)Tj/TT2 1 Tf0.0069 Tc 19.0208 0 0 33 480 441.5228 Tm(_

PAGE 47

The Sun Classified-Section APage 22E/N/C/VSaturday, September 24, 2011 ON MOST NEW VEHICLES IF YOU CURRENTLY LEASE A NON CHRYSLER VEHICLE. $1,000SAVE AN ADDITIONAL WORLD CLASS LUXURY 22 IN STOCK SAME DISCOUNT ON EVERYONE#C11220$24,9993.6l v-6, power everything including both front seats, keyless entry, tilt/telescopic steering column, uconnect voice command with bluetooth, auto temp control, 17" aluminum wheels and mor e.MSRP $28,290SALE NEW 2011 RAM 1500 QUADCABAU TO POWER WINDOWS AND LOCKS, THEFT DETERRENT, SIX SPEAKER SOUND SYSTEM, TILT STEERING WHEEL AND MUCH MORE. SALE $19,999MSRP$25,890#D11273 0% for 60 months in lieu of rebate*ALL NEW 2011 DODGE AVENGER EXPRESSAU TO POWER WINDOWS/LOCKS/MIRRORS, TILT/TELESCOPIC STEERING, SPEED CONTROL AND MUCH MORE!SALE $17,999 0% for 72 months in lieu of rebate* NEW2011RAM1500SLT CREW CAB5.7LHEMI V-8,POWER WINDOWS/LOCKS/MIRRORS, REMOTE KEYLESS WITH REMOTE START & SECURITY ALARM,ALUMINUM WHEELS,SATELLITE RADIO /W 6 SPEAKER SOUND SYSTEM, REAR POWER SLIDING WINDOW, BED LINER & MUCH MORE. SALE $25,799MSRP$34,820#D1111 0% for 60 months in lieu of rebate*NEW2011DODGECALIBER MAINSTREETLOADED WITH POWER WINDOWS/LOCKS/MIRRORS, AUTOMATIC, 17" ALUMINUM WHEELS, FOG LAMPS, TILT STEERING, MEDIA CENTER, REMOTE KEYLESS ENTRY, SPEED CONTROL AND MORESALE $15,999MSRP$19,370 NEW2011RAM2500LARAMIE CREW CAB6.7L CUMMINS TURBO DIESEL AND LOADED WITH POWER EVERYTHING INCLUDING SUNROOF, LEATHER, NAVIGATION AND MORESALE $42,779MSRP$52,780#D11273 0% for 60 months in lieu of rebate*ALL NEW 2011 JEEP GRAND CHEROKEE$27,999 0% for 60 months in lieu of rebate* ALL NEW 2011 CHRYSLER 200POWER WINDOWS/LOCKS/MIRRORS, TILT/TELESCOPIC STEERING, THEFT DETERRENT, CD/MP3 MEDIA CENTER AND MUCH MORESALE $17,999 0% for 60 months in lieu of rebate*3.6L V-6, SIX SPEED AUTOMATIC, POWER WINDOWS/LOCKS/MIRRORS, POWER LIFTGATE, SUNSCREEN GLASS, REAR A/C, REMOTE ENTRY AND MUCH MORE. SALE $24,999#C11172 0% for 60 months in lieu of rebate*ALLNEW2011CHRYSLERT&C TOURING NEW 2011 DODGE CHARGER3.6L V-6, POWER WINDOWS/LOCKS/MIRRORS/SEAT, REMOTE KEYLESS ENTRY, 17" ALUMINUM WHEELS, SPEED CONTROL, TILT/TELESCOPIC STEERING AND MUCH MORE.SALE $22,999MSRP$26,220#D11413 27 MPGHighway 2010 CHRYSLER 300 LIMITED AUTO, PW, PL, CR, TILT,AC, LEATHER AND MORE! $ 23 988#C11207A5 YRS., 4 MOS. REMAINING CERTIFIED FACTORY WARRANTY 6 AT THIS PRICE! SAVE$9,000 SAVE$10,000#D11231In STOCK from Come in and see why the experts rate the All New 2011 Jeep Grand Cherokee above every vehicle in its class. 2010 DODGE CHARGER SXTAUTO.,PW,PL,CR, TILT,A/C,ALLOY WHEELS. $ 16 9885 YRS., 6 MOS. REMAINING CERTIFIED FACTORY WARRANTY 1.9%FinancingAvailable#197641 201 DODGE DAKOTA BIGHORNAUTO,PW,PL, CR,TILT,AC,ALLOY WHEELS $ 18 9886YRS.,REMAINING CERTIFIED FACTORY WARRANTY QUADCAB#59052P#D11301 ALL NEW 2011CHRYSLER 300 #C1143 2010 JEEP LIBERTY 4X4AUTO, PW, PL, CR,TILTAND MORE! $ 18 9885 YRS., 4 MOS. REMAINING CERTIFIED FACTORY WARRANTY 1.9%FinancingAvailable#59041P 2010 JEEP LIBERTY 4X4AUTO, PW, PL, CR,TILTAND MORE! $ 18 9885 YRS., 4 MOS. REMAINING CERTIFIED FACTORY WARRANTY 1.9%FinancingAvailable#59041P Sunset Dodge Chrysler Jeep 7745 S. TAMIAMI TR AIL SARASOTA SERVICE HOURS: MON-FRI 7: 30AM-5PM, SAT 7:30AM-NOON 941.922.2400 SALES HOURS: MONFRI 8:30 AM-7 PM, SAT 9AM-6PM, CLOSED SUN WWW.SunsetDodgeCh ryslerJ eep.com *All prices include rebates. Financing with approved credit. Residency rules may apply. Vehicles may not be as pictured. 2011 JEEP 4 WHEEL DRIVE OVERLOAD, LOADED WITH ALL THE EQUIPMENT AND LEATHER $ 38,988 $ 38,988 5 YRS., 9 MONTHS REMAINING CERTIFIED WARRANTY #J1229A PA TRIOT SPORT PA TRIOT SPORT 2011 JEEP AU TO, A/C. AND, MUCH MORE! $ 14,988 $ 14,988 6 YRS., 9 MONTHS REMAINING CERTIFIED WARRANTY #J11361A GRAND CHEROKEE GRAND CHEROKEE #J11288 4W 4gqMft Erik4777-= T.00MN ABERgELEB_R_A_TION EVENT.' POW DAYSIAR)Tj/TT2 1 Tf-0.2917 Tc 20.75 0 0 9 340.2664 630.8407 Tm(.mssWOWr.f .)Tj/TT4 1 Tf-0.0584 Tc 3.7727 0 0 7 32.7664 438.8466 Tm(1 !I A,yI)Tj/TT2 1 Tf-0.0475 Tc 39.4422 0 0 36 431.7664 139.3557 Tm(Jeep

PAGE 48

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 23 VISITUSONLINEAT WWW.GETTELHYUNDAI.COM -Guaranteedtrade-InValueofqualifyingvehiclebasedonindependentsource.ConsumerwillgetthehigheroftheGuaranteedTrade-InValue,lessmileagechargesanddamagecosts,ormarketvaluewhichwillbeassessedatthetimeoftradein.Marketvaluebasedonthehighestof:NADAYellowBook,Kell yB lueBook,ManheimAuctionValueordealerappraisal.Applicabletoallnew HyundaivehiclespurchasedonorafterMay1,2011.MustshowproofofvehiclemaintenancethroughanauthorizedHyundaidealerattimeoftradein.Customermustpaymileagefeeof$.20permileover15,000milesperyear.Customerresponsibleforalldamagetovehicle.Notavailableonleasedvehicles .Validonlyduringmonths24-48ofownership.Trade-invaluedollaramount mustbeappliedtowardanewHyundaivehicleandmustbefinancedthroughHyundaiMotorFinance(HMF).Seewww.hyundai.comoryourHyundaidealerforfulldetails.^^Allpricesandpaymentsplustax,tag,license,dealerfeesandfactoryinstalledoptions.Allleaseswith12kmilesperyear.Extrachargesmayapplyatleasetermination.Withapprovedcredit.Vehiclessubjecttoavailability.Photosforillustrationpurposesonly.**MustqualifyforHyundailoyaltyorcompetitiveowner.#Intheformofmanufacturerrebatesordea lerdiscounts.EPAestimatedhighwayMPG.Offersexpire09/25/11. SALEHOURS: MON-FRI8:30AM-8:00PMSATURDAY8:30AM-7:00PM-SUNDAY12:00PM-5:00PMTHEGETTELHYUNDAIFALLKICKOFFISGOING ONNOWANDWEJUSTHIREDDIESELJONESTOCHANGETHEWAYWEDOBUSINESS!GETFALLKICKOFFPRICINGONOURHUGESELECTIONOFPRE-OWNEDHYUNDAIS NEW2012 HYUNDAIGENESISSEDAN$399PER MO.^^SweetRide!PowerWindows&Locks,CD&MuchMore!$1999TOTALDOWN,36MONTHLEASE,MODEL#B0422 TheGenesisSedanisoneofthebestdealson themarket. -Edmunds.com NEW2012HY UNDAISANTAFEGLS$279PER MO.^^Tr actionControl,Front&SideAirbags,TonsofCargoRoom&MuchMore!$3000TOTALDOWN,36MONTHLEASE,MODEL#62422 Five-starratingsinbothfrontaland sideimpacts. -Edmunds.com NEW2011H YUNDAISONATAHYBRID$26,645 NEW2012 HYUNDAIELANTRA$179PER MO.^^PowerWindows&Locks,AM/FM/CD,Tilt,&MuchMore!$1999TOTALDOWN,36MONTHLEASE,MODEL#45412 High-classCabinforThePrice. -Edmunds.com NEW2012HY UNDAIACCENT$169PER MO.^^6Airb ags,Tilt&MuchMore!$1699TOTALDOWN,36MONTHLEASE,MODEL#16402 Larger,SharperandMoreFuel-Efficient. -Edmunds.com NEW2012H YUNDAISONATA$199PER MO.^^Auto,PowerWindows&Locks,AM/FM/CD,CruiseControl,Tilt&More!$2799TOTALDOWN,36MONTHLEASE,MODEL#27402 More-powerfulandmoreefficient fourcylinderengine. -Edmunds.com STARTINGFROM40MPG $13,522 2010HYUNDAIELANTRAGLS4D oor,Auto,AllPower,MintCondition PricedToSell $23,751 2010HYUNDAITUCSONLIMITEDLeather,JustTraded,AlmostNew, Only7KMiles! $22,900 2009&2010HYUNDAIGENESIS3TOCHOOSE FROMSTARTINGAT1-877-228-9195 8526967 L-Js l op-AirI f1)-49('BN Ridg. Rd.HYUNDAIAssurance

PAGE 49

The Sun Classified-Section APage 24E/N/C/VSaturday, September 24, 2011 All Harbor Advantages With Purchase BUY THE HARBOR WAY 4336 Tamiami Trail, Port Charlotte FL 941-629-1171 www.harbornissan.com36 Month Pre-paid Lease/ 12,000K per year. Stock 12070N 12 Altima, Stock 12039N 12 Sentra, Stock 11392N 1 Maxima plus tax and tag, license fee, and non-refundable acquisition fee, $599.50 dealer fee. Lessees WAC through NMAC Dealer retains a ll rebates, bonus cash and incentives. Some restrictions do apply. Bonus Cash .select new Nissans. Cannot combine Offers. Ends 9/5 Exclusively At Harbor WOW! 8788 2012 ALTIMA!start at$You Get All TheHARBOR Now! 7988 start at$ ADVANTAGESFree Service Free Full Roadside Assistance Tires For Life Loaner Cars Friends & Family Loaner Cars One to One Rewards Card Window Tint & More! WOW! 12,388 2011 MAXIMA!start at$ALL NEW! 2012 SENTRA SUPER SEPTEMBER SALE!AMAZING CASH BACK OFFERS ON REMAINING 2011 NISSANS! OPEN SUNDAY 11-4PM FOR YOUR CONVENIENCE! CALL 888-461-0950Prices exclude tax, tag, license fees, dealer doc $599.50 and reconditioning fees. See dealer for details. Some pictures are re presentative of the vehicle for sale. WWW.HARBORNISSAN.COM .| 941.629.1171 09/16/2011 Fo r Good People With Bad Credit!At BuyRight Auto Outlets we realize good, well-incomed people go through tough financial times and experience credit ch allenges. Thats why at Harbor Nissan we have our BuyRight program. We are the bank!Short term Unemployment Unexpected Medical Expenses Family Crisis Fixed Retirement Income First Time Buyer 877-4-BuyRight We ll-maintained 12 Month/12,000 Limited Mile Warranty Car Fax Report Luxury Models Available WE ARE THE BANK No embarassing turn downs Fa st, Simple On The Spot Financing right in our showroom Tr ained Factory Technicians available for future service & More!Just a simp le process so you can drive away in a new car today. Stop in and experience the ease of buying a car from BuyRight. Located at Harbor Nissan 4336 Tamiami Trail, Port Charlotte. You won t believe the BuyRight difference. You Buy Here. You Pay Here. TITANS LIMITED ,TIME OFFER WHILE SUPPLIES LAST$10,000IN DISCOUNTS! UNBELIEVABLE OFFER.up to All Harbor Advantages With Purchase All Harbor Advantages With Purchase ON ALL REMAINING 2011 DURING OUR SUPER SEPTEMBER CLEARANCE EVENT ALTIMA MAXIMA TITAN SENTRA PA THFINDER XTERRA ARMADA VERSA MURANO CUBE ROGUE QUEST Z COUPE ALTIMA HYBRID JUKE WE HAVE A CAR, VAN, TRUCK OR SUV FOR EVERYONE!While supplies last on select 2011 Nissans in-stock models or available quali ed dealer trades. Cash back offers may vary. Some restrictions will apply. Financing through NMAC, WAC. See dealer or www.harbornissan.com for details. CA LL TODAY FOR YOUR APPOINTMENT NO WAITING 888-461-0950 ASK IF YOU QUALIFY FOR A $300 DISCOUNT VOUCHER! UP TO $ 4000 CASH BACK GO GREEN WITH THE LEAFITS HERE. The 100% electric, no tailpipe, zero emission Nissan LEAF .As low as $25,280 net, after tax savings. MSRP $32,790 with federal tax savings from $0 to $7500 now. The 2011 Nissan LEAFt. Awarded a Top Safety Pick by the IIHS. See www.iihs.org.Gotta Drive It. To Believe It. 8519275 NWoJ:)]TJ-0.2045 Tc 7.5455 0 0 4 85.5634 676.0423 Tm(1 , )Tj0 0.502 0 rg0.621 0 Td( )-273( `1 I B 42T )Tj-0.3158 Tc 26.2105 0 0 5 307.0634 648.0431 Tm(I ` ] B242y6Jr 1-zcZero EmissionHToutletsauto the right way to finance a car!

PAGE 50

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section B Page 1 8518598 NOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMES4465DuncanRd.(Hwy17N), PuntaGorda,offI-75Exit164941-637-1122 or 877-507-1122www.prestigehomecenters.comMon.-Fri.9:00-6:00Sat.9:00-5:00Sun.12:00-5:00Pr estigeHOMECENTERS,INC.NOBILITYHOMESNOBILITYHOMES Charlotte HarborPunta GordaHwy17 orDuncanRd.PrestigeHomeCenter 3.7milesfromI-75 X I-75NOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMES2BR/2BA,HugeMasterw/DreamSuiteMasterBathFrom$79,9958517103 FinancingAndInsuring Y ourNewHomeWecanofferyout rueone -stop shoppingthroughourown financecompany,21stMortgage andMountainInsurance. Askaboutoutexclusive PaymentSaverProgramand findouthowyoucansave $30,000onthepurchaseand financingofyournewhome from21stMortgage. The Islander The Islander ArthurRutenbergHomes.comNo wB uildingin CharlotteCountyFor moreinformationcall:(941)505-1800orvisitourfully-furnishedmodelat 1203DeborahDrive,PuntaGordaIsles CGC055986SandStarHomes,LLCanindependentfranchise A wardWinningModel-OpenDaily!(941)505-1800VisitourBeautifullyFurnishedmodelat 5025BalHarborBlvd.,PuntaGorda,FL33950 ArthurRutenbergHomes.comSandStarHomes,LLCanindependentfranchiseMon-Sat.10:00-5:00Sun.12:00-4:00CGC013881/CGC055986 8518589 N N E E W W S S P P R R I I N N T T N N E E W W S S P P R R I I N N T T NEWSPRINT & & & & & I I N N T T E E R R N N E E T T I I N N T T E E R R N N E E T T INTERNETEachonereinforces theother Advertiseinthe SunClassifieds and Sunnewspapers.net Offersallofthefollowing online:8518597 sunnewspapers.net NEWSPAPERS ARCADIANARCADIANServingDeSotoCountysince1887 NEWSPAPERSCHARLOTTESUN VENICEGONDOLIERSUN ENGLEWOODSUN PUNTAGORDAHERALD NORTHPORTSUN ARCADIAN Rock Rock Solid Solid Service ServiceDOTTIEJOHNSON,GRI,CRS,SFRTime Time Tes ted Tes ted Results ResultsT el. 941-391-8020 Fax 941-766-0622 T T T ogether T E E Each E A A Achieves A M M More M OURTEAME-Mail dottiejohnsonteam@comcast.net (8yrsinarow) 2003-20108518596Tel. 941-391-8020 Fax 941-766-0622FEATUREDPROPERTY AGGR ESSIVELYPRICED FEATURESGALORE! NewerhighseerA/C, carpet&screening.Largeoversizedlanai, dualmasterbedroomswithseparatebaths. Supercleanandreadyforoccupancy. Recentpricereduction. $84,850 find 941.412.3323 877.337.3542 8527506 Arcadia Englewood North Port Port Charlotte Punta Gorda Venice Classifieds & Real Estate TM 866-463-1638 866-949-1426 Fax SP27195 INSIDE THIS CLASSIFIED/REAL ESTATE SECTION LOOK FOR: Classifieds: Real Estate 1000, Legal Notices 3100 Advertising: Real Estate, Showcase Of Homes TV & Movie Listings, Real Estate, Area Property T ransfers, Comics, Puzzles, Advice Columns, Horoscopes =!)!iRifSignature SothebysU3INTERNATIONAL REALTYdEND"r 1 1 `:a`.%.. G )Tj-0.0476 Tc 5.9286 0 0 6 370.3603 287.9928 Tm(' Win.:.)]TJ-0.0476 Tc 5.9286 0 0 6 681.3603 285.4929 Tm(' ,)Tj-0.0187 Tc 3.1125 0 0 6 704.3603 282.993 Tm(a)-97(r )Tj-0.1667 Tc 6.9167 0 0 5 260.8603 282.993 Tm( )-155( ti012 "' ..)Tj-0.3381 Tc 15.3836 0 0 5 677.3603 278.9931 Tm[(r.)-693(!-iii w )Tj-0.1667 Tc 6.9167 0 0 5 718.3603 282.493 Tm()Tj-0.0191 Tc 15.8827 0 0 10 137.3603 274.4933 Tm(W2, Zia'06.'elmM \ )Tj1 0.502 0 rg0.642 0 Td(` sfir. -. > I. w ] )Tj0 0.502 0 rg0.614 0 Td(, ...." 741w.._ Hsu Baia )Tj-0.1071 Tc 10.375 0 0 7 209.8603 140.9973 Tm(i _wu ,r)Tj/TT0 1 Tf-0.034 Tc 1.9762 0 0 7 281.3603 142.9973 Tm( 1'.t)-43()]TJ-0.1071 Tc 10.375 0 0 7 341.8603 147.4971 Tm(. ,w ,j)Tj-0.0875 Tc 6.3038 0 0 7 551.3603 148.4971 Tm(:.. ,, ---litCharlotte,SunCharlotte SunEnglewood Sun f, )Tj/TT4 1 Tf-0.0098 Tc 11.9503 0 0 15 518.6366 617.1762 Tm(North Port Sun =5wAti1)-458(,. ---

PAGE 51

The Sun Classified-Section BPage 2E/N/C/VSaturday, September 24, 2011 Round Town in Real Estate! 8518599 Scott Coulombe scoulombe@sun-herald.com 941-429-3118 The top individual in Listings was Robert Gravatt and the top team was The French T eam. The top in individual Sales was Richard Gierulski and the top team was The French Team. The office is located at 19700 Cochran Blvd., Port Charlotte. For more information, please call 941-627-3321 or visit us online at www.century21almar.com Five Star Welcomes Brian Garcia Brian is a Charlotte County native and has spent his entire life here in Charlotte County. After spending the last eight years w orking for Lee County EMS as an EMT and Paramedic, he has decided to step out into a new adventure and join our team. With his home town knowledge Brian can show you all that Charlotte County has to offer, from the miles of great beaches, to the fishing in Charlotte Harbor, scenic wildlife and f antastic shopping and dining. If you would like to know more, please feel free to give Brian a call and he will be happy to answer any and all questions. Brian Garcia, Sales Associate Office: 941-637-6116, Cell: 941-276-7313 CENTURY 21 ALMAR & ASSOCIATES IN PORT CHARLOTTE ANNOUNCES TOP PRODUCERS FOR AUGUST TO P SALES TEAM John Littlejohn Marilyn Purcell Carolyn Depenbrock TO P LISTING AGENT Sara Youngblood TO P SALES AGENT Gary Teeple TO P LISTINGS TEAM The French Team TO P SALES TEAM The French Team Robert Gravatt TO P LISTING AGENT Richard Gierulski TO P SALES AGENT COLDWELL BANKER RESIDENTIAL REAL ESTATE T OP AGENTS FOR AUGUST TO P SALES AGENT TO P SALES AGENT 351 W. Venice Ave., V enice, FL 34285 941-485-9147 www.hackworthrealty.com Group Group Group LLC LLC LLC 8526094 Est. Since 1987 MARY ELLEN DEITER DIRECT: 809-7305 Y OU WONT BELIEVE YOUR eyes when you see this 3/2/ 2model perfect pool home that was built in 2000. Enjoy the wide open floor plan and great location in Gulf View Estates, only 2 miles to the beach! You dont want to miss this one! $254,900 CLIFF STILES DIRECT: 468-3606 CHRIS LAVOIE DIRECT: 234-8980 IF YOUVE BEEN WAITING for that perfect maintenance free home-look no further! Come enjoy the golf, friendly neighbors, heated community pool & club house all available when you own this 3/2/2 great room style home. $235,000 MARY ELLEN DEITER DIRECT: 809-7305 KEN SULA DIRECT: 544-3197 CINDY FUCSIK DIRECT: 416-5103 LOOKING FOR THAT LARGE on the water-here it is! T his 4/3.5/2 T udor Style Home w ith p ool & d ock Is j ust m inutes f rom t he Gulf of M exico! T his private setting has to be seen to truly appreciate what a fabulous location & outstanding home this is! $995,000 QUIET, PEACEFUL WOODED view from the 2 nd floor 2/2 condo! B eautifully turnkey furnished unit with open floor plan, cathedral ceilings, large kitchen & split bedroom lay out. TRULY A MUST SEE!!! $124,900 WHAT AN INCREDIBLE PRICE for this large spit plan 3/2.5/2 pool home! Gorgeous family room with wood burning fireplace on a beautiful stonewall all under a beam ceiling looking out onto the pool & lake. Large master suite, formal living & dining rooms plus eat-in kitchen & breakfast bar. $229,000 Hackworth Realty Hackworth Realty Hackworth Realty 1000REAL ESTATEWe Are Pledged To The Letter And Spirit of U.S. Policy For The Achievement Of Equal Housing Opportunity Throughout The Nation. We Encourage And Support An Affirmative Advertising And Marketing Program In Which there Are No Barriers To Obtaining Housing Because of Race, Color, Religion, Sec, Handicap, Familial Status Or National Origin. EQUAL HOUSINGOPPORTUNITY REAL EST A TE 1010 16501010Open House 1015 Real Estate Auctions 1020Homes/General For Sale 1030Waterfront Homes For Sale 1031 Foreclosures For Sale 1035 Golf Course Community For Sale 1040Condos/Villas For Sale 1060Townhouses For Sale 1070Duplexes For Sale 1075Tri-Plex For Sale 1080Apartments For Sale 1090Mobile Homes For Sale 1100Interval Ownership 1100 Out of Area Homes For Sale 1115Trade/Exchange 1120Wanted To Buy RENT 1205 Lease Option 1210 Homes 1240Condos/Villas 1280 Townhouses 1300Duplexes 1320Apartments 1330Hotel/Motel 1340Mobile Homes 1345Misc. Rentals 1350Efficiencies 1360Room ToRent 1370Rentals To Share 1390Vacation/Seasonal 1420Wanted To Rent LOTS 1500Lots & Acreage 1515Waterfront 1520Out Of Area Lots 1530Commercial Lots 1540Trade/Exchange BUSINESS 1600Business For Sale 1610Business Rentals 1615Income Property 1620 Commercial/ Industrial Prop. 1640Warehouse & Storage 1650Farm/Ranches Classified = Sales OPEN HOUSE1010 09/24/11 OPEN HOUSE1010 100 West Venice Avenue V enice, Florida 34285 941-485-0021 Sat. 2pm5pm 1200 Tarpon Center Rd. Unit 208 Venice Island $329,800 Fabulous Gulf views! Beachfront! End unit! Updated & furnished! 2nd floor! Must see! Fran LeRoux 941-445-7744 19700 Cochran Blvd Port Charlotte 941-627-3321 Sat. 11am-2pm19375 Water Oak Dr. K205 Port CharlotteHeritage Oak Park 2/2 condo with carport Lake view,fitness room, activites, heated pool tennis court. Gated community. Call for gate code Glen Jarman 941-404-9767 Fri.-Sun. 8am-3pm 14229 Marlin Ave. Port Charlotte. ESTATE SALE: All contents, '78 El Camino, even the home. CINDY SPIRK 941-429-2727 Sat. 12pm-3pm 3378 Deck Street Port Charlotte Exquisite Custom River Front Home! 4/4/5 Pool 5,234 sqft living $995,000 MLS#C696946 Donna French 941-661-1202 SELLING YOUR LOT, HOME OR CONDO??Call the Sun at 866-463-1638 and ask about our BRAND NEW Buy 2 Months Get One FREE! Real Estate Ad Program. Y our ad will run everyday in the newspaper & run online for 90 days! All for a ONE TIME low price. Hurry, Offer good thru Sept. 30, 2011. Call for details. Realtors Welcome! OPEN HOUSE1010 ALLISON JAMES Estates & Homes PRAIRIE CREEK PK 5 TO 21 ACRE LOTS MLS LISTINGS BEGAN @$38,200 /HOMES @ $175,000 ALSO Bank Owned & Short Sales 3/2 Pool/canal hm $184,900 ALLListings. SEARCH:www. PuntaGordaPropertiesforsale.com BAY INDIESRESORT COMMUNITYCOME SEE WHAT OUR LIFESTYLE HAS TO OFFER!950 RIDGEWOOD AVENUE VENICE, FL 34285 941-485-5444 OPEN HOUSE DAIL Y! MON FRI 8-5PM SATURDAY 10-2PM SUNDAY 12-4PM Bird Bay Village, Venice Saturday, September 24th 11 AM-2 PM 1112 Bird Bay Way Excellent Unit & Location Ground Floor 2/2 Corner on Lake $175,000!!! Hans Kirsten Cell: (941)350-0441 Bird Bay Realty, Inc. (941)485-4804 ADVERTISE In The Classifieds! ENGLEWOOD, SUNDAY 12-3 81 Stratford Rd.Great Location Near Historic Old Englewood & 10 Minutes to Manasota Key. 2 Bedroom, 2 Bath, 2 Car Garage Pool Home on Oversized lot. $150,000. Mary Stuart, Coldwell Banker (941)-735-1496 Opportunities are out there, subscribe to the Call 206-1200 Today!! SP29851 SS,U 3 I)14(r .i y.T)]TJ-0.0571 Tc 5.9286 0 0 5 569.5053 1130.7164 Tm(`-'j I r_o=. .tcl sa= 4 1F ) J)>< Fii1111Ja),p llio = 131 I :r))31())11+ )152((ib' ISUNS,r:llll)]TJ0.0968 Tc 4.0161 0 0 5 400.0053 1043.2191 Tm() 2:, 1 Cn dSwoE+;kueNww ivrt vGx i )Tj-0.119 Tc 3.9524 0 0 4 669.5053 1046.719 Tm( r! l iJ11 ")]TJ-0.0857 Tc 5.9286 0 0 10 466.0053 1004.2203 Tm('! r_ v1fr Jlt)40(ll(l)]TJ-0.0404 Tc 9.2222 0 0 11 421.5053 972.7213 Tm(. ')31( vf =IJIt )Tj-0.0189 Tc 5.4811 0 0 12 398.0053 955.2218 Tm[()184(, pl;3111y%J ,. .)]TJ0.078 Tc 7.8008 0 0 6 405.5053 933.7224 Tm[(ll(pt Q: is > a3s t.xif..: e.7Li+l 1411 -FBI Ian

PAGE 52

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 3 Meet Your Real Estate Agent Meet Your Real Estate Agent 8528970 4456 Tamiami Trail Po rt Charlotte, FL 33980 Ich Spreche Deutsch 941-235-5609 Free 1-800-445-7043 christamurch@hotmail.com www.sunnylandhomes.com Christa Murch, GRI Aztec & Associates Brett Barber We may not be the biggest But we are the best Located on the beach next to the Lock & Key Restaurant Office 941-474-7121 Cell 941-270-1659 T eam up with success!! We list, we sell and we are sold on serving our clients!! Our hours are flexible to fit our clients needs and we are available seven days a week. Direct: 941.628.5027 Jeremy T. Jones Broker Associate Venice Real Estate Company 941-650-9481 Lou Sauppe Realtor Office 1680 El Jobean Rd Port Charlotte, FL 33948 Cellular (941) 740-0529 e-mail: maureen@kelligroup.com To view all MLS listings, please visit my website www.kelligroup.com Maureen Duso SFR Realtor, REALTOR Blaine Harteg REALTOR REALTOR POWER BROKERS REAL ESTATE 4045 Tamiami Trail, Suite 9 Po rt Charlotte, FL 33952 Office: (941) 258-3379 Cell: (941) 740-2595 To ll Free: 1-866-463-1637 Fa x: 1-866-929-1207 Blaineha@gmail.com 25166 East Marion Ave. Punta Gorda, FL 33950 Cell: 941-769-0218 Fax: 941-766-0172 Email: cashsellsflorida@gmail.com Web: http:// angelacash.mfr.mlxchange.com/ Angela Cash Search All Listings, Bank Owned & Short Sales www.puntagordapropertiesforsale.com JUDY PETKEWICZ GRI, CRS Your Neighborhood REALTOR 305-304-8304 CORAL SHORES REALTY INC., FL P.O. Box 1740, 2538 SW Hwy. 17 Arcadia, FL 34265-1740 Cell: (863) 990-1877 Office: (863) 494-2211 Fax: (863) 494-2632 Toll Free: (888) 741-2632 peggymardis@remax.net www.peggymardis.com Margaret A. (Peggy) Mardis GRI, ABR, Realtor D EBORAH M ILLER REALTOR CDPE, SFR, SRES TheDeborahAndDickMillerTeam.com 941-876-7777 4456 Tamiami Trail Charlotte Harbor, FL 33980 941-457-7072 Website: www.loriannmertens.com Each Office Is Independently Owned & Operated. Lori Ann Mertens Realtor TheWatersideGroup941.268.4999 EllenBaker Specializingin L uxuryHomesTheWatersideGroup@gmail.com P ATTY G ILLESPIE 941-875-2755 REALTOR, GRI, SRES, e-PRO, CSSS www.CallTheCaptain.net Capt. Chuck Eichner CALL THE CAPTAIN! 941-833-4234 Marge Tra yner Your Hometown Realtor 941-380-2823 www.budtraynerrealty.com 1531 Rio de Janeiro Ave. Deep Creek Bud Trayner Realty, P.A. T O P LACE Y OUR A D O N T HIS P AGE T O P LACE Y OUR A D O N T HIS P AGE F OR S EPTEMBER F OR S EPTEMBER P LEASE C ALL 866-463-1638 P LEASE C ALL 866-463-1638 Lorraine Anderson Realtor 941-875-5657 We Keep in Touch 4additionalinfo@gmail.com Mark Anderson Realtor 941-875-5657 We Keep in Touch 4additionalinfo@gmail.com ADVERTISE! MLS,Ta Pines RedIty

PAGE 53

The Sun Classified-Section BPage 4E/N/C/VSaturday, September 24, 2011 SP29553 RENTALS HOMES FOR RENT1210 209 Stebbins Tr, PC Lg. 4/3/2, pool, sailboat access w/dock.........$1295 2040 Winningway, PC Lg 4/2/2, fenced, corner lot, mstr.BR/sitting/TV rm $975 116 Colonial SW, PC Lg. 4/3/2, pool, canal harbor access, dock, tile.....$1300 102 Colonial SW, PC 2/2/1 all tile, newly remodeled, upgrd kit, corner lot.............................$800 109 Leland SE, PC 3/2/1 all tile, on canal w/dock harbor access ................$950 3084 Key Ln, PC 2/1 Carprt, CHA, tile,fam. rm, scrnd lanai, laund rm.. $600 23340 Jason St, PC 3/2, window AC, tile, W/D, stained wood deck .....$550 22186 Belinda, PC 3/2/ carport, CHA, all tile, appl., W/D, fncd yard...........$725 Contact Diane @ 941626-7090 or Kathy @ 941-628-8855Paradise Properties & Rentals 46 UNFURNISHED UNITSSHORT TERM FURNISHED AVAILABLEWWW.ALMAR-RENTALS.COM WE NEED MORE LISTINGS ALMAR RENTALS & MGMT. SERVICESPORT CHARLOTTE/NORTH PORT/ PUNTA GORDA/ENGLEWOOD 941-627-1465 800-964-3095 A A F F F F O O R R D D A A B B L L E E H H O O U U S S I I N N G G ! ! 4 4 b b r r / / 2 2 b b a a / / 2 2 c c g g N N o o r r t t h h P P o o r r t t *On Selected single family homesNow Open Mon Fri 8-4 Sat. By appt. only (941) 613-1469 S S E E P P T T E E M M B B E E R R M M o o v v e e i i n n f f o o r r s s e e c c u u r r i i t t y y O O n n l l y y ! ANNUAL RENT ALS R O T OND A WEST 2/2 Oakland Hills $675 3/2 Flower $1200 GULF COVE 2/1 Hogan $550 ENGLEW OOD 1/1 Quails Run $600 POR T CHARLO TTE 3/2 Cannolot $825 NORTH PORT 3/2 Goodrich $995 3/2 Oasis $900 3/2 Monday $9002012 SEASONAL RENTALSEnglewood, N. Port & Pt.Char 1/1 Condo, waterview $1400 2/2 Condo $1800 2/2 Home $1600 3/2 Mobile Home $1300 2/2 Home $1500 2/2 Pool Home $1800 Diana Legg/Michele Ross Y our Rental Experts 941-475-7011 941-681-1189 website: www.icre.us NEED RENTAL HOMES FOR QUALIFIED TENANTS ARCADIA 1B/1B Duplex N of town, large yard, lawn care, sewer, water included $450 mthly $450 Sec. 863-5581130 PORT CHARLOTTE 2/1 CP home, FR, LR, upgraded, new, clean $650. 423-255-1612 HOMES FOR RENT1210 ARCADIA 4B/2B 1Car Garage, carport, CHA, Fenced yard, Just remodeled! In country but close to town $1100 mth Plus sec. 863-558-1130 BURNT STORE ISLES 4/2/2 w/pool & dock w/boat lift, sunset views, unfurn.,1st & last. $1600 mo. 603-491-9292 DEEP CREEK 4/2/2 $950 Lanai, cul-de-sac, Quiet Realty Executives Mainstream 941-979-8915 EAST ENGLEWOOD clean 3/2/2 Home w/lanai in quiet nhood. Bch + Shopping close $900 mo. 941-662-7874 ENGLEWOOD Rentals M&MProperty MGMT CALL 941 473-9616 or mmpr oper tymgmt.com ENGLEWOOD 1/1, Unfurn, Stove, Fridge, Air, W&Dhookup. $500/mo +util, Cell: 517358-1422 or 517-529-4533. Englewood 2/2/1 $725 Lanai, Quiet Area Realty Executives Mainstream 941-979-8915 ENGLEWOOD 3/3/1 North Englewood pool home.Fenced yard, dead end street. includes pool service. Possible in-law suite. leave message. $895 941-539-0746 ENGLEWOOD AREA: 3/2/2 Split N. Eng 2583 sqft poolw/ service $1200 3/2/2 Rotonda, living Dining, family & Extra (poss. game rm) with pool service $1050 2/1.5 Duplex N Eng new paint & tile, $600 W est Coast Property Mgt. www.rentalsFlorida.net 941-473-0718 ANNUAL & SEASONALRENTALSC all The Pineapple Girls 941-473-0333Pineapple Gulf Prop. Mgmt. Inc.www.RentEnglewood.com For a Complete List Go To eraportcharlotte.com$1000...3+/2.5/2..1713 SF..NP $900....3/2/1..Townhome.... NP $875...3/2/2..1478 SF.........NP $800..2/2/2..1356 SF...PC/ROT $750...3/2/1.....998 SF.........NP LET US RENT YOUR HOME Agent Available On Weekends We Forgive Foreclosures For Renters FULL SERVICE PROPERTY MANAGEMENT Only $59 p/m, (flat fee) 877-400-0354 RENTMEFLORIDA.COM KINGS HWY 3-4BR/2BA HOME. $500; NEEDS TLC 1ST&SEC. 941-624-0355 NEED A RENTALParadise Properties & Rentals,Inc941-625-RENT North Port 3/2/2 $875 Screened Lanai Close to Schools. Realty Executives Mainstream 941-979-8915 HOMES FOR RENT1210 NORTH PORT BRAND NEW 3/2/2 ON CITY WATER. LARGE YARD! 1500+SF $950/MO 941-350-1288 NORTH PORT Extra Clean 3/2/2 laundry room, screened Lanai, $850 Lease & Deposit. 941-379-4463 NORTH PORT NEWER 3/2/2 w/ family room on canal. 3104 Tonkin $900/mo Investment RE492-5050 NORTH PORT New 3/2/2, $875 Mo.1st & sec No pets/ smoke. 1829 New London St. Avail. 9/1/11. 941-625-9065 NORTHPORT, 3/2/2 w/pool. Built in 2005, near schools, I75, US 41 and shopping. $1350/mo. 941-426-6217 or 347-721-2958 Available Now. Sec. 8 Welcome NORTH PORT 3/2/2 Extra clean, all appliances, great central location. 1st/ last/sec, avail now $875/ mo. 305910-1829 or 941-237-8399 PORT CHARLOTTE 3/3/Den/1 newly remodeled, jacuzzi, laundry rm, huge backyd $800. No pets. 941-204-3197 or 407556-5288 DEEP CREEK 2br/2ba, 2ndflr, Lake view, GATED Clubhouse,Annual. $700/mo 941-483-9093 PORT CHARLOTTE 3/2/2 on Kim/Comstock. $975. mo. Avail. 9/1. 941-627-1000 Haley or Cathy 941-456-4159 PORT CHARLOTTE 2/2, DW, W/D hook up, all tile, lrg yard, fireplace, quite area $700 mo. (207)-590-6897 PORT CHARLOTTE 2BR/ 1BA/CP, new carpets, updated kitchen, FL rm, LR, DR $595, avail Oct. 1. 516-508-8181 PORT CHARLOTTE 3/1/ CP, CHA,$600 mo. No pets. 1st., last, sec. 941-629-7056 PORT CHARLOTTE 2/1 house, $590 mo; 2/2 duplex $500 mo 1st, last, and security required. No pets. 941-621-3389. PORT CHARLOTTE 2 Hms Great area 3/2/CP & 2/2/1 $800/$750 All tile, Avail. Now Flex terms 941-629-0157 PORT CHARLOTTE2/2 or 3/2, tile, lanai, appl. w/d $695$995 mo. 1st + sec. Ann. Sm. pet ok (941)-626-1514 941743-0386 PORT CHARLOTTE 2/2/1 on fresh water canal 1628 Abscott St. $750/mo, $1,000 Sec. no pets 941-815-7450 PORT CHARLOTTE 3/2/2 $1700 Salt Canal, Pool, Furn. Dock. Realty Executives Mainstream 941-979-8915 GET RESULTS USE CLASSIFIED! PORT CHARLOTTE 3/2/2 sailboat canal htd. pool dock lift long or short term $1,000 941-255-0554 PORT CHARLOTTE 3/2/CP, Newly Decorated. appliances, lg lanai, storage $795, Pet neg 941-456-3439 PORT CHARLOTTE Murdock Nice 3/2/2,POOLserv incl. tile, pets negot. N/S $1000 mo + sec 941-769-1604 PORT CHARLOTTE Y early, great 2/1/1 lanai, nice area, $650 1st & last. 508-8887869 or 508-274-5945 PORT CHARLOTTE Lrg., 2 Bdrm, 1 Bath central heat & air NEW blinds & carpets, No Pets $550. 941-743-3489 PUNTA GORDA ISLES, newer 3/2/2, living rm, dining rm, lanai, fenced yard, pets neg. $900 mo 317-702-2290 HOMES FOR RENT1210 PUNTA GORDA Live in luxury in a new construction pool home. Prices starting at $1,200/mo Call Robyn 941-747-7261 PUNTA GORDA, Riviera Lagoons. 771 Coral Dr. 3/2 split floorplan. 261 ft of Sailboat waterfront. Seawall, 2 docks & boat lift $1,000/mth, contact Tiffany Monday Sunbelt Home Services,LLC (941) 625-6120 a greHouses start @ $600 Condos start @ $550 www.allfloridarealty.com (941)629-1121 Real Living All Florida Realty ROTONDA 3/2/2 golf course/lake views. Pets negotiable. $1,000 941626-0858 ROTONDA 3/2/2 Pool and spa on golf course & canal. $1,450 941-270-2199 ROTONDA AREA 3/2/2 $1000 1846 sq ft, Screened Lanai Realty Executives Mainstream 941-979-8915 SOUTH VENICE ENCL POO L W ell designed 2/2 tiled, alarm, j acuzzi tub, semi furn. $115 0 mo+dep 866-653-6417 CONDOS/VILLAS FOR RENT1240 12 UNFURNISHED CONDOS Almar Rentals & Mgt. Services 941-627-1465 Almar-Rentals.com 175 Kings Hwy, PC 2/2, 3rd fl, elev, furn/unfurn ann., comm pool, clbhse.....$750 21320 Brinson PC 1/1, 55+ amenities, cls to hosp, shpg, Cult.Ctr............$475 820 Kings Ct. PGI, 1/1 PG Hist. area, close to Fishermens Vill. & downtown, no water bill..........$500 $575 25100 Sandhill Blvd, PG 2/2 2nd fl, no elev. all appl amenities, incl water....$550 900 E. Marion Ave. PG 3/2 lg new condo overlooks Peace River, dock, gated, amenities, upgrades, undrgrnd park,3rd fl, Elev.$1000 ALL CONDOS NO PETS Contact Diane @ 941626-7090 or Kathy @ 941-628-8855Paradise Properties & Rentals ANNUAL & SEASONAL RENTALSIN BIRD BAY VILLAGE BIRD BAY REALTY (Venice) 484-6777 or 800-464-8497 NEEDAJOB? CHECKTHE CLASSIFIEDS! DEEP CREEK2/2 lanai, cath. ceil., tile, wood cab., granite, w/d inc. Pets ok $695+ up. 941-661-4539 DEEP CREEK Gardens, 2/2, 1st floor end, screened lanai, $650/month, plus utilities, 1st, last, sec. ReMax Anchor Realty 941-628-1572 ENGLEWOOD 55+ Comm. To sublet for 4 mo. 1BR/ 1.5BA, walk-in closets,, lanai. $625 per mo. Cable TV incl. Avail Oct.1. 920-857-4673. CONDOS/VILLAS FOR RENT1240 ***CONDOS *** 1/1 Oak Forrest 55+ Comm., W ater Inc., Comm. Pool Forrest Nelson, P .C. $400 Mo *we welcome new listings* AWARD WINNINGSUNBELT MGT. SERVICES RENTALS COMPLETE LISTINGS (941) 764-7777sunbeltmgtser vices.com LIVE IN style in beautiful Fountain Ct, PGI. Gorgeous 3BR, amenities galore, unfurn. $850. Realty Management 941-625-3131 PORT CHARLOTTE 1/1, 55+Comm.Pool, Lndry, storage. $475. 941-223-0290 PORT CHARLOTTE 2/2 off Kings Hwy, ground floor, includes water, pool, & tennis. Sm pets ok, $675 +sec 941-286-9888 PORT CHARLOTTE 2BR/2BA Appliances. Across from Cultural Center, Available Now $600/mo + 1st & sec. No Pets. 941-575-3543 PORT CHARLOTTE, 2/2 ground floor, All amenities & appl, Military, Med. & Sr. dis. wtr/incl $700 941-627-1414 ROTONDA 2/2/1 Patio & Lanai, W/D, Quiet Area. No Pets. Unfurnished. $825/mo 941-763-3700 ROTONDA Newer 2 BR condos from $800 incl Wtr/Swr/Cbl. Sm pets ok. Fiddlers Green Rentals. 941-698-4111 or 941-539-1838 VENICE 2/2 beautifully furn, 1st fl, pool/golf, remodeled, annual. $850 mo. 1st, last, sec. 828-766-6448 DUPLEXES FOR RENT1300 ENGLEWOOD 1/1 $450; 2/1 $550 Remodeled, Lanai, All Tile NS/NP. 941-400-1670 ADVERTISEWITHTHE SUNCLASSIFIEDS ENGLEWOOD 1/1 CLEAN & ONLY 1 BLOCK TO BEACH! 1st/last/sec. $725 941-661-4871 ENGLEWOOD NICE CLEAN 1/1 LANAI,with W/D & lawn maint. incl $550/ mo. + 1mo sec 941-460-9403 NORTH PORT 2/1 near stores, buses, good condition, tile floors $700/mo + last month. 941-426-2942 PORT CHARLOTTE 2/2 $700 inc Lawn maint/ $50 of water bill Realty Executives Mainstream 941-979-8915 PORT CHARLOTTE/NORTH Port299-B Longley Dr. 2/2 garage, CHA $600 Mo + $500 dep 941-284-2917 APARTMENTS FOR RENT1320 ENGLEWOOD RESERVE NOW! 1ST MONTH ONL Y $375 12 mins from Venice 2br w/ den 2 ba 1300sf, Swimming pool $750/mo 941-473-0450 APARTMENTS FOR RENT1320 MARIAN MANOR APTS. 2/1 Starting at $595. ** Pets Welcome **Restrictions And **Income Limits Apply Call 941-391-5669 N. PORT$500.00 MOVES YOU IN! $900/MO w/ ann Lse. 3/2/1 luxury condo 1425SF. Sm Pets OK Call for apt 941-350-2704 TTJ Invest. -Emerald Oaks 4520 S Biscayne Dr NEW LUXURY APARTMENT COMMUNITY Located at 125 Airport A ve on Venice Island Just a short walk to the BEACH!! Apartment Homes are Completely Remodeled. New Stainless Steel Appliances, Tile Flooring, much More! Resort Pool, Fitness & Business Center. Pets Welcome! CLASS AAANon Smoking Community Starting at $680/mo. Call 941-412-4963 Professionally Managed by Gallina Management,Inc CITADEL APARTMENTS OF VENICE NORTH PORT VICTORIA POINTE APTS. at Sumter & Appomattox between US 41 & I-75. Accepting application s for 1BR & 2BR Apts. Conve niently located close t o schools, shopping entertainment & beaches 941-423-8720 Available Soon Studio Apts Income-Based Housing for those, 62 and older. Please call 941-624-2266 Limited availability, Restrictions Apply. TTY:1-800-955-8771 EQUAL HOUSINGOPPORTUNITY PORT CHARLOTTE 1/1 very good condition, asking $490 month. water included. 1st, last security. 941-380-9212 No pets!! PORT CHARLOTTE north end, furn mother-in-law apt, all util incld, no pets/drugs/ smoking. Avail 10/1 $600 mo. + $600 sec. 585-729-5884 PUNTA GORDA Clean 1 BR, LR, Fl rm, patio, large yard, garage available. Quiet area. Riverside Dr. $385 /mo with discount! 941-740-4769 PUNTA GORDA Downtown, walk to everything, 3/2/1, $975/mo. Call 941-456-4159 PUNTA GORDA 2BR/1BA/CP Corner of Taylor & Ann St. $700/mo incl. water 1st mo+ sec to move in. 941-740-0491 The Fountains 1/1 from $580 2/2 from $680 3/2 from $795 Call for specials 941-429-9799 VENICE ISLAND APTS 1 bedr oom apt avail. Close to beach & downtown. No pets, no smoking. 941-451-3175 Ki,,)Tj-0.0077 Tc 4.4865 0 0 7 131 1121.002 Tm(4 .e /fir )Tj-0.4248 Tc 23.2652 0 0 7 583 1114.0023 Tm[()-234(I1)Tj-0.1071 Tc 10.375 0 0 7 722 1115.5022 Tm(Io s Iftt 1 )Tj1 0.502 0 rg0.567 0 Td( -_ ,mes dos tments aMoreo ri N Cori l a 1 And)]TJ/TT3 1 Tf-0.0081 Tc 6.7558 0 0 10 590.5 1077.0034 Tm(Pr ONTHREERENT)-480(NER:1..11 )-579(IC )Tj/TT4 1 Tf-0.0868 Tc 5.8962 0 0 6 174 206.03 Tm[(0.EN7 ME FLORID,,

PAGE 54

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 5 SP31029 LAKE SUZY ESTATES Pool Home. 3/2.5/3.5 Custom Built 2004. 2 Story, 3400 sf on Double Lot. Master on 1st Floor, Granite, Tile, Gourmet Kitchen, Bonus Room, Office & MORE! $389,000 941-204-0074 UNIQUE CUSTOM BUILT HOME REDUCED!! EXTENSIVELY REMODELED with 500 SF Master Suite addition, heated pool,new kitchen and so much mor e. Estate has priced to sell $265,000 MLS#A3940834 Stevens & Salt, Inc. 941-349-6636/800-326-9114 NOKOMIS ON ST.ANDREWS GOLF COURSE Why Wait? Immediate possession of custom b uilt home with spectacular view and privacy. Pristine condition inside and out, Great r oom,Heated pool Call for Private showing401-769-4073$289,000 PUNTA GORDA ISLES Check out the Fish Finder e very Thursday,only in Wa terLine,only in APARTMENTS FOR RENT1320 TOLEDO CLUB APARTMENTS SUMMER SPECIAL!RESERVE YOUR NEW HOME UP TO 4 MONTHS IN ADVANCEFREE RENTAVAILABLE ON ALL APARTMENT HOMES!! STARTING AT $555/MO!! 2 POOLS, SPA, 24 HR FITNESS CENTERS, WIFI INTERNET ACCESS & PETS WELCOME LOCATED OFF T OLEDO BLADE BLVD IN NORTH PORT T OLEDOCLUBAPTS.COM SPECIAL ENDS SOON!! 941-423-6600 VENICE CLUBSIDE APTS. 1 Bedrooms Available. $199 Move in Fee. Call (941)-488-7766. VENICEISLAND Efficiency 1 & 2 br, Immed. occup. No pets, 1 yr lease 941-416-5757or 323-6466 ADVERTISE In The Classifieds! VENICE STUDIO & 1 Bedroom Accepting Section 8 Vouchers 941-488-7766 EQUAL HOUSING OPPORTUNITY VENICE V ery clean 1BR/1BA Newly Remodeled, covd parking, pool, Walk to shops $695/mo+ deps 941-544-3388 V ENICE-SPACIOUS 2BR/1.5, Unfurn, Close to shopping, $650mo 1st, Last + Sec (941)-966-2762 APARTMENTS FOR RENT1320 VILLA SAN CARLOS II 22250 Vick St. Affordable-Income based One bedroom apartments for 62 or older Income Limits Apply Call 941-624-4404TTY-1-800-955-8771 VILLA SAN CARLOS 2550 Easy Street Income based 62+ or needing features of accessible unit Income Limits Apply Call 941-624-2266 TTY-1-800-955-8771 EQUAL HOUSINGOPPORTUNITY VILLAS OF NORTH PORT 5200 S. BISCAYNE DR. NORTH PORT, FL 34287 (941) 426-2266 Phone Now accepting applications for seniors 62 and over and individuals with disabilities at any age. 1BR $485. $250 Sec. We allow Pets! $300. pet security deposit. Water, Sewer and garbage incl. $25.00 Application FeeEQUAL HOUSING OPPORTUNITY WOODMERE APARTMENTS OF VENICEStarting in the low 700s. Call 941-496-4161www.woodmereapartmentsofvenice.comResort Style Pool Clubhouse, Fitness, And Business Center with WiFi. Pets Welcome Professionally managed by Gallina Management, Inc MOBILE HOMES FOR RENT1340 NOCATEE MOBILE HOMES 3 BR, $550. mo. & 1 BR $400. mo. KINGSHWY. 2 BR. $400. mo. 941-624-0355 PUNTA GORDA 55+, 2/2, lake view, furn, near Hwy 75. 1st mo + sec. dep.$750. 941505-2960 or 262-498-5882 VENICE Ranch, priced to sell! Doublewide 2br/2ba/walk in closet, Furnished MUSTSELL MOVING! 941-485-2949 EFFICIENCIES FOR RENT1350 ENGLEWOOD Furnished $425/mo including utilities w/ year lease 55+ Park No pets lease (941)-474-1353 HARBOUR HEIGHTS close to river, newly renovated efficiencies with cable & internet, Sunnybrook Motel 941-625-6400 PORT CHARLOTTE 2 room suites, waterfront, weekly rates with Wifi. Between $200 & $240. Call 941-661-4262. GET RESULTS USE CLASSIFIED! PORT CHARLOTTE, Private entrance. Pool. Canal front. Furn. Nice area. Includes all. $135/wk. Ref/sec 941-624-0169 ROOMS FOR RENT1360 ENGLEWOOD $110 wk. Close to Manasota Bch & 776. No sec./util/lease, 941-473-0543 ROOMS FOR RENT1360 ENGLEWOOD FURNISHED ROOM WITH BATH, POOL UTILITIES INCLUDED. $400/MO. 941-474-4891 ENGLEWOOD, EAST senior welcome, CNA care available, quiet & clean, house privileges. 941-475-0742 ADVERTISEWITHTHE SUNCLASSIFIEDS NOKOMIS full house priv, shared bath, off street parking, quiet, no drinking, drugs, childern, or pets, $375 mo, $100 sec. 941-929-5745 NORTH PORT Furnd room & bath. Pool. Utilities incl. House privileges. Pets OK. $500/mo 941-423-6104 or 941-356-0985 PORTCHARLOTTE Furn. Nice. Close to all. Incl. util. kit privl. $125wk+dep. 941-626-2832 PORT CHARLOTTE V ery clean Lg room, Priv. bath, Priv. ent., utilities incl., no smoking, $400/mo plus deposits. 941-627-5382 PUNTA GORDA accomodataton. $50/$80/$120 per wk. Give me a call. 941-575-9577 VENICE GARDENS $435 + sec. Util, kit, & parking privilages. Reliable male. No drugs, smoking, pets. 941-497-4609 RENTALS TO SHARE1370 EAST ENGLEWOOD area, private bath & furn BR full priv. W/D $500 941-916-4058 NORTH PORT, F/seeks m/f to share furn. home. Inclds util. cable, phone, W/D, spa, across from lake. $125/wk. 941-429-1271 SP29553 RENTALS OPEN HOUSE1010 HERIT AGE LAKE P ARK Sales Office Open Daily MON.-SUN. 10:00 AM 4:00 PM Condos & Villas from Unbelievably low prices. Starting at $63,000 Summer Specials Buyers Incentives Sharon Kerr 941-286-7315 BURNT STORE ISLES Sat. 09/25 & Sun. 09/25 12:00 PM 4:00 PM 341 Monaco Dr. Captiva Professionally Decorated If you are planning to build, Y ou MUST see this home. ENGLEWOOD Sat. 09/24 & Sun. 09/25 12:00 PM 3:00 PM 4260 Placida Rd. #22D $117,500 Forest Park Pristine 2BR/2BA New 2 car carport, Lots of amenities. Room to store your boat. Jerry Curless 941-412-5123 Por t Charlotte Sun. 09/25 1:00 PM 4:00 PM 3128 Pinetree St. $89,000 Freshly painted inside & out 2/BR 2/BA Spacious home. Barrel tiled roof on a large Fenced corner lot. Anne Kyer 941-661-5272 PUTCLASSIFIEDS TOWORK FORYOU! FIND A JOB! BUY A HOME! BUY A CAR! NEEDCASH? OPEN HOUSE1010 OPEN HOUSE SAT. 10am 2pm3600 Middletown St. $89,900Must See! Large 3B/2.5B pool home on freshwater canal (North 41, R Gardner, R Westchester Blvd., L Middletown) OPEN HOUSE SAT. 11am 2pm7196 N. Plum Tree #326 Punta Gorda $119,000 3/2 condo, Plum Creek, larger corner unit upstairs w/cath. ceiling. (US 41 S to R on Royal Poinciana, R on N. Plum Tree.)OPEN HOUSE SAT. 10am 2pm333 Severin SE Road Port Charlotte $599,900 Large 5/3.5/2 on Charlotte Harbor. You will not get close to this view any where for this price!! (41 N to Edgewater, R Severin)OPEN HOUSE SAT. 11am 2pm23213 Elmira $69,900 2 Bed, 2 Bath recently updated. (Kings Hwy to Elmira or Beacon) ADVERTISE In The Classifieds! R.E. AUCTION1015 REAL EST A TE AUCTION Nominal Opening Bid: $50,000 Punta Gorda, FL 3210 South Shore Dr #12A 3BR 2BA 2,400sf+/Sells: 2:00PM Tue., Sep. 27 on site Inspections: 1-4pm Sun Sep. 18th, 25thwilliamsauction.com/september800-801-8003 Many properties now available for online bidding! A Buyers Premium may apply. Wi lliams & Williams FL Broker: Daniel S Nelson Re Lic BK3223097; W illiams & Williams Re Lic 1032049 Auctioneer: Wi lliams & Williams Auc Lic AB-0000760 Advertise Today! SHOWCASE OF FIND YOUR0 -)1 IES HOME TODAY,SUN,"= L

PAGE 55

The Sun Classified-Section BPage 6E/N/C/VSaturday, September 24, 2011 SP31029 Open Sunday 12-3pm 1424 Lemon Bay Dr. Englewood on Red Fish Cove 4/2.5 split; dock w/lift; breathtaking water views!Stephen L. Lingley 941-809-7580 LIVE IN LUXURY ENGLEWOOD $384,9001116 S McCall Road, Unit 132 T op floor Penthouse Suite w/amenities galore including 24 marble tile, granite counters, upgraded cabinets, crown molding, plantation shutters & more. Deeded boat slip, quick access to Stump Pass & less than 2 mi to Englewood Beach!Floridian Realty ServicesLinda Futch 941-270-2978 / Steve Avila 941-525-3195 OPEN HOUSE SAT. 12-3 LAKE SUZY 2005 3/2/2 Perfect Full Time or seasonal home, all app 1 yr old, Plantation shutters, Wood floors, many extras. Near golf course, Private yet convenient. Great Location. Low Taxes. $124,900. 941-286-1233 LAKESUZY ROTONDA Golf home 3/2/2, Living 1873, total 3051 Hi ceiling w/7 fans, open-split plan with untold amenities. Must See! 941-698-9652. REDUCED! $145,900 ROTONDAGOLFHOME Immaculate 2008 3/2/2 patio home, private heated pool, lakefront lot. Maint. free. HOA. $279,000. 941266-0206 SARASOTA PALMER RANCH PORT CHARLOTTE Harbor Heights. 3/2/Car Port. Completely Remodeled including New Kitchen, New Bathrooms, New Flooring, ETC! 1990 sf. on 15,000 sf. lot. Movivated seller! Owner financing available. Only $64,900. 786-223-0404 HARBOR HEIGHTS BEAUTY!! Beautiful 3 Acre Mini Ranch Special Rural FINANCING! 10 Mins to shopping, restaurants, etc..., yet offers the best of country living. Stocked pond, fenced, new appliances, completely redone. BUYERS HOME WARRANTY INCLUDED. FANTASTIC NEW PRICE @ BEAUTIFUL 3 ACRE MINI RANCH! Back on the market! CAPE HAZE AREA New seawall, Bay views, back yard faces west spectacular sunsets over the water. Possible owner financing at 3-1/2%. Reduced to $189,900K. MLS# U7516944 DEEPSALTWATERLOT 198 Hibiscus Drive #521 3/2 with 2 car garage. 2nd Floor with private elevator.Over 2400 sq. ft. of A/C. Open Floor plan, soaring ceilings Affordable luxury. $274,750 Harry Rowe 941-457-0508www.PGILiving.com PGITARPON COVE Harbor Realty LARGE TOP FLOOR END UNIT, gated, very private, no condo neighbors visible, excellent private bay & sunset views, nearly new 3 BR/2 BA, plus den. Choicest 2-1/2 car garage parking (next to elevator) w/2 large storage lockers & mini space for golf cart, motorbike, etc. Loaded w/extras. Choice Placida area with new boat slip. NOW the only bay front penthouse with its own private boat dock right at your front door. Over $800K invested, REDUCED to $429K. Possible owner financing at 3-1/2%. MLS #U7516743 Call 941-769-1017. BAYFRONTPENTHOUSECONDO 2408 Starlite Lane, Port CharlotteT otally updated, Move in Ready, 3-bedroom, 2bath pool home on Lake Betty. NOT a Short Sale, just an unbeatable value! (MLS#C7025432). REDUCED: $69,900 P atty Gillespie Realtor,Bringing Buyers and Sellers Together 941-875-2755 MOVEINREADY REDUCED LOWEST PRICED direct bayfront of its kind on Floridas West Coast. Rare, extremely deep sailboat water (10+ ft) at your lot. Spectacular one-of-a-kind BIG 180-degree water views. Price JUST REDUCED to $429,900. Possible owner financing at 3-1/2%. MLS #U7516841 Call: 941-769-0200 DIRECT BAYFRONT PROPERTY Nearly 1 acre on Lemon Bay! Best direct bay front lot in Englewood zoned so it can be split into 2 single-family home sites. Includes brand new 90ft. boat dock. Possible owner financing at 3-1/2%. MLS# U7516833 NEARLY 1 ACREONLEMONBAY P P O O R R T T C C H H A A R R L L O O T T T T E E 2.5 acres, 4 miles on Kings Hwy.to Port Charlotte WalMart at I-75.Private, 3/2/CP, Fleetwood split plan, W/D, refrigerator, stove, dishwasher, 3 bay detached carport &storage building, well & septic, metal roof.$149,900For appointment please call 941-743-6601 COUNTRYLIVING ON ST.ANDREWS GOLF COURSE Why Wait? Immediate possession of custom b uilt home with spectacular view and privacy. Pristine condition inside and out,Great r oom,Heated pool Call for Private showing401-769-4073$289,000 PUNTA GORDA ISLES MAYLEASE-PURCHASE or owner finance this beautiful large, 3/2/2 Port Charlotte pool home on canal to Gulf. Completely furnished. $274,900. Agent Owned. MLS# C7012328 Call OnlyJudy Barkhurst, Sun Realty 941-286-3473www.bonitasprings-esteroflhomes.com WATERFRONTPOOLHOME IN 3 GOLF COURSE COMMUNITY AND ITS WATERFRONT, TOO! REDUCED TO ONLY $13,900. ZONED FOR 1 TO 5 UNITS. POSSIBLE OWNER FINANCING AT 3-1/2%941-769-1017. BEST LOT BUY MAYLEASE-PURCHASE or owner finance this beautiful large, 3/2/2 Port Charlotte pool home on canal to Gulf. Completely furnished. $274,900. Agent Owned. MLS# C7012328 Call OnlyJudy Barkhurst, Sun Realty 941-286-3473www.bonitasprings-esteroflhomes.com WATERFRONTPOOLHOME 1261 SF, 55+ Golf, pool, clubhouse2/2/CP. New floors & paint, immaculate! $59,900 941-637-7803 PUNTAGORDA BLUEHERONPINES North Port 3246 Mill Run Ct., TOTALLY UPDATED 3-bedroom, 2bath with 1-car garage and spacious FL room overlooking preserve area on cul de sac in Jockey Club $69,900 Patti Gillespie, RealtorBringing Buyers and Sellers Together941-875-2755 JOCKEYCLUB SHOWCASE OF FIND YOURHOM TODAY,0 )22(-V-I As www.welcome-home.comPAW-:4 'Ah.lt5ter`.?A oaf 1 )Tj0 0.502 0 rg1.807 0 Td()Tj/TT0 1 Tf-0.0293 Tc 16.1951 0 0 20 569.0634 714.8381 Tm[(44q WU41 _ _.Il i airltL%4j AN 47 ts--)Tj1 0.502 0 rg0.848 0 Td( 's'ue . t. i. ,,., ...rug T )57(' 9

PAGE 56

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 7 BEETLEBAILEYByMortWalker HIANDLOISByBrianandGregWalker HAGARTHEHORRIBLEByChrisBrowne THEWIZARDOFIDByBrantParkerandJohnnyHart B.C.ByMastroianni&Hart MOTHERGOOSEANDGRIMMByMikePeters PICKLESByBrianCrane MARMADUKEByBradAnderson Cryptoquip2011byKingFeaturesSyndicate Challenger Ye sterdays Challenger Answers WE NEED TO WHAT DO THIS LOOKS WATCHING7 START VISITING YOU THINK LIKE A COLLEGEDIRECTIONS: 0 ,W NICE CAMPUS. FOOTBALLFill each square with a number, one through nine. /flA)-148()155(rRSOME COLLEGES. WE'REHorizontal squares should add to totals on right. Z DOING? DOESN'T Vertical squares should add to totals on bottom. Diagonal squares through center should add to g COUNT.total in upper and lower right. 24 ll '_THERE MAY BE MORE v 5 cTHAN ONE SOLUTION. 6 18H-24Today's Challenge 5 22Time 9 Minutes37 Seconds 5 26Your Working e )17(wTime Minutes 8 30 eaow eSeconds 18 22 26 30 242011 by King Features Syndicate, Inc. World rights reserved. ON YOUR WAY TO WORK, YOU WORE IT HOMEiii1 DROP THIS OFF AT THE WHY? = AFTER HIS PARTY iK R3 2W 'tAT9-24 tilAOWTHBO FJO OGHVFOUiN lE WOR05 of )Tj-0.1602 Tc 17.2917 0 0 13 443 797.5119 Tm('NEVR A BoR2oanlE2 nX S P W T C S B P T X T WGOTFOU T )4 A Y n 6 R E A r v x w & A I O R 1f (ER"PN/LOaPHb4.rrUDBFDCWF POXOPB, D BHVVSBODF JTU AHGBF DCFS FDOGB.Yesterday's Cryptoquip: MUSICAL GROUPWHOSE MEMBERS ARE WILD ABOUT EATING APARTICULAR NUT: THE ALMOND BROTHERSBAND. Q,5Today's Cryptoquip Clue: F equals T 9 Z crNNcNEVER TRY $ErNl7 Y. )107('A COURT J5TEK71. IN A FOOD COURT li c,.;I r ( ,)-88(.1)]TJ-0.1316 Tc 8.7368 0 0 4 276.5 511.5206 Tm(( 1_ s1 byl TCdro'S SyT(1li a1V N"h1YfOlfIH3'CSt:Id105. CDfl '/ E7_.ATTI LA, HOW DOSOU KNOW CATS HAVENINE LlVE5 ?"His game is bigger than your game."FORMGIt LARGE,;, C )-5(` iii)Tj-0.1667 Tc 13.8333 0 0 10 544.5 349.5256 Tm(';,. .WORD c t DENOMINATION "' ` )Tj-0.1125 Tc 31.125 0 0 10 559.5 340.0259 Tm(''" ,)Tj0.0186 Tc 25.5169 0 0 20 24 326.0263 Tm(SLEUTH U.S. CURRENCYN B Y V T Q O N 1. 1 (i D Y R B 1' M BACK AMYTRING UMM,,,1 KIND OF Donl`T 071, AND I (NIt,KHAPPEt4 WHILE I STARTEV THE v NAT / f U r THE SMOKE ALARMY O CD 1 S C 0 N T I N U F, D 1, WAG CONE, EARL? MICROWAVE IT5ALL MAY NEEDAON FIRE, RIGHT, I NEW gATTERY)Tj-0.0123 Tc 9.2222 0 0 9 30 273.0279 Tm(W T S N O S L I W O R V L P L -'/ PUT 11 OUTS M K K 1 0 1 1, T F 0 D N I. ID F 1,B M Y D C W I I 1 R U S I 1 B Q O A N M A I I G B K B K I 0I M I D H M ,I B F D 0 B C B 0 -Z L E S A 11 C 0 X 0 W 0 M 0 0U S R H Q 0 N 0 0 L J H 0 0 0 THIS IS OUP NEW WHAT KIND 27 YARDSF A D C A Y W 5 V T S Q P 0 0 NYBF-.ID GAS MODEL, of MILEAGE DO P6iz I3U2leITo1J You GET ?M N L K 1 11 F E C B Z Y W I IFriday's unlisted clue: I IARVI-S"I'Lind the listed words n the diagram. They run in all directions IIC, V c okrrd, backward, up, doian and diagonally rr(( )Tj-0.017 Tc 0.9881 0 0 7 301 82.5337 Tm()Tj-0.085 Tc 4.9405 0 0 7 303 83.0337 Tm( fi` (-+t It 'i(J)]TJ0.0767 Tc 6.5743 0 0 6 36 80.5338 Tm[(waSaturday's unlisted clue hint: CLEVELAND$1,000 bill $5,000 bill Hamilton Marshall 1$10,000 bill Adams Jackson McKinley$100.000 bill Chase Lincoln Wilson s 1$500 bill Discontinued Madison ag .it {`1'4rvj Jf' '\J2011 Kin, Features, Inc. 9/24 02011 John L. Hart FLP9)85(z4

PAGE 57

The Sun Classified-Section BPage 8E/N/C/VSaturday, September 24, 2011 ZITSByJerryScott&JimBorgman GARFIELDByJimDavis FRESHLYSQUEEZEDByEdStein DILBERTByScottAdams REXM O R G ANByWoodyW i lsonand G rahamNolan MARYWORTHByKarenMoyandJoeGiellaS pecific training improves sport performanceDEAR DR. DONOHUE: Last school term, before summer vacation, I asked my coach what I could do to improve the distance I throw a football. I would be rst-string quarterback if I could throw farther. He told me to lift w eights during the summer. I did all summer long. I can throw a bit farther, but not enough to get me to the rst string. Why not? B.Z. ANSWER: It s a funny thing about weightlifting. It always is a stimulus for muscle growth and muscle strength. Its not always a benet to sport performance. The reason is that muscle training to improve a specic sport task requires the athlete to mimic the actual movements and sequence of muscle contraction that takes place when doing that task. In other words, to throw a football farther, you have to imitate the throwing motion with weights. Thats not always easy. S port-specic motions are complicated and quite hard to imitate with w eights. You can, however, approximate the motions by using light w eights held in one hand. Dont go overboard with this at the start. You can hurt muscles and joints that are not used to this kind of overloading. You not only have to imitate the motion, you have to duplicate the speed of the motion, too. S pecicity of training applies to all sports. It holds for swinging a bat, hitting a tennis ball, driving a golf ball, swimming and every sport endeavor. Overall strength training is a must. But so is sportspecic training if you want to improve a particular aspect of a sport. DEAR DR. DONOHUE: I am a 49-year-old female. I weigh 250 pounds and am 5 feet 3 inches tall. I work ve days a week in health care. My doctor tells me I have arthritis in my hips, knees, feet and back. I take Aleve. I walk two miles. It takes me an hour. By then, my joint pain is 10 on a scale of 1 to 10. I am considering having lap band surgery. If I do, do you think the w eight loss will help much with my joint pain? I cannot lose weight because of my joint pain. I have tried many ways to treat it. All I ever get is short-term results. Anon. ANSWER: I can almost guarantee you that your joint pain will greatly decrease if you lose weight Weight loss is one of the things every doctor advises osteoarthritic patients to do. Providing a guarantee in medicine is close to impossible. I did put an almost in front of my guarantee. Yo ur body mass index puts you in the category of dangerous obesity. Not only will you benet your joints, youll benet your heart and all body organs. If surgery is the only way that you can take off pounds, Id seriously consider having it done. DEAR DR. DONOHUE: I work in a cubicle with a guy who says he exercises at his desk. Hes quite muscular, so I believe him. Our desks are rmly attached to a cement oor. He exercises by trying to push his desk. He says it builds muscles even though the desk doesnt budge an inch. Is this possible? R.R. ANSWER: It is The exercise is isometrics. With isometrics, muscles dont shorten or lengthen as they do in standard exercise. If yo u perform a biceps curl, for example, you hold the barbell at waist level, bend your elbows and lift the bar to your shoulders. When at that position, your biceps bulge. Theyve contracted. When you lower it, the bulge goes. The muscle has lengthened. In isometrics, muscles dont move. A near-maximal strain against an immovable object strengthens muscles. You have to vary the position of your hands if you want to get symmetrical growth and improvement in muscles through isometrics. It works, but not as well as weightlifting works. Dr. Donohue regrets that he is unable to answer individual letters, but he will incorporate them in his column whenever possible. R eaders may write him or reques t an order form of available health newsletters at P.O. Box 536475, Or lando, FL 32853-6475. R eaders may also order health newsletters from www.rbmamall.com.Dr DonohueRe aders may write Dr. D onohue at P .O. Box 536475, Or lando, FL 32853-6475 2009 Pontiac G5 btnfrbnbrbbbn12,000 MILES!ONLY End of Summer Markdowns! MUST SEE!STK#239538 8529035 ffo T"-oilt. U11tillE F Fr: 4 3i mom mow, 0 AutoJk1.TOM Am M mwmmmw

PAGE 58

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 9 BORNLOSERByArtandChipSansom BLONDIEByDeanYoungandJohnMarshall BABYBLUESByRickKirkmanandJerryScott MUTTSByPatrickMcDonnell DOONSBURYByGarryTrudeau FORBETTERORFORWORSEByLynnJohnston Ideas worth more than a buckD ear Readers: Fifty y ears of Hints From H eloise in newspapers around the world! This w eek marks the anniversary of this columns very first week of newspaper syndication by King F eatures Syndicate. My mother, the original Heloise (1919-1977), started w r iting her column in H awaii when my father (and our family) was stationed there (19581962) with the Air Force. I thought it would be fun to revisit some hints printed in that first year to see how they hold up today. The following hint is one that I just love! K eep an eye out in the coming weeks for more! Heloise (the daughter, 2011)Tw o ideasD ear Heloise: One of my favorite ideas: If two people each had a dollar and exchanged them they would still have only a dollar each. On the other hand, if they exchanged ideas, they w ould have two ideas! Doris Bond (1961)Dry towelsD ear Heloise: I use a standing tree-style coat rack in my guest bathroom for overnight guests and their towels. Long ago, I sewed loops on my towels at the middle, along their lengths, for when I use them at the gym. These loops will ensure that the towels dont hit the floor, and they will air out more quickly. Laura G., Springfield, Mo.Help!D ear Heloise: Almost all men think your column is only for women. Wake up, guys! Ive been reading the paper for many years. I am 57 years old and married. I do the shopping, cleaning, cooking, etc. Ive learned so much from your columns! Just a sample: Years ago, I had trouble opening the plastic bags in the produce section. Your column said, Lick yo ur ngers. Same can be done with trash bags. Start re ading the column, guys. You know, if you help your wives in the house, then Heloise Hints will make it a lot easier on you. Yo ur wife will be surprised at your knowledge! John S. from Florida Thanks for the endorsement, John. However, a lot of my readers are male! Lifestyle helpful hints are genderless. Heloise Hints from Heloise FINANCING AV AILABLEbtnffrfftrtffrfft rtrtttrtt ft!rbrbt!rbt "t#rt$t(941) 629-1888 We treat you like family, like it or not! btnnfrbbn2008 Dodge Ram 150042,000 MILES!Low, LowSTK#617763 Te st Drive Today! 8529036 iii MENSGIs looms,I)Tj-0.0739 Tc 14.9975 0 0 12 149.0634 1031.2195 Tm[(YQTQu1)]TJ-0.0355 Tc 9.645 0 0 12 217.5634 1031.2195 Tm[(ITfTTTR)]TJ-0.0842 Tc 19.8278 0 0 14 274.5634 1030.7195 Tm(II a 'Ive lLll t you psi f yq m) At of IDla loo

PAGE 59

The Sun Classified-Section BPage 10E/N/C/VSaturday, September 24, 2011 MALLARDFILLMOREByBruceTinsley PEANUTSByCharlesSchulz CRANKSHAFTByTomBatiuk&ChuckAyers SHOEByMacNellyProductions ARIES (March21-April19).Youwillfeelempoweredtoexperiment.Youlleatdierentfood,talk to newpeopleandreadaboutsubjectsyounever c onsideredbefore.Youlllikehowthisdevelopsyou. TA URUS (A pril20-May20).Peoplelikewhatthey canbeinvolvedin.Youmaystartoutalone,but dontnishallbyyourself,too,oryoullbesetting y ourselfupforjudgmentandpossiblyrejection. GEMINI (May21-June21).Youaredeeplyaverseto inconveniencin g others.What y oufailtounderstand isthatbeinginconveniencedcanbethemost interestingpartofapersonsday. C ANCER (J une22-July22).Yourcommitmentsare sonumerousthatifyoudontwritethemdown orputthemintoagoodsystem,youlllikelylose yourway. LEO (J uly23-Aug.22).Itishardtobeniceto someonewhenyouthinkthatpersonisbehaving likeanidiot.Buttry.Detach,stepback,andseethe dynamicfromahigherplace. VIRGO (A ug.23-Sept.22).Theworldisputobyillmannered p ushiness.Needin g r esultstocomefaster thantheyseemtowanttocomecreatesstruggle andnegativity.Gotheotherway. LIBRA (Sept.23-Oct.23).Afriendlyinvitation c omesyourway,andyouwouldbewisetoaccept it,mostlybecauseyoullhaveagoodtime.Social anticswillbeanadventure. SCORPIO (O ct .2 4-Nov.21).Everythinghappensin itsowntime.Rushingmakesitharderforyou.Dont letstressandstraincreepin.Rememberwhatyou learnedfromthefrustrationsofyourparents. SAGITTARIUS (Nov.22-Dec.21).Sitaroundatable withfriends c ollea g uesorlovedones.Relaxand unwindtogether.Talkaboutyourday.Youwill discoversomethingyoudidntknowbefore. CA PRICORN (Dec.22-Jan.19).Yourprioritieswill shiftagain,andastheydo,youllthinkabouthow we llyourcurrentlifestylereallysuitsyou.Youdont havetogureitoutinoneday.Thisprocessof evaluationwillgoonforweekstocome. AQUARIUS (J an.20-Feb.18).Friendsmaydisappointyou,soyoullhavetocutthemsomeslack. You llultimatelybebetterolettingthembe themselvesinsteadofmakingthemfeeltheyhave to p erformorwalkone gg shellsaround y ou. PISCES (Feb.19-March20).Youfeelrelaxed,and yo uc re at ear elaxedenvironmentaroundyou.You feelyoucansharehonestlywithyourlovedones withoutbeingattacked. TODAYSB IRTHDAY (Sept.24).Youllmakeyourself useful.Thishabitwillkeepyouatthecenterofthe socialswirlandinaprimeprofessionalposition. Refusingtotakethingspersonally,youllsailpast nancialandpoliticalobstacles.Decemberfeatures travelandstellarentertainment.GeminiandAries peopleadoreyou.Yourluckynumbersare:4,14, 39,11and29. HOROSCOPE BIBLE He that by usury and unjust gain increaseth his substance, he shall gather it for him that will pity the poor. Proverbs 28:8. No matter how it looks from the top, God has the nal say over the bottom line. Venice Gondolie r Sun r eaders: Look for the puzzle solution in the Our Town section. D aughters third pregnancy crosses the line for parentsDEAR ABBY: Our daughter Bree has just announced that shes pregnant with her third child. H er other children are 1 and 2. My wife and I are in our 60s and provide chi1d care three days a week, while the other grandma baby-sits for two days. We also pay for preschool and swimming lessons, as well as cook dinner for them on the days when we baby-sit. Br ee and her husband do not earn enough money to support even one child. W e know well be expected to nance college for the children. When we agreed to help out, we asked them to promise they would not have more than two kids. This third one will cause us to use up our savings, increase our child care r esponsibilities and take us into our 80s to continue helping. Is it wrong to feel used? I am very depressed ov er this. OVERW HELMED IN SAN DIEGO DEAR OVERW HELMED: Y our depression is understandable. If you dont draw the line now by telling your daughter you cant handle baby-sitting three small children and this wasnt part of the bargain, she may hand you a fourth or fth to take care of. Y ou should not sacrice y our retirement savings in order to nance your grandchildrens education. There are other options than your paying for it. The r esponsibilities you have assumed were not yours in the rst place. If you dont insist your daughter and son-in-law stand on their o wn two feet, you will wind up old, broke, and living on S ocial Security with nothing to supplement it because y our savings will be gone. DEAR ABBY: My a nce, J ohnny, and I have been together for four years and engaged for 16 months. O ur wedding is in a few months. Until recently, J ohnny didnt have access to a car. That means for the past four years I have done all the driving, including visiting him at school two hours from my home every three to four weeks. It didnt bother me because it was out of Johnnys control; his money went to pay for his education. Howe ve r, because he has a car now, I feel its reasonable to ask that he do most though not all of the driving. We live in the same town now and our homes are a mile apart. Jo hnny seems to take offense at the suggestion and acts as if I am punishing him. Im not, but Im tired of driving all the time and would like a break now that he can give me one. What do you think? AT THE WHEEL AGAINST MY WILL DEAR AT THE WHEEL: Jo hnny has grown accustomed to, and spoiled by, the chauffeur service you have provided. That he should assume responsibility for his share of the driving now that he has a car of his own is not an onerous request. Although you have been together four years, the two of you need to have a talk and work this out. And because you have been apart for the years he has been in school, I also recommend that you schedule premarital counseling before the w edding in case there are any other differences of opinion that need to be worked out. Dear Ab by is wr itten by Abig ail Van Buren, also known as Jeanne Phillips, and was founded by her mother, Pauline Phillips. Writ e Dear Abby at www. DearAb by .com or P.O. Box 69440, Los Angeles, CA 90069. For ev erything you need to know about wedding planning, order How to Have a Lovely Wedding. Send a business-sized, selfaddressed envelope, plus check or money order for $6 (U.S. funds only) to: Dear Abby We dding Booklet, P. O. Bo x 447, Mount Morris, IL 610540447. (Postage is included in the price.) Dear Abby wt CNly-A y W 'Ckt 4 KstGNER a '''5tGt1)115(R )Tj0 0.502 0 rg0.554 0 Td(,,CARICAKEOKAY, u,IHATs HE GOING TO TRY? I TOLD HIM THAT WHEN THE PACE HE 5 THE k;ND (OHO WILLWriYDoNTw 1 AJIL 0 = LIFE6ET5TOBET00,41Ua1HE REALL.'' HEAR IT!TR 1 j T ? SHOULD R XT AND JUST LIE ANDUSTE N TO T)58(kE ERASS 6R0O...1 yC21ISLILLIAN z.1 WAh1TQ00 TD co -FA LKIN670 TAL-KNGTOA SPECIAL FAVO(L 0eP'-%LF NOT HERSELF GYDULDFOR mE, LIL, XRCTL)76(,., 1 BETTER.cl niC.r r.jl A1 -tSKYLER, I ASKED YOU TO GET AND YOU ONLY GAVE ME YOU NEVER SAID HOW MUCHME GNANGE FOR A TWENTY... 6ACK SEVEN DOLLARS i GHANGE YOU WANTED.IN QUARTERS! oJANRIC CLASSIC SUDOKUFill in the blank cells using numbers 1 to 9. Each number can appear only once in each row,column and 3x3 block. Use logic and process of elimination to solve the puzzle. The difficultylevel ranges from Bronze (easiest) to Silver to Gold (hardest).2 6 5 Rating: GOLD5 7 3 Solution to 9/23/116 3 4 E 5 7 8 4 913 1 2 63 6 2 8 711 4 9 52 5 11 9 4 6 2 5 8 7 31 4 2 8 2 9 7 514 3 6 18 5 4 4 5 1 9 3 6 2 8 77 3 6 2 118 9 5 4a9 4 3 w 6 8 7 3 412 5 1 94 5 7 2 1 3 5 6 9 7 4 89 4 511 817 6 3 L 2JN2 8 6-4141 1

PAGE 60

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 11 S aturday TelevisionVEN-VENICE E-N-ENGLEWOOD SAR-SARASOTA PC-PORT CHARLOTTE ARC-ARCADIA SPG-SOUTH PUNTA GORDASEP. 24PRIME TIME VEN E-N SAR PC ARC SPG FIOS 6 PM6:307 PM7:308 PM8:309 PM9:3010 PM10:3011 PM11:30 BROADCASTABC 7771077College Football(Live) (HD)FootballPost Game(HD)ABC7 Weekend Edition(N)Jeopardy!(R) (HD)(:06)CollegeFootball: LouisianaStateTigersatWestVirginiaMountaineersfromMountaineer Field(Live) (HD)ABC7News at11(N) ABC 7117College Football(Live) (HD)FootballPost Game(HD)TheInsider(HD)ABC7News @7 :30pm(N)(:06)CollegeFootball: LouisianaStateTigersatWestVirginiaMountaineersfromMountaineer Field(Live) (HD)ABC7News @11: 00pm(N) CBS 213213555(3:30)College Football: Arkansasvs Alabama(Live) (HD)WINKNews at7(N)InsideEdition Alternative news. PersonofInterest: PilotYoung prosecutorinmidstofacrime.(R) (HD)Unforgettable: PilotWoman solvesmurderswithmemory.(R) (HD)48HoursMystery: Arturo GattisLastFightMysterious death.(N)Newsat 11pm(N)(HD) (:35)Criminal Minds: Paradise CBS 10101010(3:30)College Football: Arkansasvs Alabama(Live) (HD)10News The latestnews.(N)TheYoung Icons PersonofInterest: PilotYoung prosecutorinmidstofacrime.(R) (HD)Unforgettable: PilotWoman solvesmurderswithmemory.(R) (HD)48HoursMystery: Arturo GattisLastFightMysterious death.(N)10News, 11pm(N) (:35)Paid Program Sponsored. NBC 232232222NBC2News @ 6pm(N)(HD)NBCNightly News Weekend Wheel: Give MeaBreak!(R)Jeopardy!(R) (HD)HarrysLaw: Hosanna RoseannaDARoseanna Remmick.(R) (HD)PrimeSuspect: Episode1 Janefindsauniqueangleona case.(R)Law&Order:SpecialVictims Unit: ScorchedEarthHotel maid.(R)NBC2News @11pm(N) (HD) (:29)Saturday NightLive(N) NBC 888888NewsChannel 8at6:00(N)NBCNightly News Weekend EntertainmentTonight Celebritygossipandshow business. HarrysLaw: Hosanna RoseannaDARoseanna Remmick.(R) (HD)PrimeSuspect: Episode1 Janefindsauniqueangleona case.(R)Law&Order:SpecialVictims Unit: ScorchedEarthHotel maid.(R)NewsChannel 8at11:00(N) (:29)Saturday NightLive(N) FOX 222222444MLBBaseball: BostonRed SoxatNewYorkYankees(Live) (HD)TheCloser: InCustodyPopes chancetobecome commissioner.(HD)Cops Hitman case.(N)(HD)Cops Inhouse withgun.(R)American Dad! Redecorating. Cleveland Show: Beer Walk! FOX4NewsatTen Local newsreportandweather update.(N)HellsKitchen: 18Chefs CompeteSignaturedishes.(R) (HD) FOX 131313131313MLBBaseball: BostonRed SoxatNewYorkYankees(Live) (HD)FOX13NewsSaturday News eventsofthedayarereported(N)(HD)Cops Hitman case.(N)(HD)Cops Inhouse withgun.(R)American Dad! Redecorating. Cleveland Show: Beer Walk! FOX1310:00News The topnewsstoriesare updated.(N)(HD)HellsKitchen: 18Chefs CompeteSignaturedishes.(R) (HD) PBS 333(5:30)Mexico: TheRoyal Tour StoriesTheLawrenceWelkShow Musicofbigbands. AntiquesRoadshow: Jackpot! Astonishingdealsandvaluable finds. AsTimeGoes By: TheAffair Appearances Indoor barbecue. TheOldGuys Triviacontest. AreYou Being Served? GlobeTrekker: DeepSouth U.S.AFreedomWalk;Elvis. WEDU 3333MyMusic: MagicMoments: TheBestofsPops musicreunion. TheLawrenceWelkShow Musicofbigbands. AreYou Being Served? Appearances The christening. AsTime Lionel plansatrip. AsTimeGoes By: Pardon? OldGuys Former boyfriend. WorstWeek: Monday GlobeTrekker: Peruand AmazonFestival;monkey.(N) CW 11216Thats Show Blonde Donna. Thats Show Hydes father. Two1/2 Late fathersplea.(HD)Two1/2 Custodyofdog.(HD)BrothersandSisters: Bad NewsSarahstruggleswith Joesinfidelity. TheBigBang Theory(HD)TheBigBang Theory(HD)WINKNews@10pm(N)(HD)HowIMet Barneysnude.(HD)New Adventures Christine(HD) CW 9994Kingof Queens: DougieNights TilDeath: Dream Getaway Two1/2 Late fathersplea.(HD)Two1/2 Custodyofdog.(HD)CriminalMinds: ExitWounds GarciahelpsincaseofAlaska murders. ColdCase: FactoryGirlsThe 1946deathofafactoryworker.(HD)Numb3rs: BrutusArevenge plotdiscoveredagainstgovt.(HD)TheUnit: InquisitionA terroristexposeshis accomplices.(HD) MYN 11111114Hollyscoop Hollywood gossip. PaidProgram Sponsored. RingofHonorWrestling(N) (HD)Thats Show Blonde Donna. Thats Show Hydes father. Futurama Cryogenic sleep. Futurama First spacetrip. RingofHonorWrestling(R) (HD)Bones: ThePerfectPiecesin thePurplePondHeadless writer.(TVPG) MYN 898AccessHollywood(N)(HD)Seinfeld Apartment robbed. Seinfeld Insidestock tip. WelcometoMooseport (,Comedy) Ray Romano.HeatedmayoralraceensuesbetweenformerUS presidentandstoreowner.(PG-13)FamilyGuy Brianthecop. ItsAlways Sunny Four friends. Futurama Futurehijinx. Futurama Futurehijinx. IND 12124123812FamilyGuy Brianthecop. FamilyGuy Braintriesto act. TheBigBang Theory(HD)TheBigBang Theory(HD)House: FoolsforLoveHusband andwifesharesymptoms.(HD)House: QueSeraSeraTeam treatsseverelyobeseman.(HD)RushHour2 (,Action) JackieChan,Chris Tucker.DetectivesLeeandCarterinvestigateaconspiracy involvingaChinesekingpin.(PG-13) ION 22226 1817Monk: Mr.MonkMakesa FriendShadyfriend. Monk: Mr.MonkIsatYour ServiceMonktheButler. Monk: Mr.MonkIsontheAir MonkconvincedDJmurdered wife. Monk: Mr.MonkVisitsaFarm Dishermovestofarmafter uncledies. psych: ShawnTakesaShot intheDarkPlansgoawry. psych: YouCantHandle ThisEpisodePrivates suicide. CABLEA&E262626263950181StorageStorageStorageStorageStorageStorageStorageStorageStorageStorageStorageStorage AMC565656563053231(5:30)TheExorcismofEmilyRose (,Horror) A priesttriestoaidayoungwoman.(PG-13)TheOthers (,Drama) NicoleKidman.Awomanandhertwo photosensitivechildrenbelievetheirhomeishaunted. TheOthers (,Drama) Af amily fearstheirhouseishaunted.(HD) APL444444443668130BadDog! Deliverydog. BadDog!: Houdinis(R)TooCute!Puppies(R)BadDog Crooningdog. BadDog! Fastturtle. BadDog Crooningdog. BET353535354022270ParkersParkersParkersB.A.P.S. ()Awomanposesasrichmansheir. HarlemNights ()Harlemclubownersoutfoxagangster.(R) BRAVO6868686851185Housewives(R)Housewives(R)Housewives(R)TheBourneSupremacy ()Bourneisframedformurder. BourneS. COM666666661527190(5:30)BlueCollarComedyTour:OnefortheRoad (, Comedy)ABlueCollarcomedyconcert. JeffDunhamsChristmas Ventriloquist.(R)JeffDunham:Arguingwith Myself(TV14)(R)TheComedyCentralRoastofCharlie Sheen JokesaboutSheen.(R) (:37)Workaholic(R) DISC404040402543120Chopper Contestends. Chopper(R) (HD)Chopper(R) (HD)Chopper: Downsizing Chopper(R) (HD)Chopper: Downsizing E!464646462726196(4:00)Titanic () Loveanddisaster.(PG-13)MeanGirls2 Teenstakeonsocialhierarchy. E!Story(R)Soup(R)C.Lately FAM555555551046199Bolt ()Adogundertakesahazardousjourney. FindingNemo ()Afishsearchestheoceanforhisson.(G)HomeAlone2:LostinNewYork FOOD37373737-76164Challenge(R)Chopped(R)Chopped: MyWay(R)Chopped(R)Chopped(R)IronChef(R) FX51515151584953(5:00)TheIncredibleHulk (,Thriller)EdwardNorton,Liv Tyler.TheHulkbattlesanewmonster.College Football: Missouri Tigers at Oklahoma Sooners from Gaylord Family-Oklahoma Memorial Stadium(Live)League(R) (HD) GSN17917917917934179184NoDealLingo(R)Lingo(R)Chain Fam.FeudFam.FeudFam.FeudFam.FeudMil.P asswordHighStakesPoker(R) HALL5551773 240GoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirl HGTV414141415342165GreatRoom HuntersOurMagazine(N)HGTVdHighLowSecretsNovogratzDinas(N)Donna(N)OurMagazine(R) HIST818181813365128DeadlyRoad: ThinAir DeadlyRoad: CutOff! DeadlyRoad(R) (HD)DeadlyRoad(R) (HD)DeadlyRoad(R) (HD)IceRoad(TV14)(R) LIFE363636365241140TheNannyDiaries () Mom,DadandHer ()Teen&stepmom.(NR)AW alktoRemember () Disdaintolove. TheNannyDiaries () NICK252525252444252iCarly(R)iCarly(R)iCarly(R)PlayDayiCarly(N)BigTimeSupah(N)iCarly(R)FriendsFriendsFriendsFriends OWN5858585847103161Half-TonTeen(HD)Half-TonMom(R) (HD)Dr.Phil(HD)Dr.Phil(HD)Confronting...(N)(HD)Dr.Phil(HD) QVCJoanRiversClassicsAnIntimateAffairB.MakowskyClarksFootwearSpanxSlimmingB.Makowsky SPIKE57575757296354UFC135 UFCUnleashed(R)UFC135Prelims(Live)CrocodileDundee AnAustralianbushtrackerinNewYork. DundeeII SYFY6767676764180(5:00)Roadkill () JeepersCreepersII () Feedingtimeagain. Morlocks Futuristichumanoidswreakhavoc. TheLostTribe ()(R) TBS59595959326252BigBangBigBangBigBangBigBangObserveandReport (,Drama) ObserveandReport (,Drama) HaroldandKumar () TCM65656565169230(5:30)TheSpiritofSt.Louis ()JamesStewart,Patricia Smith.AviatortriestocrosstheAtlantic. LoveMeTonight ()AFrenchtailortriestocollectthe moneythatawealthyclientoweshim. Hallelujah,ImaBum (,Musical) Vagrantfallsformayorsgirlfriend. Hollywood Party TLC45454545577213948Hrs. Webofvices. 48Hrs.(HD)20/20TLC(N)(HD)20/20TLC(N)(HD)Prison Romanticrival. 20/20TLC(R) (HD) TNT61616161285551TheFastandtheFurious:TokyoDrift (,Action) Youngmaninvolvedindangerousracing. TheFastandtheFurious (,Thriller) Paul Walker,VinDiesel.Streetgangsracefastcars. 2F ast2Furious ()Anundercovercopandanex-con takeonamoneylaunderingoperation. TOON124801241244620257AdventureAdventureSpyKids3-D:GameOver ()Gametrapsgirl. OblongsKingKingFamilyBoondcksBoondcks TRAV6969696966170FoodParad(R)FoodParad(R)Ghost(R)Ghost Formerhotel.(R)Ghost HospitalinL.A. Ghost(R) TRUTV636363635030183MostShock(R)Top20(R)Top20(R)Dumbest(R)Dumbest(R)ForensicForensic TVL626262623154244(:19)S anford SanfordAllFam.AllFam.AllFam.RaymondRaymondRaymondRaymondRaymondRaymond USA34343434225250SVU Murderedteens. SVU Illkidnapvictim. SVU Repeatrapist. SVU Terrorthreat.(HD)SVU Blackmail.(TV14)SVU AIDSpatients. WE117117117117117149GhostWhisperer(HD)GhostWhisperer(HD)GhostWhisperer(HD)Whisperer: DeadAir GhostWhisperer(HD)GhostWhisperer(HD) WGN1616161641119Order:CI: TruLove Bones Wiccaremains. HomeVideos(TVPG)HomeVideos(TVPG)WGNNewsatNine(N)30RockScrubs NEWSCNBC3939383837102PaidProg.PaidProg. Money(R)Greed(R)DebtSuzeOrman(N)Princess: Julie(N)Greed(R) CNN323232321838100SituationRoom(N)CNNNewsroom(N)Restoringthe(R)PiersTonight(R) (HD)CNNNewsroom(N)Restoringthe(R) CSPAN181818183712109PresidentCommuni.America&theCourtsAmericanPerspectives Politicalandculturalissuesdiscussed.(N)AmericanPerspectives FNC646464644871118AmericasHQ(N)FOXReportSaturdayHuckabee(N)Justice(N)GeraldoatLarge(N)FoxNewsReport(N) MSNBC8383838340103Lockup(R) (HD)Lockup Inmatesspeak. Lockup(R) (HD)Lockup Ac ouplesplits. Lockup Revengeinjail. Lockup(R) (HD) SPORTSCSS282828284970(4:30)CollegeFootball(Live)CollegeFootball: GeorgiaStatePanthersatHoustonCougars(Live)WrapUp ESPN29292929125870Coll.FtblScoreboardCollegeFootball: FloridaGatorsatKentuckyWildcats(Live) (HD)CollegeFootball: USCvsArizonaState(Live) ESPN23030303065974Coll.FtblScoreboardCollegeFootball: VanderbiltvsSouthCarolina(Live) (HD)CollegeFootball: OregonvsArizona(Live) (HD) FSN727272725677CollegeFootball(Live)MLBBaseball: FloridaMarlinsatMilwaukeeBrewers(Live) (HD)MarlinsMarlinsWrldPoker(Replay) GOLF494949495560304GolfCentral(HD)LPGATournament: SolheimCup:DayTwo(Replay)PGATournament(Replay) (HD) SPEED48484848426983(5:30)BarrettJacksonAuction: LasVegas(N)SPEEDNASCAR SUN3838401401455776CollegeFootball(Live)CollegeFootball: FloridaAtlanticOwlsatAuburnTigers(Live)FootballSaturdaysFightSports VS71717171546190CollegeFootball: TeamsTBA(Live)CollegeFootball: NebraskaCornhuskersatWyomingCowboys(Live)NFLTurningPoint PREMIUMDISN1361361361369945250SoRandom!(R)ShakeItUp! Fearoffiring.(R)GoodLuck Termite costume. Wizards Asteroid mission.(R)WaverlyPlace Beingawizard. A.N.T.Farm Webathon money. PrankStars Pirate restaurant. GoodLuck Charlie: Ditch Day A.N.T.Farm: BadRomANTs SoRandom!(R)GoodLuck Termite costume. Wizards Asteroid mission.(R) ENC150150150150150350Tightrope (,Drama) ClintEastwood,Genevive Bujold.Acopseessimilaritiesbetweenhimselfandthe murdererheisstalking.(R)HeartbreakRidge (,Drama) ClintEastwood, MarshaMason.AhardboiledMarinesergeantpreparesa platoonofgreenrecruitsforcombat.(:15)AbsolutePower (,Thriller) ClintEastwood, GeneHackman.Athiefbecomesentangledinpoliticalintrigue afterwitnessingamurder. HBO30230230230217302400(:15)LotteryTicket (,Comedy)BowWow,BrandonT. Jackson.Ayoungmanfromtheprojectswins$370million dollarsinthenationallottery. LittleFockers (,Comedy)Aman focusesonbeingagoodfatherwhiletrying toimpresshisfather-in-law.(:45)WorldChampionshipBoxing: MayweathervsOrtiz(Taped) (HD)LittleFockers (,Comedy) Mantriestoimpresshis father-in-law. HBO2303303303303303402(5:30)Conviction (,Drama) A brothersfalse conviction.(R) (HD) (:15)Unstoppable (,Action) DenzelWashington, ChrisPine.Anexpertengineerandanoviceconductorraceto stoparunawaytoxictrain. Hung Mike accusesRay.(HD)Hung Ray mightquit.(HD)BoardwalkEmpire: A Return toNormalcyThe1920 elections.(HD)Treme: EverythingIDoGonh BeFunkyTonitakesacase.(HD) HBO3304304304304304404Devil () Trapped strangers. PublicEnemies () In1930sChicago,aspecialagentis commissionedbythedirectoroftheFBItoapprehendtheelusiveand notoriousbankrobberJohnDillingerandhisgang. OurFamilyWedding () Aw edding threatenstobesabotagedbyafeud betweenthecouplesfathers. Boardwalk Fashion; costumes. SomethingsGottaGive () Bachelorfondof girlfriendsmother. MAX32032032032063320420(4:30)Inception (,Drama) Enteringdreams andstealingideas. Terminator3:RiseoftheMachines (,Science Fiction) Ac yborgfromthefutureissenttobackto savethehumanrace.(R) (HD)StrikeBack Lookingfor Clare;huntedbyJanjaweed.(R) (HD)HatchetII (,Horror) A woman returnswithanarmytokillthemurderer whonearlyendedherlife.(R)StrikeBack Lookingfor Clare. MAX2321321321321321422(5:00)IndecentProposal (, Drama)Acouplefacesa difficultchoice. ScottPilgrimvs.TheWorld (,Comedy) MichaelCera.InToronto,anerdybassguitaristisforcedto battleagirlssevenevilexes.(PG-13)MySoultoTake (,Horror) Murderervowstokillkidsbornonnighthe died,&terrorstrikesyearslater.(:50)DueDate (,Comedy) An expectantfatherandanaspiringactorembark uponaroadtrip.(R) (HD) SHO34034034034019340365(5:40)TheHurtLocker (,War) JeremyRenner, AnthonyMackie.AnArmybombsquadinIraqtriestosurvive ar ecklessnewteamleader. Push (,Thriller) ChrisEvans,DjimonHounsou. Peoplewithspecialpowersteamuptodefeatasecret governmentorganization.(PG-13)NextDayAir (,Comedy)Acourier mistakenlydeliversaboxcontaining cocainetotheincorrecthouse.(R)PattonOswalt FinestHour(R) TMC35035035035020350385(:15)InglouriousBasterds (,War) BradPitt,MlanieLaurent.InWWII,aspecial unitcomposedofJewish-AmericansoldiersviolentlyattacksandkillsmembersoftheThird Reichtoinstillfearintheirregime.(R)Altitude (,Horror) A small twin-engineplanecarryingfiveteensbegins toclimbuncontrollably.(R) (HD) (:35)BuriedAlive (,Horror)Aranchs caretakerliberatestheangryspiritofawitch whowasburiedalive. 6 PM6:307 PM7:308 PM8:309 PM9:3010 PM10:3011 PM11:30 KIDS NEWS SPORTS SPECIALS MOVIES7:30 a.m. ESPN2 English Premier League Soccer Everton at Manchester City. (L) 10 a.m. SPEED Formula One Qualifying Singapore Grand Prix from Streets of Singapore. (L) 11:30 a.m. SPEED NASCAR Sprint Cup Practice Sylvania 300 Final from New Hampshire Motor Speedway. (L) 12 p.m. ABC College Football Notre Dame Fighting Irish at Pittsburgh Panthers. (L) ESPN College Football North Carolina Tar Heels at Georgia Tech Yellow Jackets. (L) ESPN2 College Football Eastern Michigan Eagles at Penn State Nittany Lions. (L) FSN College Football Southern Methodist Mustangs at Memphis Tigers. (L) MYN College Football Georgia Bulldogs at Mississippi Rebels. (L) 12:30 p.m. CW College Football (L) 1 p.m. CSS College Football Presbyterian Blue Hose at Furman Paladins. (L) GOLF PGA Tournament The TOUR Championship: Third Round from East Lake Golf Club in Atlanta. (L) SPEED NASCAR Whelen Modied Series New Hampshire 100 from New Hampshire International Speedway. (T) WGN MLB Baseball Chicago Cubs at St. Louis Cardinals. (L) 2 p.m. GOLF European Golf Tour Austrian GolfOpen: Third Round from Diamond Country Club in Atzenbrugg, Austria. (T) NBC PGA Tournament The TOUR Championship: Third Round from East Lake Golf Club in Atlanta. (L) 3 p.m. SPEED NASCAR Camping World Truck Series F.W. Webb 175 from New Hampshire Motor Speedway. (L) 3:30 p.m. ABC College Football Oklahoma State Cowboys at Texas A&M Aggies. (L) CBS College Football Arkansas Razorbacks at Alabama Crimson Tide. (L) ESPN College Football Florida State at Clemson. (L) ESPN2 College Football Regional Coverage. (L) FSN College Football California Golden Bears at Washington Huskies. (L) SUN College Football Southern Mississippi at Virginia. (L) 4 p.m. FOX MLB Baseball Boston Red Sox at New York Yankees. (L) 4:30 p.m. CSS College Football Middle Tennessee State Blue Raiders at Troy Trojans. (L) 7 p.m. ESPN College Football Florida at Kentucky. (L) ESPN2 College Football Vanderbilt at South Carolina. (L) FSN MLB Baseball Florida Marlins at Milwaukee Brewers. (L) GOLF LPGA Tournament Solheim Cup: Day Two from Killeen Castle in Co. Meath, Ireland. (R) SUN College Football Florida Atlantic at Auburn. (L) 8 p.m. CSS College Football Georgia State at Houston. (L) SPIKE UFC 135 Prelims (L) 8:06 p.m. ABC College Football Louisiana State Tigers at West Vir ginia Mountaineers. (L) 9:45 p.m. HBO World Championship Boxing Mayweather vs Ortiz. (T) 10:15 p.m. ESPN College Football USC at Arizona State. (L) ESPN2 College Football Oregon at Arizona. (L) 5 a.m. GOLF LPGA Tournament Solheim Cup: Final Day from Killeen Castle in Co. Todays Live Sports Convenient Complete SatelliteONLINE TV Listingswww.sun-herald.com/tv CIE9EcluL6]

PAGE 61

The Sun Classified-Section BPage 12E/N/C/VSaturday, September 24, 2011 V enice Gondolier Sun re aders: Look for the puzzle solution in the Our Town section. Regal Town Center 16941 1441 Tamiami TrailAbduction (PG-13, 106 min.) 12:25 pm, 1:00 pm, 3:30 pm, 4:30 pm, 7:05 pm, 7:35 pm, 9:40 pm, 10:15 pm Colombiana (PG-13, 107 min.) 4:00 pm, 9:30 pm Contagion (PG-13, 105 min.) 1:25 pm, 4:40 pm, 7:15 pm, 9:50 pm The Debt (R, 113 min.) 1:20 pm, 6:50 pm Dolphin Tale (PG, 112 min.) 12:40 pm, 3:25 pm, 7:20 pm Dolphin Tale 3D (PG, 112 min.) 1:10 pm, 3:55 pm, 7:50 pm, 10:30 pm Drive (R, 100 min.) 1:05 pm, 4:15 pm, 7:25 pm, 9:45 pm The Help (PG-13, 137 min.) 12:15 pm, 3:35 pm, 6:45 pm, 10:20 pm I Dont Know How She Does It (PG-13, 95 min.) 12:35 pm, 2:50 pm, 5:05 pm, 8:00 pm, 10:15 pm Killer Elite (R, 100 min.) 12:45 pm, 1:15 pm, 4:05 pm, 4:35 pm, 7:10 pm, 7:40 pm, 9:55 pm, 10:25 pm TheLionKing 3D (G, 89 min.) 12:30 pm, 2:55 pm, 5:10 pm, 7:45 pm, 10:10 pm Moneyball (PG-13, 126 min.) 12:20 pm, 12:50 pm, 3:50 pm, 4:20 pm, 7:00 pm, 7:30 pm, 10:05 pm, 10:35 pm Shark Night 3D (PG-13, 95 min.) 9:35 pm The Smurfs (PG, 102 min.) 12:55 pm, 3:45 pm, 6:55 pm Straw Dogs (R, 105 min.) 1:30 pm, 4:50 pm, 7:55 pm, 10:30 pm Wa rrior (PG-13, 139 min.) 10:00 pmFrank Theatres Galleria Stadium 12941 2111 Tamiami TrailAbduction (PG-13, 106 min.) 1:10 pm, 4:30 pm, 7:10 pm, 9:30 pm Contagion (PG-13, 105 min.) 1:25 pm, 4:40 pm, 7:25 pm, 9:40 pm Dolphin Tale (PG, 112 min.) 4:35 pm, 10:15 pm Dolphin Tale 3D (PG, 112 min.) 1:35 pm, 7:35 pm Drive (R, 100 min.) 1:50 pm, 4:50 pm, 7:50 pm, 10:10 pm The Help (PG-13, 137 min.) 1:05 pm, 4:05 pm, 7:05 pm, 10:05 pm I Dont Know How She Does It (PG-13, 95 min.) 1:20 pm, 4:45 pm, 7:20 pm, 9:45 pm Killer Elite (R, 100 min.) 1:30 pm, 4:00 pm, 7:30 pm, 10:00 pm The Lion King 3D (G, 89 min.) 1:00 pm, 4:20 pm, 7:00 pm, 9:20 pm Moneyball (PG-13, 126 min.) 1:15 pm, 4:15 pm, 7:15 pm, 10:15 pm Shark Night 3D (PG-13, 95 min.) 9:35 pm Straw Dogs (R, 105 min.) 1:05 pm, 7:05 pm Wa rrior (PG-13, 139 min.) 4:05 pmAMC Merchants Crossing 16888AMCFUN US 41 and Pine Island Rd.Abduction (PG-13, 106 min.) 11:30 am, 2:00 pm, 4:45 pm, 7:20 pm, 10:05 pm Apollo 18 (PG-13, 86 min.) 10:45 am, 3:30 pm, 8:05 pm Colombiana (PG-13, 107 min.) 11:50 am, 2:40 pm, 5:10 pm, 7:40 pm, 10:10 pm Contagion (PG-13, 105 min.) 11:00 am, 1:30 pm, 4:05 pm, 6:35 pm, 9:05 pm The Debt (R, 113 min.) 11:35 am, 2:05 pm, 4:40 pm, 7:10 pm, 9:50 pm Dolphin Tale (PG, 112 min.) 4:20 pm, 9:45 pm Dolphin Tale 3D (PG, 112 min.) 10:00 am, 1:50 pm, 6:55 pm Dont Be Afraid of the Dark (R, 100 min.) 2:10 pm, 7:25 pm Drive (R, 100 min.) 10:30 am, 12:55 pm, 3:15 pm, 5:35 pm, 8:05 pm, 10:30 pm The Help (PG-13, 137 min.) 10:55 am, 2:20 pm, 5:55 pm, 9:10 pm I Dont Know How She Does It (PG-13, 95 min.) 10:40 am, 1:00 pm, 3:10 pm, 5:20 pm, 7:30 pm, 9:55 pm Kevin Hart: Laugh At My Pain (R, 88 min.) 1:05 pm, 5:40 pm, 10:20 pm Killer Elite (R, 100 min.) 11:45 am, 2:25 pm, 5:00 pm, 7:50 pm, 10:25 pm The Lion King 3D (G, 89 min.) 10:35 am, 3:00 pm, 5:05 pm, 7:15 pm, 9:30 pm The Lion King (G, 87 min.) 12:45 pm Moneyball (PG-13, 126 min.) 10:50 am, 1:45 pm, 4:35 pm, 7:35 pm, 10:30 pm Rise of the Planet of the Apes (PG-13, 104 min.) 11:40 am, 4:55 pm, 10:15 pm Shark Night 3D (PG-13, 95 min.) 7:55 pm, 10:05 pm The Smurfs (PG, 102 min.) 11:10 am, 1:35 pm, 4:10 pm, 6:40 pm, 9:20 pm Spy Kids: All the Time in the W orld 3D (PG, 89 min.) 11:05 am, 1:15 pm, 3:25 pm, 5:40 pm Straw Dogs (R, 105 min.) 11:20 am, 1:55 pm, 4:30 pm, 7:00 pm, 9:35 pm MOVIE LISTINGS HOMES FOR SALE1020 SELLING YOUR LOT, HOME OR CONDO??Call the Sun at 866-463-1638 and ask about our BRAND NEW Buy 2 Months Get One FREE! Real Estate Ad Program. Y our ad will run everyday in the newspaper & run online for 90 days! All for a ONE TIME low price. Offer good through Sept. 30, 2011. Call for details. Realtors Welcome! ADVERTISEWITHTHE SUNCLASSIFIEDS HOMES FOR SALE1020 ENGLEWOOD AREA 11869 Oceanspray Blvd. Newer 3/2/2, Canal lot. $147k 21 Clubhouse Place 3/2.5/ 3 + Den, office & Pool. $278k Call Terry Long Always Lon g on Service @ Keller William s 941-830-2347 to find ou t what your home is worth. Classified = Sales HomeVestors Global Property Resource Services We Buy The Good, The Bad and The Ugly 866-250-9457 HOMES FOR SALE1020 ENGLEWOOD AREA 129 Mariner Ln. Updated 3/2/2 Pool. $169K 1149 Brown St Updated WATERFRONT $125 Call Terry Long Always Lon g on Service! @ Keller William s 941-830-2347 to find ou t what your home is worth. CLASSIFIED ADSSELL NORTH PORT 2/1 $43,000 1152 Sq ft New carpet/paint/ a/c & Fence Realty Executives Mainstream 941-979-8915 HOMES FOR SALE1020 ENGLEWOODon Red Fish Cove 4/2.5 split; dock w/lift; breathtaking water views Call Stephen at Signature Sothebys 941-809-7580 GET RESULTS USE CLASSIFIED! PORTCHARLOTTE: UNFINISHED HOME!! Concrete Shell Only, Sec. 15. 23156 Lark Ave. $49,900. obo 941-628-2883 HOMES FOR SALE1020 ENGLEWOOD SPECTACULAR CUSTOM HTD POOL HM. 4BR/3BA/2Cg 3258 SQ.FT. ON 4 L O T S IN SARASOTA CO. O nly $389,900 941-474-4279 ADVERTISEWITHTHE SUNCLASSIFIEDS PORT CHARLOTTE $2,000 down, $530 PITI, buys beautiful 3/2/1 at 21680 EdgewaterDr. Open Sun. 2-5 Call Jim 941-896-7435 Agent HOMES FOR SALE1020 ENGL/ROTONDABrand new2011 Coastal Cottage,Upgrades throughout Energy Star Certified$199,400. 941-725-1355 BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! PORT CHARLOTTE 3BR/ 3BA, all rooms large, bedrm suite is rented, fenced yard, 10x20 shed, 2 screened porches. 941-743-0813 _14GOREN BRIDGEWITH TANNAH HIRSCH0;2011 Tribune Media Services, Inc.WEEKLY BRIDGE QUIZQ 1 Neither vulnerable, as South The bidding has proceeded:you hold: SOUTH WEST NORTH EAST1 Pass lot Pass6K9`)70(O AQ85,:KQ 10746KJ6 ')Tj0.0611 Tc 9.2486 0 0 10 202 765.5129 Tm(What do you hid now?Partner opens the bidding with threehearts. What do you respond? Q 5 Neither vulnerable, as Southyou hold:Q 2 Neither vulnerable, as Southyou hold: 4109540A8 10246A8762*Q8 `J82 1 K J 9 8 6 46 A K 7 Partner opens the bidding with onediamond. What do you respond?The bidding has proceeded:SOUTH WEST NORTH EAST Q 6 Both vulnerable, as South you1 Pass 26 Pass hold:9What do you hid now'? 6K 10932 -'J100 A446AK107Q 3 Neither vulnerable, as South The bidding has proceeded:you hold: SOUTH WEST NORTH EAST1* Pass 2C Pass6108`:?AQJ7652 ;>Void44KJ93 ?What do you bid now?The bidding has proceeded:SOUTH EST NORTH EAST Look for answers on Monday.1(1, Pass 16 Pass200% Pass 3C? Pass? (Tannah Hirsch welcomes readers'What do you hid now? responses sent in care of this newspaperor to Tribune Media Services Inc., 2225Q 4 As South, vulnerable, you hold: Kenmore Ave., Suite 114, Buf jalo, NY.14207. E-mail responses may be sent to4 K102 0) AJ630>AJ86547 gorenbridge@aol.(-om.)TODAY'S 1 2 3 4 5 6 7 8 9 10 11 12 13CROSSWORD PUZZLE 14 15 1617 18 19ACROSS locale PREVIOUS PUZZLE SOLVED1 Price tag 52 Upset 20 21 226 Quick lunch 54 PCapote lay about V O L G AA I K U Q T Y9Afresh AREAS OLDEN TO014 Rolex rival 57 Weaker, as an 23 24 2515 Funny Charlotte excuse L 0 A D S P L A N S I R I K58 Learning U R E Y C 0 P S E16 Open-air lob61 PABA part S C H E M E' S P A R A S'01 126 127 28 29 30bies 62 de plume PEEPED P U G E T17 Extinct herbi63 Swindlevore 64 Yummy pie L I AID S 0 M E W H A T 31 32 33 34 351 9 Mull over 65 Coast Guard T E D S T R A D L O S20 Clairvoyance off. B I V O U A' C S N U T T Y21 Slave girl of 66 Water, in comI R I S H CAREEN22 Lemony flavors 36 37 38 39opera bos BRIEADTH D I VERISE 23 Relax, as rules DOWN RUBLE TAD A 40 41 42 43 4425 Beatles drum1 Misplace A P B RAWER J I V E Dmer 2Tsp. andoz. WEE E LATE ORATE26 Shelved indefi3 Pager's sound 45 46nitely 4 Turtle-to-be L E, D D I N E D SANE R29 Winter woe 5 Philosopher 9-24-11 (02011 UFS, Dist by Univ. Uclick for UFS 47 148 49 5031 Harvests wool -tzu32 Book source 6 Uniform trim 26 Naughty, 44 Wrathful feeling36 Zen riddle 7 Extol naughty! 47 Embarrass 151 52 153 54 155 15637 Wassail alterna8 Prefix for "tril27 Crow's-nest cry 48 Copytive lion 28 Belle's boyfriend 49 Ms. Verdugo38 Apply a mud9 More spiffy 29 In quarantine 50 Purple fruits 57 58 59 160pack 10 Fictional Frome 30 Club stint 51 Show apprecia-40 Cancun's penin11 Twist forcibly 33 Cope with tionsula 12 Parlance change 52 Magritte or 61 62 6343 Swamp gases 13 Talks on and on 34 Headstrong Russo45 "Bus Stop" 18 Treats an icy 35 Arizona city 53 Dietary needauthor road 37 Pester 54 Laced up 64 65 6646 Dogie 23 Chamonix's 39 Make illegal 55 Waterfall sound47 Silvery fish Mont 41 Pilot's flap 56 A law itself50 Bard or minstrel 24 Always in verse 42 Big bang letters 59 I, to Fritz Want more puzzles?51 Atacama Desert 25 Burnish 43 Lowed 60 Ye olden "your" Check out the "Just Right Crossword Puzzles" booksat QuillDriverBooks.com

PAGE 62

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 13 SP29630 Sell It, Buy It IN THE Call Classified 941-206-1200 Can Only Get Easier Through The CLASSIFIED SECTION CLASSIFIED SECTION CLASSIFIED SECTION Why Not Get Them Working For You! Why Not Get Them Working For You! Dont Buy It Delay Today HOMES FOR SALE1020 Beautiful 3 Acre Mini Ranch Special Rural FINANCING! 10 Mins to shopping, r estaurants, etc..., yet offers the best of country living. Stocked pond, fenced, new appliances, completely redone. BUYERS HOME WARRANTY INCLUDED. F ANTASTIC NEW PRICE @ 169,500 Call R&R Consulting to view 941-916-1662 Back on the market! Breathtaking Golf Course views from every room!ROTONDA3/2.5/2.5 w Den, 2144sf, large Pool. Beautiful lg kitchen w Island, Jacuzzi tub, dual vanities in both bath with granite. All bedrooms have walk in closets. Dry bar, lg. pantry, solid surface counter tops. New up graded stainless steel appliances, sod, 18 porcelin tile, carpet, fans & fixtures. All for $229,900 Ron McGuire Tarpon Coast Realty 941-223-4781 HUD REGISTERED BROKER941-475-7011R OTONDA 2/1 Rotonda Cir.....$53,000NORTH PORT 4/2 Maurbach Ter ...$53,000PORT CHARLOTTE2/2 Blanchard Ave...$45,000 3/2 Peachland Blvd.$64,000 3/2 Koala Ave..........$68,000 2/2Morrison Ave ....$47,700 3/2 Laramore Ave ...$25,200 PUNTA GORDA 2/2 Carmalita St.....$36,900 2/2 Roanoke Cir ....$60,000 Y ou could save $1000s Call for a list of properties. PROPERTY MANGEMENT SERVICES ALSO AVAILABLE. G G O O V V T T R R E E S S A A L L E E S S F F o o r r e e c c l l o o s s u u r r e e s s / / R R E E O O s s EQUAL HOUSINGOPPORTUNITY LAKE SUZYESTATES Pool Home.3/2.5/3.5 Custom Buil t 2004. 2 Story, 3400 sf on Dbl. Lot. Mstr on 1st Flr., Granite, Tile, Gourmet Kit, Bonus Rm, Office & MORE! $389,000. 941-204-0074 REDUCED!! NEEDCASH? Have A Garage Sale! Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week VILA .)83(.ff 1 1SUNtPEWS)94(r" )Tj0 0.502 0 rg/TT2 1 Tf0.2645 Tc 15.0909 0 0 11 183.0702 559.3429 Tm[(gaitSU 2dinN%ddmlkkLl-lb drr. .NEWSPAPERSr .)TjEMC ET

PAGE 63

The Sun Classified-Section BPage 14E/N/C/VSaturday, September 24, 2011 AREA PROPERTY TRANSFERS ENGLEWOOD COURTESY OF ENGLEWOOD AREA BOARD OF RELATORSML# Status Address Zip Code Subdivision Name List Price Pool Sold Price BE FB HB Built Property Style Sold Terms Sold Date LP/S qFt LP/SP RatioD5783678 SLD 2811 PLACIDA RD 34224 GROVE CITY 19,000 Y 23,100 3 1 0 1959 Single Family Home All Cash 09/14/11 23.34 121.58 N5773224 SLD 1655 FLORENCE AVE 34223 CLINTWOOD ACRES 38,500 N 34,000 2 2 0 1974 1/2 Duplex All Cash 09/14/11 34.5 88.31 D5784153 SLD 170 LAKEVIEW LN 34223 LAKEVIEW TERRACE 41,900 N 42,000 3 2 0 1959 Single Family Home All Cash 09/12/11 29.89 100.2 4 N5773834 SLD 12538 FELDMAN AVE 33981 PORT CHARLOTTE SEC 56 59,900 N 65,200 3 2 0 1999 Single Family Home All Cash 09/16/11 50.2 5 108.85 D5784000 SLD 62 S BUENA VISTA AVE 34223 ALAMEDA ISLES 77,500 N 73,000 2 2 0 1979 Manufactured/Mobile Home All Cash 09/16/11 73.39 94.19 C7006186 SLD 62 BUNKER LN 33947 ROTONDA PEBBLE BEACH 85,000 N 86,000 2 2 1986 Single Family Home All Cash 09/15/11 67.73 101 .18 C7021748 SLD 7301 HART ST 34224 PORT CHARLOTTE SEC 64 86,900 N 83,000 3 2 0 1993 Single Family Home All Cash 09/15/11 54.28 95. 51 D5782781 SLD 6800 PLACIDA RD # 181 34224 FIDDLERS GREEN II CONDO 89,500 N 77,500 2 2 0 1987 Condo All Cash 09/15/11 81.96 86.59 C7024880 SLD 14303 ALLENSWORTH AVE 33981 PORT CHARLOTTE SEC 87 89,900 N 75,000 3 2 0 2007 Single Family Home All Cash 09/15/11 56.19 83.43 D5776094 SLD 4260 PLACIDA RD # 14-B 34224 FOREST PARK 109,900 N 109,900 2 2 1996 Condo All Cash 09/15/11 96.74 100 D5777033 SLD 7022 BEARDSLEY ST 34224 PORT CHARLOTTE SEC 64 118,000 Y 87,500 2 3 1982 Single Family Home All Cash 09/13/11 85 .51 74.15 O5049356 SLD 12028 NEWGATE AVE 33981 PORT CHARLOTTE SEC 72 118,500 N 105,000 3 2 0 2007 Single Family Home All Cash 09/12/11 64 .37 88.61 N5773236 SLD 10176 WILLOWOOD AVE 34224 PORT CHARLOTTE SEC 64 134,900 Y 136,000 2 2 0 1992 Single Family Home New FHA 09/14/11 8 8.23 100.82 D5781057 SLD 9371 HEARTWELLVILLE AVE 34224 PORT CHARLOTTE SEC 84 139,900 Y 125,000 4 3 0 1985 Single Family Home All Cash 09/12 /11 98.24 89.35 A3947335 SLD 8571 AMBERJACK CIR # 202 34224 HAMMOCKS PRESERVE PH 14 149,500 N 149,500 3 2 0 2007 Condo Other 09/16/11 89.31 100 N5771946 SLD 2560 LEMON AVE 34223 MANASOTA GARDENS 1ST ADD 149,900 Y 160,000 3 2 0 1992 Single Family Home New Conventional 09/ 16/11 93.51 106.74 D5783727 SLD 3 BRIDGE ST 34223 ENGLEWOOD ISLES 159,900 Y 155,000 3 2 0 1982 Single Family Home New Conventional 09/16/11 77.25 96.94 C7019837 SLD 14226 WHITCOMB LN 33981 PORT CHARLOTTE SEC 71 172,000 Y 172,000 3 2 0 2006 Single Family Home All Cash 09/14/11 82 .1 100 D5778340 SLD 474 TOMOKA DR 34223 PARK FOREST PH 5 172,900 N 172,900 2 2 2010 Single Family Home Balloon Mortgage 09/15/11 10 1.47 100 R4596174 SLD 7454 PALM IS DR # 3324 33946 BEACH VILLAS 185,000 N 123,000 1 1 0 1985 Condo All Cash 09/13/11 276.95 66.49 C7025955 SLD 221 N GULF BLVD # B 33946 PALM ISLAND ESTS 225,000 N 221,000 2 2 0 1986 Condo All Cash 09/15/11 152.03 98.22 N5772183 SLD 1550 BAYSHORE DR 34223 ENGLEWOOD GARDENS UNIT 5 247,000 Y 223,000 3 2 1 1980 Single Family Home All Cash 09/15/11 132.8 90.28 D5783410 SLD 2700 N BEACH RD # A205 34223 PELICAN LANDING 249,900 N 225,000 2 2 0 1981 Condo New Conventional 09/13/11 193.72 9 0.04 D5784438 SLD 2955 N BEACH RD # A-521 34223 TAMARIND GULF & BAY 299,900 Y 250,000 2 2 0 1981 Condo New Conventional 09/13/11 258 .31 83.36 C7021521 SLD 3418 DECK ST 33981 PORT CHARLOTTE SEC 60 695,000 Y 625,000 4 3 1 1988 Single Family Home New Conventional 09/16/11 174.8 89.93 D5768834 SLD 6421 MANASOTA KEY ROAD 34223 MANASOTA KEY 750,000 N 685,000 4 4 0 1968 Single Family Home All Cash 09/12/11 302.18 91.33 D5776131 SLD 251 GILCHRIST AVE 33921 BOCA GRANDE 2,850,000 Y 2,600,000 8 8 1 1924 Single Family Home New Conventional 09/16/11 508.93 91.23CHARLOTTE COUNTY/NORTH PORT COURTESY OF PUNTA GORDA, PORT CHARLOTTE, NORTH PORT ASSOCIATION OF REALTORSML# Status Address Zip Code City List Price Pool Sold Price BE FB HB Built Property Style Sold Terms Sold Date LP/SqFt LP/SP Ra tioC7026559 SLD 21150 GERTRUDE AVE # A1 33952 PORT CHARLOTTE 19,900 N 19,900 2 2 0 1977 Condo All Cash 09/16/11 24.12 100 D5784116 SLD 6174 GILLOT BLVD 33981 PORT CHARLOTTE 23,999 N 25,000 2 2 0 1975 Single Family Home All Cash 09/20/11 21.39 104.17 D5783804 SLD 22335 LASALLE RD 33952 PORT CHARLOTTE 26,800 N 28,000 2 1 0 1963 Single Family Home All Cash 09/15/11 27.35 104.48 C7026536 SLD 8243 GALLO AVE 34287 NORTH PORT 36,000 N 36,000 2 1 0 1977 Single Family Home All Cash 09/21/11 30 100 N5773721 SLD 2 QUAILS RUN BLVD # 2103 34223 ENGLEWOOD 36,900 N 36,000 1 1 0 1977 Condo All Cash 09/19/11 64.51 97.56 D5783272 SLD 30437 HOLLY RD 33982 PUNTA GORDA 37,900 N 35,000 3 2 0 1991 Single Family Home All Cash 09/16/11 30.71 92.35 A3947361 SLD 20988 CORNELL AVE 33952 PORT CHARLOTTE 38,000 N 36,777 2 2 0 1979 Single Family Home All Cash 09/16/11 30.35 96.78 C7024772 SLD 4158 TAMIAMI TRL # M7 33952 PORT CHARLOTTE 39,000 N 37,500 2 2 0 1970 Condo All Cash 09/15/11 40.75 96.15 C7023984 SLD 2395 HARBOR BLVD # 107 33952 PORT CHARLOTTE 44,500 N 42,500 2 2 0 1984 Condo New Conventional 09/15/11 42.62 95.51 C7020454 SLD 4106 MICHEL TREE ST 33948 PORT CHARLOTTE 48,000 Y 48,000 3 2 0 1972 Single Family Home All Cash 09/16/11 41.03 100 C7026686 SLD 20200 TAPPAN ZEE DRIVE 33952 PORT CHARLOTTE 49,900 N 48,000 2 1 1 1984 Single Family Home All Cash 09/19/11 54.71 96.19 C7026725 SLD 2258 LAKESHORE CIR 33952 PORT CHARLOTTE 52,900 N 46,500 2 2 0 1981 Single Family Home All Cash 09/19/11 49.35 87.9 A3946357 SLD 2771 STRAWBERRY TER 34286 NORTH PORT 55,000 N 56,100 3 2 0 2001 Single Family Home New FHA 09/16/11 46.14 102 C7026711 SLD 3231 BOHIO ST 34287 NORTH PORT 55,000 N 55,000 3 2 0 1977 Single Family Home All Cash 09/15/11 41.29 100 T2482033 SLD 7843 SWISS AVE 34291 NORTH PORT 56,000 N 66,100 3 2 0 2001 Single Family Home All Cash 09/19/11 35.15 118.04 C7024951 SLD 1232 S CRANBERRY BLVD 34286 NORTH PORT 59,500 N 65,000 3 2 0 1992 Single Family Home All Cash 09/19/11 37.61 109.2 4 C7024946 SLD 965 MCMAHON NW AVE 33948 PORT CHARLOTTE 59,900 N 59,900 4 3 0 1981 Single Family Home All Cash 09/15/11 42.48 100 N5773834 SLD 12538 FELDMAN AVE 33981 PORT CHARLOTTE 59,900 N 65,200 3 2 0 1999 Single Family Home All Cash 09/16/11 50.25 108.8 5 C7018105 SLD 6039 N CRANBERRY BLVD 34286 NORTH PORT 60,000 N 60,000 3 2 0 1999 Single Family Home All Cash 09/16/11 40.84 100 C7013076 SLD 3300 LOVELAND BLVD # 2301 33980 PORT CHARLOTTE 61,000 N 48,000 2 2 0 1991 Condo All Cash 09/15/11 57.01 78.69 C7023201 SLD 2140 HERON LAKE DR # 204 33983 PUNTA GORDA 63,000 N 60,000 2 2 0 2006 Condo All Cash 09/16/11 79.95 95.24 N5773372 SLD 2539 VALKARIA AVE 34286 NORTH PORT 64,000 N 66,500 3 2 0 2003 Single Family Home All Cash 09/16/11 50.35 103.91 D5780666 SLD 590 ARTISTS AVE 34223 ENGLEWOOD 64,900 N 57,000 2 2 0 1973 Single Family Home All Cash 09/19/11 72.35 87.83 C7014671 SLD 900 MARLIN DR 33950 PUNTA GORDA 65,000 N 65,000 3 2 1978 Single Family Home All Cash 09/15/11 53.63 100 C7006129 SLD 3310 LOVELAND BLVD # 1204 33980 PORT CHARLOTTE 69,900 N 54,000 2 2 0 1989 Condo New Conventional 09/15/11 66.95 77 .25 C7025012 SLD 3433 SARDINIA AVE 34286 NORTH PORT 70,500 N 80,600 3 2 0 2006 Single Family Home All Cash 09/19/11 42.86 114.33 C7026221 SLD 3865 BEEBER ST 34287 NORTH PORT 71,900 N 61,000 2 2 0 1980 Single Family Home All Cash 09/16/11 63.52 84.84 C7025254 SLD 177 DOWLING NE AVE 33952 PORT CHARLOTTE 74,900 Y 66,500 5 3 0 1970 Single Family Home All Cash 09/16/11 32.57 88.7 9 C7024807 SLD 25118 PALISADE RD 33983 PUNTA GORDA 75,000 Y 75,100 3 2 0 1991 Single Family Home All Cash 09/15/11 54.51 100.13 N5773694 SLD 1066 MALAY NW TER 33948 PORT CHARLOTTE 79,900 N 75,000 3 3 0 1985 Single Family Home All Cash 09/15/11 47.84 93.87 C7025857 SLD 3121 SHEBOYGAN AVE 34286 NORTH PORT 83,000 N 86,000 3 2 0 2004 Single Family Home New FHA 09/21/11 46.76 103.61 C7024880 SLD 14303 ALLENSWORTH AVE 33981 PORT CHARLOTTE 89,900 N 75,000 3 2 0 2007 Single Family Home All Cash 09/15/11 56.19 8 3.43 A3946379 SLD 2347 PONCE DE LEON BLVD 34291 NORTH PORT 89,900 Y 87,000 3 2 0 1992 Single Family Home New Conventional 09/20/11 7 2.85 96.77 A3942495 SLD 3168 SAINT JAMES ST 33952 PORT CHARLOTTE 94,900 Y 87,000 3 2 0 1979 Single Family Home All Cash 09/15/11 60.79 91. 68 C7025767 SLD 3257 SUNRISE TRL 33952 PORT CHARLOTTE 95,000 Y 96,000 3 2 0 1972 Single Family Home New Conventional 09/16/11 59.6 101.05 C7008633 SLD 150 HARBORSIDE AVE # 316 33950 PUNTA GORDA 99,000 N 75,000 2 2 0 1974 Condo All Cash 09/16/11 78.57 75.76 A3935157 SLD 2426 HOMESTEAD CIR 34286 NORTH PORT 99,000 N 90,000 3 2 0 2005 Single Family Home New Conventional 09/16/11 48.65 90.91 C7026179 SLD 2274 BRIANT ST 34287 NORTH PORT 109,900 Y 105,000 3 2 0 1995 Single Family Home New Conventional 09/16/11 77.89 95 .54 C7026041 SLD 1906 LAMONT ST 34288 NORTH PORT 114,900 N 113,900 4 3 0 2007 Single Family Home All Cash 09/15/11 50.44 99.13 C7023319 SLD 1362 N CARABOA S LN 33953 PORT CHARLOTTE 115,000 Y 100,000 3 2 0 2007 Single Family Home All Cash 09/21/11 61.14 8 6.96 C7013658 SLD 3512 DISCOVERY DRIVE 33983 PUNTA GORDA 118,000 N 107,500 1 1 1964 Single Family Home All Cash 09/16/11 165.5 91 .1 N5763532 SLD 17435 HILLSBOROUGH BLVD 33954 PORT CHARLOTTE 125,100 Y 125,100 3 2 2007 Single Family Home Combination 09/21/11 68.81 100 C7026048 SLD 2552 GREENLAND ST 34288 NORTH PORT 128,000 Y 129,000 3 2 0 2006 Single Family Home All Cash 09/16/11 65.07 100.78 C7024690 SLD 10177 GASPARILLA RD 33981 PORT CHARLOTTE 128,900 N 116,500 3 2 0 2009 Single Family Home New FHA 09/20/11 65.04 90 .38 N5772919 SLD 1545 GAUGUIN RD 34288 NORTH PORT 139,900 N 129,900 4 2 0 2006 Single Family Home New VA 09/15/11 63.05 92.85 C7024740 SLD 2844 ALHAVEN TERR 34286 NORTH PORT 139,900 N 139,900 3 2 0 2005 Single Family Home Combination 09/20/11 88.54 100 M5821735 SLD 2588 HOBBLEBRUSH DR 34289 NORTH PORT 140,000 N 136,000 4 2 0 2006 Single Family Home All Cash 09/15/11 58.14 97.14 N5771946 SLD 2560 LEMON AVE 34223 ENGLEWOOD 149,900 Y 160,000 3 2 0 1992 Single Family Home New Conventional 09/16/11 93.51 106.74 C7018837 SLD 311 GARVIN ST # 405B 33950 PUNTA GORDA 153,000 Y 145,000 2 2 0 1973 Condo All Cash 09/19/11 139.09 94.77 C7024248 SLD 1690 NUREMBERG BLVD 33983 PUNTA GORDA 154,900 Y 144,000 3 2 0 1991 Single Family Home All Cash 09/20/11 90.01 92.9 6 N5773649 SLD 201 CHAMPION ST 33953 PORT CHARLOTTE 156,750 Y 150,000 3 2 0 2009 Single Family Home All Cash 09/16/11 86.89 95.69 D5783727 SLD 3 BRIDGE ST 34223 ENGLEWOOD 159,900 Y 155,000 3 2 0 1982 Single Family Home New Conventional 09/16/11 77.25 96.94 C7025917 SLD 2801 CARMELA AVE 34286 NORTH PORT 159,900 Y 159,000 3 2 0 2004 Single Family Home New VA 09/20/11 97.44 99.44 D5778340 SLD 474 TOMOKA DR 34223 ENGLEWOOD 172,900 N 172,900 2 2 2010 Single Family Home Balloon Mortgage 09/15/11 101.47 100 C7026729 SLD 1010 SHEEHAN BLVD 33952 PORT CHARLOTTE 175,500 Y 168,000 3 2 0 2003 Single Family Home All Cash 09/19/11 84.74 95. 73 C7022296 SLD 84 MCCABE ST 33953 PORT CHARLOTTE 177,500 Y 180,000 3 2 0 1984 Single Family Home New VA 09/15/11 93.77 101.41 C7021599 SLD 495 RAVENSWOOD BLVD 33954 PORT CHARLOTTE 210,000 Y 170,000 3 2 0 1999 Single Family Home All Cash 09/16/11 98.22 8 0.95 C7024636 SLD 4331 BLUE HERON CIR 34287 NORTH PORT 233,300 N 228,300 3 2 1 2004 Single Family Home All Cash 09/16/11 107.31 97.8 6 D5777698 SLD 6664 OLD COURT ST 34291 NORTH PORT 239,000 N 239,000 4 3 1 2004 Single Family Home New Conventional 09/16/11 59.42 100 N5772183 SLD 1550 BAYSHORE DR 34223 ENGLEWOOD 247,000 Y 223,000 3 2 1 1980 Single Family Home All Cash 09/15/11 132.8 90.28 C7025250 SLD 9060 GROVE BLVD 33982 PUNTA GORDA 259,000 N 241,000 3 2 0 1992 Single Family Home All Cash 09/16/11 96.35 93.05 C7004299 SLD 164 BALDWIN SE CT 33952 PORT CHARLOTTE 299,000 Y 290,000 3 2 2006 Single Family Home All Cash 09/21/11 146.43 9 6.99 D5778934 SLD 203 LAKE VICTORIA CT 34223 ENGLEWOOD 299,000 Y 277,500 3 2 2005 Single Family Home All Cash 09/20/11 147.44 92. 81 C7026232 SLD 2531 RIO LARGO CT 33950 PUNTA GORDA 347,900 Y 365,200 3 2 0 1991 Single Family Home All Cash 09/15/11 172.57 104.9 7 C7022697 SLD 15576 MELPORT CIR 33981 PORT CHARLOTTE 349,900 Y 325,000 3 2 0 2008 Single Family Home Balloon Mortgage 09/21/11 1 46.71 92.88 C7016600 SLD 5575 RIVERSIDE DR 33982 PUNTA GORDA 397,500 Y 375,000 3 2 0 1998 Single Family Home New VA 09/15/11 169.29 94.34 C7021521 SLD 3418 DECK ST 33981 PORT CHARLOTTE 695,000 Y 625,000 4 3 1 1988 Single Family Home New Conventional 09/16/11 174.8 89.93

PAGE 64

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 15 AREA PROPERTY TRANSFERS CONTINUED SOUTH SARASOTA COUNTY SOUTH SARASOTA COUNTY COURTESY OF VENICE AREA BOARD OF REALTORSML# Status Address Zip Code Subdivision Name List Price Pool Sold Price BE FB HB Built Property Style Sold Terms Sold Date LP/S qFt LP/SP RatioA3947260 SLD 624 CORONADO RD 34293 SOUTH VENICE UNIT 3 62,900 N 63,000 2 2 0 1978 Single Family Home All Cash 9/15/2011 45.75 1 00.16 N5773662 SLD 1065 HUDSON RD 34293 SOUTH VENICE UNIT 25 74,900 N 70,000 3 1 0 1960 Single Family Home All Cash 9/16/2011 75.43 9 3.46 A3947286 SLD 290 PELICAN RD 34293 SOUTH VENICE UNIT 17 74,900 N 72,900 2 2 0 1986 Single Family Home Other 9/16/2011 58.88 97.3 3 D5783954 SLD 347 TIHAMI RD 34293 VENICE GARDENS UNIT 3 98,500 N 85,000 2 2 0 1959 Single Family Home New Conventional 9/16/2011 86.71 86.29 N5772400 SLD 3490 SIESTA DR 34293 SOUTH VENICE UNIT 35 99,999 Y 98,000 2 2 1 1965 Single Family Home New Conventional 9/13/2011 70.37 98 M5822067 SLD 106 COROT DR 34275 SORRENTO EAST UNIT 3 109,000 N 110,000 3 2 0 1973 Single Family Home New Conventional 9/15/2011 55.44 100.92 N5771878 SLD 433 CERROMAR LN # 538 34293 FARMINGTON VISTAS 114,900 N 95,000 2 2 0 1982 Condo All Cash 9/15/2011 106.88 82.68 N5768617 SLD 603 TANGERINE ST 34275 CITRUS HIGHLANDS 119,000 Y 100,000 2 2 1960 Single Family Home All Cash 9/14/2011 78.96 84.03 A3946169 SLD 5040 LARRY ST 34293 MANASOTA 129,900 Y 127,000 3 2 0 1983 Single Family Home All Cash 9/13/2011 76.41 97.77 N5773738 SLD 305 ANGELICO DR 34275 SORRENTO EAST UNIT 2 144,900 N 140,000 3 2 0 1979 Single Family Home All Cash 9/16/2011 76.5 5 96.62 N5773591 SLD 1613 E CYPRESS POINT DR 34293 VENICE GARDENS UNIT 33 149,900 Y 140,000 2 2 0 1976 Single Family Home New Conventio nal 9/12/2011 97.21 93.4 N5773474 SLD 3425 KENNEDY DR 34292 NORTH VENICE FARMS 150,000 N 150,000 2 1 0 1932 Single Family Home All Cash 9/15/2011 167.41 100 N5771867 SLD 201 AUBURN LAKES CIRCLE # 1 34292 AUBURN LAKES 159,900 N 145,000 3 2 0 2000 Condo All Cash 9/12/2011 115.62 90.68 C7023402 SLD 1010 JOYCE CT 34293 VENICE GARDENS UNIT 34 SEC 3 159,900 Y 159,900 3 2 0 1993 Single Family Home New Conventional 9/14/2011 79.16 100 T2463555 SLD 19270 LAPPACIO ST 34293 ISLANDWALK AT THE WEST VILLAGES 186,525 N 174,165 2 2 0 2011 Single Family Home All Cash 9 /15/2011 130.53 93.37 N5772600 SLD 973 GONDOLA CT 34293 VENICE GARDENS UNIT 34 SEC 2 199,500 Y 185,000 3 2 0 1978 Single Family Home All Cash 9/16/20 11 107.61 92.73 N5773568 SLD 24793 BONIFAY PLACE 34293 PENNINGTON PLACE 219,990 N 219,990 3 2 0 2011 Single Family Home All Cash 9/13/2011 121. 95 100 N5771706 SLD 5053 SEAGRASS DR 34293 WHITESTONE AT SOUTHWOOD UNIT 2 PH 3 268,000 N 241,000 3 2 0 1997 Single Family Home All Cas h 9/15/2011 117.18 89.93 N5773599 SLD 516 SANTE JOSEPH ST 34285 BEACH PARK 279,000 Y 265,000 2 2 0 1956 Single Family Home All Cash 9/14/2011 171.8 94.9 8 N5772677 SLD 202 TREVISO CT 34275 VENETIAN GOLF & RIVER CLUB PH 2B 279,500 N 235,000 2 2 0 2003 Single Family Home All Cash 9/1 2/2011 147.81 84.08 N5773620 SLD 405 ALHAMBRA RD 34285 VENICE SOUTH GULF VIEW 325,000 Y 295,000 2 2 0 1968 Single Family Home New Conventional 9/13/2011 265.52 90.77 N5773625 SLD 507 PARK ESTATES SQ 34293 PARK ESTS 325,000 Y 310,000 3 2 0 1996 Single Family Home All Cash 9/15/2011 151.09 95.3 8 N5768677 SLD 414 MONTELLUNA DR 34275 VENETIAN GOLF & RIVER CLUB PH 2F 349,000 N 325,000 3 2 2004 Single Family Home Combinat ion 9/15/2011 168.03 93.12 N5773064 SLD 422 MARSH CREEK RD 34292 SAWGRASS UNIT 5 399,900 Y 380,000 3 2 0 2002 Single Family Home All Cash 9/16/2011 194.69 95.02 N5774063 SLD 19733 COBBLESTONE CIR 34292 STONE WALK 431,648 Y 431,648 3 3 0 2011 Single Family Home Combination 9/13/2011 165.0 7 100 N5772086 SLD 620 BARCELONA AVE 34285 VENICE GULF VIEW 649,000 N 600,000 3 2 0 2011 Single Famil y Home New Conventional 9/16/2011 298.39 92.45 HOMES FOR SALE1020 NORTH PORT 3/2/2 1834SF, Lanai, all appls & W/D, fenced, Sprinkler sys, Low maint & taxes. $149,500. 941-429-9305 Eves CLASSIFIED W ORKS! Owner Financing $699/mo Nor th Por t Ready to move in! 3/2 FL room, Gar, $99k 941-716-0040 PORT CHARLOTTERent to Ow n 3/1 Shows like a Model Hom e Many New Features: $68,00 0 Poss. Finance. 941-629-6329 PUNTA GORDA Remodeled 2/2/2 pool home with dockage for 65' plus sailboat, depth maintained by city, dead end street in restricted neighborhood. $229,900. Lisa Laflamme, Micheal Saunders and Assoc., 941-916-0538, Lisala@earthlink.net PRAIRIE CREEK,PUNTA GORDAEquestrian Country Estate 4BR/4.5BA, Htd pool/spa, gazebo. Gated on 5+ acres w/ stocked bass pond & more 17400 White W ater Ct. 941-575-4783 or 637-1673 $675,900. For virtual tour:www.floridaneighborhoods.net REDUCED WA TERFRONT HOMES 1030 PORT CHARLOTTE 3/2 Fresh W aterCanal, new: r oof, AC, floors, cabinets. lanai, $79k 941-6296329 poss finance WA TERFRONT HOMES 1030 ENGLEWOOD/VENICE Beautiful home in Waterfront community with dock. No bridges out. Lg. Fl room, Many new upgrades including: tile roof, wood kitchen cabinets, upgraded stainless steel appliances, granite, gutters, 18 porcelin tile, carpet, fans light fixtures, doors, sinks, faucets and new paint! $229,900 Ron McGuire T ARPON COAST REALTY 941-223-4781 PORT CHARLOTTE Executive, furnished, 3/2/2 pool, canal to Gulf. May Lease-Purchase, owner finance. $274,900 Judy Barkhurst, Sun Realty, 941-286-3473 PUNTA GORDA WATERFRONT Great View, Boat Dock, newer 2/2/CP, & 12x12 lanai. Res Owned, htd pool, Lg club house. no pets. 55+, $78,000. Selling due to health, 941-833-8370 VENICE AREAFULLY REMODELED WATERFRONT HOME,pool w spa, pavered deck & driveway. Dock, $199,900 Call Ron McGuire T arpon Coast Realty 941-223-4781 CLASSIFIED SELLSCALLTODAY!941-207-1200 V enice/Englewood Nor th Port areas OR 941-206-1200P t. Charlotte Areas GOLFCOURSE COMMUNITY1035 PG BLUE HERON PINES 1261 SF, 55+ Golf, pool, clubhouse, 2/2/CP, New floors, paint, $59,900 941-637-7803 CONDOS/VILLAS FOR SALE1040 SELLING YOUR LOT, HOME OR CONDO??Call the Sun at 866-463-1638 and ask about our BRAND NEW Buy 2 Months Get One FREE! Real Estate Ad Program. Y our ad will run everyday in the newspaper & run online for 90 days! All for a ONE TIME low price. Hurry, Offer good through Sept. 30, 2011. Call for details. Realtors Welcome! NEEDAJOB? CHECKTHE CLASSIFIEDS! 414 CONDOS/VILLAS FOR SALE IN VENICEAvailability changes per wk/MLSWe are Condo/Villa SpecialistsBIRDBAYREALTY, INC.485-4804/1-800-464-8497 Bay Front Penthouse Condo Large top floor end unit, gated, very private, no condo neighbor s visible, excellent private bay & sunset views, nearly new 3 BR/2 BA, plus den. Choices t 2-1/2 car garage parking (nex t to elevator) w/2 large storag e lockers & mini space for gol f cart, motorbike, etc. Loaded w/extras. Choice Placida are a with new boat slip. NOW the onl y bay front penthouse with its own private boat dock right at you r front door. Over $800K invest ed, REDUCED to $429K. Possible owner financing at 3-1/2%. MLS #U7516743 941-769-1017. PUNTA GORDA ISLES WA TERFRONT! **5 MINS TO** FISHERMANS VILLAGE By Boat Beautiful lg furnished 2/2 condo,boat slip,htd pool,large lanai,$159,900 T arpon Coast Realty Call Ron McGurie 941-223-4781 ENGLEWOOD 2/2/1 Gulf W inds on Oyster Creek w/dock, access to Intercoastal, Clubhouse, Rol-Safe shutters, All tile. Reduced to: $125,000. FSBO 941-4600669 CONDOS/VILLAS FOR SALE1040 THISIS THE ONE ROTONDA 2BR/2BA CONDOMINIUM Built in 2005.Granite counter tops,Brand new Upgraded Stainless Steel appliances, Beautiful new flooring.Tennis courts,Large pool & beautiful c lub house with walk/ biking trail right next door $103,900. T arpon Coast Realty Call Ron McGurie 941-223-4781 PORT CHARLOTTE CONDO Ground floor, furn, 2BR/2BA/CP Pool, Jacuzzi, Te nnis, Shuffle Board, Rec Hall, etc $39,900. (941)-613-2940 NEEDCASH? PUNTA GORDA Emerald Pointe Condo, 4th flr. Canal view. 2/1, Beautifully appointed. Tu rnkey. Boat Slip.$127.9K 941-637-1422. To Advertise in The Showcase of Homes Please Call 866-463-1638 or Email; special@sunnewspapers.net WA TERSIDE VILLAGE:2nd fl condo,2/2+den,water view. $143.900.Barb Gahry, Michael Saunders & Co 941-586-3936 T OWNHOUSES FOR SALE1060 PUNTA GORDA ISLES T arpon Cove 3/2/2 car garage. 2nd Flr. w/ private elevator. 2400+ sf. of A/C. Open Floor plan. Affordable luxury. $279,750. RE/MAX Harbor Harry Row e 941-457-0508 DUPLEXES FOR SALE1070 E.ENGLEWOOD 3/2/2 on each side. All appliances. Very Nice. Looks Like new. Only 4 yrs old. $230K 941-809-1820 Furnished duplex in Englewood. Close to town. $130k Tennants in place. $18k income. Owner will consider holding mortg. with 30k down. Broker protected. Bill941-492-6025 Great Annual Investment! MOBILE HOMES FOR SALE 1090 INVESTORS Oyster Creek, 2 Dblewides on canal, private area, fully furnished, rented $150,000, 941-356-0391 LAKE SUZY Country Living 4 mi. to PC, I-75, Wal Mart, PRI VA TE 2 1/2 acres, 3/2/CP, well, septic $149,900. 941 743-6601. P ALM HARBOR HOMES Red Tag SALE Over 10 stock units must go Save up to 35K! 800-622-2832 ADVERTISE In The Classifieds! PUNTA GORDA 1/1 14x40 furn, 55+ Resident owned SR. Park. RIVER HAVEN MHP 10100 Burnt Store Rd Unit 129 Low maint. fees REDUCED $25,000/obo 516-850-0576 PUNTAGORDA Resident Owned 55+ Socially Active Boating Community. W aterfront & interior newer homes and lots, from $12,000, in Windmill Village MHP. 215 Rio Villa Dr. Visit windmillvillagehomes.comJim Schappe Gulf Access Homes Inc. (941)-380-3230 VENICE ISLE REAL ESTATE SALES, INC. 55+ Resident Owned Comm. Lic. R.E. Broker. 941-485-7743 Many homes to choose from. 941-485-7744 MOBILE HOMES FOR SALE 1090 VENICE RANCH M.H.E.Community is being Renovated! Lot rental community Singlewide homes starting @ $500.00 down Doublewide homes starting @ $4,000.00 WALKING DISTANCE TO PUBLIX & CVS 55+ comm. No pets Call Dick or Steve 941-488-5672 www.VeniceRanch.com MANUFACTURED HOMES FOR SALE1095 A RCADIAVILLAGE, 55+ Gated, 2/2/Den, fans, Large shed, vinyl porch, 1500 sq ft on golf course. $65,800. 941-429-2316. ASKUS HOW you can place a PICTURE of your item for sale in your classified ad! LETTUCE LAKE AREA 5 acre s zoned AG, fenced & cleared, 28x64 1800 sf, 24x20 metal garage $187,500/OBO 941-624 0275 SETTLE ESTATE $27,980!!! Furnished Move in today! Call 941-356-5308 PUNTA GORDA Tr opical Palms 2/2, huge closets, 2004, new appl., window treatments, lanai, porch. Mint. Low lot rent. 239-543-5857 PUNTA GORDA Lakewood V illage, Lot #42. 2/2/CP, kit., LR, DR, FL rm., CHA, Amenities. $29,500. 941-204-7548 PUNTA GORDA Nice remodeled 2bed/2bath, large carport, screenroom, utility shed, $14,900 941-626-7829 Greg. LW44 F--f \)Tj-0.0162 Tc 7.5455 0 0 28 68.5 921.5081 Tm(tvrte:-,.r.:,,m.._..)Tj0 Tc 0 0 0 6 70.5 763.513 Tm(. ',)]TJ-0.2932 Tc 12.5 0 0 6 281.5 767.0128 Tm[()-63(a)-360()]TJ-0.1879 Tc 8.4694 0 0 6 305 772.0127 Tm(, #)-530()-213( 8.,, `Z7F .7 urY fam M . ,Vol42R 9Irk,

PAGE 65

The Sun Classified-Section BPage 16E/N/C/VSaturday, September 24, 2011 SAME DAY A PPROVAL WITH NO A PPLICAT ION F EES Tony M oore Michelle Hanna h Sandra Hoy Mark Piet raniec Susan Hogr efe 807 US 41 ByPa ss South, Sui t e A Veni ce, FL 34285 PH ( 941)485-4222 FX ( 941)485-4223 www. gul fsi demt g. com www. MyFl ori daMort gage. com The People to Know, for the Mortgage you need VOTED #1 VOTED #1 Mort gage Mortga ge Company Company 8 Years In A Row 8 Years In A Row MORTGA GE BANKI NG I S OUR BUSI NESS Mi che lle Ha nnah Tony M oore 8527505 Welcome HomeFOR 25 YEARS THE#1 REALESTATE MAGAZINE INTHEMARKETPLACE!www.welcome-home.com (941) 206-1200 Classified Ads (941) 206-1000 Display Ads Thinking about advertising ? Thinking about advertising ? Now is the time! OUTOFAREA HOMES1110 CHIMNEY ROCK, NC 1328sf log chalet unfinished on 4+ acres $94,800 or on 2 acres only $79,900 your choice.Call owner for details 828-286-1666 Classified = Sales LOTS & ACREAGE1500 NORTH PORTSumter Blvd. Great location. New home area. $6,900 941-457-6811 CLASSIFIED ADSSELL PUNTA GORDA 1.25 Acres. 10 minutes from exit 164. $12,900/obo. 239-777-3447 LOTS & ACREAGE1500 SELLING YOUR LOT, HOME OR CONDO??Call the Sun at 866-463-1638 and ask about our BRAND NEW Buy 2 Months Get One FREE! Real Estate Ad Program. Y our ad will run everyday in the newspaper & run online for 90 days! All for a ONE TIME low price. Hurry, Offer good thru Sept. 30, 2011. Call for details. Realtors Welcome! PUNTA GORDA 1.25Acres Country living Bring your livestock! Close to I-75 & shops $22,900. 941-637-7776 BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! WA TERFRONT1515 BEST LOT BUY in 3 golf course community and its waterfront, too! Reduced to only $13,900. Zoned for 1 to 5 units. Possible owner financ ing @ 3-1/2% 941-769-1017 BYOWNER, Sailboat Lot, 3472 Discovery 33983 Great Location. $39,900 941-6778550 details at KL30.com WA TERFRONT1515 DEEP SALTWATER LOT Cape Haze area, new seawall, Bay views, back yard faces west spectacular sunsets over the water. Possible owner financing at 3-1/2%. Reduced to $189,900K. MLS# U7516944 Call 941769-0200 DIRECT BAYFRONT PROPERTY LOWEST PRICED direc t bayfront of its kind on Florida s W est Coast. Rare, extremel y deep sailboat water (10+ ft) a t your lot. Spectacular one-of-a kind BIG 180-degree wate r views. Price JUST REDUCE D to $429,900. Possible owne r financing at 3-1/2%. MLS #U7516841 Call: 941-769-0200 LEMON BA Y at your fr ont door Build your dream home on 100 x 287 lot. W alk to beach. A steal at $139,900 Call Diane Newland 941 223 5387 Palm Realty Group MANASOTA KEY Building lot 4th from Gulf. $499,000 401-596-0614 GET RESULTS USE CLASSIFIED! Nearly 1 acre on Lemon Bay! Best direct bay front lot in Engle wood zoned so it can be spli t into 2 single-family home sites. Includes brand new 90ft. boa t dock. Possible owner financin g at 3-1/2%. MLS# U7516833 Call 941-769-0200 BUSINESS FOR SALE1600 NORTH PORT, Pool Route. $45K + year. Will train & guarantee accounts. $36K full price. Other routes available. www.poolroutesales.com 772-220-3306. National Pool Route Sales, Inc. Broker. BUSINESS FOR SALE1600 VENICERESTAURANT 90 seats, Fully equipped, $59,900 MaryBeth, Preferred Properties, Realtors. 941-416-3829 BUSINESS RENTALS1610 DAYCARE approved for up to 40 children, on 4 acres in V enice near I-75 interchange, 1st mo. free, $2,200. 941-488-6210 P AULSON CENTREEXECUTIVE OFFICE SUITES18245 Paulson Drive. P.C 25% off first Year Rent 80 s.f. to 230 s.f. Offices Vir tual Offices available Info call (941)-206-2200 PUNTA GORDA on US 41 CEDAR POINT OFFICES Near downtown 1,250 sqft $1,400 Smaller spaces avail. Flip, 941-505-0482 a GREAT day! ~JIllMurdock Prof. Plaza. US 41 frontage, Approx. 650SF, Free Rent, Call for details. (941)629-1121 Real Living All Florida RealtyiA INCOME PROPERTY1615 NOCATEE, 11 Homes on 5 Acres. 1/2 Rented. Will Pay for Itself! Great Investment! $125,000. 941-624-0355 ADVERTISEWITHTHE SUNCLASSIFIEDS VENICE MINI STORAGE F ACILITY, 425 Units, $1.1M. MaryBeth, Preferred Properties, Realtors 941-416-3829 COMMERCIAL/ INDUSTRIALPROP1620 ENGLEWOOD ROUTE 776 55K SQFT AVAILABLE RETAIL/STORAGE. $250/PER MO FOR TEMPMPOARY LEASE. CALL TIM 440-334-8371 PORT CHARLOTTE 1,000 sq.ft. Commercial units for lease. $642 Contact Kevin. 941-548-7882 PORT CHARLOTTE AAA location, 3,000sq ft, call 941628-2883 PORT CHARLOTTE-Prime office space, 3 units 1,000sf. ea. Brand new. Sandhill Blvd. Turnkey/Fully built out. (941)-624-5992 COMMERCIAL/ INDUSTRIALPROP1620 VENICEISLAND Eff, 1 & 2 br, Immed occup. No pets, 1 yr lse 941-416-5757 or 941-323-6466 VENICEWAREHOUSES USER OR INCOME 4000Sqft; 7,000 sq ft, 10,000 & 20,000 MaryBeth, Preferred Properties, Realtors 941-416-3829 IN THE SUN CLASSIFIED YOU CAN..... Find a Pet Find a Car Find a Job Find Garage Sales Find A New Employee Sell Your Home Sell Your Unwanted Merchandise Advertise Your Business or ServiceClassified its the reliable source for the right results WA REHOUSE & STORAGE1640 CHARLOTTE HARBOR 20X40warehouse/business, AC office, city water, dumpster, 23250 Harper Ave. #2 $460/mo. 715-367-8236. NORTH PORT-800 SF Warehouse, $400 + tax.; 800sf w/ electric & small office $500/ mo + tax. 941-661-6720 PORT CHARLOTTEWarehouse For Lease 800 or 1600 sq ft. available. Starting at $330 941-380-9212 PUNTA GORDA, 1600 sf. with interior office & lg overhead drs $600/mo+Tax.239-248-0020 VENICE 400ft to 7,000 ft $6.00 per foot MaryBeth, Preferred Properties, Realtors 941-416-3829 VENICE Warehouse Complex Bay Rentals Starting at $200/per mo. 941-4858402 NiL )Tj-0.4583 Tc 38.0417 0 0 4 102.5634 679.2762 Tm[(-T,it I/GULFSIDE)Tj-0.1391 Tc 28.8696 0 0 15 52.2664 433.5523 Tm(r MORTGAGE SERncEa..1 \\7n,E.fieofiGe CUAKO[U/ r v )75(or t era a/e)85(ou Keee()Tj/TT1 1 Tf-0.011 Tc 5.0303 0 0 11 65.7664 384.5538 Tm(J 1SUNNEWSPAPERS

PAGE 66

September 25, 2011

PAGE 67

Comics Page 2 D/E/N/C/V www.sun-herald.com The Sun /Sunday,September 25, 2011

PAGE 68

Sunday,September 25,2011/ The Sun www.sun-herald.comD/E/N/C/V Comics Page 3

PAGE 69

The Sun /Sunday, September 25, 2011 Comics Page 4 D/E/N/C/V www.sun-herald.com

PAGE 70

Sunday,September 25,2011/ The Sun www.sun-herald.comD/E/N/C/V Comics Page 5

PAGE 71

Comics Page 6 D/E/N/C/V www.sun-herald.com The Sun /Sunday,September 25, 2011

PAGE 72

Sunday,September 25,2011/ The Sun www.sun-herald.comD/E/N/C/V Comics Page 7

PAGE 73

Comics Page 8 D/E/N/C/V www.sun-herald.com The Sun /Sunday,September 25, 2011



PAGE 1

rfnn rfntfbfnntftrfnttbfnnnnbnbnnn nbnbfnbnbrn nnrnrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrf ntrrrrrrrrrrrrrrrrrrrrrrrrrrb rrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrb rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrb rrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr trrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrf trrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr n t rrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr nrrrrrrrrrr nrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr rrrrrrrrrrrrrrrrr trrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrb rfn tb t nf f tr tf tfr fnf nr rrb rnn rtff tt tfn nrb r r nf t frfn b n t bbr b trfn fb rr rr b tn tntf b r r fr ntt b rrt rb n b rt t ft fff t f t frfft rt nf tb btt tb tt rt f nf tf ftr bb rrb t ffb n fft ft fftrt ff n r ntr f tb fr nbrt ftt rt f ff ff bb t tfrfntb rfn tbnn b nr r tnr nr fb rn bnn f f nf r nr n tn t trt nt trnr r f rf n tbn nnr nf fftt tt t tr t tb nbttf rb nrb rftt trrb t b b r ttf ff trfb b f fbf trt f ntfb f rf fb t rfr rrff rr f ftr n rrb tnrf tfr t rttrr ttftft tnr rt t tfn f tnbbfr br ftf fntb nfbb br ttt fbt f bb rtff ntf trr f r t tfrt rffr t nfr f nf ff fr f ftn brnt tr f n fbnfrb tftfr nf ftrtt t t bb nr trtfr t trfrtn tfrfrnftbrtrrb bnnn btnnnb n nb )-4(uJGtiYdolierd SCHOOL BUS blobefthelrt II: L)Tj 0 0.502 0 rg 0.54 0 Td (c .OLIN)26(. i* Iitt \ \7 05252 10075 0

PAGE 2

r rf ntbbr br fr rfnnftbftnrnnt b tnftnnbb t fttrn nrnnntt n fbn rf ffffb ffffb rfrr bfrr f nn nn f ntb tb r ff br bf ff brr b r f r r b r f b t tt r ttb fb ff nnf bf rf rfff rbf frfnnfnfntt nrbfff tt t r tt t tnbnnt rfnttb nnfffr ff bfr fnrtb ntn nt rbn brtt rn ntb nnnt ttrnt tnttn nntrtt t tbrnn bt rtn nb tt nnnt ntb rtr nn t ntrbnb trbntnt tr tt rtt ttr nn rn nntnn nr tn nntr nntb nttn nt br tbtn ttb n nntt rnt nnntb ntn rtr n ttt nbbt tbr bt r rffn tbbt ntbnnnnt btbt rnnrnnt bnb ntbnn t nbn nnrrnt r tt tbtt ttnr fr ntnn nbnt nn tnrt rttn bt rf r frnftbf n ffr rff f nff ftf bnft ft ff brb r b rfntbnf bn bb nnbnntbn n n f nf bnbbbnbn )Tj /TT1 1 Tf -0.2991 Tc 37.2436 0 0 6 555.921 770.0965 Tm (S UN----lotte NE ,WSPAPER DcSoto b:nglcx and No th Port VcmecEy0UTH OfRor t & Joan LeeBoys & Girls ClubSarasota County Parks & Recreation it d' "-, )Tj -0.0117 Tc 7.3009 0 0 7 432.329 434.9675 Tm (Venice YMCAVenice Main Street AM,Venice Library FREE Door Prizes!for teens Games!and their familiesPre-Registration suggested for this event call 922-5126 or register online at cydonline.orgFF7V r..... ...................................SrAutumn treats & prizes!? 0 11 Explore with exclusive f aaccess to nature experts. f T" p -!;+ f' Customize your schedule of events.Girdingr` Butterflies,,..S' `A/' Kayaking 4AfeettheArtistRecePtionV Vat er, Wings 2 2r) Y IrIlt/ 1 / ling` Hiking featuring an exhibitbWildlife g a byAir Boat Rides Sponsoredb Artist asBroolcs,and Fri Y k credit UnionWildflowers ends of the the Parks FoundationExperience why Nature Viewingis in our Nature. visit: )-116(* sCentral Florida/,, October 6-9, 2011 )Tj /TT3 1 Tf -0.0262 Tc 10.9051 0 0 10 503.5218 62.0054 Tm [(800-828-7655 Follow us onRegister online atwww.V*isitCentralFlorida.org/naturefestk -, .. .. _.... r :ca)dr.rtl.'_ :,.r.,r:.t,14, uf1.i.,k _11.1.b41c 1

PAGE 3

rff n rfnrtf b fn nn n fn r n n f nf f n f nfn nn n nnn fnfn nfn fn nfnnf nnrrb nfnf nn ffff f fnf fnff fnf fnfn nff ff nff f fnn f fnfn f nntff nfnf fn nn nfnf nnn n ffn nff n nnf nfff fn nfn nn nff rrbnf f nf nnn n f fnn fnnf fnff n rrbnrf nf nfffn ff nf nnn nfn fnfn fn nf nnn nnnnnf fnn nffffnf nft tff n nnnn nfnfn fnff fn fnf n nnn nf nn fn nfn frrbn rf nn nn nf nnn rfn f f nf nrrb f tf n n f fn fn nn ff ffn nn fnfn ffn f f rff ff n f f n ffn n nnf nnf n f nr n rff fnnff ntf f nr ffn nf nnf fn ff nf nn r fnnn nnn nf nftt nn ft ffn nf fnf ff nnftf ffff ntf nf fnnf f nfr fffn fn ffnf n nrfn rtfbfn nnfnfn nfn n nn ffn n rn rfntbr rrrrr rfntb rfntbr rf ffffrff rfnntbbbbtbbbb frtbbb tbttbfrntb rffrb frnrtrb fftbftbb f rrrtbbb ffr r ttbbb ff rr tbbrfrt rfrrr frrrrfrff r fntbnrn r rf rff f r fntbtrt ntbrn btr r r tbtntb trb b rrtrtrtbr btrrrr frbtrbtrb n tr tr rb rb rttrttrbtr rrrf r rr fntb f rfr n rtbfttr 44 -s A-)Tj /TT2 1 Tf -0.2778 Tc 27.6667 0 0 6 36.3624 469.8639 Tm (Il e -i vAji,' )Tj -0.3663 Tc 13.5116 0 0 4 487.3624 175.8728 Tm ()Tj /TT1 1 Tf -0.1209 Tc 18.8247 0 0 12 243.8624 172.373 Tm (OF AA)-125(',) r., y,Z

PAGE 4

rffn rfn tb bn r rrrrb rtrrr rb n b b r r ft r rb r rtrtn rr t b frn br r bt rr rrrn r tr rtrn rrr n f rb t f t t rn f rfnnt bnbn t fb nnb n t rrr f t t f f tfr rrn rrr rtrn rb f t r rrrrr rtr f t rn f r tt r r rb f b tr r t f tr r r r rrrr rtr ff bt rrr brb rtb n bfftb rn rrb b ftrtt brr r b r tb b rr rtbt f brn rrn rtbrt b rb t f ftrn br rtb rr tn trtb r rt b b t ftrn br b rr b rn rrn rrb n rbt b rr r f r rr bb n rtb r rfrntnbnbnnnnbbffnbbnfrf rrrnnffntnbrrfn r fbrn rfntbbbnrfnfffnbnfffnbbnrfntbbb nfnfffnb nnfbnb ffbfnnb rrf ffbfnnbr ;fr,. IR1 )Tj -0.0273 Tc 7.5455 0 0 10 209.124 1083.867 Tm (" .)-32()]TJ -0.0419 Tc 7.2625 0 0 11 251.624 1085.3669 Tm [(Ilill r IlhI'1 n ii...... .I,.;1I'awn i iprsw907I I 1 I:J. tqVORTEC5.3LV8 AUTOLOCKING LOWESTCOSTOF+ REAR OWNERSHIP OFDIFFERENTIAL ANY FULL-SIZEPICKUPson )105(. 24 MPG HWY SEATS UP 116.4 CUBIC FEETTO EIGHT OF CARGO SPACE

PAGE 5

rff n r fntb rftf fffr ffrff fftf btfff fttfrr t ffn rrn fb fn fftf b ffr tttf fftf nftffr b fnffnfftrff frffrftt ff trftfrf nffrftf ffb r frf fftfftffftn frfttfnbr frfff brf tff frfftrb ffnft rff fnt bt n frrfff frrffb rftff ntrf rffb n fffr ftfffb rfff b nf nfff rf fn rf ftt frftf bfbtb btbff btbbtbb frbftb frftfff ffb r rfntbbrfbtrbrfnt rrbrb ttrbbf r frrnr tbb rfntbnrr fntb b r fttt ftttt fntb b rfntnb f ntnbtftftfftfr ftfrf frffntnb r fn rfnrtbr nrfr rfntbr f rfrnt b b b b b b rfr rfnnbtn r rfntb b r btb fntbrb b t b fbb rffntbfnfrnf n rf frntbbfnfnt fntb b )Tj -0.3809 Tc 23.7143 0 0 3 160.3624 1431.5616 Tm (' e-\ it IIIf I -'-rfr r I1 \aineeenou t yI! ti_a-csDIVINECONSIGNc(lheu2E 7l/zc .CIilcl-, 1 c I>>zcl CT I fNIF----------i---------

PAGE 6

rffn rr fr nt brr nr n tbr rrrrrt br tbr t rrrr rtr n t rr brrrn rr r t bn rtbr rr rrrt rr rrnrt r rr t b tb rt frrr rnrrrt nr rr rr rrr rrt n rrrr rb rr rt rr r rrb r rrt r rr rrt brrr r rr r rr rt rr rrb rnr r r rt brr nr rr rr tb rrrt rn rrrr rr rnt rrr r rr nr rrr r rrt r t rr rrr tr brrt r r rrrt rrttr rr r rr rr rt rr rr rrr t r rn r t r r rr rrr n nt rrr rr rrrt rr b rrr r r rrr rr rt r rrrrr rt t br rrr nt rrr rr r r rrt rr r n rr rr r t rrr rr r rr rr nr rr r btrr rt rr nr rr rt r rr r t r r tr r r rrr nt b rrrt r rt rr rr rr r rrr rrt rr rrtrf r fntb f rfntbftbnbf fbfrtbfttrfn bbbrtf bf rf f bf b t bfftnbtntb fbbbtbfn nbftnbn ftt nb nbbt f rf nt t bbtbf nnfr bbfn f fffr tff f f fffr fff f bftfbbftr frnnrbntn rnnbffttb fbfnnfr tnttbtn n n fnnn fbnbbf bnbtrn bb n fb ntnbfbbf nnbbnn b b b b f btb b bt r b b b rn rbtn n bbfbtbff ntrbf n fnnbr nfb rbtnn r f f rf t brf f bfbtnbft tt tft tbtrnbfrnbtbt fbfbfbnrbrnn f rfnbnbbtbf nttbbt f b ftfntttntf nntfbfntfnn tfbtnfntn nbntffn ntftbfbtnft bftfttf btfbbtnrbn tnrtbbnbtbbt rn f frf f frf b nnbntff nntftbfbtnft bftfttrtbbn btbbtrn f frf r b f rff fb r b f rff f f fb bntrbbfbt bbt f r fb tfb rtn r bffb bffrbb nbn rbbnb nn fbbfbfnrttrff f f rf bf t brf r f bfbtnbft bf tt t n fttbtnrnbfrnbt btfbfbfbnrb rnn f rfnbn bbtbfnttbbt nfrtbfnnn f rbbf b ftfntt tntfnntfbf ntfnntfbtnfnt n b nbntffn ntftbfbtnft bftfttf r btfbbtnrbn tnrtbbnbtbbt rn f frf f frf b nnbntff nntftbfbtnft bftfttrtbbn btbbtrn f frf b f rff fb r b f rf f f fb bntrbbfbt fbbt fb ntfntfb bffn ntfttfbbf nfnntf ntfb nbrn nfn nbn nfbf f f rff ff rf rbfb brnf r f bfbtnbft r rbfb t tt btfbfbfbnrbrnn f rfnbnbb tbfnttbbt rbb f ftfntttntf nntfbfntfnn tfbtnfntn nbntff nntftbfbtnft bftffttf btfbbtnrbn tnrtbbnbtbbt rn f frf f fr fb nnbntf fnntftbfbtn ftbftfttrt bbnbtbbtrn f frf b f rff fb r b f rff f f fb bntrbbfbt fbbt fb r tt r fb nbn bn bbnb fb f rff rf rfntb rf rnrtr bb rfnt bb rf n t b t b b f rrr rf ntb rfrntbtf tfrt ffftrrffntbtrbrffrr r ttbtrfnfnbttbrffbtnfffrb rfb b ftrb rfntfbbfrfrnrftffbb bnb rnr n b b rfr M,QMTGQMERoY'S -)]TJ /TT1 1 Tf 0.0003 Tc 31.946 0 0 33 389.999 1245.1514 Tm [(rCar etsPlusf L,925 I f0 Y em,c Ave. o velm e o hog f Vem,c e 200)Tj /TT4 1 Tf -0.0333 Tc 6.9167 0 0 5 353.1921 788.8541 Tm (TIitl)-500(IIIIIIIIII IIIIIII IIIIIli lilljlll llllll I [IIIIIIIIIIIIIIIIIII,IIIIIIIIIIIIII,llt,,,aootooooooooooooJftI

PAGE 7

rff n r ffnt bfn t t n tf f n rtt r r f f t tt rtff rf ffn f ff nr fn f b f r fft rn tf r rtf n r tn f n r rn nr r t n f f t tff f nt f nn t n t f f t t nt n n n n n rfntb fn ff rfrfnnftbn fbffffbffnnf bffnf bfffffbf rfrrfb fbnffff nfrb f ffffbffnnfb fbfffr frrfbfbn ffff nfrf f fbffffbffnnfb ffnfbf ffffbfr frrfbfbn ffff nfr ffbffbffnnf bfbfffr frrfbf bnffff bfrfftbb f f f ffrfbbfbffnnbtrr f f rfr rfnrtbrrtr rfntb rntttnrfnfrtrnftfbr r fff rtrfr f frfnfnrr rnnbtrnftfbrtfr rrnrnnrnnffrfrr nrrrfrrrr nrnr ft n fnfffrnf fnfnrnf rrfrrffn nn fbb n tt bbbtffrnfrf trnrrrrnr rnrttrn n bfrrrtrnrrftf trftrrfrf tffnrfrnfftff ftfftrrtft tfbf nf tffrnntr nrftrrnf bnrrfff tfnrnrrf f rfffftrfn fffntrfntrfnf rfnrrrtrff frfrf rnrrbbrffrf trrfrtrtrr bbrrnfbbr nrrfr nf bbrfrrnrn nn fnnrnfrrnrrnr frfr tttfffnf ntfftr brfrrrrfrnfnff nfffnffrfn rrfrrnrrfr trrnrbbbrr rfrrnrrrrr bbrtrfnffnnr trnrrfffrfr rrfrrrrrrr rnrfrntffr frfffrnrbnrr fnnrrfnnrr rrfrrrrtrfr nfrffrtf tr rrfrrfnfnr trnrrffffnrnff fffrfftrrf nftrtr n trnf bfrrrf fnrfffnrrf trntfr brrrrtrnrfnf frf tfrrn bfffr rn trtrnfr trnrrfrfff ftrrnrfb tftrnrff nftrrnrfnrff rffnfntrnrrrrrf rftrnrrffnrfn frrnfrffnfrf frfrfrnfrffrfffrn nrnr rfntb n rf ntbnfr ff fffr n ttt btb btt ttt tt bbt r t bb ttb f f rnr LJ)Tj -0.0889 Tc 6.64 0 0 9 34.0218 1081.5606 Tm [()134(J ft f li A LCIS LLGA,I LIB! Lf 1J.^bm11)Tj -0.0772 Tc 14.7383 0 0 23 113.5218 913.0657 Tm (r 11Call 206-1200 to place your ad today.\ r)-191(j / 1r. )Tj /TT0 1 Tf -0.0926 Tc 6.9167 0 0 9 591.261 1258.4069 Tm ()Tj -0.1111 Tc 11.8571 0 0 9 594.761 1257.907 Tm (;)210(TiHIV]',OzOPotS a -B000 O $24 99$7246 E................................... ....................................................................... ................................... .....)-319(........... .................. ....................... ..........S (Tl= S (R=...................... ............. .................................. .auion(TL ki Lo)-41()]TJ -0.053 Tc 8.803 0 0 4 22.5218 851.2751 Tm (J )57()]TJ -0.8928 Tc 29.6429 0 0 4 55.0218 844.7753 Tm ()Tj -0.1458 Tc 6.9167 0 0 4 71.5218 851.2751 Tm (L)124(Y

PAGE 8

rr f fn tbrrrr tbrrr br rf rnrrrr tbbrrr rr rrrrr nrr rrr rf rnrrrr r r rrr rrrrr rfr r rr rr rrr rrrr rnr rf rtbbrr ttfrr r rftbbfr rrr rrf r rrr rrtrf rr rrnr rr frtbbrtr tbbfr rrrrr rrr rf rr rrr rrr rrr rrr rrr rfrr rr rrf rrnr rrr rrrr rrr rrf r rr rr rrrrnr r trtbbr rtbbfr r rf rr rr r frrbftrf r f rrr rrr rfrrfrf r rrrr rfr r rf nr rbr rrfr rnrr rrrf rrrnr rr rf rnrr rrr rrrr rnrr bfrrrf r r r rr frrr r rrrr rrrf rf r rr rrr rrr rf rr rr rrr rr f r rt r rr rrr r rf r r rrr rr f rrr rr rrr rfrr rr rr rrf r f r r rr f rrnr rr rf r r rrr rr rrr rr frr f rrr rr fr rr r r r rrrr rrf rr rr rrrrr rrr rr rrrrrr rrf rrrt rrrf rr rr rrrr rrf rrrr rrr rr rr r rfrr rrr rrrrr r rr rrr rrr rrr rrr rrf rr rrrrn rrr fr rrrf rrr fr brf rr r rr r rr rrrf r rr rrrf rr rrr f rrfff rrrr rrr rrr rrrr rr rrr rf rr rr ffrf rrf rr rrrr r rffr fr rrrr rrrrr f rr rffr rrr rrfr rbbr rf r rr rr frrr rnf rr rfnr rrrr rrrr f rrrr rr rfr r rr rrr f rrrr r rr f f r r rrrrrrf fntb r rrrrr rrr rrrf rrf rr rr f rrrr rr rr frnrrr rf rr rrrr rfrrf rrrf r rfr fr rf r rrnr rrr rrf rf r rrn rr rr rrrr f rr rrr rr r rrrr rr rr rrn ffn rr rf rrrf rfr r rfrrr rrrf r rrf r r r r rbrrr rr r rrbf r rrrf r r r rrrr rrrf rrf rrrr rrrnr rrrr rr rr rf rrrf rfntbr rf rrrnr rrrr rrr rrrf rrrr rr rr rrr rfr rrrr rrnrrr rrf nrrf nrbr r fr rrrrr frnr rrrr nrf rrrrf rnrr rrrr ff rr rrr fn rrr rrr f rrr rrrr rr ffrr bb rr rrrf nr rrrrr rrfr rrr r rf rfrr rr rrrfn r rrf rrr rr rrr f tt n rrr frr rf rrr rr rr rr rf rfntb CAPTAIN QUINN, WE JUST NIT THAT ICEBERG.WHAT DO WE DO?RELAX. WE'RE UN5IN4cABLE!OPPOSITION TO )Tj 0.0944 Tc 9.5502 0 0 11 478 804.0222 Tm [(NAME CHANGE.r/r

PAGE 9

rff n rfnttb f frb ft tt fr t t t t ft f t tr ft bttt rtt brft rttb ft tttf ttbtt ttbtf rt tr tttf tbbtt b tb bf rb tfft t ftttrt f rffntfb fb f rtfb ftf nfbft tft ff b f b f f t r rt b f rtt nf ff b f r r tt f f ttf f rf tttrf bftr bfb tbf ttr f b fttft f t b ff t rb bftf f tb fr f nf fft ft f ff fttt rtrftt rf ntt ft fnftt bftrtt f ftnf bb t f b r rf nrtb nrffff fff nfr fff rr fff rfnff rfrfntbb nffnnrrn rfrfntbntbtbbbbb rf r r r r nt nbf bf nftf ff r rfnttbt rr t fb ft nf nf bt nbr rfnttbb tn rr tf bf nf fr rfntt n r fft n f tf bfb nnt fr rfnttbt bn r bt fb bf r ff ffr rfnttbn ff ff ft fff r rfnttb n r f fn f ffr rfntb n fb fr ftff b nbf rfnttt r nt nb ff bt ff ffr rfnttbt n fb nf ff fb f nbr rfnttb bn r rr nt nbtf ffb f nfr r rfntt b r tbt nt n f ft f rfnttbn t r ntnt nbfbbr fnbfr rfnttt rfntb n rfb nt nbff fbnb frrfnttb n r r f ft bft n f fr rfntt n r f ft nt nbt bf f rfntt b fb r rb fb bnr rfnttbb r f f rf fft nt f f fr rfnttb bn r r nt nb fbf fft ff r rfnttbn r rff nt fbn rfnttbn t rf b f r ffr r rfnttbbb n rr r nb bfff tn b ff bb fr nn n r fbt f fffr rfnttb n VENICE ISWU.w www.veniceisparadise.com I!III;,Ire. i r!IIIl,)-807(!j* b rjai )-11(. I`1 f rsG+)Tj -0.0281 Tc 5.2979 0 0 6 418.329 979.8646 Tm (lltlll0lijljaia,-o1wIN)]TJ -0.0225 Tc 3.1125 0 0 5 530.829 870.368 Tm (+lii+nr' JkL Allooolp? I IIBeachxc I ps.ari41 :Sx..c4r3Sla'N.F'm)87(IP a)]TJ -0.0394 Tc 2.9225 0 0 5 697.829 533.3783 Tm (,.')]TJ /TT4 1 Tf 0.006 Tc 13.401 0 0 16 564.829 170.8893 Tm (AS I SEE 1T!_ ttry' Vy)186(J )5(JlfJ J)-83()]TJ 0.0508 Tc 10.8073 0 0 12 237.3624 912.1915 Tm (TTSarasota County GovernmentAta wMr sa,exCOUNTY CALENDAR Developmental Disabilities StrikeTeam Sept. 29, 8:30 a.m., RoomBoard of County Commissioners 227, Health and Human Services, WORKSHOP TO CONSIDERSecond Budget Public Hearing 2200 Ringling Blvd., Sarasota. COMPREHENSIVE PLANSept. 26, 7 p.m., Commission Call 941-861-2558 AMENDMENT ON RETAIL USEChamber, Robert L. Anderson Sarasota County Planning ServicesFacility, 4000 S. Tamiami Trail, Early Learning Coalition Budget SVenice. Call 941-861-5344 and Finance Sept. 30, 8 a.m., will hold a the public workshop tooLIVE TV and Webcast Conference Room, discuss possibility S allowingCavanaugh and Company, LLP, retail uses in Major EmploymentBoard of County Commissioners 2381 Fruitville Road, Sarasota. Center areas already zoned forSept. 27, 9 a.m., Commission Call 941-954-4830 Industrial Light Warehousing (ILW).Chamber, First Floor, Administration begin at 6 p.m.Center, 1660 Ringling Blvd., Family Safety Alliance Sept. 22, The shopSarasota. Call 941-861-5344 4 p.m., Large Conference Room Tuesday, w wowoSept. till ill bet 27, at ColonialCol OaksLIVE TV and Webcast United Way of Manatee County Oaks Park,Building, McClure Center, 4215 Blvd., Sarasota.Board of County Commissioners Concept Court, Lakewood Ranch. It will cover a Sarasota CountySept. 28, 9 a,m., Commission Call 941-861-2882amendmentPlan amendmentChamber, First Floor, Administration Comprehensive omprehensive redevelopmentCenter, 1660 Ringing Blvd., Historic Preservation Board allow theSarasota. Call 941-861-5344 Sept. 27, 4:30 p.m. Think Tank, of existing ILW within MajorLIVE TV and Webcast Third Floor, Administration Center, Employment Centers with more1660 Ringling Blvd., Sarasota. retail opportunities, without turningCommunity Alliance Aging in Call 941-861-6883 the centers into CommercialPlace Action Team, Sept. 28, Centers. The workshop will focus on3 p.m., Second Floor Conference Human Services Advisory options for including retail uses inRoom, Center for Healthy Aging, Council Sept. 30, 3 p.m., Health these areas. Planning Services willCampus of Senior Friendship and Human Services Building, present findings about the marketCenters, 1900 Brother Geenen Second Floor, 2200 Ringling Blvd., impact of allowing retail uses inWay, Sarasota. Room 226, Sarasota. Major Employment Centers withCall 941-861-2564 Call 941-861-2882 significant amounts of ILW zoning.Community Alliance Nominating Sarasota Partnership for Children For additional information aboutand Membership Committee Kick-off Event-Sept 77,5:30 pm., the workshop or the proposedSept. 28, 1 p.m., Room 2063, Lee Wetherington Boys and Comprehensive Plan amendment,Health and Human Services, 2200 Girls Club, 3100 Fruitville Road, contact Planning Services atRingling Blvd., Sarasota. Sarasota. Call 941-861-1410 941-861-5140.Call 941-861-2561Criminal Justice Commission NATIONAL NIGHT OUT COMING BUSINESS TAXES DUE BY SEPT. 30Sept. 26, Noon, Think Tank, TO URFER FAMILY PARK OCT. 4 Formerly known as an occupationalThird Floor, 1660 Ringling Blvd.,Administration Neighborhoods throughout Sarasota license, this business tax mustCall 1-861-Center, 2882 S. County will join communities be paid by Sept. 30. ExistingLIVE TV and Webcast nationwide for the 28th annual businesses may pay online atcrime and drug prevention event. www.SarasotaTaxCollector.com.Want to know more? Scan this. New businesses should call theTax Collector at 941-861-8300ADVISORYBOARD VACANCIES (select option 3), or visitVistwww, v.netladviso Info@SarasotaTaxCollector.com.scgo ryboards or EA contact the Sarasota County Call Center at861.5000 for latest vacancies and information about Sarasota County isory Boards. Indbiduals wt disabilities who need assrctance to participate in any of these proceedings should roitad the roanty admnistntion at least Net (3) business dap before the meeting time and due at 941-861.5344.Fantastic San2soYOUR STYLE AWAITST"----------------1,Fq-----------------, ,1)Tj 1 0.502 0 rg /TT0 1 Tf 0.193 Tc 64.0702 0 0 4 94.8624 656.2922 Tm (A, ,------------------,

PAGE 10

rfrf ntbntntn r rf rrfnt br r rr ntfnt trrrn brrr rrn nrn r rr r rnt nb nrr fr nnrfnt ntrrn rn r nr rrr n rrn rttrn r nr nr nrrnrrr n r n ntrr rr rf rntbnntbtn nn ntntbtbbt tbbt ntbtntnb bnnt nbtnnt n ntbnnbt bbtnt btnt ntnnbb tbnntnt nbnnbtnn tbnn ntbtbtbtn b fr ntntn tntnnbb tntbbtnn ntbnnnt ntnntbn b ntbt nntbntnt nbnnnn rntbnnb nntbt bnftfbn bntnbtntntn nttfnn tbtntt ntbt ntnnbtn ftbtn fbnbnbbt nbtn nbtntbnnnbt bnttnbb ntntbn nt nbtnt ftfnn ntbnnft tnt nntbnt rfnntb rrfnt brtrbr fbf rtrntr nrrr ff nnr r fbnf rr fr nrr r tbnnr rrbrr nt tnr rrnr nrn trtn rrrn bnn rtnrnr rnrtn rrtr rrnt rfn n rnr rrr rt rrrbn rtnnrt tr tnbbr trtnnr ntn rn rtn b trbrtn nrrrtn rn tn rbnnnr rtrb rnnr nfrt rntn bn rrrrn nnn n rnrn rtrrnn rnn tr tn rtn rnnrrn nnbn tnbn rn nnrr trr nt nbt rrrbrn rbr bnnr trnr nn nrnr tnrtr nr nnrrt rnr brr nn rtbnr ntbrrn nrtr brnr nrrn rrrr nr ttrr nrrnr rnnnrn rr ntnr rnr nrr rtrbb rn r rrn rr rrrn bb n rnrrrn brrtn rr nrn rtnr brn nn rntbb bttn nntn rtrr rrn nrtrrtn rn nt rrbnn rrrn rn nrb bnrnr r rr brrr nn r fr frr nnrnn r bnr ntn rn tr r ntfr fr r nrnn n rnr fr rnnn rbnrt n rrr nrrnr r rrrn trrr rnrrnnr nr rr bbr r bb t rn rt trt t r bnr rrnnn rbn t rr nr br rtb rrn rr rttrr rrn ttrr rrr nrrr tnr rrrn fr rn rnn nb nrrr ntnr rtn r rr nn r bnr r r nr rr rtn r b brn rn r bn nr nt nnrr rnr tnrt rnr rr nntrt n rr nrn nrr nrtr nr ntfrtn r rn rr brn r rn r nnb rntr n r r r nf rrr n rbr tr trn t r n tn n rr nrr nrrrr rn tr rntrtr rtr trt brn n rr rntnrrfntbtrntbtr tbtbbttbbbtbtttbtbt tnbtttbbtttbr r tbttbtbtbtt ttttbbtttb btttftbtbtbtn tttfn rf nt bt tn n rrf ntbb rfntnbtb bnt nff bbbt rr b r b f ff f ffrf tn t n r rr b n r rr b

PAGE 11

rff n rf rntb b f f bt fn f ffrf rf b f ff f f f f f r fr rf fn rf fb nf f rf r f n f n f f ff f f f ff n rfnr rff rfr b n fn f f f n ff f f r n rr t rrf r n n f rfb f n f f f f r ff r f f n f rff ff t f f f f f r ff n rf r f f f f br f r f f tn rf ntb rf nrtnb f fnrtnb ntb nrtnrb tb rrtr rb f rr tnrtnb ttt t n tn n t rr rt rrbrt rr bfnrrb t rt r r r rtfnrnr r rf rn ffn f r n ff ffr b f f ff n r rr rffr f ff nf ffr b ff n rff r bfr r f r f f f nr b fffb b f f f ffr f f n f f f t n tn fr f f n f r bf f b f f r tn ffb fr fn fnf f ff f f r fnb t ff nbrf t f ff b n f n f fnb fn rfntbfnntft r fntbtn fntbtnnrfntnrfntbftbbn rfnrtrbtbr rrr rfntbbbrfntnbf nntntn frtttt tf rr rfrntb rfr rfntbftnbnr rbrbfnt rfrfntbbfbfbbt rfrfrntb tftrt rf ntfbnrbrtfb nbnrrbrbfnt

PAGE 12

rffn rf rn tb n tb rf f f b t r r r ff f r t r f t r r f t rr n r f r trf rr rr b r tf r ff tf f r f r rr r r f r r tf f t t r rr r rf r r t t t rr rrfntbtnnb rfrfntbrf rffn tfrbbff f fff fn ffffrfrr fff rrbn ffffn rfff rnffrn t r fff f nf rfntbnbtnr rfrntbbfbfnnrbnbrn bbbbntbbfbbbbtbtbbntbtb rfntbn nn h 1 I I I Ijam' x ,)Tj -0.2976 Tc 14.8214 0 0 6 464.0327 560.6114 Tm ( )Tj /TT1 1 Tf 0.0087 Tc 4.3229 0 0 6 480.0327 542.112 Tm (_ )Tj -0.2568 Tc 10.6163 0 0 6 567.5327 554.6116 Tm ( .r ,F. _V!S!t OurFabulous NewModels!Visit Arlington Cove Today.abulous Florida Living WhereEverything i Close to Home.Close to Manasota Beach and Englewood BeachMinutes from fishing and boating access to Lemon Bay and the GulfIn close proximity to a variety of shopping in Englewood and VeniceF, ceze 1 557 5F The proven quality service and integrity of Neal CommunitiesNew M inte n e-I I eP ire Will s Fr m Ml $1 Os)154(_I Bohan Ar :r, MD E Dea.born Stirgeon S.McCa Rd 27201 psw ch Dr ve Eng ewood FL 342239 175-1 98www nea commun t es comCENTER FOR SIG NEEFTFT qCSC 1256375 SOUTHWEST FLORIDA'S MOST EXPERIENCED BUILDER1AVOW--N-00'rAW-N iA A ho iCosmetics ImplantsGeneral Dentistry Facial EstheticsDr. Jill Morris Dr. Burr Bakke No Prep Veneers and Affordable ImplantsLumineersTM Implant Surgery Smile Makeovers Teeth Today Implant System Headaches and TMJ Pain Extractions and Bone Grafts Six Month BracesTM Implant Restorations Facial Rejuvination with Cat Scan in OfficeBotox, Dermal Fillers, and Lasers Non-Surgical Treatment forGum DiseaseSEMINAR: October 27, 201 1Learn more about the newest techniques in general dentistry,smile makeovers and implants. Call to reserve 914-9344fillMorrisCosmetic & Imp'anti.-.-iRestorative Dentistry Rest,,3951 Swift RoadSarasota Florida 34231941.914.9344www.SarasotaDentist.com Use your smart phone to scanhere to visit our website

PAGE 13

rff n rfnftb rnf brf nnt tbt nf rtbbr tb fbrf tbntb bn tbn rtbr t tb ffn tbr tt bnn r fr n f rt b r tbb bntbbtn bt bnb nn r f n bbb bn tbbtnbt bntt r r bbb bn tbbtnbt bnb r f r rn fr f r t bbb bn tbbtnbt bnn r r ff bbfb bn tbbtnbt bnn r n r r t bbb bn tbbtnbt bnn nf r frt bbb bn tbbtnbt r ftbttttttttrr tftbtttttttttttttttttrfrntn rftbtttttttttttttttttttttttttrbtf rbtttttttttttttttttttttttttttttttr tbtttttttttttttttttttttttttttttrf ntftbtttttttttttrr btttttttttttttttttttttttrfrn ftb f n ftfnbrf bt b t t t t t t t t rfntbnbbbbnbbbbnbbbbnnbbb nnbbnbbrrnbbbbbnbn rrrrrfrrrrrnrtr rfrntnbfrbntff bbb b trr t tr rt b b trr t tr rt brrfntb rfntbbb b bbb bbbb bb rtft rf nntrnttb -Av JIMk to OD D LM1AJVILILI U LILTTot4NowS77 sIlk)-127(V 'YYM1 1 'IIfit -:\.Nod= )163(') ; -. (0 (0 1-)-16(, (0 (I) )Tj -0.0496 Tc 11.6719 0 0 17 653.5327 125.9313 Tm [(') '? 1Ia (I iii"' // /

PAGE 14

rffn rfn tbbr rbbfnrn fnnn f bfnrn fn rffntffb bnrfft f ffnrn fnnrrn frf fnnrr rnfn r fntbb rbn rfntbnftb b bnnf n bnf n n rfnf ntntn nnf tffn ftntnnbfbnnn tntn fnn ffn nbfbnnn ttf tntn ttbttbnb r r r nbt r ffrbbfnrn fn ftt nnn r r rf r r r nnb nbn t t Ru1' )Tj -0.0952 Tc 11.8571 0 0 6 137.5327 1453.5609 Tm (' )Tj -0.0198 Tc 0.9881 0 0 6 142.0327 1464.5606 Tm ( 42 yJ. m p o a o 0irkH0 IIHUIDU HERSfl11311 E II K i DO HIMENEHam?,Domma 1LmttIII_-.LF)]TJ /TT3 1 Tf -0.0066 Tc 2.1842 0 0 4 528.5327 558.5882 Tm (yyll^ Ws,y' `I

PAGE 15

rr r f ntb rrr bt rf n trb r nn rn n fnn n frn rn tn n nr t n nn n nt tn n nt nttn rrn n nn n nn rn n nnrr nr nt nn r n r nt t n ntn rr ntrn rn fn n n t ftn t nr n fr n n t n n nt n n f n n tn r n nr tfr nttn nn nr nnn tnn rrn nnn t n rt n n n nn n rf n t r nt n nnt n ft tntn t tr ft tnf tn nrr nn nr tnr n rntr r nt nrn fnn trr nn f n nn n r r nn nn rrntn r nn n r n t nr r n rtn n n tr nr n f tr rrnt t nnt nn f n fn n n n n ftrn nrn frt n r nftn n n t rn n fn rn r nn nn nnn nnt n n tn n nn n nnn n r nr nt nn n nnrn fn tr nn r r tnr r r nr nn t fn nt tn nnt nt n t r n n f tn t nn r ftn nn nt n n fn r n n rn r t f rnf n n rnnn n r t f r nn nnr nr f nf nnn nn nn nt t tr nr fr r r n t r r nn fnn t tn rrrr nrn n t n r rnt nr r n t tn n nr nt ttr n n rf tn rr t n t n tnnn n t tr n n rtn nt n n nn r n tnt n n nnr rt tn tnn r tn nn rrtr n t n n n t nn rtn nnn rrtf tn n n n n nr rtn t r nr tn f tr ftn b r n nn fn r rnn r n n rr tnn nn n n tn r tnt r ft n rn n r r n rb r b rn rffffnt bfn ffff rf f rfr fbf brf nfrff rfrnrtbtbr r bb fbr rf rffn tbr bn t b rfrntb rfntbr rfntbnrfrrrnnnn rfntbbtnffr rrfn rfntbbfr tnb fr trrb nr bn b mj (iw.; nvRiehs,r sl

PAGE 16

rffn rfrntb ffn rrrb fb nn rnf br nn bf t nr rnnr t ff nn nff rnftf nfr rb n nbn rnnr fbn rb tf rr ff nfff rnn bff fnb fbfffr rn rr r fnn nb rtff rrr btffb fnfrnb f f tfrn t nnfr tf f n nfb b f nff t tf tr btb ff fff f rf rf rrbff t tf fbf ffb ff rnn tft tft nfrfr f bf fbnf r f n n frnf nn ffbbt r tbn fb f n r rf n fbrn rnfr nft rnfr rntfnn n fbnff fn f nfr nf nfr r fr nrfb n n nfbr ff frnnfft r nfrb f frr r fb rffbfb r nr nfrfffn trt rtntr nr rtn rntbrt b n fr tb tn fb rffb bnffb fb fr n tnr rn tf tf frn rff rb ftrf f n nrnrb br brr bb f rbn rb nrf fr bnn r n tfr r r tnr fr n nn fffr n f nn fn nftrr rbn r f fff fr rn r nf f nfn nrn b bnf rrnr ffnfr nfr nrfn rf nrf r nfb nf f nr nffbfr rtf nrnb fr rnrf rrffbr f nrn n b fb fnnf r ff fbn t n nf ff fn bffnb bf nb nt n ff nffn rff rfrffnrrtbntbb rff n rffrntrbff r f n n t b r r f f f b rnrrtnrn rfntbrfntbnb ttftn rfnttbnnnbnrbnnbb rffntfttbrf rftff f f rftrf fttbf rr tr r fntrbrrbr frbrf rrrn rrrr rrrrr rrrrrn rrrrrrr brrrr fbnrrr rrrn frrrf brrn rfrrrr rrbrnb brrrrr rrnrrbb frrf ntbrf rbrrn rrb rrn r rfntb b b n n 1SupS)-14()119(t _601' ^N,110160')Tj -0.0714 Tc 0.506 -0.286 Td (.} W)49(rt)49(' 8)-50(f)72('0:)-26()]TJ -0.1137 Tc 7.9468 0 0 8 549.8447 980.0141 Tm [(:o[i'Advertising with the-4 bPAPERSreally works.af,d CH)94(ISEHORSE Manor.' Hcnwtr and PropeWe are donating 100% of fees for comprehensiveexams and x-rays performed on aill new patientsthrough 10/31/11to the AmericanCancer Society.

PAGE 17

rrrf rfntbn rfnrtbb rb rrfb rbbrn rrbb rbrnbb bb r r frnntnftrr rb rr b rbr bfbbrr bbbb brrrr brnb tbbrf rbr rrrfb n r nnftrr brb rrn rr bfrr rr rfftftft b rrbrrb tt rfrb rb b nntt rtbr rbbb rrb ffrr b rrb r rbnrr rrrbfr brfrbbr ftf nff r b bbfbr bbnbfrrf brnb rb rrbbn bb nbrnb nnfrr tbnb rrb rrb rnf rbn tf btrnr b rbfrbrnr bbbrrr bbr f ftt bbr r bb rbfr n bb ftff fnr brf b rb rbrr bff bn r brr tt bbr r bb tr brfrn rbrnbr rb trrrrr rrbf bn ftf nffr r rb r b bbfbr bbnbfrrf brnb rb rrbbn bb nbrnb nt f rb rb n rrrbb rnfrr b frrr fr nbb bb rrr rfbb bn tr tnfbt tftf r nbbn rrb nbbbb rrbbb brnbbr brtbf rbnf rffffn tfnt rr r b br bbr brrrbr fbrrb bbrb frrb r rrfr bb bbr brb rnfr n bt tbnb rrb rrb b rrbrrb nft rb b b frr frr r tnfrf b rbb bb rbrb rrrbb rrbnrr t nfffnr bbnb r rr rr rftf nff r b bbfbr bbnbfrrf brnb rb rrbbn bb nbrnb nfnftr r b bfrnb bb nbrnb ntttr b b nrrr b rrf br r rfr rnrrrr brrr rb tfttnfr r frrbrb b rb btrn ttnr nrb rfrfrntrnbrrf rnrrrtrrrrrrr rfrntrtrrnrrfrnr rrrtrrnrtr brrrrtr trr ftff nf b rrbbb b r btrfr brbr brrbb btrrbr trrfrbrb bfrbrf rbbbnbb b bbrr fttnr bb b tbbb bbrrrb bnrr rf bbbb fbrfr trbrbr tfb nr brfrn brfntbb brfrb nrbbn bnnrr rbnf bb b tbrb r tt ttfrr brb rrbb bbbrb rfrrr bbnbr bbrb brbbrr nr rr r nrnr b b rfntb rrt ttb trr b b rr frnr tbbbt

PAGE 18

rffn rfrnt btn r rnnr rrt nrn rrr r nr rn t r nrr n t r rrnt rn r r n rft n rnr rr rrnnr n t rrr fr t ntbbn n rbrn t n nnr rfn nnnnn br n r rr rn nrr brr rn r nfn r r r rr rn nr r r tn rnrnr rrrnr r nrnnn rnrn rnt r nrn rn nrr rn nr r rt trnn nnnnrrtrrn nr rn r rr rn nrrr rr tn rrft t r n rr nnr r r nrr rnr rrrn nrr nrn rrr trr r nnfnrr r brn t n nnr rfrn fnrnrt rfrn r r rfrn fnrn rtr rrn rfrn r rr n rrrr rnrrnt rn b r n nrr rfrn rrt nrf r nrr n t r rrnt rn r bf rrbrrf rt nnrn r nrr n t r nn nn rt rnrn nr r rrfn t t r r r nn nnnr n t r r r n n nr nn r t rnr tn nrrr nr rrn rtnnn n rrnr n nr rnn n nnnrr nt n nrnnf tnrn nnnn rrnn nntn nr n rb r rn nr r tn rnrnn rrnn tnfn rnnn rrf nn rn nrrnr b rfrn t rn rrnn nnnr rrtnnr nnnrn rnnrn r frnrr r rf ntbr fffftbr b rr bb f bbrfnf r bt b bnb bn rb bb tbf b t bfb tb bnb bb f rffntb f ff bt b nr r b brntbfbf ff br f r n tbftr rtrrfr fbnb rfff tr rr fn fn rff tbr ntbrb nnb rrb ntb rbfr rrbr nbb tnt rb rrfn f rftfb bff nnn rb tb rfn rff tn ffnb fb bf f fbf fftt nf nrn f nb tbt t brbb b f r b fff bb bt b bt fff t tb t bff tn ffn rf br rfnttb rrfn tbf ttnrf rrrfrnfrtb rf nf tt tfb t r frntfbtr nfr btt frbbnb bftfn bbbnrbttb bbfrtb fb rbbn nbb nntn b nbbf n nrbf nffbf brn rbnntnfr f rfrnrntbbfrrf rrfnbnrbtrf rfn tfb r tfbrb rfrftnrr rf rfrrrf The Power of One presentsAn [vening w> \VtndDancerfooor1 )Tj -13.41 -0.917 Td ( )Tj -0.1587 Tc 7.9048 0 0 6 19.4535 205.1748 Tm ( )Tj -0.1587 Tc 7.9048 0 0 6 19.4535 199.675 Tm ( )Tj -0.136 Tc 7.9048 0 0 7 19.4535 193.6752 Tm ( )Tj -13.41 -0.786 Td ( )Tj /TT0 1 Tf -0.1395 Tc 7.7209 0 0 6 19.4535 78.6787 Tm ( I1)Tj 14.642 0 Td [(-)]TJ -0.1587 Tc 7.9048 0 0 6 19.4535 55.1794 Tm ( )Tj -13.41 -0.917 Td ( )Tj -13.41 -1 Td ( )Tj -13.41 -0.917 Td ( )Tj -13.41 -1 Td ( )Tj -0.1587 Tc 7.9048 0 0 6 19.4535 26.6803 Tm ( )Tj -0.1667 Tc 13.8333 0 0 10 164.3899 145.6766 Tm ()Tj EMC ET

PAGE 19

rff n rf ntbtttt t t f ttbt tt r f tbb bbtt bt tfntbb nnb t t tt bt tnt ff b bt tb b nttt tbb tt tt bt t ft ttbt btt ttb ntt r t tt t ttbnt rf tt ttt tnnbtnrff bt ttbb frfrf rf bt tt tnntrf rb t ttt tt t bttt tt ttt b r rfn tntnrttn ft fbrf nnr tr nr ft n ttttt frt ntt fnn nn nnrtr nbr rr r rfntn nnn r nnnr tnr nt r ntn tb fnn n t tntf r f ttt nnf tbf fn nn rr nrnt f r tt fn rfntbfrf nnbfb nn ftrn nn t n n n f n f ttt nnbn n frtn n nr ttntn nn n f rn tf f nn nt t b r nf tnn nr t t n nrnb nr n r f nntn r n rfn rfntrbftrffftfrrfttftrftfrf ftftftftfrtftfbtttb rftfbfrfffrbbfbb fttrrffbfttrt ftftb trftfr ftfrrf t tftrf btrftr f fftf rrf ttftr ftf t tft fbb rffbfttrtftfbf rrfttfbtfttrrftfb ftffftffrf ftfffftftb rffntb rr r f f rrrrrrr ntrr bnrfnnrrrrf nfnr fnf n rfnfnfnff rff ntbn rrfr ntrbr rn rtt f nrb tntrntt ttrtrn tr frnr trt rrfrr fr rtfrr nrt rnr rtrn rfntb rfnn ftnb ffrt nffntnb r fnnrtbttrn fnt brt btnnfnnfttrfntbb rtbftbbftrfntft rfntnbrf ttbrnbrrbbrrft i mmmommomiter,` M.4. ras)-152()]TJ /TT2 1 Tf 0.0352 Tc 31.9754 0 0 32 492.7161 497.1462 Tm [(tom g3 'Bella Vita HORIZON BAYIndependent & Assisted Living

PAGE 20

rr f ntb rrr bt rf ntb rf bftt ntnt fn bfttt nrn rfnt rf rrn rtnb tnb b nb r rn b rb n tn b rr r b rnb b tn b r r t tn tn rb r tnr rr b r tnbn ntn b r r b nb nb rnb rrn brb rn n rb nr n n rrrrn b n r rrn rr n n n r t n b n n tn r n r n r r r ff r bnb rr r b nn nbn n br r f f rr r rrr n r nr n n n rn r b n n rr r nbn tn n t rrff rfntfbbbfb b ff ntfb bffrf rbbnf bfrbbf ntf ffrb fbnntbn b b n nbr rn nrb n rr rr n r bb r nb n b r rrrn rb r r nrrr nn n br nr n br n rnrr r n rn rnb n r br r rrrr r r b rrb r nr rb rrn n nrr rnb nr nrfbrr rf rffn tb ffff fff rfntbf ff f fn rfrntbr fntntbnr tr nrrtr bfntb ttttrbftrtnt ntf tbnt rnnrtnnr nt bbnnrtbfn rnrrn bbrftbfff btt nnrtbtrttrr trt ntr ff ntbtntbnttttn trrtftr trtt nnt rf ntb

PAGE 21

rff n rrfnt ff bb f rf bff n r rt rbbr fr nn b b n t r rn ff rbbr f t fr bfr r b n rt f ft nn bfr b bbr br br rnf rr fbb bb rb n ntnf bb f f n ff r bf t bf bbb nbn r bfr bbn n tff br rr f nb rn r nrb b ffrr bn rf nrr nn bb b f b tn ntn r n bbn ff bnf n r ff b bf f r n f ff ntr f fb bf f bbnn fn nf n nrtn r b tn n b r br tnt r rt tnff rbb fr ft br bf rr n n nbb fr f rfnn rn ff r nn b fbr fn bb brf nff bb fb rr bb t bn bbn r fb b r r bn r fb bf n nf f t fnb b n rrf n ff b f tnt b btt bbn bbn ftr fn bb b bt bt f fnf nt n ntf bb nb fbb btt nbn n f f n rrn nb nrb n bn bbt f f bt tt fb bb b bf nb f b bfb f n nb bn rf f ntb n nb tf rr bb bf r f bfn bbn b t b nb n bbn n b f bn ff bbbb rn bnrf nf fnn fbfb bn nb r b f nff b ntn rn rt nfb f nff bfb nn n rn b nt rf ntbrff ntnt t t rf rf r fffnntbfbb tffbbf r fntrntb t n fb t f f r t tt n f nt rn f t t t t t n n t tn rt t n n n fn n t n fn t t r rfntfb bnr rfffntbt rf rrrfntbrnf tfnnnntbbtf f F 7I II I II. JVENICE REGIONAL,MEDICAL CENTERThe best healthcare under the sun.Idiamonds : goldMurphy Beds, Custom Closets, PantriesHome Offices, Garages & Laundry Roomsmores laceSarasota: 7418 South Tamiami Trail 9270807Bmdetore 1847 Lakewood Ranch Blvd 53&6574Port Charlotte 1808 Tamian,i Tail 613-2797sales?Mores ace8eds.com www.MoreSpaceP[ace.com=O-El

PAGE 22

rffn rf ffntnbnfn ffnntf nn fnf fnnrf ntbt tn ntbt rf ntfb f t nb t f b r bt rft r tt t rft r rr ttf r r b nt rt t f t nft tf f t t t bt r tbt r t t r f brr f t ft r r r n t r t tf rt r f t fnb t tb tr b trf t ft nft ff t frr b r rf ntbr rrr r r rrr rr r frrrr r rrr rf rn rrrntbnnn tbtnt bnn ttrt r r nr b rrtr bt t t ft brr n rrr t r rr rfrt tr ft rfnttt br tt trbt t tr ttbf trr bbbfrbtff r tfn r trr t rbttf ttr tt r rbtt tf b rt rr tb ttbtt f r tttt bbbfrf ttr tt b t rf r fntnnb t r t rrfntbf btf rfntb t bt btfntbbrrfntbn rfn ntb rfntbr rf ntbfrfrrfntrfb ft fnft rrfnbr fnfrrtrb rfnftbfbrfrfrtr ffftffft rfftrbbtrfffbtf ffffftftfr tfrfbtfrrbfr btffrtff frfbtrftfbrtff rffbffr rfnt b rfntbb HARBORCHASEAssiscc fig, & Ski led NLrsin,Qa_.Si

PAGE 23

rff n rf ntnnb tt b b tr b bb bbtr t tttb tbr ft t rb nttb bn r b n br b rb tn n brf r n tbr t nnn r brrn rn n r bt ft r ft rftb nt bb nnb bn bbt b br bbt rn tt nrt b r tbt t trtn tnt t br bb n trbb nb tn bbr n nt tn b ft brr nn b n r b b btnbn r t tn nr tnnn r t t n r nt t n n r n ntn nn tbn bt br tt nt tbr brr r tb btb rr nt t ntb n ntn nfnn fr rfnt bnnrfnn fnnfffnt fnrfnffnnt fnfnnff ntt fb nttb nttnr brrn r fnn t ntr fntbt nn r tr n n btn tr nnt tnt tnt n b r nbn n brr brt brr fb n bbbn t r n nr bbb nb nbtn btb nt br bbbtt tt bn nntbbn tr n rbrr nnnb tt nnb tb nn bn r b br fn br fnb n tn nbttn n nrnrr fn br nbb ntn tnr ftr b n nr fb nr trr fnn nbtn ntr n nn nrnn nb nr nrn nb b bbnb tt ftrrbrr ttrr brr n nn n rrfnftbnrtf Thousands Rebates and Credits Tax still available!Buy now and also receive a$1,500 Sarasota Get Energy Smart REE 3-year Maintenance Plan.$1,000 Maytag Rebate 0&x$300 Federal Tax Credits$1,510 FP&L RebateUp to$4,310.00 OFFa new system purchase.IIIIIIIIIIIIJIIIIIIIIP'lllll''llllll II NIIIIIIIIIIIIIJllllllllllllllilIIIIIIIIIIIIIIIIIIIIIIIIIIIIIillllllllllllldllli I.IIIIIIIIIIIIIfllllllllllllllllllllllllllllllllllllllllJANaERSON IIIIIIIIIIIIIIII IIIIII1111111111111111111111111111111116Service for Home & Business 111111111111111111111111111111111111111611111111111111111111')Tj /TT3 1 Tf -0.0126 Tc 27.949 0 0 28 291.7798 62.5501 Tm [((94 1 ) 488-9633 Manufactured under license by NORDYNE, O'Fallon. MORegistered Trademark/TM Trademark of Maytag CorporationWWW.AndersonAir.com or its related companies. 2009. All rights reserved.CAC1814718 CFC048275 F:R0014451 CBC1253491 CODE: SUN

PAGE 24

rr frnrrr tbt rfn tb bb rf rfnt brr tr rf f tr r f f r f f r rt r rt r fr rrt r f rrf r t r r f t t f nt brr t rf rr rf t t r f rt f rrr r f rt t r r rt t bfrff t rtr f tb t rbf rt rrf b rf rtf rrfr rfr rrt bt t r ff tbff f bfr r ffbtrft bf rf rffr rt ftt r fftb r rffr t f rt rtt rt fr f r tf ft rr ff b rt rf bttr t f rtb t r ff bf rtr f rf tb tr fft b f nt b rtfr ft r fft t f f r rr r f r trr t rtrr ff fft rt rf r rrf rrf f ff rtfr ftr fr t rf ft r rt ff ffr t r r f f r f r rt bt rr t r t tt t t fn ff ff ffn rtb t tr tr rf rt rt rtrt nrtr bt ff rrt ff f b ff rt f rrf r r t tff tfff tb f r fft ffff b rt ff ff r rt tf f frf t rt rt r r t ff rt bf t frfr f r ff r ff r r rtb fr ff t tr trr bff frr rr rrf rtr f rf t fr ft r fftbft r nt r nfb r t f rr r rr ff f tr f ntbt t r rr r rbt bfft r f f f t rtr tff ffr r rbft rr rf ft b rr ff r ffb bft f r ntt t r r ff rf tr f r ft bt tt ffbf rr f t tb t ff r f rf r tr t rff r t bf rf f rrf fn f ft fft r r rr r t ff ft bftr ffr btr nr rf tbft ffff n f t rf t t r f rr r f rt f f tf tn tff frr r f rf rt f t rf rrr rffntbn rffntbn rffntbn rffntbn rffntbn rffntbn rffntbn rffntbn tbn tbn tbn tbn tbn tbn tbn tbn t tt t t tt t r r r r r r r r r fntbnf r r nr br bnn bnr fntbrnn n rf ntb f r rfrntbr r fr ntbbbbn rtrt rtrt nrnnnrnn nrnnrfnrnnr rfntnbrnr rnrrnrttrrr nnbfrr rfntbr rnrfbfbt r rf fnr r fntnrrb rfr nfrfnfb n rnn bbfr rbrnn nr r rfntrbrrbrffffnbrbrbrffbbbr bb rfntfbtfrtr rnnrb r fntbnnnrrnnrfnt bfn rfntbrbnb bb rf ntbrff fftff rf ntbbtnfrf I II IEm BMW "Venice United Church of Chest-New LifeCOMMUNITY CENTERhome oP 9?ew -46e j4ssemb/y of r?odI IVENICE BIBLECHURCHLoving God, Loving People, Making DisciplesThere's somethingfor every member of the family!SUNDAYS9:00 a.m. Bible Classes10:30 a.m. WorshipCHILDREN YOUTH SMALL GROUPS493-2788www.VeniceBibleChurch.com2393 W. Shamrock Dr. (2 bucks webY of US 41)

PAGE 25

rff n r f n r f f tttttttttttrfnrff rf fn ftb r r fr nfr frt f ff f nfft f rr nt r fn rt nfn nr nn ffrf nt bf n t f rf ntnr fr fn f frnt fn n rr fn frtb frn n fn fr ft rfn tbtt rffntbbbf fnff ntnff rnftrfrntbrbn bnf nn nfr nt bf ffr ff fnnf ff ffff rfrt ft frfn r ff f f tntf tb f t tnttnttnt tntn tbfrfn ft f fn ff tntbft f ffn tff ff r n frnt bff nf ft f ff ff ff fnf r ntbfr r fff ftb f ff f n tntbtt bfrfnft bnf rn r tntbtt bfrfnft tnt bft f tn rfr f fftb frfnft rffnf f f frn ft f tbntrbbn nnn rrn r fn f r fnff tf ft ff t bfn ff f f bn rff ff ff ffr f nn fnft f fr n nff ffn frf tf n nn rff ff nf fntt f fnf fnt fbf tt bf f frf f bft rfntb r f r f r rfrfrrfntbrttn tnn trtnttn r rfntb f n rfntbr nr nr frr rrrfntb rfffrntrbfff bbb rfr rf r ntb rf ffr nrtbb rf ntbrftrf rffrnttbb rfffntbntnnn n rfn tbn bbfn bbbbn n rfnf tbfrrf ntb frbn rfrtnb n bbn V4 )27()]TJ -0.0216 Tc 3.9524 0 0 22 138.9535 443.7989 Tm ()Tj -0.0519 Tc 23.7143 0 0 22 146.9535 445.2988 Tm [('.0 0ANNE TII I N THE CLAOSIREDO CALL (91) MUMAUTO DR ECTOIRYAmodam AuW40-ae1 a1i )Tj -0.6428 Tc 35.5714 0 0 4 398.4222 273.6203 Tm (l )Tj -0.1733 Tc 21.58 0 0 3 711.01 763.6873 Tm (f1

PAGE 26

rr frnrr tbt rfntrn bnnnf nn rfnrbnbfrnbnnrnnnbfnn nbnnnnnbnn fbfnntbffnbnnbnr nnnnnbn nnn frbnnnbn nn nbnfn nnnnbnnf nbnrrrnbnn nnnnbrfn nnfrn nbn nrnnnnbn fnbnnnnnnb rfnfbnfr ff ffnbf nnnn nnrnrfrrr fnrbnnbrbnnr bnnrn f nrrfnnnrnbbnrbbnbrrr rrbnbrnfnbfnb nrfnnnnbbnnnnbn n rfnbn rrnbnrnrnb nnbnnf t nbnnfnnf rfntnb nnbnnn n rfntb rrrfnt b n n r nnnt 'Addmmbkhhhh,,O 0 1000 00o00 0ON THE ISLEEVERYDAY'S A NEW DAYJVILLAGE

PAGE 27

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 1 Ends9/26/11. Allpricesandpaymentsinclude$598.50dealerfee,plustax,license,titleandaccqustionfee.Allpreownedwith$5000down72months4.9%APRwithapprovedcredit.*Leasebased on36months12,000milesperyearwith$0downpaymentsubjecttoAHFprogramchanges.Basedon2010EPAmileageestimates,reectingnewEPAfueleconomymethodsbeginningwith2008 models.Useforcomparisonpurposesonly.Donotcomparetomodelsbefore2008.Youractualmileagewillvarydependingonhowyoudriveandmaintainyourvehicle.Allofferswithapprovedcredit. 800-507-1256985S.41BY-PASSEnds9/26/11. Allprices&leasesexcludestax,tag,registrationandtitleandincludedealerfees.Leasesbasedon36month12KMilesyear,$3000down. Prices/DiscountsnetofallFactoryRebates/Incentives&FactoryValuePackagediscounts.*Allpreownedwith$5000down72months4.9%APRwithapprovedcredit.**0%APRonselectmodelsinlieuofrebates,termsmayvary.Allpicturesforillustrativepurposesonly.Allofferswithapprovedcredit. 900S.41BY-PASSTOLL FREE 800-507-1498 CramerHonda .com CramerToyota.com TheBestNewCarsMakeTheBestUsedCars! SHOWROOMHOURS:Mon.-Thurs.9am-8pm Fri.&Sat.9am-6pm SUNDAY11am-5pm PAR TS/SERVICE/BODYMon.-Fri.7:30am-5:30pmSaturday.7:30am-1pm SHOWROOMHOURS:Mon.-Thurs.9am-8pm Fri.&Sat.9am-6pm SUNDAY11am-5pm PAR TS/SERVICE/BODYMon.-Fri.7:15am-6pm Saturday.7:15am-4pm SIGN Drive!& 2WD,AUTOMATIC,A/C, POWERWINDOWS/ LOCKS,CRUISE,KEYLESS, VIN#7645 28 MPGHWY $249/mo.*LEASE FOR SIGN Drive!& 2011 Honda CRVLXOPENSUNDAY11AM-5PMOPENSUNDAY11AM-5PM AUTOMATIC 34 MPGHWY ALLREMAINING2011TOYOTA INSTOCK! CAMRY XLE s 0%APR**VIN#9356 COROLLA LENEW2011TOYOTAAUTO,4CYL, VIN#6899 0%APR** OR $ 99 /mo 39 MPGHWYLEASE FOR $ 4500 OFF MSRP! OR 8527508 $2,000 36 25% Ford 500 SEL Aut o, Fu ll Power, A lloy Wh eels. Leather, Power Seats, Premi um St ereo. $ 6,988 Toyota Venza V6, Fu ll Power, Aloy Wh eels, Local One Owner Trade, Wholes ale Pri ce! $ 21,988 Or $ 259 per mo* Nissan Pathfinder SE 2wd, Aut o, Power Wi ndows, Locks & Mi rrors, A lloy Wh eels. $ SAVE $ $ 12,988 or $ 129 per mo* Toyota RAV4 Limited 34 MPG! Leather, Premi um St ereo, A lloy Wh eels, Li ke New, One Owner. $ 16,988 or $ 189 per mo* Honda Accord LXP Only 4K Mi les! A ll Power, A lloy Wh eels, Li ke New, One Owner Trade. $ 18,988 or $ 229 per mo* Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 Toyota Matrix 36MPG! Aut o, Fu ll Power. Local one owner Trade, only 17K mi les. $ 15,988 or $ 179 per mo* Pontiac Solstice 5 Sp eed, Leather, A ll avai lable options, only 18K mi les. $ 16,988 or $ 189 per mo* Honda Odyssey EX Dual Ai r, Fu ll Power, Local one owner Trade. 42K mi les. Great Fami ly Vehi cle! $ 17,988 or $ 209 per mo* Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 Nissan Versa S Only 42k Mi les! 35 MPG Aut omati c, Ai r, AM/ FM/ CD Af f ordable Versati li ty. $ 11,988 Or $ 109 per mo* 0 Honda Civic LX 36 MPG! Aut o, Fu ll Power, Local One Owner Trade. $ 15,988 or $ 179 per Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 mo* Nissan Murano SL Leather, a ll power, premi um st ereo, a ll servi ce records, below wholes ale! $ 17,988 or $ 209 per mo* Toyota Highlander 4WD V6, Leather, Fu ll Power, A ll Servi ce Records, One Owner $ 8,988 Honda CRV EXL Only 25K Mi les! Leather, Power Sunr oof and Seats, A lloy Wh eels, One Owner Trade $ 19,588 or $ 239 per mo* Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 Buick Century Custom Aut o, Power Wi ndows, Locks And Mi rrors, Great Bui ck Ri de! $ 5,988 Dodge Dakota Crew Cab SLT Only 19K mi les! V6, a ll power, a lloy wh eels, one owner. $ 16,988 or $ 189 per mo* Dodge Caliber SXT 34 MPG! Aut omati c, A ll Power, Af f ordable Versati li ty! $ 12,988 or $ 129 per mo* ALTIMA SEL NISSAN $ 15,990 Auto, air, alloys, leather, loaded. T AHOE LTD CHEVY $ 30,990 Nav., DVD, sunroof, leather. Below book value. GRAND CHEROKEE JEEP $ 7,990 Only 82K miles! 4x4. Auto, air, leather, sunroof. HHR LT CHEVY $ 15,990 Only 38 K Miles! Auto, leather, sunroof, chrome pkg. TUNDRA TOYOTA $ 12,990 Only 47 K Miles! V8, longbed, auto, air. T OYO TA CERTIFIED T ACOMA SR5 TOYOTA $ 20,990 V 6, auto, all power. P riced to sell. SIENNA XLE TOYOTA $ 19,990 Dual air, dual power doors, leather, loaded. RAV4 TOYOTA $ 19,990 Only 18K miles! Auto, air, all power. Factory Warranty CAMRY TOYOTA $ 14,990 Auto, air, all power, priced to sell. T OYO TA CERTIFIED SEDONA LX KIA $ 12,990 Auto, air, leather, loaded. HIGHLANDER HYBRID TOYOTA $ 30,990 Leather, alloys, sunroof, loaded. T OYO TA CERTIFIED VERSA S NISSAN $ 9,990 Auto, air, all power. Priced to sell! AVEO LT CHEVY $ 11,990 Auto, air, AM/FM/CD, 35 MPG. ACCENT GLS HYUNDAI $ 10,990 Auto, air, power pkg., clean BEETLE VW $ 8,990 Auto, air, leather, loaded. 5 SPEED, Jeep Commander LTD Only 33K Mi les! Leat her, Power Seat s, Premi um St ereo, A ll Servi ce Records, Rare Fi nd! $ 16,988 or $ 189 per mo* 0 Honda Fit Sport 35 MPG! Aut o, Fu ll Power, A lloy Wh eels, Loaded! $ 15,988 or $ 179 per mo* Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BAD CREDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call2010 Ends9/7/09.Ends9/7/09. ASLITTLEAS$1000DOWNGULFCOASTAUTO CREDITONSITE!1STTIMEBUYERSOK!BADC REDIT?NOCREDIT?WELLGETYOUONTHEROADTODAY!Call 2010 Arcadia Englewood North Port Port Charlotte Punta Gorda Venice Classifieds & Automotive TM 866-463-1638 866-949-1426 Fax SP27196 INSIDE THIS CLASSIFIED/AUTO SECTION LOOK FOR: Classifieds: Employment 2000, Notices 3000, Financial 4000, Garage Sales/ Merchandise 6000, Business & Service 5000, Automotive/Boats 7000 Advertising: Automotive, Business & Service Directory, Employment Columnists: Don Royston, Click and Clack 2-Q 11 c RV'LK---------------'ROWwa 1111111+ -r)Tj /TT1 1 Tf -0.3208 Tc 7.6083 0 0 4 727.3603 303.7008 Tm [(19HO DA It if

PAGE 28

The Sun Classified-Section A Page 2E/N/C/VSaturday, September 24, 2011 LowMilesL001T-1A2: Lea ther,Bose, ExtraClean! $ 8,984 LowMilesK182TA: 4x4,DURAMAX Diesel!Fullpower, topper. $ 22,984 2003ChevyMalibuK169T-1A: On eo wner,V6, PowerPack. $ 7,984 2008MercuryGrandMarquisOnly30KMiles2566P: Silver, Exceptional! $ 12,984 2004ChevyImpala 2006PontiacTorrentLowMiles2588P: Cer tied,one owner. $ 12,984 2007GMCYukonSLEOnly37KMiles2553P: 1o wner,Certied, showroomnew. $ 23,984 2006ChevyHHRLTLowMiles2599PA: Cer tied,Leather, Sunroof,all theextras! $ 13,984 2006ChevySilveradoLTOnly56KMilesK010TA: ExtendedCab, leather,loaded. $ 12,984 2009CorvetteConvertible3,200oneadult ownerMilesK244A: Cer tied,still smellsnew! $ 45,984 US41&SR776SouthVenice1-800-448-2825or493-5000 1996ChevyCorvetteOnly33KMiles2424MA: Aut omatic. Red/Black! $ 15,984 2009PontiacVibeK215A: Cer tiedw/ warranty,1owner trade-in!. $ 14,984 2008ChevyCobalt2drOnly10KMiles2451MA1: On eo wner, Cer tied! $ 12,9 84 2005GMCSierra4x4LowMilesK208T-1A2: V8power,sharp truck. $ 14,984 2008DodgeDakotaClubCabOnly33KMiles!2616P: V6,custom wheels,sharp! $ 14,984 NEVERADEALERFEE *SalePriceincludesallincentivesanddiscountsplustaxesandlicensefees.Youmayqualifyforadditionalincentives,pleaseseedealerfordetails.Picturesofnewvehiclesforillustrationpurposesonlyandmaynotbetheactualvehicleoered. 2003ChevySilveradoExtCabLowMilesK214TA: On eo wner trade-in,serviced, immaculate! $ 9,984 www.BillBuckChevrolet.com 1999MazdaMiataMX5 MALIBULS $ 19,990Stk#K066 MSRP $23,749 IMPALALS $ 21,760Stk#K241-1 MSRP $25,709 NOWINSTOCK! BILLBUCKCHEVROLETHAS O VER20NEWEQUINOX TO CHOOSEFROM!Getsupto32mpgHwy FuelEconomy100,000MilePowertrain W arrantyUpto64CubicFeetof CargoVolume!NowStartingat$23,500 orLess!!Stk#K155-1 8527509 Todays column features two unusual convertibles owned by very interesting people. The Presidential B lue 1966 Thunderbird, known as Thelma, is the property of Rotonda W est residents G len and Donna Alton. They gave it that name because its the same year, make and model of the car used in the movie Thelma & Louise that the main characters drove off a cliff. Even though the picture was a B ick, more people, certainly those in the hobby, remember it well. This bird came to Alton as a result of playing golf at the Pinemoor West Golf C ourse near his home. He struck up a conversation with an employee who said he had a T-Bird for sale. They went to the mans home for a looksee, and it was love at rst sight for Glen. S eems it had belonged to the gentleman for about four years. He had liked it enough to have the fancy paint job done in same color as original, however he used it very little afterward. Soon a deal was made and the big bird was in Altons garage. That was 14 months ago. Since then, Thelma has been driven 4,000 miles, bringing the odometer up to 82,000. Along the way there have been many new parts and repairs, totaling over $4,000. Wi th everything xed, shes back in good graces with Mr. and Mrs. Alton. Theyve been in the Rotonda Christmas parade and the recent Pioneer Da ys parade, top-down and smiling, plus several cruise-ins and shows. The soft top is original, so Glen has the boot on almost all the time. Bo th Glen and Donna we re Ca nadians in Markdale, Ontario. His parents own ed a Pontiac/Buick dealership and Glen grew up pumping gas, cleaning new cars and actually sold a brand new Buick at age 12. The business overhead was too high to be protable, and it closed in 1998. Donna, a registered nurse, qualied for a gr een card and the family had a discussion with daughter Gracie Thelma the T-B i rd and Mean Green the F i reb i rd C ARS TODAY AT BATTERIES PLUST he Veteran Motor Car Club of America will exhibit antique autos 10 a.m. to 1 p.m. today at Ba tteries Plus, 1690 Tamiami Trail, Port Charlotte. P erhaps you saw the national advertising in this paper during the w eek. The public is invited to attend. Call 941-639-8448 for information. Collector Car Events Info Larry Day of Lee County has cruise-in and show information from Naples to Sarasota. Email him at lwnkday@aol.com to get his free email newsletter with all the details. Also visit www.Flacarshows.com or www.musclecarcity.net. Call the DJs T ommys Traveling Tunes, 941-240-5799 Lance Cruisin to the Hop, 941-371-1061. You Auto KnowDon Royston SUN PHOTOS BY LEE ROYSTONGlen Alton and his 1966 Presidential Blue Thunderbird, Thelma. Ga ry Mruz and his lime green 1969 Firebird 400 convertible.ROYSTON | 3 LLfZ !\ )18()-11()]TJ -0.1701 Tc 32.2778 0 0 16 390.4695 523.5948 Tm (L!\LLZ f LLNew 201,1 NSW 2011f 6 )Tj -0.0028 Tc 9.2222 0 0 10 463.9695 370.5994 Tm [(SPt PRICE SALt ,'RICEr.,, i =Y)188(_o )142(^ rte.. -6jawlA&M

PAGE 29

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 3 Interior of the T-Bird. Interior of the Firebird. The 400-cubic-inch, 330-horsepower engine of the Firebird.and agreed to get out of the cold by moving to F lorida. They purchased a house three days after arriving here. Donna worked for Bon SecoursS t. Joseph H ospital in Port Charlotte and now is one of the four nursing directors at Englewood Community Hospital. G len became an employee of Crest Cadillac for several years, then moved on to become a sales agent for Coldwell B anker Sunstar Realty in Englewood, where hes been for the past six years. D aughter Gracie attends college in Gainesville. They have dual citizenship in the United States and C anada, but call the USA their home. W atch for Thelma out and about at community and old car events. Glen will be glad to answer any questions about specication and the Birds complete background.Mean GreenThe unique lime green 1969 Firebird 400 series convertible, Mean Green is owned by Gary and Kay Mruz, of Osprey for the past 38 months. Its the latest of 50 yes, 50 P ontiacs Gary has had in the past 30 years, mostly Tr ans Ams, Grand Ams, Fir ebirds and Fieros. Star ting at age 16 he and Miss Kay Kirby, now Mrs. Mruz, were in high school courting in cars of that brand. During college, marriage and becoming parents, the name Po ntiac was a household name. Gary would locate, buy and x them up to earn get ahead money! That was back in Forsyth, central Illinois, where the winters were very cold and snowy. However the employment situation was good, enabling Gary to secure a position with Archer Daniels Midland, a For tune 500 company as In formation Technology Ofcer in Decatur. Now, 28 years later hes still employed by ADM, operating mainly from his home in the Sunshine Sta te after moving south in 2008. Kay is a semi-professional photographer. Their daughter, 24-yearold Beth, lives and works in central Illinois as a computer programmer. Of all Garys Pontiacs, Fir ebirds are his favorite. The one featured today was purchased three years ago over the Internet from a dealer in Ohio. This couple also owns a white-with-blue-stripes 1969 Firebird under r estoration. You can meet the Mruzes alongside the gleaming convertible at antique car events in Charlotte and Sarasota counties. On Nov. 12, one of these Birds will be on display at the Sun Newspapers Fifth Annual Welcome Ba ck Collector Car Show and Open House. Look for more details regarding this affair in the near future! Some specications are: Basi c cost new, $3,045 plus A/C, power brakes and steering; production, 11,649; wheelbase, 108 inches; weight (basic) 3,330 pounds; engine 400 cubic inches, 330 horsepower; AT Turb o; rear, Posi Trac. Tip of the WeekK eeping tires fully inated will give you up to two more miles per gallon. Don Ro yston is president and co-founder of the Veteran Motor Car Club of America SW Florida Region. Call 941-5750202 or email leekr42@ embarqmail.com.ROYSTONFROM PAGE 1 Dear Tom and Ray: I live in a gated community with lots of speed bumps to deter speeding. I am always amazed at the ingenious techniques people use when they go over speed bumps. There is the one-wheel technique, the diagonal technique and, of course, the oldman (3 mph) technique. I prefer the straight-onat-20-mph technique. Which way is best for y our car? Frank Tom: W ell, the straighton-at-20-mph technique is best for US, Frank. We sell a lot of suspension parts that way. Ray: B ut whats best for the car? No question about it: The old-man (3 mph) technique. In fact, we r e going to rename that approach the genius technique. Tom: When you hit bumps hard, like you do, Frank, you jolt every part of the suspension system. Its like whacking every part in the car with a hammer. And even though cars are built to take a certain amount of punishment, the more they take and the harder they take it, the sooner their parts wear out. Ray: And what happens to older cars that have taken more than their share of hard knocks like that? They tend to squeak and rattle and chatter their way down the road, dropping occasional parts along the way (see also: any of my brothers heaps). Tom: Whereas using the genius technique and going over a bump like that at 3 mph does practically no damage. The springs and shocks compress gently and absorb the bump, and then they decompress. Ray: And theres certainly nothing wrong with staying to the right and avoiding the speed bump with your rightside wheels, as long as you combine it with the genius 3 mph approach. Tom: And as long as you dont drive too far to the right, jump the curb and run over someones prized tulips. Ray: The same is true for the diagonal approach. It cant hurt, as long as youre going very slowly. Tom: And besides, when you go 20 mph ov er speed bumps, yo u re defeating their whole purpose to stop knuckleheads from driving too fast in a pedestrian-heavy area. Theyre slowing you down for a re ason so that kids and older folks and everyone else who walks or crosses the street is safer. Ray: So because of the damage you can do to y our car, and to innocent pedestrians, were renaming the straight-on-at-20mph approach the moro n approach, Frank. So well leave it up to you to decide which technique y ou want to be associated with from now on.Whats the real story with timing-belt claim?D ear Tom and Ray: Abo ut a year ago, I had the timing belt replaced on my 2003 Subaru O utback. Then, last week, I had the head gasket replaced at a different shop. When they replaced the head gasket, they looked at my timing belt and said I needed a new one! The re ason was because they could not see any writing on the belt, and they said if it was replaced last year there would still be writing visible, as it takes 40,000-50,000 miles to wear th e writing off a belt, even an aftermarket one. So, now I am wondering, Did they really replace my timing belt last year, or did they rip me off? Jim Ray: Ive heard of seeing the writing on the wall, but seeing the writing on the timing belt is not as well-known a phrase for good re ason, Jim. Its not a reliable indicator. Tom: We v e seen belts with different amounts of writing on them. The factory belts often have white marks that line up with the timing marks on the cylinder heads and cam sprockets. But not all aftermarket belts do. So me have just the part number written on the belt, and thats it. Ray: So, its possible that the rst mechanic used an aftermarket timing belt that had very little writing on it. And it may have worn off after just a year. Tom: Weve never studied the wear patterns in the writing on timing belts and how they corr espond with mileage in an Subaru. But well put the next graduatestudent intern at the garage right on it. Ray: So now there are three possibilities: One, the original guys didnt change your timing belt and ripped you off. Two, the original guys changed the timing belt, and the second guys made an honest mistake because they think all timing belts have long-lasting writing on them. Or three, the second guys ripped you of f, which you hadnt considered yet. Tom: Lets say the second guys tried to pad their bill by selling you a timing belt, and you surprised them by saying: Whadda ya mean? I just had it replaced! Then maybe they did a song and dance with this whole writing thing, even though they knew better. Ray: Heres o ne clue: When the second guys r eplaced your timing belt, did they charge you just for the part, or did they charge you for labor, too? Tom: He re s why we ask. When you replace a head gasket, you have to remove and replace the timing belt anyway. So theres no additional labor re quired to change it. If theyre honest guys, they would have told you that yo u needed a new timing belt and it would just cost yo u $75 for the part. Ra y: On the other hand, if they tried to charge you an additional $300 in labor which is what it would cost if the timing belt were not ALREADY off then that would suggest that theyre ripoff artists, and it would lead us to question their credibility about everything. Tom: And it would lead us to study their methods to see if we could learn anything useful! Good luck, Jim. Dont get stuck with a lemon. Be an informed shopper. Read Tom and Rays guide How to Buy a Great Used Ca r: S ecrets Only Your M echanic Knows. Send $4.75 (check or money order) to Used Car, P.O. Bo x 536475, Orlando, FL 32853-6475. G et more Click and Clack in their new book, A sk Click and Clack: Answers from Car Talk. Got a question about cars? Wri te to Click and Clack in care of this newspaper, or email them by visiting the Car Talk website at www.cartalk.com.Slow i s best for speed bumps CLICK and CLACKTALK CARSby Tom & Ray Magliotht'i rte,14)33(i;i'Mid

PAGE 30

The Sun Classified-Section A Page 4E/N/C/VSaturday, September 24, 2011 RESTAURANT/ HOTEL2040 SERVER, PART TIME, golf course server, days & evenings, flex hrs, Apply in person The Palms at Rotonda Golf & Country Club on Tues, Wed, Fri, or Sat. Ask for Cathy. SKILLED TRADES2050 A/C TECH, for maintenance and installs experienced and clean DL required, Franks Htg. & Clg. 941-484-0058 AUTO TECH NEEDED Must have some Certs. Current or expired. Apply in person to: Gene Gorman Tire & Auto Repair 4396 Tamiami Trl., P.C. (941)-629-TIRE (8473) ELECTRICIANS AND ELECTRICIAN HELPERS with Commercial experience needed. Please call Jenny (941)-429-4900 MAINTENANCE MECHANIC, Min 5 yr exp. Electrical, welding & gen mechanical knowledge Ability to speak, read & write English. Fax resume to 239-332-3514 EEO/DFWP MARINE TECHNICIAN Palm Island Marina Service Dept. is taking applications for a Technician who will compliment our team. Neat, organized, with own tools & knowledge of outboard, stern drive & inboard engines & various plumbing & electrical systems. Certification is not required but would be a plus. Salary based on knowledge & exp. Contact Bob @ 941697-3778 or fax r esume to 941828-1087 MECHANIC EXPERIENCED Arcadia Business Call for more inform 863-494-2601 RESTAURANT/ HOTEL2040 BARTENDERS/SERVERS needed for busy restaurant experienced and great personality a must. Apply in person 24 Boca Lupo Coal Fired Pizza Murdock Carrousel Plaza, (next to Lowe`s) 941-2351404 FINE DININGrestaurant in Englewood/Pt charlotte area requires SOUS CHEF, SERVERS & BAR PERSON. Send resume & details to Cathybur gess99@gmail.com THE GASPARILLA INN & CLUB We currently have openings within the following areas:Restaurant Counter Help Bakers Pastry Cooks Line Cooks Baristas Dishwashers Overnight Front Desk Porter Grounds Laborer Group Fitness InstructorsFor more details please call 941-964-4570. Resumes can be sent directly via email to smoore@gasparillainn.com or via fax to 941-964-4571 Pre-employment drug test and background check r equired. RESTAURANT/ HOTEL2040 A+ BARTENDER & POKER DEALER TRAININGAges 18+ 1+ week programsJob Assistance 24 Years in SW Florida Day, Eve & Saturday classes $35/week Payment Plans(941) 564-9633 All Restuarant Positions Now Hiring, plus laundry and cleaning crew apply in person 1601 Englewood Rd. GENERAL MANAGERSmall busy Keys style Bar & Grill. Must have marketing and promotion knowledge PLUS willingness to learn and grow. Take charge personality a must. Port Charlotte area. Please Send Resume to: NGM PO BOX 511223 PUNTA GORDA, FL 33951 A Bargain Hunters Delight Check the Classifieds first! A Whole Marketplace of shopping is right at your fingertips! Call The Sun Classifieds T oday! From Venice, Englewood, North Port Areas Call 941-207-1200From Pt. Charlotte Areas Call 941-206-1200 NEEDCASH? MEDICAL2030 Www.HorizonTechInstitute.ComADVANCEYOURCAREER Licensed & Accredited School Corner of 41 & Toledo Blade YOUcan become a MEDICAL ASSISTANT in just 8-10 months CLASSES START Nov 7 Start Working In 2-5 wks! CLASSES START Oct 3r d & Oct 24 Nursing Assistant (120hrs) Home Health Aide (75hrs) Phlebotomy Tech (165hrs) EKG Tech (165hrs) Patient Care Tech (600hrs) LPN Board Review ( 200hrs) Job Assist. & Pymt. Plans Call Now to Register!941-889-7506Corner of 41 & Toledo Blade NIGHTCLASSES MEDICAL ASSISTANT Open House every Thurs 9am-7pm MUSICAL2035 Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week NEEDAJOB? CHECKTHE CLASSIFIEDS! MEDICAL2030 Billing Manager for Internal Medical Cardiology Practice. Exp. only need apply, please send your resume to 941-629-1737 BECOME A CNA $250. HHA, MED TECH, CPR & CNA CLASSES. 941-255-0675 www.bestchancecpr.com CNAS, HHAS. WORK NOW! FT/PT in-home care. Exp required. Top Pay! (941)-257-4452 PUTCLASSIFIEDS TOWORK FORYOU! FIND A JOB! BUY A HOME! BUY A CAR! DeSoto Health & Rehab has the following job opportunities available: LPNs CNAs PT or PTA PRN Fax resume to (863)-4949470 For questions call: (863)-494-5766 EXPERIENCED CNA/HHAs Needed for immediate placement in V enice, Englewood, Port Charlotte, Punta Gorda & Arcadia, Competitive Wages. Health plan & 401K available. Call today, work tomorrow Call Mon. Fri., 8am-4pm. 941-764-0880 or 941-480-0880 ALL STAT HOME HEALTH Licensed Echo TechPlease fax resume and salary r equirements to 941-629-1737 LPNMon. Fri. Busy Family Practice Office Seeking FT LPN. 2+ Years Experience in Family Practice Required. Must be Able to Multi-task in a Busy Medical Office. Fax Resume to Dr. Shell: 941-7433313 LPN/CNA/MA FTMon-Fri. Looking for self starter, team player, multi-tasking professional w/ cardiology experience. Great benefits. EOE/DFWP/smoke free. Email resume to doctorsoffice1@yahoo.com Massage Therapist for busy PT patient clinic: LMTresume@yahoo.com MEDICAL RECEPTIONIST FT position for busy Physicians office. Experience a must. Fax resume to (941)-624-0941 MEDICAL RECEPTIONIST, MEDICAL RECEPTIONIST. FT position available immediately. Port Charlotte Allergist seeking experienced medical r eceptionist. MEDICAL OFFICE EXPERIENCE IS A MUST! Email CV with salary r equirements to: PORTCHARLOTTEMD@GMAIL.COM. Physical Therapist/Assistant P/T for Busy PT Clinic Send Resume to PTAresume@yahoo.com RNS HOME Health, Medicare Home Health Agency hiring PRN RNs for the Charlotte/Sarasota area. Competitive Pay & 401K. 941-244-2590 ST HOME Health, Medicare Agency hiring PRN STs for the Charlotte/Sarasota areas. Must have 1 yr exp. Competitive Salary & 401K 941-244-2590 ULTRASOUND TECH Part Time. Experienced only, Days, no W/E or holidays. Fax r esume to 941-629-1737 2000EMPLOYMENT EMPLOYMENT 2005 Services 2010 Professional 2015 Banking 2020 Clerical 2025 Computer 2030 Medical 2035 Musical 2040 Restaurant/Hotel2050 SkilledTrades 2060 Management 2070 Sales 2090 Child/Adult Care Needed 2100 General 2110 Part-time/ Temp 2115 Home Based Business 2120 Seeking Employment PROFESSIONAL2010 ADMIN ASST, Must have Series 65 and get life ins. lic. Fax resume: -888-453-0089 ASKUS HOW you can place a PICTURE of your item for sale in your classified ad! BARBER, experience, needed immed. in busy Pt. Charlotte shop 941-457-9348 HAIR DRESSER/STYLIST NEEDED, APPLY ALL IN ONE HAIR, CALL: 941-637-3839 CLERICAL/OFFICE2020 HR PERSON Home Health agency seeking outgoing HR person. Must have exp. in HRexp. w/ Medicare HH a plus. Must be able to multi task and work independently with a positive attitude. Competitive salary and 401k. 941-244-2590 MEDICAL2030 CERTIFIED NURSING ASSISTANTS FULL TIME / PART TIME ALL SHIFTSTired of being just a number at HARBORCHASE we care about our employees as much as our residents. ****************** ****************** HarborChase offers competitive wages and an excellent benefits package such as Medical, Dental, Vision & 401K Part-time team members receive benefits at 20+ hours. FOR CONSIDERATION PLEASE APPLY IN PERSON TO:HARBORCHASE OF VENICE ASSISTED LIVING AND SKILLED NURSING950 PINEBROOK ROAD VENICE, FL 34285 (941) 484-8801 PH (941) 484-3450 FAX EOE M/F/D/V GET RESULTS USE CLASSIFIED! Are your )Tj /TT0 1 Tf -0.0313 Tc 72.6642 0 0 88 272.4832 235.3181 Tm (PAYING FORYou are if you subcribe to the Sun Newspapers.In your Sun Newspaper, you get morelocal, national and world news than you willget from any other newspaper in town.,J y )Tj -0.0819 Tc 30.5789 0 0 9 546.9832 73.823 Tm (lSUN :'(mrrica'. B1 S I (..mmuniiv I)a11V

PAGE 31

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 5 EXERCISE CLASSES3095 400 W Retta Esplanade Saturdays at 9:30am. TA I CHI QIGONG Curves with Zumba Classes Zumba & Yoga Classes Line Dancing and Pilates Silver Sneakers Welcome Open to Public 941-639-8525 for Times. NEEDCASH? GULF COAST ACUPUNCTURE 151 Center Rd. We dnesdays 5:30pm Thursdays 9:00 am Saturdays 8:30am YOGA FOR BEGINNERS Proceeds to V enice Wildlife Center Call Rick or Mary 941-488-1769 KRIY A YOGA MEDIT A TION 1250 Rutledge St. Unity Church of Peace Mondays at 7pm. 941-423-0029 YOGACLASS FREE FREE Hatha Yoga Class Thursdays at 8:30am to New Students with Yoga for Every Age. Instructor Ilse Mindling RYT This class is suitable for those with little or no experience. Proper alignment, movement and breath will be emphasized. Relaxation/meditation is part of every class.Beginners welcome. Punta Gorda Isles Civic Assoc. 2001 Shreeve St. Seehttp://www.yogaforeveryage.comor call 941-204-0095 for more info. Pls. bring your own yoga mat. RELIGION CLASSES3096 BEGINYOURDAYIN DEVOTIONALSTUDY Christ the King Lutheran Church, 23456 Olean Blvd. TUES & FRI 9:00-9:30 am. For more info 941-766-9357 Port Charlotte F AITH LUTHERAN CHURCH 4005 Palm Drive, Punta Gorda Various Days & Times CONFIRMATION/BIBLE STUDY Classes for Youth and Adult 941-639-6309 OTHER CLASSES3097 CONCENTRATIVE MEDITATION with Linda Weser, 7 p.m. every Monday at Unity Church of Peace, 1250 Rutledge Street, off Veterans Boulevard between Orlando Boulevard and Torrington Street, Port Charlotte/North Port line. Free; open to the public. 941-423-8171 or 9416292077 4000FINANCIAL BUSINESS OPPORTUNITIES4010 BLADEZ BARBERSHO P KIOSK FRANCHISE FOR SALE In the PORT CHARLOTT E TOWN MALL. FINANCING AVAILABLE $55K total. John @ 800-851-8160 o r j ohn@bladezbarbershop.com BIBLE STUDY & CHURCHES3065 F AITH BUILDERS A Basic Study to Build your Christian Faith. Call Pastor Parsons at Christ the King Lutheran Church for times. 941-766-9357 Port Charlotte F AITH LUTHERAN CHURCH 4005 Palm Drive, PG Thursdays 7-8pm. Adult information classes Open to anyone interested in becoming a Lutheran or joining the church. 941-639-6309 FIRST BAPTIST CHURCH 278 S. Mango St. Englewood Mondays & Thursdays at 9am. Offering chair exercise classes For more info. Call 941-474-2473 LOST& FOUND3090 FOUND DOG: Found in Burnt Store Meadows area. Call with discription. 941-639-9600 LOST: Barnes & Noble Nook Color. Vicinity of Marion Ave, Punta Gorda. Near Jacks & Thomas Ryan Real Estate. Reward... 941-380-2089 ADVERTISEWITHTHE SUNCLASSIFIEDS $$ REWARD $$Missing English Bulldog1 year old female lost off Biscayne in North Port Estates Tuesday morning, Sept. 14th. Black, white, and pink collar with no tags. Bella is a part of a large family with children and they r eally want her to come home. Please call if you have seen her. 941-2232475 or 941-915-6480 REWARD: FISHING GIRL Statute, please call if you see her, missing from front yard, Gulf Cove area. 941-457-2573 ARTS CLASSES3091 ACRYLICPAINTING T uesdays 1-4pm & Thursdays 9-Noon Call Barb at 941-497-1395 MOSAICS Thursdays 6 9pm Call Rosemary at 941-6977888 PG BOA T CLUB 802 Retta Esplanade. T ues. 8am. WOODCARVING 941-505-4246 941-5754276 DANCE CLASSES3093 BELL Y DANCING Charlotte Cultural Center Saturdays, 11am. 941-276-0935 EDUCATION3094 TM PROGRAM W arm Mineral Springs Every Saturday at 11am LECTURE Reduce stress, Improve health. 3000 NOTICES HAPPYADS3015 Place your Happy Ad for only $8.75 3 lines 1 day. Add a photo for only $10.00! Please call (866)-463-1638 PERSONALS3020 ADORABLE TASHA. Stretch & Relax Therapy 941-497-1307 PUTCLASSIFIEDS TOW ORKFORYOUV enice,Englewood, North Port 2 2 0 0 7 7 1 1 2 2 0 0 0 0Pt.Charlotte Areas Call 2 2 0 0 6 6 1 1 2 2 0 0 0 0 ALEXIS SOOTHING SESSIONS! 941-549-3804 RELAXATION Located in Englewood Call Stormy 941-549-5520 SINGLE LADY hair stylist,44 yrs old looking for man 4260 for relationship. 941-201-9853. SINGLE WOMAN LOOKING FOR SINGLE MAN. 941-6232386 SCHOOLS & INSTRUCTION3060 ED KLOPFER SCHOOLS OF CNA TRAINING-1 wk class $250. Locations: Sarasota, Port Charlotte, Ft. Myers 800-370-1570 FLA CNA.COMCNA $300 HHA $125 CEUs $50. Phlebotomy $300 State testing onsite. 941-822-2290 Heat & Air JOBS Ready to work? 3 week accelerated program. Hands on environment. Nationwide certifications and Local Job Placement Assistance! (877)359-1690. BIBLE STUDY & CHURCHES3065 BIBLE STUDY First Resurrection Call Tom (941)-423-5458 CAL VAR Y BIBLE CHURCH 1936 E. Venice Ave. V enice Friday at 9am. Study features video teachings of noted Bible Scholars on various subjects. For more info. Call Rev. Jones at: 941-485-7070 or visit www.CBCVenice.com COMMUNITY CENTER 4PM 7PM each Wednesday. Christ the King Lutheran Church, 23456 Olean Blvd. PC Open to All Ages. For more info 941-766-9357 GENERAL2100 GROWING RETAIL business needs mgnt. trainee. exp a + Send resume: jnqcr@hotmail.com Medical Billing T rainees Needed! Hospitals & Insurance Companies hiring now! No Experience ? Local training & Job Placement available! HS Diploma or GED & PC needed. 1-888-528-5176 Interested in working 6 weeks four times a year?Nielsen (the TV ratings people) is looking for quality focused individuals to interpert and input TVDiaries fourTV sweeps a year. Basic computer skills. Apply on line at Nielsen.com Search job number: Day shift 1103992Night shift 1103994 Paid training begins Monday October 24th 1080 Knights Trail Nokomis, FL 34275941-488-9658EOE/M/F/D/V TV DIARY EDITOR POSITIONS Day Shift 7:45AM 4:00PM $8.50 Hr. Night Shift 4:30PM-12:45 AM $8.50 Hr. WANTED someone who can build an outdoor brick oven. 941-740-2152 WANTED: RELIABLE, trustworthy lawn care service. Must take pride in your work, willing to get paid at end of month after work is done. Willing to do as customer requests without an attitude problem? If so, please call 423-4252 in North Port. PA RT TIME/ TEMPORARY2110 P ART TIME WEEKEND POSITION CUSTOMER SERVICECHARLOTTE SUNMust be 18 years or older. Reliable, flexible, pleasant personality and ability to handle customer relations. Computer literate a must. W eekends 6AM-1PM plus holidays & vacation coverage Please Apply at: 23170 Harborview Rd. Charlotte Harbor, FL Mon.-Fri. 9AM-4PM only Applicants, please fill out application ATTN: L ynda Toner We will contact you for an interview. No phone calls, please. SCMG is a drug free and nicotine free company Pre-employment testing is required EOE SEEKING EMPLOYMENT2120 DRIVER with Clean CDLA Lic. looking for employment. Call (941)-743-7747 Classified = Sales CHILD/ADULT CARE NEEDED2090 CHILD CARE TEACHER Redeemer Lutheran Child Care in Englewood now hiring a full time teacher. CDA is required. 941-475-2631 Ask for Wendy. T eacher for 3 yr olds. FT, Exp. Call 941-743-0016 or apply at 2733 Tamiami Trail,PC ADVERTISE In The Classifieds! GENERAL2100 29 Serious People to Work From Home using a computer. Up to $1500-$5000 PT/FT Free info www.pticoncepts.com CUSTOMER SERVICE REPRESENTATITIVE (CSR): Good phone etiquette and professional demeanor r equired for high volume call center Computer proficiency in MS Word, Excel & Outlook Data Entry using proprietary software Attention to detail -hour work week, Monday-Friday. Rolling on-call for week end CSR coverage Hourly rate of $10.25 per hour plus incentive. Send r esume only to: hradmin@tricountyair.com No phone calls or office visits please. We are a Drug Free W orkplace. T ri County AC Heating, Inc DANCERS WANTED Emerald City Gentlemans Club $1,000 bonus 941-766-1161 DRIVERS TEAMS: $6,000 T eam Sign-On Bonus when you team drive for Werner Enterprises! Call Now for details! 1-888-567-4856 FLORAL DESIGNER, PT to start, potential FT, min 5 yrs exp. Ref. req. 941-475-3358 GARDEN CENTER Must have exp. PT/FT DFWP 941-662-8733 GENERAL LABOR, Must be able to speak, read & write English. Fax resume to 239332-3514. EEO/DFWP MAINTENANCE full time, knowledge in electrical, plumbing, & carpentry apply M-F 8-12 at: Bird Bay Management Office 606 Bird Bay Dr So., Venice P ART TIME WEEKEND POSITION CUSTOMER SERVICECHARLOTTE SUNMust be 18 years or older. Reliable, flexible, pleasant personality and ability to handle customer relations. Computer literate a must. W eekends 6AM-1PM plus holidays & vacation coverage Please Apply at: 23170 Harborview Rd. Charlotte Harbor, FL Mon.-Fri. 9AM-4PM only Applicants, please fill out application ATTN: L ynda Toner We will contact you for an interview. No phone calls, please. SCMG is a drug free and nicotine free company Pre-employment testing is required EOE SKILLED TRADES2050 PLUMBERSExpd in all phases of NEW CONSTRUCTION and/or remodel. Must be willing to work. F AX RESUME TO 941-488-4693 OR E-MAIL TO josh@babesplumbing.com DFWP EOE Press OperatorSUN COAST PRESS Commercial Print Operation is looking for an experienced web Press Operator to work in the Venice Pressr oom running a color lead on a Goss Community press. Candidates must have at least 3 years experience running a color lead on a Goss Community or Urbanite press. The Sun Coast Press commercial print operation is located in V enice Florida. This position is for the night shift, Monday through Friday, 5:00 pm to 2:00 am. Pre-employment drug testing required. Applications accepted at the V enice Gondolier, 200 E. Venice Ave., V enice. Please put the attention of Mark Wilson, V enice Operations Manager, Sun Coast Press. MANAGEMENT2060 AARONS NOW HIRING Retail Mgr. for Arcadia Store 1735 E. Oak St. Salary + BENETITS, Sundays off, 45hrs. wk. Must pass criminal & drug test, 21 yrs. +, clean MVR. Apply to www aar ons.com/car eers type in Arcadia in keywords and apply or stop by store and apply! SALES2070 Be a Real Estate Agent!Earn $30-$50K 1ST YEAR!Busy Real Estate office is expanding & needs local real estate agent. No exp. nec., leads provided, training avail. Comm. base. Limited Positions. Call Today! 941-915-1297 orcareer@listingservicesdirect.com RV SALES.RV, Auto or Real Estate sales experience preferred but will train the right person. NonSmoker, DFW. Full time, benefits. Excellent income potential. Call Steve Erdman @(941) 966-2182, fax to (941) 966-7421 or jobs@rvworldinc.com SALESposition available for fast growing Plumbing company. Previous sales experience with proven record. Must be well groomed and have a clean driving r ecord. We offer a Competitive compensation package including base salary with commission and benefits. This is a drug free work place. Please call 941-468-2949 SALES PROFESSIONALS NEEDED IMMEDIATELYGreat Pay! 3 Locations! Benefits Available. Gene Gorman`s Auto Sales3305 Tamiami Trail Punta Gorda(941)-639-1601 Illll llliiii iiillllll lIIIII IIIIIIII llllll%fto0*woooo)Tj /TT2 1 Tf 0.0736 Tc 23.466 0 0 26 270 950.5072 Tm [(.--------,rte)Tj -0.1875 Tc 17.7857 0 0 8 564.5 634.0169 Tm (,r wv-t"

PAGE 32

The Sun Classified-Section APage 6E/N/C/VSaturday, September 24, 2011 Aluminum btntnftbtrtttnrbttrnrrbfInclude Your Business in This Directory. Call 866.463.1638 Edward Ross Construction Services, Inc.No Job Too Big Or Too Small Over 30 Yrs Exp in Venice Area(941) 408-8500Lic#CBC059107 Bobcat Services Bobcat Services Air Conditioning Bush Hog & Lot MulchingLicensed & Insured 941-697-3116 or 802-417-7650 by Fred Immaculate Cleaning Service, LLC 941-879-2348Lic./Bondedbtn fbrfbtn rrn nfFree Estimates AIRBOATRIDESONTHEPEACERIVERNAV-A-GATOR 941-627-3474 $5 OFF w/ad W ith Capt. Kirk P eace River Wilderness Eco-Tours Guided Fishing Trips Museum & Gift Shops Cozy Cottage Rentals Boat Slip, Canoe & Kayak Rentals 941-627-FISH (3474)HOME OF THE BIG FISH Vot ed #1 T rop RockVenue in the U.S. 3 Years in a Row! www .Nav-A-Gator.com info@Nav-A-Gator.com 9700 SW Riverview Circle Lake Suzy, FL 34269 Additions Builders ONSITECOMPUTER SERVICES Virus, Spyw are Removal Data Back-Up & Recovery Wired/Wireless Networking Aordable Rates WeComeToYour HomeorBusiness! www .fastteks.com 941-484-1511 Certif iedTechnicians New Clients Receive$25 OFF btn ftbrCOMPUTER & LAPTOP REPAIR COMPUTERS S D Jbtbnf Certi ed941.764.34002270-F Tamiami Tr., P.C. Free Estimates Lic. / Ins941-626-0622 A-STAR CLEANING SERVICESM ove-Ins M ove-Outs We ekly, Bi-Weekly, Monthly HOME & OFFICE CLEANINGSeniorcaregiver & organizerbtnftrttt ttntnt ftnfnt ftn! tn nffrfnbf941-421-9232 Information Specializingin ElectricalProblemsHomeofthe $25ACCharge941-916-9098btntfr tnfrbtn Lic# MV82675 Beths Sparkling Cleaning Call for Summer Specials! 941-993-4375Residential Of ce ttnft Professional Reasonable Rates Prompt Thorough D riveways Pavers Sidewalks U tilityPads Culverts BobcatServices V egetationGrinding/ Mulching Bush Hog Computers Computers Call 429-3110 Electrify Your Service Business! Blinds/Wiindow Treatments Concrete Alleviate Debt Cleaning Cleaning Cleaning Cleaning Aluminum Im Cleaning Up!withmyadinthe Business & Service Directory YouCanT oo! CallToday toreserve yourspace 941-429-3110 "#tnt$n t%tfnnft Registered or Certi e d. &tnft#t'(tft )tf*##tntbn+ !"##t,tn my oridalicense.com Place Your Ad Here! Call 429-3110 Your Ad Here 941-391-0694Driveways Pavers Sidewalks UtilityPads Culverts BobcatServicesPou-Jac, Inc. 0010641 New Home Construction Additions Remodeling Detached Garages Window & Door ReplacementLic. & Ins. CBC1258602btnnfrfbt $rt rtr%t ft And Inspection&rt'trt Go GREEN!("# Sr. Discount &bt# ) *Over 30 Years ExperienceGARY DRAKE Insured Your Ad Here Attractions Auto Air Cond Concrete SCHULTE CONCRETE J.D. Schulte 941-493-1803 Cell 941-416-3092b !b"#$%n&# tft#$ttb %"#rbtn 't(t)tt*bbb Your Ad Here Construction Contractor Curbing Dog Grooming Dryer Vent Cleaning KUSTOMIZED KURBINGWeCanT ossYourRocksDecorativeRocks Starting @ $29.99Limited Supply We install941-623-6192Lic./11-00002010/Ins AC/DC+,-.'%,,.','FREE $39941-716-1476tfbfn&-bb!/+n01 bDuring Reg. Bus. Hours 941-544-3256 Cell 941-486-9104 PhonetffPoolCages ScreenedEnclosures FrontEntries CustomScreenDoors 6SeamlessGutter Soft&FaciaFacelift bttnfrOutsideSales Commercial Residential Aluminum of Venice, Inc. Appliance Repair Affordable, Honest 2 4/7 Same Day Appliance RepairAdvanced Appliance Repair 941-412-6783fbnbn 20% OFFLic. 990010102590/Ins Pawprints* individual appointments *s pecializingintoybreedsandsmalldogs 17 years ExperienceVanda lia Avenue North Port, FL 34286dog grooming(941) 257-8463 8528965 SUN-NiEL-Ill' LSPERSIlk-R&L Building Contractor, Inc. Money Problems941-743-8858 Got You FeelingGeneral Contracting ` OverwhelmedROOM ADDITIONS GARAGES h 1 and All Alone?CONCRETE DECKS -CARPORTS POOL CAGES Don't go it alone!LANAIS -ACCORDION SHUTTERS Non-profit agency can help!STORM PROTECTIONS CONSUMER DEBT COUNSELORSFREE, CONFIDENTIAL andQuality Work Competitive Pricing NON-JUDGEMENTALReferences CONSULTATION941-255-3236 or 800-801-3325C: 1254660 L www.debtreduction.org )Tj /TT1 1 Tf -0.5682 Tc 56.5909 0 0 6 63.4695 707.9323 Tm (' Pool Cages ScreenLanais Acrylic RoomsScreen Entries Rescreens Garage ScreensHandrail Hurricane Shutters Window Replacement $sILawn= )]TJ /TT2 1 Tf -0.0964 Tc 17.1413 0 0 15 45.4695 556.4369 Tm (HORIZONTALS HALL'S TRUCKING B'JACOBSEN Specializing i,r:I TO & BOBCAT SERVICES ENTERPRISES Additions Kitchens & BathsConcrete Removal Remodeling Interior Trim WorkStone Washed Shell Custom Hones BURNFill Dirt Mulch LeVasseurShell Driveway Installed Building & Remodeling. Ince cal Bli (115 1 it Yo ait Inc M ch ore! Small Tree & Brush Removal eeStave LeVae ur, {'residentS tt rs, h es BI id To T a e is D aperies Commercial & Residential Clean-Ups For i your conetr.,ction natl., cell e todayReasonable Rates & Reliable Service 941-698-9045t p n ft o s ur S o% r (941) 485-5717 No Job TooBigorSma11 www,levasseurbuildinq.com AS)]TJ -0.0449 Tc 7.4487 0 0 6 39.4695 441.9404 Tm (2 Ta i mi l ) 444 )Tj 0 0.502 0 rg /TT2 1 Tf 0.0504 Tc 11.5814 0 0 8 145.4695 441.9404 Tm (62, 1P rt h rl tt w s lu b n s.com Cell (941) 716-3650 941-391-0694POU-Jac, Inc. 0010641 7.71tc t.urwt a ir,enrodr -1 1I I 1 1[LI)Tj /TT3 1 Tf -0.0595 Tc 4.9405 0 0 10 208.9695 334.9437 Tm ( 9 1 11 11 11 11 1 ttA & Sdkd ft1 1 "I-4804M1 1 Fast vteks m1 1 .,xe=, x. H
PAGE 33

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 7 Landscaping Landscape/Lawn Landscape/Lawn Furniture Restoration Grab Bars Handyman Hauling btnbfrfbnbtrbfbrbnrbbbtfrttrbbrrtnInclude Your Business in This Directory. Call 866.463.1638 Im Cleaning Up! 941-429-3110with my ad in the Business & Service Directory You Ca n Too! Call Today to reserve your space btnt fr btt fr btfPalmer Builders Inc.( 941 ) 474-1473Licensed/Insured CBC054517 Hauling Construction Clean-Out Garage Clean-Out Yard Clean-Up Garbage Clean-Up Free Estimates! Same Day Service! 24 Hours a Day!No Job Too Large or Too Small!t941-764-0982 941-883-1231 Home Improvement grabbarguy.com Licensed & Insured HANDYMAN941-539-1694 PalmTreeLandscaping,Inc PalmTreeLandscaping,Inc 9 4 1 5 8 5 2 3 0 1 o r 2 3 9 2 2 2 5 1 2 7 9 4 1 5 8 5 2 3 0 1 o r 2 3 9 2 2 2 5 1 2 7 941-585-2301or239-222-5127 1 2 5 9 4 T a m i a m i T r a i l P u n t a G o r d a 1 2 5 9 4 T a m i a m i T r a i l P u n t a G o r d a 12594TamiamiTrail,PuntaGorda L i c + I n c F r e e E s t i m a t e s L i c + I n c F r e e E s t i m a t e s Lic+Inc.-FreeEstimates W h o l e s a l e & W h o l e s a l e & Wholesale& R e t a i l R e t a i l Retail S p e c i a l i s t i n S p e c i a l i s t i n Specia listin C o l d H a r d y C o l d H a r d y Cold, Hardy P a l m T r e e s P a l m T r e e s Palm Tr ees S y l v e s t e r S y l v e s t e r Sylvester P i n e a p p l e P i n e a p p l e Pineapple Q u e e n Q u e e n Queen F o x t a i l F o x t a i l Foxtail R o y a l R o y a l RoyalPalms: Palms: C h r i s t m a s C h r i s t m a s Christmas P y g m y P y g m y Pygmy C o c o n u t C o c o n u t Coconut F r u i t T r e e s F r u i t T r e e s FruitTrees Landscaping & Lawn Lawn Care btnfr btntfff *Re nishing* Repair *On-Site Touch Up *Antiques rbtn nftrtb nfnbnnbf n Ga tor Building & Design, Inc.btrrC ell: 941-916-5526Military Discount Free Estimates R emodeling Additions Kitchen &Bat hsLicensed&Insured License#CBC1254945 PressureWashing WindowsCarpets ANDMORE! My Friend Handyman ServiceLic./ Bonded tttt t !tt"941-321-4348 Lawn Care Lawn/Garden/Trees Kitchen & Baths btnfrttfttttn !" #$"$%%& !"&' "!$$#B ushHogging B rushMowing T ree,Lot&Vegetation Mulching T ree,StumpRemoval S electiveClearingLic. & Ins. Hoops Lawn Servicet#t $t!rLawn Cutting Weeding Trim ming Mulching Sod Palms Landscaping 941-258-8175Res./Com. Lic./Ins. 941-426-7844btnfrtr r rt rtf!""#n$bn%!$ Venice Englewood North Port Pt. Charlotte Rotonda Gulf Cove bt Mowing Mulch Stone Design Installation Trees Shrubs Great Equipment Great Work Ethic Satis ed CustomersLic. Ins. btnt frfbtbbt tb CALL TIM ( 941 ) 492-517116YEARSEXPERIENCE LICENSED&INSURED TJ MILAZO SR. 941-475-0058 LAWN CUTTING MOST LAWNS $20 $25 TRIM BUSHES PLANT DESIGN WEEDING & MULCHINGServing Englewood, Cape Haze Rotonda, S. Venice and North PortPROMPT, DEPENDABLE SERVICE 45 YEARS EXPERIENCE LIC. & INSURED (941) 255-3834 STEVENSCUSTOM PAINTINGFREEESTIMATESReferencesAvailableResidential,Commercial InteriorsandExteriorsQUALITYWORK AFFORDABLEPRICESFreePressureWashingwith ext.painting.26yrs.exp.Lic#10-00007724&Insured 1/2 PRICE HAULING & TREE SERVICE805-252-3452MovingLarge&SmallJobsFurniture,Appliance& ConstructionRemoval Demolition DeliveryService!tt %!!t&t 't( Licensed&Insured Gutter Cleaning/Handyman Handyman Handyman Handyman Handyman btntfr btf b trb t ttrt ftftt 941-223-7186 Full service lawn and landscape company on Venicesince1992 Burtons Lawn and Landscape HAUL AWAY POSSIBLY FREE(941) 268-0796 Aluminum Appliances Bicycles Hot Water Heaters Scrap Metal Any Others Free Estimates TW O MEN AND A TRUCK U .S. DOT No. 1915800 F ully Licensed and InsuredMovers Who Care 359-1904We sell boxes! MOVING HELPSave $PackingLoading DrivingJIM 223-687030 Years Exp. Itsyour move... LetstalkJFRich1@comcast.net Handyman Handyman Cutters (Masonry JR MASONRY & TILESTUCCO,CONCRETE, BRICK,BLOCK,STONE PRESSUREWASHING VETERANSANDSENIOR DISCOUNTSNoJobTooSmallYOUR REPAIR RESTORATION SPECIALIST(941) 716-0872 Moving ( Movers ( Moving & Hauling ( Painting ) (Mold "!& Testing Inspection Complete Build Back Wat er Damage Odor Removal Pressure Washing for House, Boat, RV, Business 941-244-0319 Vete rans Mold Services f'()((*+ Ken Violette, Inc. 941-240-6699 6 Seamless Gutters CALL FOR A FREE ESTIMATE Lic.&FullyInsured 941-525-7967 941-493-6736 James M. Okell%%,%% Remodel & Finish Work Cabinet, Door, Window & "!""! Full Handyman Services%$ft-../f$b%$A Carpenter Around The House941-270-1693 BillsHandyman Service941-661-8585 CeilingFans Lights Faucets Clogged Drains T oilets Appliances 15+YrsExperienceLicensedSP28235 BLUE PARROT,INC.AllInterior/ Exteri orWork NorthernCustomBuilderCALLBLAINE: 941-662-0266withexcellent references onquality,cost and professionalism. Li censed&I nsured Interior/Exterior Work Just Call and Ask! Excellent references onquality,cost and professionalism Y ourTotalHome MaintenanceProvider CALDWELLS HANDYMAN SERVICES CALDWELLS HANDYMAN SERVICES25+Years ExperienceLicensed FREEESTIMATESCALLDON941-585-3760Courteous, Prompt, Dependable & Affordable Service Handyman (Movers Handyman Your Ad Here Land Clearing *0!%, Handyman Handyman Handyman SP29201 PleaseSupportOurTroopsBasic Landscaping Dependability Accessability CustomerSatisfaction(941)504-3307 StartingAt$80* 50%inWinter Askaboutour specialoffers*(Restrictions Apply)per monthLic.&Ins. 8528966 P-A rJ )-216( _. )Tj /TT3 1 Tf -0.0177 Tc 15.6729 0 0 19 239.9695 927.1287 Tm [(Menis Sw1df'ur' ,)Tj -0.1354 Tc 17.3721 0 0 17 212.9695 910.1292 Tm [()154(_ _' handyman Seviee' LIC IINA 9Rescreening PeUy MJble Sealing P eswre Cleaning -s RooJCoating PlambingFirtares t(obDe& vReiair 1l A I f'y1IA )68(1Drywall Repair aul&t PalI ing Eel fiuurs ; 1 IGutter Cleaning Mat Wood Repairs Drger Vent ClewwgVenice NativeServing Sarasota County941.485.2172 )Tj /TT4 1 Tf -0.016 Tc 26.6026 0 0 20 129.9695 743.6343 Tm (J & J Mike a Vicki'sHANDYMAN Handyman Services DAN JE Painting )156(Yard Work: mowing, Dave Beck HAND Pressure trimming, all landscaping The Handyman, ,.r DO Washing Pressure Washing: Kitchen & Bath JUSHouses, pool deck. Countertops and Much Moret driveways Drywall BathrOver 30 Years Small Repair inside/ Texturing/Painting RemoExperience & Ceramic TileSatisfied outside your home Aluminum Screens Painting1 Customers No job too big 941-766-1767 AnnMythingor small! CRC 1327942 \ 941-697-(941) 623-3408 Licensed & InsuredCall For FREE Estimate Lic/ins Member BBB )Tj 1 0.502 0 rg /TT1 1 Tf -0.3947 Tc 32.7632 0 0 4 501.4695 537.6406 Tm (QDave BeckThe Handyman,u,cKitchen &Bath RemodelsCeramic Tile941.766.1767CRC 1327942LM I Licensed & InsuredMember BBB )Tj /TT1 1 Tf -0.2833 Tc 19.2317 0 0 13 494.9695 168.1519 Tm (110131 Mill C1,9 X,AM ON THE NON,MOVE, INC.loving & Delivery `iHonest, Reliable,1 Courteous,C p I l Very Low Rates )Tj 0.0174 Tc 7.6852 0 0 8 480.4695 82.1545 Tm (15 yrs. ExperienceLic. & Ins.941-237-1823FL. Miner Reg. No.1M1647

PAGE 34

The Sun Classified-Section A Page 8E/N/C/VSaturday, September 24, 2011 Let us clean & repair your outside living area FREE Evaluation(941) 979-0922Custom Rescreen Repair & Pressure Washing Get ready for Summer!Lic#RR0067695Insured Rescreening Rescreening Rescreening Rescreening btn frttwescreen o rida.comLic# SA37, AL0511993X 941-876-4779 SPECIALIZINGIN SCREENROOMS NEWANDRE-SCREENS 20+YEARSEXPERIENCE ROOFING& REPAIRS,LLC941-625-1894 ShinglesMetal T ileFlatRoofsGetaGreatRoofataLow PriceforRoofRepairsor T otalRoofReplacement Ca rpentryWork* Free Estimates Over25yrsExp.inSWFla Lic.CCC-13326838Ins. BondedSTEVES Roo ng Rescreening Roo ng Painting btnnfrntnnbfnnftfnnbfbbfffbtrInclude Your Business in This Directory. Call 866.463.1638 MyadinTheBusinessand ServiceDirectoryhasbroughtme loadsofsuccess! Call429-3110toplace anadforyourbusiness! Thanksto myadImBusy AllTheTime! Youcan betoo! Call429-3110 Your Ad Here Painting Baileys Pain ting and Pressure CleaningServing the area since 1983Ext erior/InteriorPainting SoftandFaciaRepairLic.& Insured in Sarasota, No. Port & Charlotte CountiesCHAMBERMEMBER941-497-1736 btb nfrbbrb Bi-weekly Chemical Service Leak Detection Licensed & Insured Owner Operated 941.585.1711 Pool Decks Bensons Soft Wash Cleaning941-697-1749 941-587-5007 Roofs P oolCages Lanais Driveways...ETC!BensonsSoftRoofWash.comb btnt frVENICE PRESSURE CLEANINGbtbn tbfrttb tb Pressure Cleaning JUMP IN! Call 429-3110 Reachthousandsof customers withyouradinthe BusinessandServiceDirectory Pressure Cleaning Mark Hunter Painting941-475-2695Call Mark Fine Interior & Exterior Painting My 32nd year in business Perfect work, prompt service Pay nothing until work complete Over 1,200 Jobs Completed Free Estimates, Bonded, Insured btn Painting Painting Painting LARRYS PLUMBING941-484-5796R e-Pipes Mostin1Day WeW illBeat AnyEstimates CompleteServiceLic.#CFC1425943 1-941-204-4286 NEED A PLUMBER ?Call Local Experts 423-3700 btnrrfrnn rrnnrnBack ow TestingONLY $19.95fr rrbSwift Plumbers.com Aaron Swift, Inc. Utility Department Charges $35.00State license # QB42652 Plumbing/ Leak Detection Pool Cleaning Pressure Cleaning RECISION LUMB ING 423-3058 tnfrrnState Certi ed Master Plumber Lic. & Ins CFC1427378REPIPES Slab&WallLeaks Replace,Repairs & Remodels Backow FULL SERVICE PLUMBING !"#$ %&'(f%)'n frnbnnnn%*'+& ,bf*&''-.b/"fnnnn.f%*''btbn fbrnfn,3fr.rrff.*'b/btnbFREEESTIMATES,+5*/+8)*)9Lic.# 22454 & Ins. Residential& CommercialFREEESTIMATESLicensed&Insured 01036730405875ServingSouthwestFlorida941-474-9091FullSer vicePaintingCompany F urnitureRenishing FullSpr ayShop P owerWashingSuperior P ainting,Inc. AAA009837 Plumbing bb !"#t$% &'()*(+)*(*'b New Construction Custom Home/ Repaints Interior Exterior Pressure Washing fffrrbt (+,"b Plumbing Remodeling Painting Painting t nbnbn ftn CALLALFormer Fire ghter941-468-266025 Years Experience Licensed & insured 50% OFFLic. # AAA00101266 GUY CORICACustom PaintingInterior Exterior Quality Work Honest Prices Drywall Repair Wallpaper RemovalFREE ESTIMATES Prompt, courteous serviceCall Guy,+5*/*:85*+5 Mike DymondQuality Painting941544-0764 Interior/ExteriorRepaints Residential/Commercial Pressure Cleaning 27YearsExp-ManyRef. Free EstimatesSENIORDISCOUNTSLic#990010072743&Insured frtt WE INSTALLConcrete & PaverFREE Estimates We AcceptCreditCardsP atios PoolDecks Sidewalks DrivewayExtensions941-623-6192Lic./11-00002010/InsKUSTOMIZED KURBING Pool deck Driveway designs Garage oors Patios Senior Discounts 941-375-1103Lic.Ins Quality DecksFree Crack Repair with Complete Renovation Painting Painting Plumbing Your Ad Here Pavers Put this ad space to work for you! 8528967 Alexander's Larry's PaintingAndpaper V U L OisPainting Etc. Waif15 Year Pro Interior/Ext(941) 228.6747Drive/Garage/Deck FREE ESTIMATESRemovePressure Wash/Re it No Job Too SmallllPre-Rent/Sale Spec NortheastFree Est, Ref, Uc, Ins. Workmanship and941-496-9131 Reasonable Pricesor Fully Licensed941-223-0941 and Insured IFSwe 1 B apit1 B 1 1will) Ali it0% OFF t o ,hot)Ulan] )Tj /TT5 1 Tf 0.0047 Tc 6.7974 0 0 13 564.2664 551.3431 Tm [(`'Retired but not tired"Faucets, Sinks, Stools, GarbageDisposals, Pressure Tanks,)Tj -0.0166 Tc 4.15 0 0 9 157.2664 525.8439 Tm (aWater Sofeners/Filters Elc.aTa Most Anything,lust Ask AtRossMaster PlumberRF11067393 )Tj /TT3 1 Tf -0.0293 Tc 5.7462 0 0 8 479.2664 328.3499 Tm (Our Cvd } h 100 $aidadian 1 fSpectailzin In t )Tj -0.1428 Tc 5.9286 0 0 6 713.7664 316.8503 Tm ('Lungin Place.Modifications I Iq -ResidentialOput airsInside-.. -Small RemodelingProjects .:y ,)Tj /TT6 1 Tf -0.0714 Tc 5.9286 0 0 6 473.7664 257.8521 Tm (l v, .., u ire a -)46()98(s' ..941-493-813830 years experienceOwter:. Walt Eros)Sarasota County Only )Tj /TT0 1 Tf -0.0233 Tc 13.551 0 0 14 317.2664 168.3548 Tm (E & F Randy Haskett Re-Roofing & Repair Specialists;tescreens Screening LEONARD'S ROOFING,amlyOwned &Opeated & INSULATION INC.)1(Pool ea es Licensed & Full Insure d Family owned andFl )Tj -0.0684 Tc 10.0841 0 0 8 307.2664 126.3561 Tm [(Lanals 9 25 yrs. of experience 9ertified operated since 1969' II I )130(Earr ry ysdErs SPECIALIZING IN ` nRESCREENING Shingle Sir Mle Metal PlyHonest, )144(pe,da lE, POOL CAGES Tile Full CarpentryReferences Available. & LANAIS Built-up Service AvailableAlso Repairs, Entryway.,=REE ESTIMATES Garage, Sliders-icensed &. Insured. No Job Too Small Reagan Leonard 488-74789or I -9 493-4 -457570 809-1171 93 Lic.lt RC 0066574o

PAGE 35

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 9 Tile Trailers Your Ad Here btntnftbtrtttnrbttrnrrbfInclude Your Business in This Directory. Call 866.463.1638 Place Your Ad Here! Call 429-3110 $1 per sq ft.CALL NOW!941-979-9902 A JAMISON TREE SERVICE 941-423-0020 btbnfrr bbrbtbr bbbb r 475-6611 PC 539-2644 Prof. Arborist FREE Estimate! Expert Tree Trimming & Tree Removal All Phases of Lawn Care 941-408-8654 Dietrich Tree ServiceLICENSED & INSURED Ware house Bay Rentals V enice Warehouse Complex Warehouse Rentals Well Drilling Window Cleaning PROFESSIONAL TREE SERVICE941-624-4204 Stump Removal Palm Trimming Removals Hedge TrimmingFr ee Estimates 10% Senior Discount 25 Years ExperienceLic. #001053 Insured Tree Service Call 429-3110 Electrify Your Service Business! JUMP IN! Call 429-3110 Reach thousands of customers with your ad in the Business and Service Directory 941-815-2126 10% Senior Discount Palms / Hedges Trimmed Removals Trees Planted Stump GrindingOaks Thinned & Raised UpDPs ABILITY TREE SERVICELic. #0000006131 / Insured Tree Service Windows Sliding Glass Door941-706-6445Wheel RepairsWindows, Doors & Home Repairs Lic. / Insuredbtn bfr Windows Tree Service 941-460-8500 863-221-9037 Lic#CC20597 Roof Maintenance Screening Stucco Tile Tile Your Ad Here Tree Service Roo ngRoofing Roo ng !"#$% Family Owned Since 1961 New Roofs, Re-Roofs, Repairs All Types of Roo ngFL Lic #CCC1326751 Lic # CRC1328045 GAF ELK Certi ed Roofing Roofing Roo ng AnyColor-EvenClearR24RValueShingles Built-upTileFoamPolyesterMetalFlatRoofs&More. A-1 COATINGSWhy replace it when you can save it!12YearWarrantyPreserves&Rejuvenates IncreasesWindProtectionMildewResistant426-9354423-5458800-221-6751Lic#AAA771910% Discount Roof Coatings SP30896941-628-5912 LEAKINGROOF?LeakSpecialistCallTheRICHARDTHOMPSONROOFINGHUMANCONTACT NOW40YearsOwnerOperatorLic#RC29027056&Insured941-637-6555 Roo ng Your Ad Here 8528968 CLEANING SERVICES5060 LuLusCleaning & Landscaping Relax, let me do your Fall Cleaning 22 yrs. exp. 941-416-0975 Cheryls Sparkling Clean Service, Reasonable, Reliable 30 yrs. exp. 941-426-8401 ADVERTISE In The Classifieds! Classified = Sales CHILD CARE5051 ALL CHILDCARE F ACILITIES MUST INCLUDE, WITH ADVERTISEMENT, STATE OR LOCAL AGENCY LICENSE NUMBER. COMPUTERSERVICE5053 COMPUTER TUTOR (Your home or mine) ONLY $25.00 an hour! Please call Steve at: 941-445-4285 GET RESULTS USE CLASSIFIED! ADULTCARE5050 ALTERNATIVE TO NURSING Hm Beautiful Rm & bath avail. in Priv. hm in Venice. Lic. CNA will provide care. 941-493-1879 CHILD CARE5051 FLORIDA STATE LAW r equires all child care centers and day care businesses to r egister with the State of Florida. The Sun Newspapers will not knowingly accept advertising which is in violation of the law 5000 B USINESS SERVICES AN OCCUPATIONAL LIC. may be required by the City and/or County. Please call the appropriate occupational licensing bureau to verify. BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! BUSINESS OPPORTUNITIES4010 VENICE MINI STORAGE F ACILITY, 425 Units, $1.1M. MaryBeth, Preferred Properties, Realtors 941-416-3829 ASKUS HOW you can place a PICTURE of your item for sale in your classified ad! DO IT THE EASY WAY! F AX IT!!For your convenience you can fax us your classified ad.North Port 207-1200 Englewood 426-3576 Port Charlotte 629-7740 Arcadia 494-3533 f afill )Tj -0.1111 Tc 101.4445 0 0 33 144.7664 744.3345 Tm (s )]TJ /TT4 1 Tf 0.0009 Tc 11.2511 0 0 16 27.7664 718.3353 Tm (James Weaver ENGLEWOODRoofing ROOFING Shirelles, Slate, Family )Tj -0.0657 Tc 6.7755 0 0 8 123.2664 686.8363 Tm [(L100K Us,iiepaksOwned & Old Roof RemovalOperated Otr SpecWtySince 1984 FullCwpw*y426-8946 NEW ROOFSFr~ weenum RE-ROOFS REPAIRSFree Estimates Pub Insured Commercial & ResidentialState Lit.e0001325679Metal, shingles, flat roofs. Re-roofs Are Our SpecialtyReplace & Repair ,AiftIttNYZ Sus: 941-474-5487Lice & at r `-ax: 941-475-079.' .:all Ron Call doh )Tj /TT8 1 Tf -0.0247 Tc 27.6667 0 0 27 73.2664 522.3413 Tm ( RICH LANDBRS CE10IIC TILE LEMON BAY TILESALES AND/OR )Tj /TT4 1 Tf -0.0088 Tc 10.0688 0 0 23 299.7664 505.3418 Tm (STUCCO, INC, INSTILL/ 'ION When Quality CountsNew Constriction Convert bath tub to easy& Remodels 35 YRS EXP. access showerRusted bands & NO JOB T00 SMALL Handicap access shower 20x20 Porcelain Shower repair/Replace from $3.69Wire Lath Repair. Free In-Home Shopping12 yrs. In Rotondo West. Licensed & Insured ProfessionallySpraycrete & Free estimates. -Owner/Install InstalledDry-wall repair. Installer/Owner. Over 20 Years in Englewood948 474-1000 .,.visa 1(941)497-4553 941-697m )Tj /TT4 1 Tf -0.024 Tc 12.4299 0 0 13 117.2664 346.3467 Tm [(Trailer Repair momMajor & MinorBoat/UtilityTrailersSprings, AxlesBearings, Tires 101Lights & WiringEnglewood ""' v V eTrailer Center On941-460-9700 )]TJ -0.057 Tc 15.3619 0 0 12 217.7664 160.3524 Tm [(Mater Works Well Drillirg WE DO Custom jfom6 e(/)(W rs, .Inc.re 9 WINDOWSPRESSURE Windows, Doors &WASHING More...)-408(,O 41-484-3634 NewCustomer Jeff Reinhardt,:_c Specials Replacement Windows Interior DoorsPackage Deals a,PS nSIII cd 1 Hurricane Protection Garage Doors & Patio Doors" IrriF:dien In?tolled )13(, Repiire
PAGE 36

The Sun Classified-Section A Page 10E/N/C/VSaturday, September 24, 2011 HOUSEHOLD GOODS6030 STEMWARE HAND cut sets of 8/wine, water, etc. $15, OBO 941-624-0364 T ABLE 16x20 wood tbl. top 6 adj. hgts. 3 adj. angles. Folds. NEW $15 941-6255211 TABL E LAMBS 2 big 3ft.end table lamps $25 941-4732150 T ABLE TOP burner Ruffoni, copper, never used $125 941-380-3000 TURKEY FRYER 36 qt. complete outdoor propane NIB. $60 941-380-3000 TV CONSOLE Black, 55long. 2 shelves. Like new. $95 941-240-2848 TV TRAYS PECAN TRAYS ON SWIVEL STAND $50, OBO 941-447-8149 UTILITY CART folding utility cart still in package $30 941237-1085 VACUUM DYSON dc-25 Animal w/warranty $295 941698-1039 VACUUM,BISSELL VGC Clean, Bagless, all attachments $35 941-894-4115 WALL ART 48x60blk & gold, Manhattan skyline w/ T win Towers. Lv. msg. $100. 941-255-0237 WINE SET 16 piece La Virgina, Wine opener & accessorizes. $15 941-276-0271 HOLIDAYITEMS6031 1992 XMAS Quilt 48x64 W/pillow 14x14.J.L.Hudsons.dated ex.cond. $35 941-625-5211 BYERS CHOICE V ictorian Carriage 15h 30l $150 941637-6474 GOEBEL DATED WHT CHINA ORN VINTAGE PCS W/BOXES EA $15 941-639-1517 VICTORIAN FAMILY House of Hatten Victorian Family $75 941-637-6474 FURNITURE6035 1) SET movie seats,seats fold up great for kids $65 941623-3496 A FURNITURE SHOPPE Selling QUALITY Used Furniture 941-473-1986 BAKERS RACK Cream metal,4 glass shelves exc. cond. $150 941-492-7198 ADVERTISEWITHTHE SUNCLASSIFIEDS BAKERS RACK V ery decorative, metal, exc cond. $125 941-468-3252 BAR & Game Table Marble tops, like new! 2 stools, wood. $375, OBO 941-716-9912 BAR STOOLS (4) wooden, 25 H, $20/ea or $70/all, OBO 941-979-7112 BAR STOOLS 2 beige swivel stools 24 $120 941-2551255 BARSTOOLS 2 metal bases, fabric swivel seat. Exc cond. $100 941-468-3252 BED MATTRESS/BOX. New will sell $100. 941-629-5550 BED Queen,headboard, footboard, frame, med dark wood, a beauty $250 941-255-0275 BEDTWIN Adjustable,new mattress, has massage & heat $395, OBO 941-423-2091 BEDROOM SET, King, 7 pcs. solid oak, med. finish. Exc. cond. $575. 941-445-5533 BEDS, LOVESEAT dressers, endtables lamps Kitchen /chairs, more $100/all 941-740-4769 HOUSEHOLD GOODS6030 DRAGON MIRROR Beautiful,18in.round $50, OBO 941258-5698 ELECTRIC FIREPLACE Antique White $150, OBO 941-637-7032 FLOOR LAMP TIFFANY STYLE$65 941-716-9912 FONDUE SET Stainless Steel. 6 forks. Like new. $25 941240-2848 GOLD & SILVER SILVERWARE serv.12 dbl.serv pcs. wd.case $115, OBO 941-624-5211 HALLMARK TABLE Covers:(5)New. Great for fall gatherings. $5 941-276-1881 HEADBOARDS (2) T win size, Brass-plated $75 941-9238715 HEATER STOVE V intage $495 941-496-9252 HOME INTERIOR print new r ooster framed print 24x28 $35 941-228-1745 I BUYFURNITURE Or anything of value! 941-485-4964 Kenmore Grill, Good Condition, Plus Extras! $100. 941-460-1756 KEURIG COFFEE POD HOLDER EC, holds 30 pods $12 941-505-1492 LIGHT FIXTURE (w/bulb+cord) 4 fluorescent $7 941-629-8955 LIGHT FIXTURE (w/bulb+cord) 4 fluorescent $7 941-629-8955 LUGGAGE 3 piece with wheels $30, OBO 941-6251328 MATTRESS, QUEEN AND BOX. Brand New will sell $175. Also have KING. 941-629-5550 MATTRESS/BOX. New Will sell $100. 941-629-5550 MATTRESS & BOX SPRING -2 sets Twin, Exc. Cond., Clean $350 941-923-8715 MATTRESS + frame QNNO BOXSPRING NP-area $50 941-544-1128 MATTRESS SET King, Sealy Posturepedic Firm 4 years old XLNT $395 941-258-0472 MICROWAVES 3 sm counter top used $18 941-475-7507 Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week OUTSIDE GRILL George Foreman pedestal electric bar b q $40 941-564-8770 PICTURE, LIGHT UP with sound. Northern autumn scene. $40 941-235-2330 PICTURE, LIGHTED motion fish swimming, 11by19 mirr or brder. $20 941-423-2585 REVEREWARE 10 pc set Made in USA Exc cond $40 941-423-9371 SHEET SET, king USA made blu.2xtra lg.towels 3blankets brn.All for $25 941-625-5211 SHELL PICTURE 36x48 Signed $50 941-492-7198 SHOPPING BAG: Giant Mall of America, zippered pouch. $5 941-276-1881 SHOWTIME ROTISSERIE by Ronco, like new $30 941-2559788 HOUSEHOLD GOODS6030 AREA RUG 5x8.new.never used.oriental design.brown. $79, OBO 941-235-2203 BEDSPREADKING w/shams, multi-colors, new. $85 941473-9773 BEDSPREAD QUEEN white bkgd w/blue,pink,green flowers. $10 859-466-9572 BEDSPREAD TWIN & Pillow tan,blue&rust.Smoke/Pet free home. $25 954-809-5325 BLANKET/SHEETS:KING Monets Water Lilies Nice. $45 941-276-1881 CARPET-ORIENTAL NAVY w/Blush-Slate Blue floral border $80 813-240-0844 CEILING FAN beautiful hand carved elephant and leaf detail $300 941-429-8507 CLASSIFIED ADSSELL CHAMPAGNE GLASSES Mikasa new set of 4 black. $20 941-228-1745 CHINA SANGO majesty r omanica platinum collection 64pc. $250 941-473-2150 COMFORTER SET King Pretty floral with piping. $25 941-698-0154 COMFORTER SET Queen Reversible blue dolphin with curtain $20 941-698-0154 COMFORTER SET Queen Reversible cheetah with 2 dec. pillows. $20 941-698-0154 COMFORTET SET twin 6pc,solid or blue/biege stripe new cond $20 941-575-1393 COMPLETE BATH:BROWNS w/white.Linens/accessories.N EW. $45 941-276-1881 DEHUMIDIFIER LG brand 45pint capacity. NEW COND. $100 941-423-2585 DESIGNER AREA Carpets 2 124x96 and 90x69 $300 941-505-0920 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** 6000 MERCHANDISE AUCTIONS6020 SATURDAY September 24, 2011 10 AM Preview at 9:00 amOil Painting and Frame Warehouse23196 Fr 23196 Fr eedom Ave. eedom Ave. Charlotte Harbor Charlotte Harbor , Florida 33980 Florida 33980Auction Location: Auction Location: From Peace River Bridge in Charlotte Harbor, travel HWY 41 north approximately 1/2 mile to Touch of Class Car W ash. Oil Painting and Frame War ehouse is located right behind Touch of Class Car W ash. __________________________Partial list of items for sale: Office Equipment, HYSTER FORK LIFT, Briggs and Stratton power washer, Almost new T ran A/C system with ducts, BLACK MAX 5 hp Air Compressor, 16 ft extension ladder, 16 foot utility trailer, 27 ft 1987 Class C Holiday Rambler Camper, pallets of Frames of all sizes and so many more items. EQUIPMENT: Fletcher 1100 Oval Mat Cutter, Vacuseal 4366M Combination Vacuum Press, C&H Advantage Pro 60" Straight Line Mat Cutter,Fletcher 3,000 Wall Mount Cutter, Morso Chopper, 24" Paper Dispenser, 30" Paper Dispenser, 36" Paper Dispenser, 48" Paper Dispenser, Mitre Mite VN42 Under Pinner, Coner Vises, Print De Roller, 10" Frame Square Mitre Saw, 12" Boseo Double Head Mitre Saw, Avery Microtach Tool (Large and Small), Release Boards for Vacuum Press, Roll Adhesive Tissue for V acuum Press, Rolls Print Guard for Vacuum Press, 44" Canon IPF 8100 Printer, Lowel Tota Hot Lights, Rolls-various sizesart papers for printer, Delta Dust CollectorAB 2321 AU 1191Please visit our web site for additional information about this auction.W eb:www.PhillipWilsonAuctioneer.com AUCTION ARTS AND CRAFTS6025 EASEL V lrg on casters w ratchet adj only $88 941-6971102 FRAMED PRINT, JIM HARRISON39X23/signed SC Artist41/975 $499 941-6981039 DOLLS6027 BARBIE ROSE SPLENDOR Collector edition w/box, stand, cert. $15 941-258-2016 BARBIE DOLLS 22 all new in boxes Special Editions $400, OBO 941-467-5716 STEIFF BEARS MIB Tea Set 4 Bears $495 941-637-6474 STROLLER VICTORIAN Doll Stroller Orig. Paint $225 941637-6474 HOUSEHOLD GOODS6030 1970S OSTER Kitchen Center 5units in 1,Gold like New $125 941-698-1039 AIR CONDITIONER, Sharp, r emote control, 6200 BTU, Newer $80 941-637-6374 PLUMBING5160 THINK PLUMBERS are too high? Give me a try! Retired master plumber. Lic. RF11067393 Ross (941)-204-4286 POOLSERVICES5165 AZTECH POOLS Personalized Complete Pool Serv. & Repair Lic/Ins. 941-585-1711 CLASSIFIED SELLSCALLTODAY!941-207-1200 V enice/Englewood Nor th Port areas OR 941-206-1200P t. Charlotte Areas PRESSURE CLEANING5180 DIRT BUSTERS PRESSURE CLEANING LLC. W alls, Driveways, Sidewalks, Roofs...ETC. No Job Too Big or Too Small 941-286-4671 or 628-8326 Lic./Ins. ROOFING5185 KETTERS ROOFING. Specializing in Re-Roofing & Repairs #CCC1325663 (941)-815-8633 Lic./Ins. 6000 MERCHANDISE GARAGE SALES 6001Arcadia 6002Englewood 6003Lake Suzy 6004Nokomis 6005North Port 6006Port Charlotte Deep Creek 6007Punta Gorda 6008Rotonda 6009Sarasota 6010South Venice 6011Venice 6012 Out Of Area 6015Flea Market 6020Auctions MERCHANDISE 6013 Moving Sales 6025Arts & Crafts 6027Dolls 6030Household Goods6035 Furniture 6038 Electronics 6040TV/Stereo/Radio6060Computer Equip6065Clothing/Jewelry/ Accessories6070Antiques & Collectibles 6075Fruits/Veges 6090Musical 6095Medical 6100Health/Beauty 6110 Trees & Plants 6120Baby Items6125Golf Accessories6128Exercise/Fitness6130Sporting Goods 6131 Firearms6132 Firearm Access. 6135Bikes/Trikes 6138Toys 6140Photography/Video 6145Pool/ Spa & Supplies6160Lawn & Garden6165Storage Sheds/ Buildings6170Building Supplies6180Heavy Constr. Equipment 6190Tools/Machinery6220Office/Business Equip & Supplies6225Restaurant Supplies 6250Appliances 6260Misc. Merchandise 6270W anted to Buy/T rade HEATING& AIR5090 FRESH AIRCooling is offering $500.00 off the purchase of a new A/C system with the mention of Promo #2468. A 10 point inspection of your existing A/C system for only $29.95 with the mention of Promo #3690. Call: 941-429-6200 to schedule your appointment. Coupons expire 10/31/2011. HOME / COMM. IMPROVEMENT5100 CARPENTER, INC. Handyman Rotten wood, window, doors, cabinet repair, soffit, facia. Phil 941-626-9021lic. & ins. CERAMIC TILE installed from $1 per sq ft Call now! 941-979-9902 DAN THEHANDYMAN Bath rm & kitchen remodels Painting, Carpentry, Anything? 941-697-1642 DA VE`S HANDYMAN Honest, Knowledgeable & Reliable. Call for all your needs, Sm/Lg 941-628-8326 Lic/Ins FCI CONSTRUCTION Concrete, Masonry and Demolition. Driveways, Additions, Commercial Buildings. Lc./Ins. 941-628-5965 HANDYMAN 25 Years Exp. Quality Assured.Handy Randys Home Improvement Svcs. (941)-268-3522 PUTCLASSIFIEDS TOW ORKFORYOUV enice,Englewood, North Port 2 2 0 0 7 7 1 1 2 2 0 0 0 0Pt.Charlotte Areas Call 2 2 0 0 6 6 1 1 2 2 0 0 0 0 HURRICANE PROTECTION W indow Replacements & Installations. Installed or Do-it-yourself 941-769-1679 QUALITY DECKS Pool Decks, Garage floors, Patios & more. FREE crack Repair with renovation. 941-375-1103 LAWN/GARDEN & TREE5110 AN OCCUPATIONAL LICENSE may be required by the City and/or County. Please call the appropriate occupational licensing bureau to verify AFFORDABLE MOWING by the cut or by the month 941-623-3297 BASIC LANDSCAPING *Dependability *Accessability *Customer Satification STARTING AT $80/per mo Some restrictions apply. Lic/Ins 941-504-3307 BURTONS LAWN & Landscape Full service since 1992 Accepting new act. 941-223-7186 HOME MAINTENANCE, mowing & trimming Serving Charlotte Co. 941-916-8504 P AINTING/ W ALLPAPERING5140 BEST PRICE FOR QUALITY JOB! Best Coast Painting Residential/Commercial Handyman services also! V isa/MC/Disc accepted 941-815-8184 AAA00101254 illillillillilllllllllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIillillillilliililillkftwooooooD0 )Tj -0.1541 Tc 234.475 0 0 55 18 96.0333 Tm (a G

PAGE 37

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 11 YEARENDMODEL US41BypassBusiness41 Buick-GMC T ake41Bypassto Business41.Justover thebridgeonyourright. 20MinutesNorthof To wnCenterMall btnnfbrbnbnfn BUICKGMC b !"n #$%f" &"'('))'* bnnf++, On ly37KMiles St#1B308A Was................$17,955 Discount..........$3,105 Tr ade................ $3,000 2008BuickLucerneCX SalePrice$11,8500%FINANCINGFOR60MONTHS...PLUS$1,000REBATE* ONALLNEWGMCVEHICLESINSTOCKEXCLUDINGTERRAINSt#1GT388 NEW 2011GMCSierra CrewCab 25MPG M.S.R.P.................. $33,746 Fa ct oryRebate...... $4,505 DarbyDiscount..... $2,250 CashorTrade......... $3,000U .S.A.A.PrivateOer... $750 $ 23,241SALE PRICE $ 285/ moORLEASEFOR 0%FINANCINGFOR60MONTHSSt#1011 NEW 2011GMCSierraDenali H.D25004WheelDriveCrewCab 0%FINANCINGFOR60MONTHS NEW 2011GMCSierraExtCabSLESt#1G561 JUSTANNOUNCEDSt#1B381B Was...............$21,975 Discount.........$3,010 Tr ade...............$3,000 2008GMCEnvoySLT SalePrice$15,965 On ly49KMiles St#CP353 Was...............$20,965 Discount.........$2,000 Tr ade...............$3,000 2008PontiacG6GTConv. SalePrice$15,965 On ly44KMiles St#CP366 Was...............$25,899 Discount.........$1,000 Tr ade...............$3,000 2008CadillacCTS SalePrice$21,899 On ly21KMiles Was..............$12,965 Discount........$850 Tr ade..............$3,000 2002ChevySuburbanLT4x4 SalePrice$9,115 On ly85KMiles St#1B512A St#1BT583A Was...............$13,900 Discount.........$900 Tr ade...............$3,000 2006BuickLaCrosseCXL SalePrice$10,000 On ly55KMiles St#TP185A Was................$5,999 Discount..........$850 Tr ade................$3,000 2002ChevyVenture SalePrice$2,149 F amilyVan St#1G518A Was...............$28,495 Discount.........$1,500 Tr ade...............$3,000 2008LexusES350 SalePrice$23,995 On ly31KMiles St#1B308A Was.................$8.985 Discount...........$2,000 Tr ade.................$3,000 2005DodgeCaravan SalePrice$3,995 On ly88KMiles St#TP184 Was................$15,725 Discount..........$1,000 Tr ade................$3,000 2008KiaSedona SalePrice$11,725 On ly44KMiles St#CP358 Was.................$17,499 Discount...........$850 Tr ade.................$3,000 2008ChevyMalibuLT SalePrice$13,649 On ly22KMiles St#TP178 Was................$28,850 Discount..........$3,350 Tr ade................$3,000 2008CadillacSRX SalePrice$19,500 On ly38KMiles St#1BT504A Was................$10,975 Discount..........$1,000 Tr ade................$3,000 2002LincolnLS SalePrice$6,975 On ly71KMiles St#1B444A Was................$24,965 Discount..........$1,200...... Tr ade................$3,000 2008PontiacG8 SalePrice$20,765 On ly15KMilesbtnfttrfbbfbrfftbfbbbtnrfffbbtnf ffbrf!b "#tffbfbtnf$ffb%& n tt'fb(NavigationSystem,20Chrome Wheels,Heated&CooledSeats, FullPower,Loaded! $ 9,000!SAVE $ 23,358 24 MPG 24 MPG NEW 2011AcadiaSLEM.S.R.P.................. $35,942 Fa ct oryRebate...... $2,000 DarbyDiscount..... $2,340 CashorTrade......... $3,000U .S.A.A.PrivateOer....... $750 $ 27,852SALEPRICE 0%FINANCINGFOR60MONTHSSt#G1263 26MPG St#1GT543 NEW 2011GMCTerrainSLEM.S.R.P.................. $25,997 DarbyDiscount..... $1,366 CashorTrade......... $3,000U .S.A.A.PrivateOer... $750 $ 20,861SALEPRICE 32MPG 2.9%FINANCINGFOR36MONTHSM.S.R.P.................. $33,637 DarbyDiscount..... $2,524 Rebate..................... $4,005 CashorTrade......... $3,000U .S.A.A.PrivateOer... $750 SALEPRICE 8527510 0.9%APRASKUSABOUT WILDEHondainSarasota New|Used|Parts|Service CLICKgowildehonda.com CALL877-471-0088 GO7333STamiamiTr.SarasotaCarbuyingmadesimple! WILDESOCIALNETWORK F A F F N &FOLLOWER S PECIAL S*36mo./12,000milesperyearleaseplustaxtoapprovedpreferredcredit.Tax,title,license,acquisition,FLanddealerfeesextra.Securitydepositwaivedto approvedcredit.710+beaconscore.Vehiclemustbefromdealersstock.Buyersmustqualify.^0.9%forupto60monthsequals$17.05per$1000borrowed, nodownpaymenttoqualiedcustomers.**Basedon2010EPAmileageestimates,reectingnewepafueleconomymethodsbeginningwith2010models.Use forcomparisonpurposesonly.Donotcomparetomodelsbefore2009.Youractualmileagewillvarydependingonhowyoudriveandmaintainyourvehicle.Offer expires09/30/11. $269ZERODOWN! e r m o n t h 36months* Leasefor 2 0 1 1 A C C O R D L X 23/34CITYHWYMPG** 21/28CITYHWYMPG**$249 LeaseforZERODOWN!2011CRVLX2WD4DR AUTOMA TIC A A YES,WEHAVE INVENTORY,DRIVE A HONDATODAY! 8526961 FURNITURE6035 DINING SET Natural Rattan,4 chairs like new, from Leaders $295 941-627-6542 DINING SET Rattan, glass top, 4 caneback chairs.great cond. $200 941475997 DINING SET rattan, glass top, 4 caneback chairs. great condition. $200 941-475-9197 DINING SET Tbl.& 4Chairs + 5 more matching pcs. NICE $325 941-661-8117 DINING SET: black iron & glass top table w/ six chairs $300, OBO 941-716-9912 DINING TABLE set 6 chairs glass top stone base txt pic $150 941-286-1651 DRESSER 6 drawer,solid wood,masc. excl. $130, OBO 941-979-7112 END TABLES (2) & 2 lamps ceramic light beige glass tops $99 941-544-1128 NP ENTERTAIN. CTR/CABINET good cond. MUST SELL $499 856-381-8617 ENTERTAINMENT CENTE R cherry & maple. Also 44 LG projection tv. Both exc cond. Orig over 5000.00. Askin g $1200/both. Will sell sepa rately. Call 941-497-2310 ENTERTAINMENT CTR. Glass/chrome,4pc.lighted $300, OBO 941-456-2840 F ARM TABLE painted ivory, decorative legs $125, OBO 941-716-3259 FILE CABINET Home 3 dr, letter/legal Cherry finish, ornate dtl $60 941-624-0364 FUTON solid cherry wood, expensive plush mattress. New!$200 941-698-9467 FURNITURE6035 CORNER CURIO Off White could be used for sm dish display $150 941-249-0885 COUCH AND matching love seat $75 941-623-3496 COUCH, Sectional, 2 desks, china cab, ent. ctr,lanai (8pcs), APPLIANCES. (941)-764-8272 COUCH, LOVESEAT Leather, beige, Great condition $375 941-270-2199 DARK BLUE leather couch $110 941-623-3496 DAYBED W/TRUNDLE w/matching nitestand.ln. $375, OBO 941-235-2203 DESK AND Hutch w/chair, like new, cherry color $499 941429-8507 DESK CHAIR Dk green, w/arms & adjustable $30 941-698-6692 DESK, CHILDS wooden with chair good condition $25, OBO 941-256-6962 DINETTE SET 42 in round glass & metal table,4 chrs. Lovely! $225 941-468-3252 DINETTE SET 48 oak table 12leaf 4 Chairs Good condition $175 941-255-1255 DINETTE SET Round lt beige table,6 chairs $120, OBO 941-637-7032 DINING CHAIR Auth. Rachel Ashwell, lined, slipcover. $175 941-716-3259 DINING RM. Chairs American Drew,Oak, 2 Arm, 2 Side, Exc. Cond. $195 941-575-1942 DINING ROOM COMPLETE 11 PC.,EMAIL PICS $499 941-493-7238 DINING ROOM T ABLE 42X66 w/2 18 leaves, med wood $125 941-698-6692 DINING SET hidden leaf w/4 chrs & buffet. $410, OBO 941-979-7112 FURNITURE6035 BED DBL W/FRAME:CLEAN $85 941-661-8117 BEDS, with headboard Twin $30 & Queen $70 941-429-9122 BOOKCASE LIGHT wood 72X28 good condition $25 941-661-3775 BUFFET OFF white with custom glass top $150 941-249-0885 CHAIR AM. SIGN.FURN Kendall Stripe $200. 813240-0844 CHAIRS (4) brown wicker, black metal legs 33H x 16W $40 859-466-9572 CHINA CABINET Oak, 36x17x72. Glass doors. Leave message. $350 941255-0237 COFFEE TABLE Large 34x60in.,cherry,like new. $50 774-526-7538 COFFEE TABLE Matching end tables.Wrought iron w/ glass tops. $250 941-276-1956 COFFEE TABLE teak & inlaid tile 30x49 gorgeous exc cond $75, OBO 941-743-3321 COFFEE TABLE walnut color 47 x 22 x 24 inside storage $300 941-429-8507 COFFEE TABLE WALNUT/ WROUGHT Iron Base $50. 813-240-0844 COMPUTER CABINET Great cond. Brown. Opens up to a desk. $100 941-661-5480 COMPUTER CABINET Oak armoire style double door cabinet. $50 941-830-8739 COMPUTER DESK L-shaped chrome & glass. NICE! $129, OBO 941-505-5747 COMPUTER DESK Large work area. 46wx29 1/2h, on casters $40 941-914-1770 COMPUTER DESK White W ash. $40 941-764-8594 plus tax permonth,36 months")Tj /TT1 1 Tf 0.1749 Tc 7.9338 0 0 7 105.5634 832.3496 Tm (IY4DR AUTOMATICplus tax ptmonth.O 0 nD D=7 )Tj -1.9428 Tc 65.2143 0 0 5 689.3603 383.7834 Tm (. )Tj 0 0.502 0 rg /TT1 1 Tf -0.0768 Tc 15.3952 0 0 15 30.8603 203.2889 Tm (stwearw swrr rerr,r : rrr.r srr. srrrroffto tsr r srrr.e )Tj -0.1193 Tc 40.6644 0 0 18 339.8603 108.2918 Tm (srrrr r. srrrrw _I1i r)]TJ -0.0948 Tc 8.5862 0 0 5 111.3603 102.792 Tm ('^ ..)]TJ -0.1 Tc 5.9286 0 0 5 193.8603 104.7919 Tm (,.liY.r 1.-'-_-' 7i/4}N7Si7-J / 1E} )Tj 0 0.502 0 rg 0.506 0 Td (' \x -rgya )Tj 0 0.502 0 rg 0.58 0 Td (_r sa

PAGE 38

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 13 The Sun Classified-Section A Page 12E/N/C/VSaturday, September 24, 2011 Get it all at PALM AU T O MALLOr lease for$330/MO.***Buy now$27,995 QUALITY PRE-OWNED VEHICLES New 2011 MITSUBISHIOUTLANDERSPORT ESOr lease for$209Buy now/MO.**$18,995STK#B1022 scan here to see a complete list of our mitsubishi inventory! scan here to see a complete list of our hyunDai inventory! New 2011 JEEPCOMPASSSTK#D11131Or lease for$249/MO.###Buy now$18,770 $289/MO.***OR buy for scan here to see a complete list of our chrysler DoDge Jeep ram inventory! scan here to see a complete list of our chevy, buick gmc inventory! scan here to see a complete list of our toyota inventory! scan here to see a complete list of our maZDa inventory! All New 2011 MAZDA3ISTK#M11083Or lease for$159Buy now/MO.^$14,986 New 2011 HYUNDAIELANTRA GLSOr lease for$159Buy for/MO.^$17,835STK#H20038 0% REBATESUP TO $ 4,500! ~0% FINANCING!~ PRIUSNEW 2011 TOYOTAStk#T1 1199$22,961$349/MO~~Or Lease For HYBRID! Sign & Drive!BUY NOW SIENNANEW 2011 TOYOTAStk#T68711$24,953$399/MO~Or Lease For AUTOMATICEQUIPPED NOT STRI PPED! Sign & Drive!BUY NOW NO PAYMENTS FOR90 DAYS! ~ New 2011 CHEVY SILVERADO CREWCABSTK#C11720Was$33,769Buy Now $ 25 995Or 0 % For Up To 60 Months I 888-534-1544^O% FOR 60 MONTHS ON ALL 2011 MODELS. LEASE IS FOR 36 MOS. 10KMI/YR WITH APPROVED CREDIT $3392DUE AT SIGNING. ^^LEASE IS FOR 36 MONTHS WITH 10K MI/YR $1895 DUE AT SIGNING. OFFERS MAY REQUIRE FINANCING THRU HYUNDAI CAPITAL WITH APPROVED CREDIT. *LEASE IS FOR 39 MONTHS, 12K MI/YR. WITH $1999 DOWN PLUS TAX, TAG, TITLE REGISTRATION, FIRST PAYMENT DUE AT SIGNING AND INCLUDES DEALER FEE. **ALL LEASES ARE FOR 36 MONTHS 10K MI/YR WITH $4618 DUE AT SIGNING WITH APPROVED CREDIT. #39 MONTHS WITH $1475 CASH OR TRADE EQUITY, WITH APPROVED CREDIT. 10K MI/YR. ***BASED ON 72 MOS @ 3.9% APR. ALL PRICES AND PAYMENTS INCLUDE ALL REBAT ES INCLUDING CHRYSLER LEASE LOYALTY AND MILITARY DISCOUNT. PAYMENTS AND PRICES ARE PLUS TAX, TAG AND $599 DEALER FEE. PalmAutomall.com###LEASE IS FOR 39 MOS, 10K MI/YR WITH $2500 DUE AT SIGNING. ^^^OFFERS MAY REQUIRE FINANCING THRU HYUNDAI CAPITAL WITH APPROVED CREDIT. LEASE IS FOR 36 MONTHS WITH 10K MI/YR $3618 DUE AT SIGNING. %SPECIALS ARE MUTUALLY EXCLUSIVE AND CANNOT BE COMBINED. MUST BE PRESENTED PRIOR TO PURCHASE. ALL PRICES ARE PLUS TAX, TAG, AND A $599 DEALER FEE. %% BASED ON 72 MOS @ 1.9% APR. ALL PRICES AND PAYMENTS INCLUDE ALL REBATES INCLUDING CHRYSLER LEASE LOYALTY AND MILITARY DISCOUNT. PAYMENTS AND PRICES ARE PLUS TAX, TAG AND $599 DEALER FEE. %%% $2198 DUE AT SIGNING 36 MO 12K MILES A YEAR. ~36 MONTHS 12K MILES/YR. WITH APPROVED CREDIT AND TAX, TAG, TITLE, AND DEALER FEE. ~~60 MONTHS 12K MILES/YR. WITH APPROVED CREDIT AND TAX, TAG, TITLE, AND DEALER FEE. LEASE IS FOR 36 MOS 12K MILES PER YEAR WITH $36 48 DUE AT SIGNING. scan here to see a complete list of our useD inventory! QUALITY CERTIFIED PRE-OWNED VEHICLES 2008 HONDA FIT$12,941HATCHBACK!4 door, Hatchback, Automatic With Overdrive, Ext. Color Vivid Blue Pearl. STK#M2022A 2005 MERCURY GRAND MARQUIS LS$12,991AUTOMA TIC!4 door, Sedan, Automatic With Overdrive, Ext. Color Light Ice Blue. STK#H12069BB 2007 HYUNDAI SONATA GLS$12,991LOW MI LES!4 door, Sedan, Automatic With Overdrive, Ext. Color Deepwater Blue. STK#PH5788 2005 DODGE DAKOTA SLT$13,581GREATSAVINGS!Pickup Truck, 4 door, Quad Cab, Automatic With Overdrive, Ext. ColorBright White. STK#PD5295B 2004 CHEVROLET TAHOE$13,941A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Black. Stk#C11422A 2009 TOYOTA COROLLA$14,941MANUAL!5 Speed Manual, Ext. Color Desert Sand Mica, STK#M2012A 2009 CHRYSLER SEBRING$14,754CONVERTIBLE!2 door, Convertible, Automatic With Overdrive, Ext. Color Silver Steel Clear Coat. Stk#D11572A 2006 TOYOTA TUNDRA X-SP$17,991GREAT PRICE!4 door, Double Cab, Automatic With Overdrive, Ext. Color Salsa Red Pearl. STK#CB11238B 2010 JEEP PATRIOT$18,891LOW MI LESONLY 23,994!4 door, SUV, Automatic With Overdrive, Ext. Color Brilliant Black Crystal. STK#T10855C 2009 FORD FUSION SE$14,941A MUSTSEE!V6, 4 door, Sedan, Automatic With Overdrive, Ext. Color Redre. STK#H20125A 2007 FORD F-150 FX2 SUPER CAB$22,591LOW MI LESONLY 14,535!Automatic With Overdrive Ext. Color Black, STK#D11468A 2007 HUMMER H3$22,991A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. ColorBirch White. STK#C11724A 2003 LEXUS RX 300$15,441A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Burnished Gold. STK#D11644BB 2006 DODGE MAGNUMRT$15,981AUTOMA TIC!4 door, Wagon, Automatic With Overdrive, Ext. Color Midnight Blue Pearlcoat. STK#D11601A 2006 FORD MUSTANG$16,491LOW MILESONLY 47,559!2 door Coupe Automatic With Overdrive Ext. Color Performance White. STK#H20165A 2003 INFINITI G35$16,941GREAT PRICE!2 door, Coupe, Automatic With Overdrive, Ext. Color Diamond Graphite. STK#H20180A 2010 DODGE CHARGER SXT$19,582A MUSTSEE!4 door, Sedan, Automatic With Overdrive, Ext. Color Bright Silver Clear Coat. STK#D11556AA 2009 HYUNDAI SANTA FE GLS$19,921LOW MILES!4 door, SUV, Automatic With Overdrive, Ext. Color Powder White Pearl. Stk#H20213A 2008 JEEP WRANGLER X$20,741AUTOMATIC!2 door, SUV, Automatic With Overdrive, Ext. Color Black. STK#D11099A 2010 JEEP WRANGLER SPORT$24,881LOW MI LESONLY 8,075!2 door SUV 6 Speed Manual Ext. Color Stone White Clear Coa. STK#D11316C 2011 HYUNDAI TUCSON$23,991LOW MI LES!4 door, Automatic With Overdrive, Ext. Color Garnet Red Mica Crossover, Stk#PH5800 2011 TOYOTA RAV4$24,941LOW MILES!Automatic With Overdrive Ext. Color Sandy Beach, STK#T10899A 2009 TOYOTA VENZA FWD$25,441LOW MILES!4 door, Wagon, Automatic With Overdrive, Ext. Color Blizzard Pearl. Stk#T10862A 2011 CHEVROLETTRAVERSE LT$27,941LOW MI LES!4 door, Automatic, Ext. Color Silver Ice, Crossover, STK#PC5798 2008 TOYOTAHIGHLANDER LTD$28,941A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Blizzard Pearl. STK#H12145A 2004 INFINITI Q45$17,991AUTOMATIC!4 door, Sedan, Automatic With Overdrive, Ext. Color Royal Pewter. STK#T10292A 2008 SATURN VUE XR$17,991LOW MI LES!4 door, SUV, Automatic With Overdrive, Ext. Color Sea Mist Green. Stk#PC5741A 2010 HONDA CIVIC LX-S$18,881GOOD GASSAVER!4 door, Sedan, Automatic With Overdrive, Ext. Color Polished Metal. STK#H20111A 2008 NISSAN XTERRA$19,541A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Night Armor. STK#C11683A 2010 KIA SPORTAGE LX$20,541LOW MILESO NLY 18,284!4 door, SUV, Automatic With Overdrive, Ext. Color Steel Silver. STK#H20061A 2011 HONDA CR-ZEX$23,781LOW MILESONLY 5,404!2 door, Hatchback, Automatic With Overdrive, Ext. Color Storm Silver. STK#CB11199A 2010 NISSAN XTERRA$24,98 1A MUSTSEE!4 door, SUV, Automatic With Overdrive, Ext. Color Night Armor. STK#T11048A 2000 NISSAN QUEST$5,941 AUTOMA TIC!Mini Van, 4 door, Automatic, Sunset Red STK#PD5528A 2000 MERCURY GRAND MARQUIS LS$7,991 LOW MI LES!4 door, Sedan, Automatic With Overdrive, Vi brant White. STK#T10507A 1999 PONTIAC FIREBIRD$9,753 CONVERTIBLE!2 door, Convertible, Automatic With Overdrive, Arctic White. STK#D11547A 2003 TOYOTA CAMRY XLE$9,991 GREAT PRICE!4 door, Sedan, Automatic With Overdrive, Ext. Color Black Walnut Pearl. Stk#C11705A 2006 HYUNDAI ELANTRA GLS$9,991 A MUSTSEE!4 door, Sedan, Automatic With Overdrive, Ext. Color Spruce Green. Stk#H20212A 1998 CADILLAC DEVILLE$5,991 GREAT PRICE!4 door, Sedan, Automatic With Overdrive, Ext. Color Gray. STK#T11141B 2003 CHEVROLET VENTURE$5,999 GREAT PRICE!4 door, Extended Mini Van, Automatic With Overdrive, Ext. Color Bronzemist. Stk#T11175A 2007 CHEVROLET IMPALA LT$9,997 AUTOMA TIC!4 door, Sedan, Automatic With Overdrive, Ext. Color Silverstone. STK#C11697B 2006 HYUNDAI SONATA$10,941A MUSTSEE!4 door, Sedan, Automatic With Overdrive, Powder White Pearl. STK#T11070B 2003 FORD F-150 XLT SUPER CAB$10,993GREAT PRICE!4 door, Super Cab Pickup, Automatic With Overdrive, Silver. STK#M11045B 2008 MITSUBISHI GALANT DE$11,591LOW MI LES!4 door, Sedan, Automatic With Overdrive, Ext. Color Liquid Silver. STK#H20084A 2003 CHEVROLETAVALANCHE 1500$11,991GREAT PRICE!4 door, SUV, Automatic With Overdrive, Ext. Color Summit White. Stk#T10469A 2010 GMC CANYON WORKTRUCK REGULAR CAB$16,551LOW MILES ONLY 24,105!2 door Regular Cab 5 Speed Manual Ext. Color Fire Red, STK#C11713A 2011 CHEVROLET IMPALA LT$18,954A MUSTSEE!Automatic With Overdrive Ext. Color Silver Ice, STK#PC5744 2007 CHRYSLER SEBRING$13,541A MUSTSEE!4 door, Sedan, Automatic With Overdrive, Ext. Color ModernBlue Pearlcoat. STK#D11635A 31 MPG! Now Thru September 30th Get Closeout Pricing on over 2,000 New and Used Vehicles! St op in and register to win one of 15 prizes given away! Dra wings each Thursday! PRIZEGIVEAWAYSEVERY THURSDAYTHROUGH SEPTEMBER30TH! PRICESSTARTING $ 5941AS LOW AS All New 2011 HYUNDAIACCENT GLSSTK#H20167, AUTOMATICOr lease for$139Buy now/MO.$15,986 51 MPG! New 2011 HYUNDAISONATA GLSOr lease for$179Buy now/MO.^$20,650STK#H20057 All New 2011 DODGEDURANGOSTK#D11141 O r for$369/MO.***Buy now$27,975With $2500 Down New 2011 RAM 1500 STBuy now $ 22 870STK#D11323 NO PAYMENTSFOR90 DAYS! ~ COROLLANEW 2011 TOYOTAStk#T11189$14,972$199/MO~Or Lease For AUTOMATIC! Sign & Drive!BUY NOW New 2011 GMC ACADIA STK#CG11172Was$35,279Buy Now $ 30 491Or 0 % For Up To 60 Months 2009 DODGE GRAND CARAVAN SE$18,991LOW MILES!4 door, Mini Van, Automatic With Overdrive, Ext. Color Stone White Clear Coat. Stk#D11610B 2008 CHEVROLET COBALT LS$11,991LOW MI LES!2 door, Coupe, Automatic With Overdrive, Ext. Color Summit White. Stk#PC5808 2009 FORD MUSTANG V6 DELUXE$18,941A MUSTSEE!2 door, Convertible, Automatic With Overdrive, Ext. Color Dark Candy Apple Red. Stk#H20136A 8518963 1 I i PIJLI111 I\UTO IlTtIJ\LL 3TOYOTA.4 )Tj -0.0395 Tc 13.1053 0 0 4 509.6725 1012.923 Tm (;i' Pu # i 1 '_-Nrlpr.F xid. f:thi ancrr1 1)Tj /TT0 1 Tf -0.2045 Tc 7.5455 0 0 4 1064.6725 1002.9233 Tm (1 1llll ")Tj -0.0262 Tc 1.9762 0 0 10 530.6725 988.9237 Tm ()Tj -0.1333 Tc 18.4444 0 0 10 531.6725 986.9238 Tm (.' )l)-406(llllf i)-71(ll)15(ll)Tj /TT0 1 Tf 0.1393 Tc 16.4271 0 0 4 447.6725 946.425 Tm (-f LJ 1I I I l I l l f l' l I S l '.III i)lt ) .J'1 l t l!J Jt ic.1R Z J a' 1! '1I 5.. -!! I _ -. )Tj /TT0 1 Tf -0.0485 Tc 10.0606 0 0 5 491.1725 877.9271 Tm (J G I l E)75( --THUR)16(SD)16(` THROUGHJaVl)64(wv 61 a)85(fflfUoaLDAu S'E:P1E: i61E:R OiS1 BTH, --sue.n0)]TJ -0.2551 Tc 29.6429 0 0 14 386.1725 732.4315 Tm ( Dh. F J)-107()]TJ 0.1355 Tc 7.0854 0 0 6 1248.6725 688.9329 Tm [()110(r.IJ .. ..)Tj -0.0652 Tc 7.2174 0 0 4 341.1725 578.4362 Tm (} + I I1'S 0 0 S'Tr i I lW(/: .)Tj 0 0.502 0 rg 0.0046 Tc 3.4583 0 0 9 1152.6725 496.9387 Tm (_ o 0,)Tj -0.4762 Tc 27.6667 0 0 7 1162.1725 485.4391 Tm (. .)Tj /TT0 1 Tf -0.1403 Tc 8.7368 0 0 3 1223.1725 464.9397 Tm (O Tti. : )Tj 0 0.502 0 rg /TT0 1 Tf -0.0149 Tc 0.9881 0 0 8 218.1725 445.4403 Tm ()Tj 0.506 0.187 Td ()Tj -0.3631 Tc 21.7381 0 0 8 257.1725 430.4408 Tm (::,1 rq: d o )-135(f )Tj 1 0.502 0 rg 0.585 0 Td ()Tj 0 0.502 0 rg -0.1358 Tc 16.9074 0 0 9 776.6725 366.9427 Tm (r 1)72(4: ./1`111: II03 i .)Tj -0.15 Tc 10.375 0 0 5 397.1725 243.9465 Tm (ivu [ S mazalip I .rn1r a iL___...................................... .. ........................................

PAGE 39

The Sun Classified-Section A Page 14E/N/C/VSaturday, September 24, 2011 South Floridas Volvo DealerVolvo of Fort Myers 2600 COLONIAL BLVD FT MYERS, FL 33907Sales 877.865.86 76 Ser vice 239.313.4412 les 877. 8 8 6 5 5 .8676 Serv ice 239.313.44 ON LINE AT www.volvoftmyers.com Monday Thursday 9am-7pm Friday 9am-6pm Saturday 9am-5pm Sunday 12pm-4pm2600 COLONIAL BLVD FT MYERS, FL 33907Sales 877.865.86 76 Ser vice 239.313.4412 PLUS... Special Financing Available All Month!CHOOSE FROM DOZENS OF PRE-OWNED VEHICLES 4 YEAR A nniversary E vent! VOLVO OF FORT MYERS invites you to join the celebration! Save thousands on every new or pre-owned vehicle in stock!Plus Tax, Tag and Dealer Fees. STOCK #R1928 2006 Volvo S60LEATHER, SUNROOF 11311B$1 0,887 ONLY2009 Ford FocusSE, ALLOYS, GAS SAVER R1863$11,995 ONLY2007 Jeep Wrangler R18232 DOOR, 4 X 4 AUTO, LEATHER, REDUCED!2009 Mini Cooper R1887$17,995$18,999 ONLY ONLY2008 Audi A4 R1886TURBO, SUNROOF, LOADED!2010 Hyundai Sante FeLIMITED, 18,000 MILES, LOADED! R1872W$19 ,986$22,783 ONLY ONLY2006 Jeep LibertySPORT MODEL, LOW MILES! 12035B$9,995 ONLY CLEAN!2005 Ram 1500 R1920A$14, 995 ONLY R1875 $13,9742011 Suzuki SX4AWD, 3500 MILES! ONLY R1835A 2009 Dodge Caliber SXTALLOYS, AUTO$1 3,995 ONLY2006 Toyota CorollaS MODEL. ALLOYS, AUTO R1828A2006 Pontiac TorrentEXTRA CLEAN SUV R1892A$9,995$9,995 ONLY ONLY 2009 Volkswagen JettaLOW MILES, AUTO, SPORTY R1888$13,884 ONLY ALLOYS, AUTO2007 Mazda 6 R1792$13 ,895 ONLYAll vehicles are Plus Tax, Tag and Dealer Fees. Pictures are for illustration purposes only. See dealer for complete details. ONLY $ 33,995 2011 Volvo XC60 All vehicles are Plus Tax, Tag and Dealer Fees. Pictures are for illustration purposes only. See dealer for complete details. 8529010 WILDESOCIALNETWORK FA N&FOLLOWERSPECIALS Pre-OwnedEmployee PricingSaleSALEENDSSUNDAY,OCTOBER2ND!**1.9%APRfor48months,$21.65per$1000borrowed,2.9APRfor60months,$17.92per$1000borrowedonallCertiedPre-OwnedVehicles. Buyersmustqualify.Offerends10/2/11.87 7211-8041 4883CLARKROAD,SARASOTA WILDELEXUS.COM38RXSUVS INSTOCKONALLPRE-OWNEDRXSUVS ANDALLPRE-OWNEDESSEDANS35ESSEDANS INSTOCKBUYLIKEOUREMPLOYEESAT$500OVERCOST!PLUSCERTIFICATION,TAX,TAGSANDDOC.1.9%Av ailableonallCertied Pr e-OwnedVehicles.** FURNITURE6035 MATTRESS Pillow top, Full $30 941-743-7747 SLEEPER SOFA queen size thick 5in.matress like new $295 941-473-2150 SOFA & loveseat Clean and excellent condition. $130 941-240-0123 SOFA & loveseat Tommy Bahama style, in good condition. $850 941-276-1956 SOFA BEIGE microfiber. Like new. Lv. msg $300 941-2550237 SOFA BLUE/GRAY, r eclines good condition $50 941-4265875 SOFA like new, beige sofa, 2 glass end tables & coffee table $595, OBO 941-284-2414 SOFA New Beige leather Sofabed, Queensize & Electric Recliner. Must Sell, Best offer $900 941-492-6011 SOFA SET Red microfiber can txt pics $200 941-286-1651 SOFA SLEEPER queen size sofa sleeper good cond r ose color $25 941-548-8299 SOFA YELLOW/RED/GRN Floral HAVERTY $200 813240-0844 SWIVEL ROCKER Rattan w stool excellent condition $95 941-766-1582 SWIVEL/ROCKER CHAIRS (2) EXCELLENT CONDITION $250 941-460-8528 T ABLE, OAK pedestal, 54round, beautiful. $375 941-639-3887 TRUNDLE BED Excellent condition $150, OBO 941-2551255 WICKER BAR LN,sturdy 44x40H w/3 stls, glass shlvs & top. $325 941-698-1042 WROUGHT IRON Barstools (3) Pretty. sturdy. Lt Copper clr $300 941-716-3259 FURNITURE6035 DARK BROWN leather couch $110 941-623-3496 PA TIO SET large table 6 chairs umbrella. $95, OBO 941-629-5576 PA TIO SET lg.hvy stone like table 6chairs w/cushions $200 941-830-8778 PA TIO SET: Hampton Bay r ound table 4 mesh chairs tile top exc.cond $200 954-8095325 PA TIO TABLE w/4 chrs, rattan & faux bamboo, 42sq. 37h. $450 941-639-3887 POKER TABLE w/6 chairs, never used, asking $650 obo. James $650. 941-391-3362 POOL TABLE 4x8,slate,LN cond. w/acc. Buyer removes. $495 941-698-1042 QUEEN BED serta w/frame nice $100 941-624-5725 QUEEN HEADBOARD w/nightstand, Tropical/walnut color $200 941-429-8507 RATTAN DINETTE FOUR CHAIRS,GLASS TOP TABLE $135 941-626-5501 RECLINER & Loveseat Blue Gd Cond. Non smkng home. $125, OBO 941-544-5755 RECLINER LA-Z-BOY Burg., full, very comfy, good cond. $45 941-743-0348 ROLLTOP DESK Dbl pedestal, 7 drawer, early Am. style, gd cond. $175 941-474-6912 SLEEPER SOFA NEUTRAL COLORS N/S $100 941-4937238 SLEEPER SOFA QUEEN LOVELY, CAN DELIVER $200 941-493-7238 FURNITURE6035 GUN CABINET WOOD Glass front, storage space on bottom. $150 941-626-7452 HEADBOARD FULL size, dark antique brass finish new condition $30 941-575-1393 HEADBOARD KING great cond light wood $15 941548-8299 HUTCH & T ABLE SET CAN EMAIL PICS. NICE $250 941493-7238 LADIES 9 Drawer Desk Dark wood 8 side drawers 1 middle $75 941-457-6034 LANAI FURNITURE 2 round tables w 4 chairs $50/set; One alum. glider and one wooden loveseat $40/ea 941-468-1146 SOFALEATHER 3 cushions. Lt Tan. Like new. $125 941637-7032 LOVESEAT & matching chair exc. cond $350 941-492-7198 LOVESEAT, ROBIN Bruce ivory slipcovered, like new $325 941-716-3259 NIGHTSTAND SOLID mahogany, 4 drawers, traditional $40 941-627-6542 OCCASIONAL TABLE w/ magazine rack. Solid wood. V enice $15. 941-544-5755 OFFICE DESK metal, light beige, 30 X 60, 2 dwrs. on left $49 941-662-0063 ORIENTAL ROOM Divider black, bamboo both sides, very good cond. $125 941662-0063 PA TIO FURNITURE table 4 chairs and a glider nice set $50 941-473-2150 PA TIO LOUNGE chair w/ottoman, rattan,very nice. $150 941-639-3887 PA TIO SET 48GLASS TABLE 4 SWIVEL SLINGBACKS $175 941-447-8149 I o1Uvoof FT. MYERSDnRr ep AN Avg a on" Ar7LEXUS OF SARASOTAi -'CERTIFIED PRE-OWNED-ONLY AT YOUR LEXUS DEALER-

PAGE 40

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 15 MEDICAL6095 WALKER FOLDING 2 FRONT WHEELS NEW CONDITION. $15 941-627-9736 Pt Char WHEELCHAIR LIGHTWEIGHT Invacare(new)SX5 $125, OBO 941-391-4628 WHEELCHAIR LIKE New $75 941-629-7880 HEALTH / BEAUTY6100 CERAMIC FLAT Iron Tool Science. Barely used $20 941-628-6371 CG OUTLAST Smoothwear lipcolor&moisturize #865 have 11 ea. $6 941-628-6371 WIG LONG WITH ORANGE HIGHLIGHTS $14 941-6395966 TREES & PLANTS6110 CROWN OF THORNS PLANT IN 3 GAL. POT. RED. $5 941258-2016 ORCHID TREE ONLY ONE, WHITE 3-4 FT. TALL IN POT $10 941-258-2016 P ALM TREE Six foot tall specimen quality. $25 941-8333326 PAPAYA PLANT in 1 gallon pot $4 941-697-0794 ROYAL PALM 7-8 $15 or 2/$25 941-380-7146 BABYITEMS6120 BABY MONITOR Safety 1st Brand 2 channel exec cond $8, OBO 941-698-9304 CRIB MATTRESS SEALY ULTRA BABY,NEVER USED $40 941-624-5725 CRIB, DELTA, PERFECT, CHERRY,NEW,3IN 1 $125 941-624-5725 DIAPER BAG/BACKPACK, COLUMBIA navy blue, $18 941-769-1771 JOGGING STROLLER JEEP jogging stroller great condition 1 year old $55 941-916-1657 STROLLER BABY Tr end T an/Pink exc. cond! like new! $45 954-809-5325 GOLFACCESSORIES6125 BATTERIES (6) 6VOLT Golf Cart batteries. New, Leading brand, 12mo warr. Limited Qtys. Exchange/cash&carry $399 941-769-1431 GOLF CARTEZ-GO Golf cart brand new batteries,cart in r eal good shape $1,200 941-468-4110 GOLF CART, Club Car, 2003, new windshield, roof, lights, & batt. Spare tire, fold down rear seat for storage, good cond. Charger incl. $2,700. 941255-9953 or 440-897-7440 GOLF CLUBS Mens set of clubs with bag $35 941-6244617 GOLF POLO shirts Heron Creek Pro shop name brands. L & XL $7 941-626-0680 PUTTER NIKE ignite like new. $50 941-286-2602 TITELIST CART pull cart ex cond $20 941-575-1393 EXERCISE/ FITNESS6128 BOWFLEX EXTREME hardly used, excellent condition, mat included $450 941-662-0063 MEDICAL6095 2-WHEEL WALKER or Bedside Commode, Nice Condition, each $20 941-629-7880 BLOOD PRESS. Kit Auto/dig/Homedics/dual. $10 941-624-2105 BLOOD PRESSURE MONITOR AUTOMATIC NEW IN BOX COST 75 SELL $50 941-2689029 EMSI-2001 ELECTRIC Stim.Mobile unit(back) $499, OBO 941-235-9885 FOLDING WALKER Medline 2-button, 2-wheel, brand new $30, OBO 941-587-5512 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** LIFT CHAIR BRAND NEW, brown $450. OBO. 941-764-1725 LIFT CHAIR BY PRIDE, BRAND NEW, NEVER USED, W/FACTORY WARRANTY $499 941757-9049 LIFT CHAIR Electric,recliner, works great, comfortable $395 941-580-1921 LIFT FOR scooter Power lift fits 1 1/4 hitch on vehicle $499 941-639-5611 NEEDAJOB? CHECKTHE CLASSIFIEDS! MATTRESS CYCLO PEDIC single, adjustable bed,Great Condition $50 941-629-7880 POOLLIFT Aquacreek, great condition $800 941-474-7252 POWER WHEELCHAIR Golden Technologies Compass (new). $275 941-391-4628 SCOOTER MERIT 4 wheel scooter, red, charger and basket used on 2 cruises $499 941-639-5611 SHOWER BENCH Like New $40 941-629-7880 WALKER 4-LEGGED with food table $50 941-237-1085 WALKER BLUE Hugo Walker with front wheels and back skids $30 941-457-6034 ANTIQUES COLLECTIBLES6070 HESS TRUCKS 27 trks ,,86-2010 LN take all $270 941-474-4550 HESS TRUCKS All new in boxes 1994 and up $475, OBO 941-467-5716 HESS TRUCKS, 12 trucks from 1988 to 2006. NIB. Each $50, OBO 941-626-5099 HOT WHEEL COLLECTION and BOOKS 941-875-0078 HUMMELL&ROCKWELL PLATES $10, OBO 941-6233723 IRON SKILLET V intage 8 $20, OBO 941-408-4596 JEFF GORDON 1999 Nascar stars of racing figure and card still sealed $10 941-2352330 MEMORIAL COIN 9-11 Twin T owers engraved on it, w/ case. $15 941-423-2585 MILK GLASS VINTAGE GOBLETS 6 mint s footed COLLECTIBLE $40 941-639-1517 MUSIC CARDS 1991 proset still sealed box of 36 packs $5 941-235-2330 NORMAN ROCKWELL VINT AGE PLATES orig boxes-bargain! Ea $15 941-639-1517 PUNCH BOWL Set Jeanette Glass Co. $15 941-6242105 PYREX CASSEROLE white with green $15, OBO 941-408-4596 SOFA, beautiful Victorian, beautifully carved, 1st $100 takes it. 941-769-2389 TEA POT Lenox butlers pantry tea pot new in box $20 941-766-0464 TV 1950S Philco Predicta w/orig. stand. $350, OBO 914-626-5099 VAN BRIGGLE Indian Plaques, brave and squaw, beautiful aqua, both $250 941-6620063 VICTORIAN FLOOR Lamp wrought iron with marble base $100, OBO 941-255-9788 YELLOW BOWL Oxford Stoneware no chips or marks $15, OBO 941-698-9304 FRUITS & VEGETABLES6075 HUGE ORGANIC MANGOS $1.50 AVACADOS $1.00 Rotonda. 941-214-0770 MUSICAL6090 ALTO SAX FE Olds & Sons Great Condition $150, OBO 941-883-1786 CDS, LPS BE-BOP,JAZZMint $3 941-421-9964 DEAN ACOUS./ELEC.PLAYS & sounds great. $120, OBO 941-258-5698 GIBSON LES Paul Cherry Mint. Cond. Great Action $490 941-883-1662 GUITAR ACCST. custom new pro.dreadnut,great $225 786306-6335 GUITAR FENDER Acoustic and case $75 941-625-5374 Guitar lessons platinum selling artist taking on new students 941-916-8040 PIANOBALDWIN Used. In good condition. Need tuning. $200 941-286-7229 PIANO KEYBOARD Casio CTK-720, w/ stand, Exc. Cond. $50 941-627-2192 RECORDS (105) 45RPM $75 941-496-9252 TURNTABLE STANTON ProDJ ex. cond $400, OBO 941626-2832 COMPUTER EQUIPMENT6060 WORD PROCESSOR Smith Corona $25 941-764-8594 CLOTHING/ JEWELRY/ ACCESSORIES 6065 BIRKIS SANDALS New in box size 6.5/7 Lille-Oak Linen $30, OBO 941-764-9100 CLOTHES JUNIORS szs3&5 s&m misc newer washed NP ANY6 $25 941-544-1128 CLOTHES LADIES, dresses, pants, tops, sweaters, S-M. $10, OBO 941-698-1039 HANDBAG D&GKnockoff sm striped, tan/oran/teal/wh. brnd new $25 941-628-6371 LADIES SCRUBS Nice small & x-tra small tops and bottoms $3 941-276-9580 LEATHER BIKER VESTXL w/fringe UNISEX, New..ONLY $25 941-493-3851 LEATHER COAT ladies small r ed knee length/waist length vgc $65, OBO 941-306-8650 LEATHER JACKET mens bomber style, like new w/zip-in lining $50 941-639-1517 MENS ALPACA sweaters Six sweaters, solid colors-Sz. L & XL. Each: $39 941-505-5747 MENS SPORT coats Size 42R, like new (3)coats. Each: $59 941-505-5747 MOTORCYCLE JACKET Alpine, fully padded, red-black $80 941-929-5432 SNEAKERS LL Bean Mary Jane sz 8.blue/white worn once $20 941-628-6371 WEDDING DRESS JESSICA McCLINTOCK Ivory, Sz 11 $40 941-460-8189 ANTIQUES COLLECTIBLES6070 2 PC stepback cupboard 4x7.storage.glassdoors.exc. $350, OBO 941-235-2203 80S COLLECTION r ock bands full color embroid. emblems $20 941-743-0348 ALWAYS BUYING ANTIQUES, ART, SILVER NEW ENGLAND ANTIQUES (941) 639 -9338 ANTIQUE CLOCK Clean TELECHRON 7H133 $20 941-544-0042 ANTIQUE TRUNK-BERBER Wa rdrobe-From 1890-1920s $400 941-276-8970 A VON CAPE Cod ruby collection. Cup and saucer. $24 941-764-5804 BALD EAGLE Freedom signed Paul Rankin, $499 ask for Pat 941-429-2037 BED IRON V intage full size $150, OBO 941-408-4596 BENTWOOD ROCKER ornate design, needs new seat $35, OBO 941-255-9788 BOOKS VINTAGE hard cover $5, OBO 941-408-4596 CASH PAID**any old military items, swords, medals, uniforms, old guns. Dom (941)-416-3280 CEDAR CHEST exc. cond. cedar & walnut chest $275 941-380-3000 CUCKOO CLOCK $60 239481-2832 DELFT WINDMILL music box ec $50, OBO 941-306-8650 FRIENDS MEMORABILIA trivia game & commemorative mags Exc $25 941-629-7449 HALL DOUBLE Boiler Copper and pottery. $15 941-6242105 HESS TRUCK 1994 Rescue T ruck NIB $50, OBO 941-6989304 TV/STEREO/RADIO6040 20 T.V. $10, OBO 941623-3723 CDS ROCK&ROLL 60s &70s $6, OBO 941-2585698 DIRECTV REMOTE RC24. great shape. $10 941-2352330 RECORD ALBUMS $299 941-549-0475 STEREO older fisher receiev sonyCDplayer cabnt speakers $99 941-544-1128 TELEVISION 32 T oshiba, older table top, great picture $40 941-929-5432 TV 13 SANYO color tv w/ r emote, exc.cond $20 954809-5325 TV 20 ORION w/remote looks and works like new. $20 941-627-9736 Pt Char TV 21 SYMPHONIC W/remote just like new. $25 941-627-9736 Pt Char TV 25 Sanyo perfect color $35, OBO 941-421-9964 TV 37 LCD TV, 3 month warranty $300 941-627-1647 TV 55 Samsung w/custom table. Needs color wheel. $200 941-456-4135 TV MAGNAVOX 20 built in DVD & game ports $30 941475-7507 TV RCA 32 console, good picture & sound $50, OBO 941-256-6962 PUTCLASSIFIEDS TOWORK FORYOU! FIND A JOB! BUY A HOME! BUY A CAR! TV RCA, 24 in, w/matching DVD/VCR. $75 941-7648594 TV SANYO 25 works fine $40, OBO 941-626-2832 TV SONY 42 projection LCD, New Lamp. Works good $175 941-475-2861 TVSONY 53 projection tv. Good picture, good shape. $150 941-276-1956 TV SONY 55 grand weega $250 941-493-0133 TV, Sony 50 needs color adj., r ear proj. $250 941-6973754 COMPUTER EQUIPMENT6060 COMPUTER APPLE G3 with monitor & printer. $300 941-697-3754 COMPUTER CHAIR Gray fabric, adj seat and arms, like new $35 951-624-5745 DAVEIN-HOUSE-OFFICE computer repair, set-up Serving Charlotte Co. 10+yrs 941-629-6337 DESKTOP PC tower XP sys.up2date, 1yr antivirus (refub) $80 941-639-1113 LAPTOP COMPAC with windows xp exc condition $135, OBO 941-306-8650 MONITOR 19 inch. $20 941764-8594 MOUSE,KEYBOARD,SPEAKERS, OFF brand.New in box. $19 941-276-1881 PRINTER HP Color Laserjet 3600N like new $225 941380-3000 PRINTER LEXMARK new in box $70, OBO 941-626-2832 ROUTER, LINKSYS WRT54G V3 w/latest DDWRT installed, good condition $30 6970794 ELECTRONICS6038 60GB HARDDRIVE 60gb Hard drive for Xbox360. $35 941-276-0271 AMPLIFIER 75W 12V 5ch amp+1.0 Farad Capacitor $100, OBO 941-629-4940 BBERRY 8530 clean ESN. case, home & car chrgr. Exc. Cond. $50 941-544-5755 BLU-RAY & DVD Player SONY HD 5.1 Dolby Clean BDP-S300 $40 941-544-0042 CELL PHONE METRO PCS-1 week oldincludes charger$40 941-237-1085 CELL PHONE MOTOROLA CITRUS NEW IN BOXLIST 249.00 ASKING$150, OBO 941-429-1591 CELL PHONE Samsung Reality $35 941-256-1037 CONSOLE STEREO black 6 disc, dual cassette $250, OBO 941-429-8507 ELECTRIC TYPEWRITER dictionary.w/bbok&cover. 169.00 new. $55 941-235-2203 FRANKLIN ELECTRONIC scoring arcade basketball game $58 941-697-1102 GPS MIO Moov 300 hardly used $125 941-564-8770 PS2 GAMES (6) MORTAL KOMBAT&MORE,GREAT COND. $20 941-460-8189 QUARTZ TUNER/AMPLIFIER/RECEIVER Onkyo a steal @ $78 941-697-1102 TV/STEREO/RADIO6040 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** illill illilli lllllllll 11111111 1111111111111*40000000 Lwm 111111111111111111111IIIIIIIIIIIIIIIIIIIIIIilllllllllllllllllllllilillillilillillillilliftmoooooooooDO ODDOD00 0 c )Tj -0.3572 Tc 244.6316 0 0 33 504 72.0341 Tm (0

PAGE 41

The Sun Classified-Section A Page 16E/N/C/VSaturday, September 24, 2011 DOGS6233 NOTICE: Statute 585.195 states that all dogs and cats sold in Florida must be at least eight weeks old, have an official health certificate and proper shots, and be free of intestinal and external parasites. BORDER COLLIEPUPS Reg, Working parents, 941-624-0355 or 875-5253 CHIHUAHUA PUPPIES FOR SALE Call 941-623-8926 GERMAN SHEPHERD Pups. CKC Cert. $600-$700 OBO. Can work on $ Male/ Female. Mom on-site. (941)256-4883 MALTESE PUPPIES 8wks, Adorable, Tiny, shots, health cert $450 863-7734308 RARE BRUSSELS GRIFFON 9wks 1F 2M Health cert $20 0 each 941-661-9081 SHIH TZUS8WKS OLD $499 2 FEMALES 941-681-1016 SHIH-TZU PUPPIES Registered 941-276-9498 YORKIE-POO PUPPY, Black & Gold, 3.5 lbs, DOB 5/12/11 $1100 call 863-244-4182 PETSUPPLIES & SERVICES6236 AQUARIUM 10 GAL WITH GRAVEL ONLY $5, OBO 941268-9029 AQUARIUM 72GAL Salt Wtr live rock and lots of accessories. $495 941-698-1042 DOG CAGE black wire w/tray 24x18x21 high like new $29 941-627-9736 Pt Char FISH TANK 5gal hexagon tank, stand, filter, hood & decorations. $25 941-276-0271 PET CARRIER/CAGE 16W23L-17H exc cond $25, OBO 941-423-2875 PET CARRIER: Canvas Print T ote for travel,etc.Unused.Nice. $25 941-276-1881 APPLIANCES6250 $40 SERVICE CALL The Areas most trusted Appliance Repair Service. We can fix it! 941-473-9484 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** ADVERTISE In The Classifieds! T OOLS/ MACHINERY6190 PVC FITTINGS 850 ASST.PIECES $200 941-4757577 RACHET 1/2 NEW CRAFTSMAN COST OVER 30 SELL $15 941-268-9029 RAMPS & CHOCKS HD car ramps for oil chg. etc $20 941-575-1393 SCROLL SAW Dremel 16 2 speed $45 941-423-9371 STATIONARY MITRE saw B&D, new spare carbon steel blade $60 941-423-2585 T ABLE SAW 12 Full Size table $250, OBO 941-2140453 T ABLE SAW Craftsman 10 in. T able Saw $200 941-7162493 T ABLE SAW Craftsman 10, stand, extras, North Port $250 941-769-2956 T ABLE SAW Craftsman 10, stand,extras. $225 North Port 941-769-2956 TOOL BOX SEARS 9 DRAWERS 2 SHELVES, COST 499. SELL $250 941-268-9029 TRANSIT DEWALT with case, tripod. good cond. $80 941929-5432 WANTED USED MECHANICAL PLATFORM SCALE 500lb capacity or more. Call 941-416-6293 WEEDWACKERECHO EXCELLENT MACHINE,RUNS GREAT $50 941-460-8189 WET TILE cutter Chicago $39 941-625-8956 WRENCHES, STD & METRIC NEW CRAFTSMAN. COST 80. SELL $50 941-268-9029 OFFICE/BUSINESS EQUIP./SUPLIES6220 OFFICE OUTFITTERSPre-owned & new office furniture. VENICE 941-485-7015 FILE CABINET 2 drawer lateral $45 941-698-6692 STORE SHELVES & Stands Like new formica different size $100, OBO 941-629-4444 RESTAURANT SUPPLIES6225 CANDY VEND Machine V endesign 4 section takes quarters $65 941-629-7449 LOBSTER TANK $450 941-697-6666 BIRDS6231 B&G Macaw pd.$1800.00 First $395 cash takes it Illness forced to sell 941-740-2152 EXOTIC BIRD EXPO At Charlotte CountyFair Grounds Sun. Sept 25, 9am-4pm 941-276-1561 info at: companionbirdclub.com CATS6232 NOTICE: Statute 585.195 states that all dogs and cats sold in Florida must be at least eight weeks old, have an official health certificate and proper shots, and be free of intestinal and external parasites. BUILDING SUPPLIES6170 GARAGE STORAGE cabinets Old kitchen cab. used in garage. $50 941-661-5480 KITCHEN CABINET 4 white, dbl stnless steel sink gd cond. $60 941-474-6912 LUMBER: 5-2X6X12, 22X6X11, 1-2X6X5.$15, OBO 941-979-8730 SECURITY LOCK SCHLAGE key pad and handle NIB $110 941-697-8457 VANITY SINKS (2) Corian White Oval w/backsplash NEW IN BOX $50 941-624-0121 WATERSYSTEM KINETICO $495 941-496-9252 WINDOW ANDERSON Comp. made. Still in box. White vinyl double pane. $79. 941-6294444 WINDOWS, 17X34 TEMPERED GLASSwhiteframe fixed windows $50.00 each 941-697-3754 WOODColumbia Wood Prod (34 pcs.) 1/2x48x96 Walnut & Birch $375 941-624-0121 HEAVY/CONST. EQUIPMENT6180 WANTED USED MECHANICAL PLATFORM SCALE 500lb capacity or more. Call 941-416-6293 T OOLS/ MACHINERY6190 10 TILE W et Saw 2HP with stand like new. Call George $375 941-380-4464 ALL IN 1 CUTTING SYSTEM UNIQUE HAND HELD COST 150 SELL $70 941-268-9029 ASSORTMENT SCREWS, bolts, etc $10 941-564-8770 B&D 2-SIDE case w/asst.drill bits,driver heads.No handle. $8 941-276-1881 BAND SAW 12 2 wheel Craftsman. Extra blades Ex. cond. $125 941-475-9689 CHAINSAW & sawsall batt. Roybi,18volt,good $99 786306-6335 CHOP SAW Delta w/attachments Exc cond $45 941423-9371 CIRCULAR SAW Craftsman mdl#207.25530, vintage, $80 571-251-4101 COMPRESSORKOBALT 60 Gal. Compressor. In Great Condition. $335 941-716-2493 COMPRESSOR SPEEDAIR 3HP Briggs gas good cond $300. 941-639-7558 DETAIL HAND SANDER CRAFTSMAN NEW IN BOX W/ CASE $30 941-268-9029 DIAMOND TIP blade new 9 wet tile blade $20 941-2281745 ELECTRIC SANDER Craftsman H.D. $10 941-228-1745 GENERATER B&S 5550 watts 8550 starting 10Hp $385, OBO 941-475-7507 GENERATOR COLEMANPOWERMATE.6250 Wat ts, 10HP.Used very little. No r oom to store. $300 941426-2466 LAWNMOWER ENGINE 6.5 HP WITH BLADE,RUNS GREAT. $30 941-460-8189 PLANER DEWALT 735 Planer. Excellent Condition. $350 941-716-2493 PLANERRIDGID 13 Inch, Used but Excellent Condition. $250 941-716-2493 PULLING CART / dolly / hand truck, Greenlee 2 wheel wire $150 941-626-0680 LAWN & GARDEN6160 ANTI GRAVITY Recliner Blue very good shape $25 941429-9120 ANTI GRAVITY r ecliner camouflage pattern. $25 941-429-9120 BLW,VAC,MLCH CRFTMN, Exc.Cond. $75 941-3917531 CONCRETE BOARDERS FOR LAWN/GARDEN $2 941-237-1085 CUTTING PONY of a tractor, 42 craftsman w/owners manual. $450 941-412-1966 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad and the price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** HEDGE TRIMMER B&D Exc.Cond. $50 941-3917531 PUTCLASSIFIEDS TOW ORKFORYOUV enice,Englewood, North Port 2 2 0 0 7 7 1 1 2 2 0 0 0 0Pt.Charlotte Areas Call 2 2 0 0 6 6 1 1 2 2 0 0 0 0 LANAI SWING Call after 10:00 AM $50, OBO 941639-1228 LAWN MOWER Self Propelled, Toro 21 $70 941485-0681 USED LAWN MOWERS *Riders, Push & Parts. 941-268-0917 or 416-1109 NEW AD Push Mower $40, OBO 941-623-3723 PA TIO TABLE w/ large umbrella 4 chairs on casters $150 941-564-8770 PUSH MOWER Murray, exc. cond. $125 941-391-7531 TIKI BAR New, 3 x 6 U pick top color. $425 941-6612667 TRACTOR TIRES 8 CARLISLE TURFSAVER 13x5.006 brand new $130, OBO 941-6616941 WANTED: NON-RUNNING LAWN MOWERS, NO RIDERS CASH PAID! 941-286-3119 STORAGE SHEDS/ BUILDINGS6165 SHEDRUBBERMAID 6x6 storage missing panel txt pic $200 941-268-5413 BUILDING SUPPLIES6170 ALUM HURRICANE Panels 16 68X15, 5 86X15, 3 Clear 70X15 $300 941-276-8970 BR SINK w/ cabinet 24inch white drop in sink with white cabinet. $25 941-474-6912 COUNTER TOP CORIAN, gray, very clean, 4 different sizes. $235, OBO 941-6294444 FIREARMS6131 GLOCK 45 ca. Model 36 Concealed carry gun $500. 941-661-8953 SPRINGFIELD XD 9mm pistol, 3 mags, mint cond. in box. Concealed weapons permit r equired.$525. 941-492-4503 BICYCLES/ TRICYCLES6135 3 BICYCLES ladies for all $75 941-629-5576 BICYCLESTREK matching his/hers for trail/road $450 941-628-4520 BIKE 18 Girls Training wheels & knee pads incl. CASH $30 941-629-6850 Classified = Sales BIKE CARRIER RHODE GEAR 2 BIKE CARRIER USED ONCE $40, OBO 941-698-9899 BIKE, TREC GIRLSCoaster $325 941-496-9252 FRONT RIM NEW, ALUM, FOR 26 BIKE. SHOP CHARGE 53. SELL $35 941-268-9029 TRICYCLE MIAMI SUN Excellent condition Hardly used. $250, OBO 941-545-2176 TRICYCLE totallyrestored. Asking what was spent. Must see!!! $450 941-268-2147 T OYS6138 CHILDS SLIDE STURDY, SAFE, INDOOR/OUTDOOR. $15 941-258-2016 FISHER PRICE ride on /bouncing zebra, looks new, $20, OBO 941-769-1771 LITTLE TIKES outdoor gym/slide,faded $10 941769-1771 TOY CHEST Tiny Tykes bench $15, OBO 941-979-8730 TOY GIRAFFE 4 Ft. Stuffed Giraffe, Exc. Condition. $50 941-627-2192 PHOTOGRAPHY/ VIDEO6140 CAMERA CANON 35 mm sure shot max date /w 3 rolls of film $40. 941-628-6371 CAMERAPANASONIC lumix DMC-TZ3 10X ZM Call for details $75 941-625-1328 DIGITAL CAMERA ricoh RDC2E complete w/case&cables $50 941-697-3754 MOVIE SCREEN 38X39 Free standing, no wrinkles or tears. $20 941-475-2861 POOL/SPA/ & SUPPLIES6145 **SPAS & MORE**TRADE-INS WELCOME We buy used & move hottubs. Many used to choose from $100 and Up 941-625-6600 HUGE-A HOT TUB SAVINGS HOT TUB Fits in corner. Used 1 mo. Paid $3700 Asking $2,000 941-255-3831 HOT TUB SWIM SP AS 5 PERSON SPA W/ LOUNGER $1595 SWIM SPA LOADED $8995 941-462-0633 POOL BASKETBALL/VOLLEYBALL Set. New. $75 941-766-1582 PUMP, HAYWARD 1 1/2 HP Self priming. Like new. $200, OBO 941-830-8161 EXERCISE/ FITNESS6128 BOWFLEX POWER Pro 410 lbs rods+leg attachment $175, OBO 941-629-4940 BOWFLEX ULTIMATE, like new,W/manuals and film $450, OBO 941-759-2222 ELLIPTICAL A nice Pro Form elliptical machine great condition the newer model $70 941-916-1657 ELLIPTICAL WESLO exercise equipment, Like New. $200 941-475-9197 EXERCISE BIKE New Balance, fairly new $200 941-629-7225 KICK/PUNCH BAG W aveMaster by Century.Perfect shape $50, OBO 941-268-3034 MASSAGE TABLE w/bolster and stool Oakworks $240 941-627-1371 NORDIC TRACK Skier excellent cond, LED display $75, OBO 941-629-4940 TREADMILL PROFORM Crosswalk 405E Exc. $350 941-766-9305 WEIDER WEIGHTS bar bench & more over 200lbs only $74 941-697-1102 ZUMBA BASIC Custom DVD $20 941-276-8259 ZUMBA TOTAL Body Fitness CUSTOM DVD $40 941-2768259 SPORTINGGOODS6130 COMPOUND BOW GRIZZLY BEAR 40-45LB DRAW RH $80 941-493-3851 CORNHOLE GAME Custom made Fl. Gators with matching bags $165 941-628-4520 DARTBOARD ARACHNID Elect/wall 27x20 darts inc. gd cond. $35 941-575-7270 FISHING REELS 16 used dif sizes and brands $110 941661-6941 FISHING WAGON Metal,lrg wheels, folding sides, 8 rod holders $35 941-223-9800 KNIFE Hunting/throwing custom made (McEvoy) w/book $70 941-629-8955 MINI HELMET signed by Ben Roethlisberger $125, OBO 941-244-3387 REEL GAMEFISHER AUTO MANUAL internal trip, stainless ball bearing $7 941-2761881 RIDING HELMET SAVE $ Small,Blk., nice cond. $25 941-474-4550 ROD SHIMANO w/bait caster r eel $175, OBO 941-6262832 GET RESULTS USE CLASSIFIED! SUNCOAST GUN SHOWSept. 24th & 25th SAT. 9-5, SUN. 9-4 Lee Civic Center Bayshore Rd. N. Ft. Myers BUY SELL TRADE Concealed Weapon Class $45 10AM & 2PM daily WAKE BOARD-LIQUID Force w/LifeVest & Fins $150 941276-8970 FIREARMS6131 45 ACP 900 rnds, 230 grn. FMJ, Wolf ammo, $300, consider trades. (941)-769-1367 A COLLECTOR buys military guns, swords, etc. Old Colts & W inchesters. 941-705-5145 Lwa low,0000000000)-511(0 0

PAGE 42

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 17 6000 MERCHANDISE ENGLEWOOD GARAGE SALES6002 SAT 7 12 14242 Whi t comb Ln. SGC. TV, chick en coup, hockey equipt, doll house w furn, Cabagge Patch. SAT .SUN 8 1 410 So. McCall Rd. (Old Englewood, accross from Comm. Presbyterian Church) SAT .SUN 8 : 30 -2 : 30 1526 St. Clair Rd.. Tak e Overbrook Rd. go to stop sign, turn L & R on St. Clair. SAL E SALE SALE 2 families, John Deere mower, 6 mos. old, $1,450/ obo. Micro-wave, fur niture, man y old & new items. NORTH PORT GARAGE SALES6005 FRI.-SAT-SUN. 9-4 1611 Okolona St. ESTATE SALE ALL FURNITURE, household items & tools. FRI .SAT 8 4 3029 LOG CABIN RD. Lots of stuff, clothes, comput er desk, household, tools, etc PT. CHARLOTTE/DEEP CREEK GARAGE SALES6006 FRI SAT 8 2 1116 & 1128 Belmar Ave. Havin g two family garage sales. FRI.-SAT. 10-3 1264 Marke t Circle, Pt Charlotte. DDM Thrif t Store moving. Select M W Children clothes @ .25 ea. TVs Beds Dressers Household Medical -Clearance to 75% off FRI .SAT 7 2 27070 Curitiva Dr. Deep Creek MOVING SALE, Beds, chin a hutch, Sofas, etc... Too much PT. CHARLOTTE/DEEP CREEK GARAGE SALES6006 FRI .SAT 8 ? 22114 M a lone Ave. INSIDE SALE. Fur niture, washer, dryer, 198 0 Corvette, TOOLS & lots mor e BIG SALE! FRI.-SAT. 8-2 167 Oldenburgh Ct NE. Music equip., tools & books. Call for directions 941 391-5448 FRI .SAT 8 2 754 Seabold Ave. Furniture lap top house items lamps kid s stuff shed decor unique items FRI .SAT 8 3 1549 Abscott St. 3 families, Bikes, large outdoor swing, tools incl. air compressor, household & clothes. FRI.-SAT. 8-3 701 Jarvis St. Multi-family, low prices,tools,household,etc FRI .SAT 9 4 226 B angs burg (off Edgewater).Hug e 2 family sale, new household items,decor.,furn.,lamps,rugs, child clothes & toys FRI.-SUN. 8-3 14229 Marli n A ve. ALL CONTENTS, El Camino, EVEN THE HOME CINDY SPIRK, CENTURY21 ALMAR & ASSOC. 941-429-2727 FRI.-SUN. 8-5 3495 Drance St (off Harborview) Huge warehouse sale. T ons of tools. SAT. 7:30AM 12:30 2321 Sofia Lane. Deep Creek, No presales. No early birds. furniture Christian items, tapes, books, VHS movies, cd's. household Scents y warmers & wax at 20%of f r etail. Collector items, Avon plates 1973-1981. Air tan k costume jewelry.Just too much SAT 8 1 501 Sh aron Ci r. Mixed clothing, kitch, toys, fooseball table, & lots of misc. SAT. 8-1 57 Rosemary St.. Lots of toys and misc. items. SAT 8 2 2403 Ald a L n. 2 family loads of tool s antiques clothing household items. Something for everyon e PT. CHARLOTTE/DEEP CREEK GARAGE SALES6006 SAT. 8-3 17131 Horizon Lane. Collectibles, art, bronze, eletronics, nautical SAT ONLY 8 1 4206 W inona St. No Early birds. Elect. scooter, refrigerator, T v & stands, Much more. THU .SAT 8 2 26169 Rampart Blvd. Moving Sale! Tools, Furniture, Housewares, Crafts, A lot of stuff! THURS.,FRI..& SAT. 9A-4P 25793 Aysen Dr, Deep Creek ESTATE SALELots of vintage & decorativ e items, lovely furnitue, loads o f j ewelry and household full. PUNTAGORDA GARAGE SALES6007 CONSIGNING WOMAN 6188 Elliott St. Up to 20% off. Large selection of furniture & access. (941)-505-9701 FRI .SAT 7 : 30 12 7513 S Blue Sage, Burnt Stor e Meadows, Baby items, lots o f DVDs, misc. FRI .SAT 7 : 30 2 : 30 6035 Acline. (& Sun) of f T aylor past Walmart. huge sal e something for everyone FRI .SAT 8 3 6040 Grove Blvd. Punta Gorda. Estate Sale all in house/garg e must go 2 mi. down Bermon t from Rt 17.1st house on Grov e SAT 9 3 3886 B or d eaux Off Madrid ESTATE SALE SAT 8 NOON 25477 Marion Ave. (Located on corner of Marion Ave and Flori da St.) Antiques, clothes for whole family, baby & kids stuff, bed frames, dishes & MORE!! THUR SUN 8 2 1471 Appian Dr. MUL TI F AMIL Y SALE: Outdoor & inside art, household items & much mor e THUR-SUN. 8-2 1471 Appian Dr. MUL TI F AMIL Y SALE: Out door & inside art, household items & much more ROTONDAAREA GARAGE SALES6008 FRI.-SAT. 7:30-2 4 Pine V alley Ln. Misc items SAT ONLY 8 2 250 ROTONDA CIRCLE. Lots of great stuff. Household items and much more. S. VENICE AREA GARAGE SALES6010 FRI .SAT 8 1 380 S Qunicy Road. Moving Sale Everything must go! Furniture, TVs, etc. SAT. 7AM 4129 Hibiscus Rd. Antiques from Asia, 1960 s winchester rifle, assorted gun s and household items. SAT 8 1 S un 8 12 3436 Rosyln Rd. No Early Birds. Holiday ornaments, electronics, outdoor equip, misc. Must see VENICE AREA GARAGE SALES6011 FRI .SAT 7 : 30 3 2601 Ellis Blvd. Venice Ranch between Pinebrook & Jacaranda off Venice Ave. FRI .SUN 8 1 429 E as t Shade Dr. off Center Rd. Lawn furniture, figurines, pots, bicycle, lots of housewares. PUTCLASSIFIEDS TOWORK FORYOU! FIND A JOB! BUY A HOME! BUY A CAR! SAT 8 2 4521 C rysta l Rd. Tools & supplies fo r the do it yourselfer, wor k bench, ladders, & much more SAT 9 4 1239 W aters ide La.: Collectables, Kimball piano, housewares, books, CDs, holiday items, handbags, kitchen items & much more!! SAT OCTOBER 1 8 3 492 E Shade Dr. Larg e Furniture, Tree with staghorn ferns!! & some lawn equip ment, 941-716-3260 SARASOTA COUNTY DESOTO COUNTY CHARLOTTE COUNTY 31 74 70 72 Arcadia Nokomis Ven ice Nor th Po rt Murdock Gu lf Cove D eep Creek Bur nt Store Punta Go rda Osprey Laurel Bo ca Grande Grove City En glew ood P lacida R otonda W est 6001 6006 6002 6005 6004 6007 6011 V enice Ave. C enter Rd. Port Charlotte El J obean S o. Ven ice 6001 Arcadia Area 6002 Englewood Area 6003 Lake Suzy 6004 Nokomis/Osprey Area 6005 North Port Area 6006 Port Charlotte Area 6007 Punta Gorda Area 6008 Rotunda 6009 Sarasota Area 6010 South Venice 6011 Venice GARAGE SALE LOCATOR RATES 1 day $ 11.95 4 lines ($5.00 ea. addl line) 2 days $ 18.25 4 lines ($5.00 ea. addl line) 3 days $ 23.40 4 lines ($5.00 ea addl line) 7 days $ 29.65 4 lines ($5.00 ea addl line) To place your ad call: 8664631638 GARAGE & YARD SALES FREE GARAGE SALE SIGN WITH ANY AD 776 771 775 776 75 41 41 75 17 41 6008 6010 6003 6009 APPLIANCES6250 WASHER WHITE Whirlpool $125 586-216-4084 MISCELLANEOUS6260 AIR CONDITIONER Kenmore window 5050 BTU New $80 941-423-9371 BOOKS,CHILDREN-TEENS Over 100, exc.cond. $40 941-268-3010 CAR TOP CARRIER HIGHLAND KARPAK WATERPROOF $30, OBO 941-698-9899 CHRYSLER SEBRING Top Boot Cover #OQG88TRM Tan $100 941-539-7468 CIGAR HUMIDOR Glass lid, Rosewood w/cedar, holds 100 cigars. $50 941-258-0472 CORAL STAGHORN 15H X 20W cost 350.00, sell $150 941-629-8955 DVDS, 35 plus new, ask for Patrick $75, OBO 941-4292037 E-Z UP 10 X 10 commercial 600 Denier, roll bag new in box $450 941-624-0121 FIREWOOD SEASONED split oak 1/2 facecord $120 941526-7589 HURRICANE LAMPS Matching set need top glass globes $20, OBO 941-698-9304 LADIESblouses, Mens shirts, Childrens clothing. Overstocked jewelry, Christmas items and more. 941-623-6302 NEON BEER sign German SPATEN 16x18 $70 941-6257900 POKER TABLE Top Roulette/Craps w/carry case $20 941-628-6371 W ANTED TO BUY/TRADE6270 BUYING gold, silver and vintage costume jewelry. 941-769-8561 CASH PAID FOR WWI WWII KOREAN, VIETNAM GERMAN,JAPANESE, ETC. Military items (941)-416-3280 COLLECTOR BUYING Jewelry, gold, silver, coins, watches, costume jewelry, silverware, antiques collectibles, firearms, anything old and interesting. House calls. V enice (941) 445-9002 ADVERTISEWITHTHE SUNCLASSIFIEDS WANTED USED MECHANICAL PLATFORM SCALE 500lb capacity or more. Call 941-416-6293 WASHER/DRYER WANTED. Fast Pick up. Cash Paid $75 941-301-3928 Y amaha Acoustic wanted nylon strings, Must be in good cond. 941-445-1274 7000TRANSPORTATION BUICK7020 1999 BUICK PARK AVE ULTRA 52,000 mi. white w/grey leather int. Mint! $6,700 OBO KBB $7,055 941-661-1399 PC APPLIANCES6250 A/C 4 ton Trane central split outside $475 786-306-6335 COOKTOP KENMORE 30 glass touch control $300, OBO 941-525-3429 DRYER AMANA HD 6 cycles, white, needs heating element $25 941-629-7449 DRYERELECTRIC WHITE WHIRLPOOL H.D. $100, OBO 941-585-8778 DRYER KENMORE, looksgood, works good $50 941624-4758 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** FREEZER SANYO 48Hx22W 25D like new. Call George $75 941-380-4464 FRIDGE GE White SxS 36x68 25cf water ice on door Ex Cond $295 941-766-7545 FRIDGE, GEside by side 22cf $200; 10cf Magic Chef fridge $100; GE dishwasher $50 All EXCELLENT Cond. 941-228-2454 MICROWAVE GE Profile White Convect/bake overstove $100 941-639-3760 MOST WASHERS, Dryers & Fridges repaired for $65 or less. 941460 0763 BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! PEPSI COLA Drink Cooler 18D x 40W X 36 H indoor/outdoor $275 941-625-6646 RANGE GE Electric SC black glass door $128 941-6256646 RANGE GLASS top Frigidaire, SS $375, OBO 941-585-8778 REFRIGERATOR GE, Top freezer. Excellent condition, white. $125 941-629-7670 REFRIGERATOR KITCHEN Aid s/s water/ice white $299 941-639-3074 REFRIGERATOR MAYTAG 18cf freezer on top $150, OBO 941-625-2779 STOVE GE Spectra 30 Glass T op White $200 941-6393760 WALL OVEN Kenmore 30 self cleaning, stainless steel $400, OBO 941-423-2235 WASHER & DRYERmatching set, approx 2-3 yrs old, like new! $350 941-286-9001 WASHER & DRYER Whirlpool Estate White. Venice $250 941-492-5331 WASHER & Dryer Whirlpool Set, white, excellent Condition $250 941-257-8405 WASHER ANDDryer Roper $195 916619752 WASHERS/DRYERS $149. each or $290. Set 1 Year Warranty. 941-766-0226 WHPL WASHER $100, 3.5 ton cond $399, 18,000 BTU a/c 220v $225, mower 4.5 hp $65. 941-764-7377. 1 it ^)Tj -0.2083 Tc 6.9167 0 0 4 148.5 997.5058 Tm ()Tj 1 0.502 0 rg /TT1 1 Tf -0.1474 Tc 45.8684 0 0 15 54.5 644.0166 Tm (Q X El EElF ElEl El El LoweaEl El El El ElLlm)]TJ -0.1389 Tc 20.3431 0 0 15 262.5 322.5264 Tm (El ElEl ElEl )Tj /TT2 1 Tf -0.1389 Tc 20.3431 0 0 15 262.5 193.0304 Tm (ElLOOMIS )Tj /TT2 1 Tf -0.1333 Tc 19.5294 0 0 15 141.5 119.0326 Tm (ElEl ElEl El )Tj EMC ET

PAGE 43

The Sun Classified-Section A Page 18E/N/C/VSaturday, September 24, 2011 HONDA7160 2010 HONDA ACCORD LX, 4 door, white, 17,689 mi. $19,875 877-219-9139 dlr 2010 HONDA ACCORD LXP, 4 door, red, 17,014 mi. $19,875 877-219-9139 dlr CLASSIFIED ADSSELL 2010 HONDA CIVIC Certified LX, 4 door, silver, 25,107 mi. $17,245 877-219-9139 dlr 2010 HONDA CIVIC Certified LX, 4 door, white, 12,960 mi. $17,540 877-219-9139 dlr 2010 HONDA CIVIC LX, 4 door, silver, 24,547 mi. $17,854 877-219-9139 dlr 2010 HONDA CIVIC LXS, 4 door, blue, 20,346 mi. $17,992 877-219-9139 dlr 2010 HONDA CIVIC LXS, 4 door, polished metal, 13,836 mi. $17,854 877-219-9139 dlr 2011 HONDA ACCORD Certified EXL, coupe, red, 5,548 mi. $24,975 877-219-9139 dlr 2011 HONDA ACCORD SDN Interior : gray, cloth Exterior : Gray. #: 11366A CALL 888-690-8667 2011 HONDA CIVIC Certified EX, 4 door, silver, 3,248 mi. $20,458 877-219-9139 dlr 2011 HONDA CIVIC Certified LX, 4 door, white, 7,076 mi. $16,950 877-219-9139 dlr 2011 HONDA CIVIC LX, 4 door, blue, 5,732 mi. $18,245 877-219-9139 dlr HYUNDAI7163 2002 HYUNDAI XG350 4 door, black, 109,696 mi. $6,875 (877)-219-9139 dlr 2004 HYUNDAI TIBURON dark blue, 49,282 mi. $9,875 877-219-9139 dlr 2008 HYUNDAI ACCENT GS, coupe, blue, 71,773 mi. $7,985 877-219-9139 dlr 2009 HYUNDAI ELANTRA Interior :Beige,Exterior Merlot #: CHARRONA CALL 888-690-8667 DLR 2010 Hyundai Elantra Interior : Exterior : Black #:92629, 888-690-8667 Dlr 2010 HYUNDAI ELANTRA Interior : Exterior : Beige #: 59251-1 CALL 888-690-8667 dlr. 2010 HYUNDAI ELANTRA Interior : Gray Exterior : Blue #:92668. 888-690-8667 dlr. 2010 HYUNDAI ELANTRA Interior : Gray Exterior : Silver #:92669 CALL 888-690-8667 Dlr. 2010 HYUNDAI ELANTRA Interior : Tan Exterior : White #:92665. 888-690-8667 DLR. 2010 HYUNDAI GENESIS coupe, 2.0, silver, 11,023 mi. $21,458 877-219-9139 dlr INFINITI7165 2008 INFINITI G35 4 door, black, 43,156 mi. $24,950 877-219-9139 dlr 2008 INFINITI G35 nav, 4 door, 41,489 mi. $25,693 877-219-9139 dlr JAGUAR7175 1999 JAGUAR XJ V ANDEN PLAS BRITISH GREEN W TAN L TH LOW MILES CHROME WHEELS & MORE $9,988 WILDE JAGUAR 877-216-8292 2003 JAGUAR S-TYPE 4 door, silver, 79,437 mi. $12,587 877-219-9139 dlr HONDA7160 2009 HONDA ACCORD Certified LX, 4 door, red, 7,817 mi. $19,875 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, beige, 35,337 mi. $22,458 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, black, 22,799 mi. $22,875 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, blue, 20,086 mi. $21,588 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, green, 22,374 mi. $19,950 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, polished metal, 16,444 mi. $24,547 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, red, 35,655 mi. $23,875 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, silver, 39,984 mi. $20,987 877-219-9139 dlr 2009 HONDA ACCORD EXL, 4 door, white, 48,607 mi. $18,950 877-219-9139 dlr 2009 HONDA ACCORD Interior : Exterior : White #: 92588-1 CALL 888-690-8667 DLR 2009 Honda Accord Interior : Exterior : Silver #: 15526-1 CALL 888-690-8667 2009 HONDA ACCORD LX, 4 door, polished metal, 40,299 mi. $16,987 877-219-9139 dlr 2009 HONDA ACCORD LX, 4 door, silver, 21,758 mi. $16,950 877-219-9139 dlr 2009 HONDA ACCORD LX, 4 door, silver, 39,215 mi. $16,875 877-219-9139 dlr 2009 HONDA ACCORD LXP, 4 door, black, 10,046 mi. $19,875 877-219-9139 dlr 2009 HONDA ACCORD LXP, 4 dr, polished metal, 20,081 mi. $19,245 877-219-9139 dlr 2009 HONDA CIVIC EX, 4 door, silver, 47,313 mi. $18,754 877-219-9139 dlr 2009 HONDA CIVIC LX, 4 door, auto, red, 31,659 mi. $17,248 877-219-9139 dlr 2009 HONDA CIVIC LX, 4 door, red, 37,981 mi. $16,697 877-219-9139 dlr 2009 HONDA CIVIC LX, 4 door, royal blue, 38,910 mi. $15,950 877-219-9139 dlr 2009 HONDA CIVIC LXS, 4 door, silver, 38,542 mi. $16,875 877-219-9139 dlr 2009 HONDA FIT base, auto, silver, 36,469 mi. $13,950 877-219-9139 dlr 2009 HONDA FIT base, silver, 16,579 mi. $15,877 877-219-9139 dlr 2009 HONDA FIT Sport, blue, 29,743 mi. $15,950 877-219-9139 dlr 2009 HONDA FIT Sport, blue, 39,521 mi. $14,950 877-219-9139 dlr 2009 HONDA FIT Sport, silver, 29,307 mi. $15,875 877-219-9139 dlr 2010 HONDA ACCORD Certified EX, 4 door, gray, 13,711 mi. $18,950 877-219-9139 dlr 2010 HONDA ACCORD Certified EXL, silver, 12,650 mi. $22,950 877-219-9139 dlr 2010 HONDA ACCORD EX, 4 door, blue, 26,969 mi. $21,470 877-219-9139 dlr 2010 HONDA ACCORD EXL, 2 door, polished metal, 26,363 mi. $21,785 877-219-9139 dlr 2010 HONDA ACCORD EXL, 4 dr, polished metal, 23,135 mi. $23,458 877-219-9139 dlr NEEDAJOB? CHECKTHE CLASSIFIEDS! 2010 HONDA ACCORD LX, 4 door, beige, 16,415 mi. $19,875 877-219-9139 dlr ACURA7145 2005 ACURA TL 3.2 4 door, gray, 70,988 mi. $16,875 877-219-9139 dlr BMW7148 2001 BMW 740I GRAY 79K MILES MUST SEE $12,988 WILDE JAGUAR 877-216-8292 2006 BMW 330CI 2 door, manual, red, 54,904 mi. $20,478 877-219-9139 dlr GET RESULTS USE CLASSIFIED! 2007 BMW 335I 4 door, gold, 72,529 mi. $17,950 877-219-9139 dlr 2008 BMW M3 CONVT GRAY 6 SPEED 28K MILES $49,988 WILDE JAGUAR 877-216-8292 HONDA7160 1999 HONDA CIVIC VP, 4 door, green/beige, 86,804 mi. $6,987 877-219-9139 dlr 2003 HONDA CIVIC SI, white, 95,581 mi. $7,985 877-219-9139 dlr 2004 HONDA ODYSSEY EXL, blue, 67,609 mi. $12,950 877-219-9139 dlr 2006 HONDA ACCORD EXL, 4 door, silver, 94,547 mi. $11,487 877-219-9139 dlr 2006 HONDA ACCORD EXL, V6, 4 dr, nav, silver, 65,093 mi. $13,875 877-219-9139 dlr 2006 HONDA ACCORD LX, 4 door, gray, 105,015 mi. $9,875 877-219-9139 dlr 2006 Honda Accord, 4-door. $13,990 Gorman Premier 941-639-7300 2007 HONDA ACCORD EXL, 4 door, bronze, 43,529 mi. $17,245 877-219-9139 dlr 2007 HONDA ACCORD EXL, 4 door, silver, 38,487 mi. $18,754 877-219-9139 dlr 2007 HONDA CIVIC EX, red, 69,726 mi. $13,879 877219-9139 dlr 2007 HONDA TIBURON, V6, MINT, $11,488 $10,988941625-2141 Gorman Family 2008 HONDA ACCORD CPE Interior : Black, cloth, Exterior : Black. #: 7206P CALL 888-690-8667 DLR 2008 HONDA ACCORD EX, 4 door, green, 33,287 mi. $17,950 877-219-9139 dlr 2008 HONDA ACCORD EXL, gray, 45,262 mi. $18,950 877-219-9139 dlr 2008 HONDA ACCORD EXL, nav, 4 dr, black, 25,522 mi. $21,487 877-219-9139 dlr 2008 HONDA ACCORD EXL, r ed, 29,444mi. $17,950 877219-9139 dlr 2008 HONDA ACCORD EXL, V6, 4 dr, polished metal, 40,887 mi. $18,950 877-219-9139 dlr 2008 HONDA ACCORD EXL, V6, black, 35,209 mi. $20,986 877-219-9139 dlr 2008 HONDA ACCORD EXL, V6, white, 37,416 mi. $21,487 877-219-9139 dlr 2008 HONDA CIVIC LX SEDAN WHITE/TAN PERFECT FLORIDA CAR $15,988 WILDE JAGUAR 877-216-8292 2008 HONDA CIVIC LX, 4 door, black, 52,005 mi. $15,847 877-219-9139 dlr 2008 HONDA FIT base, silver, 34,352 mi. $13,875 877-219-9139 dlr 2008 HONDA FIT Sport, black, 78,157 mi. $11,547 877-219-9139 dlr JEEP7080 2005 JEEP WRANGLER X, white, 68,878 mi. $15,478 877-219-9139 dlr 2006 JEEP WRANGLER Unlimited, yellow, 53,518 mi. $15,897 877-219-9139 dlr 2007 Jeep Wrangler $16,990 941-639-7300 P.G. 2008 JEEP LIBERTY Limited, silver, 56,147 mi. $16,950 877-219-9139 dlr 2010 JEEP GRAND CHEROKEELaredo, black, 24,538 mi. $21,487 877-219-9139 dlr LINCOLN7090 2008 LINCOLN MKZ 4 door, white, 39,574 mi. $18,950 877-219-9139 dlr MERCURY7100 2002 MERCURY GRAND MARQUISLS, 1 ownr, 57K mi. Beautiful. $7,995. Charlotte Motor Cars 941-979-9331 2002 MERCURY SABLELS. 61K mi. Leather. Loaded. Cln Car Fax.$6,895 941-9799331 Charlotte Motor Cars ADVERTISE In The Classifieds! PONTIAC7130 2001 PONTIAC Firebird Convertible, cln Car Fax. FL car. Leather. Must see. 80K. $7,695. Charlotte Motor Cars 941-979-9331 SATURN7135 2002 SATURN L200 4 door, blue, 70,260 mi. $5,950 (877)-219-9139 dlr 2002 SATURN LW200 wagon, silver, 45,424 mi. $6,987 (877)-219-9139 dlr 2004 SATURN W agon low mileage, exc. cond.$5,000 OBO N. Eng. 941-460-9456 PRO-POWER AUTO SALES(941)-627-8822USED SATURN SALES P ARTS & SER VICE THE SATURN GUYS 98 SL2 Sedan..........$2495 98 SL1 Sedan..........$2695 99 SL2 Sedan.........$3,299 98 SW2 Wagon........$3,399 00 SL2 Sedan..........$3495 01 SW 1 Wagon.......$3,999 03 VUE SUV.............$5,995 03 VUE SUV.............$5,999 03 ION Sedan..........$6,299 02 VUE V6 AWD.......$7,399 07 ION Sedan..........$8,29908 Astra XR Sedan..$11,995Why Pay US 41 Prices? SCION7136 2006 SCION XB 60,150 mi, torched penny, auto, r elease series 4.0, $8,500, OBO 941-639-8741 2011 SCION XB green, 10,225 mi. $16,875 877219-9139 dlr ACURA7145 2000 ACURA TL 3.2, base, 4 door, beige, 133,449 mi. $5,988 (877)-219-9139 dlr CHRYSLER7050 2007 CHRYSLER SEBRING 4 door, gray. 73,123 mi. $9,950 877-219-9139 dlr 2008 CHRYSLER PT CRUISER Auto, Air. Loaded. Clean Ready to go. 50K mi. $9,499. Pro Power Auto Sales 941-627-8822 2008 PT CRUISER $9990. Gorman Premier 941-639-7300 DODGE7060 2001 Dodge Dakota, Super cab, all power low miles, $6988. 941-639-1601 Dlr. 2001 DODGE NEON 4 DR Sedan, 163,000 mi, 4 cyl., automatic, silver, pwr locks, pwr win, $2,900, 941-468-4915 ADVERTISEWITHTHE SUNCLASSIFIEDS 2007 DODGE Caliber, $11,990 Gorman Premier 941-639-7300 2008 Dodge Magnum $15,990. Gorman Premier 941-639-7300 2010 DODGE CHALLENGER 200 MILE NEW CAR $39,988 WILDE JAGUAR 877-216-8292 FORD7070 1991 FORD MUSTANG convt, 2 dr, silver, 82,981 mi. $5,986 (877)-219-9139 dlr 2004 Mustang Convertible GT. $12,990 Gorman Premier 941-639-7300 2005 FORD THUNDERBIRD 2 dr, convt, blue, 31,465 mi. $24,587 877-219-9139 dlr 2006 FORD Freestyle 4-door, low mi. $12,990. Gorman Premier 941-639-7300 2006 MUSTANG 2-dr Coupe GT, many extras. $17,990.Gorman Premier 941-639-7300 P.G. 2008 FORD EDGE, LOADED, MUST SEE, $18,988 941-6252141 Gorman Family 2008 FORD FUSION SEL V6, loaded, 64k mi, Must Sell. $13,500 obo 219-575-3770 2008 FORD MUSTANG convertible, 2 dr, white, 34,886 mi. $20,950 877-219-9139 dlr 2009 FORD TAURUS white, 26,238 mi. $18,975 877219-9139 dlr Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week BUICK7020 2000 BUICK PARK AVENUE 69k miles, All power options, Very good cond. $4800. 941-473-1587 CADILLAC7030 1995 CADILLACSEDAN DEVILLE, Leather. Full Power! $2,988. 941-639-1601 Dlr. 1999 CADILLAC DEVILLE 94K miles, white, nice, $4,500 941-575-2425 2002 CADILLACELDORADO, Lthr, Moonroof!Loaded! $6,988. 941-639-1601 Dlr. 2003 CADILLAC CTS beige, 32,882 mi. $14,875 877-2199139 dlr 2003 CADILLAC DEVILLE 4 door, beige, 80,968 mi. $9,987 877-219-9139 dlr 2007 CADILLAC STS SILVER 43K MILES GRAY LEATHER PREMIUM SOUND $21,988 WILDE JAGUAR 877-216-8292 2008 CADILLAC DTS WHITE W IVORY LEATHER 34K MILES BEAUTIFUL FLORIDA CAR $26,988 WILDE JAGUAR 877-216-8292 2009 CADILLAC XLR SILVER NAV CAR ONLY 14K MILES $54,988 WILDE JAGUAR 877-216-8292 2011 CADILLAC STS Int : LIGHT GRAY, LEATHER Exterior : SILVER, #:7195P 888-690-8667 DLR CHEVY7040 1987 CHEVROLET CORVETTE Must sell or trade New grandkids 91k miles 95% show ready Over 20k invested Appt. Only, $8,000 941-623-8392 1999 CHEVYMALIBU, 4 Dr. LS, All Power! Low Miles! $3,988. 941-639-1601 Dlr. 2000 CHEV CAVALIER Convertible, auto, leather, low mi. $4988 941-639-1601 Dlr. 2006 CHEVY UPLANDER 43K MI, LIKE NEW $10,988 941-625-2141 Gorman Family 2006 HHR, 44k mi, like new, $9,988941-625-2141 Gorman Family 2007 CHEVY IMPALA LS, gold, 106,102 mi. $7,855 (877)-219-9139 dlr 2008 CHEVY COBALT silver, 51,185 mi. $11,785 877-2199139 dlr 2010 CHEVY IMPALA LT, 4 dr, leather, black, 30,901 mi. $15,950 877-219-9139 dlr CHRYSLER7050 1968 CHRYSLER Newport2 dr, 383 motor, new exhaust, tires and wheels, needs paint. $2800. Call 863-494-0839. 1999 CHRYSLER SEBRING LXI, Coupe, 108k miles, Exc cond. $2600/obo 941-7630608 2005 CHRYSLER CROSSFIRE ROADSTER WHITE 38K MILES L TH LOADED LIKE NEW $17,988 WILDE JAGUAR 877-216-8292 2006 CHRYSLER PTCRUISER T ouring, silver, 77,861 mi. $7,859 877-219-9139 dlr 2007 CHRYSLER 300C HEMI POWER SITTING ON 22 CHROME WHEELS MUST SEE $21,988 WILDE JAGUAR 877-216-8292 0 )Tj /TT0 1 Tf -0.2901 Tc 246.8158 0 0 41 139 932.0078 Tm (0 )Tj 0 0.502 0 rg /TT2 1 Tf -0.0306 Tc 157.5593 0 0 62 18 684.0154 Tm (ADD a D0 )Tj -0.1367 Tc 234.475 0 0 62 18 255.0285 Tm (a )Tj -0.1367 Tc 234.475 0 0 62 261 184.0306 Tm (aCD )Tj EMC ET

PAGE 44

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 19 V ANS7290 1993 OLDSMOBILE SILHOUETTEV6, 3.6 fuel injected, $1000. 941-456-5999 1997 DODGEGrandCaravan 89000 mi. Good cond. $3500.obo 941-474-5293 1999 CHEVROLET VENTURE no a/c. $1,500, OBO 941-661-8842 1999 FORD ECONOLINE E150/runs great/new tires, ladder rack $1,800 941-237-1051 1999 TOYOTA SIENNA LE, r ed, 74,164 mi. $7,895 877219-9139 dlr 2001 FORD WINDSTAR SEL trim, All power options, Good Mechanical, paint and interior. 126k miles, $2800. 941-473-1587 2006 CHEVY EXPRESS white, 36,665 mi. $14,987 877-219-9139 dlr 2006 HONDA ODYSSEY EXL, nav, RES, slate, 103,943 mi. $15,987 877-219-9139 dlr 2006 TOWN & COUNTRY L TD, MUST SEE, $13,988 941-625-2141 Gorman Family 2007 HONDA ODYSSEY EXL, blue, 40,435 mi. $23,785 877-219-9139 dlr 2008 HONDA ODYSSEY EXL, green, 44,420 mi. $25,478 877-219-9139 dlr 2009 HONDA CIVIC LX, 4 door, royal blue, 38,910 mi. $15,950 877-219-9139 dlr 2009 HONDA ODYSSEY EX, gray, 40,877 mi. $23,547 877-219-9139 dlr 2010 KIA SEDONA LX, white, 21,179 mi. $16,950 877-219-9139 dlr TRUCKS/ PICK-UPS7300 1997 DODGE RAM 1500, Quad cab 4 x4, $1,800 239370-5212 1997 FORD F-150, 4x4, lift tip, 36,000 original miles. $6,995. 941-979-9331 DLR CLASSIFIED W ORKS! 1997 FORD RANGER XLT Air Con, stick shift, w/ OD Nice! $3,500 941-426-8660 1998 CHEVROLET TAHOE LT cold AC, rear AC, leather, loaded. many new parts, $4,000 941-625-2252 1999 DODGE RAM 1500 WHITE/GRAY GREAT WORK TRUCK EXCELLENT CONDITION 56K MILES $6,988 WILDE JAGUAR 877-216-8292 2000 CHEVY S10 gray, 74,732 mi. $5,988 (877)-2199139 dlr 2002 NISSAN FRONTIER silver, 78,571 mi. $9,975 877219-9139 dlr 2003 DODGE RAM 1500 4x4, 95K, long bed, a/c, runs great, REDUCED MUST SELL! $5,995. OBO. 941-206-1262 2003 FORD F150 gold, 55,495 mi. $12,875 877219-9139 dlr 2003 FORD F250, AUTO, COLD AC, BEDLINER, $6988. 941-639-1601 Dlr. 2004 CHEVY SILVERADO 1500, quad cab, green, 87,448 mi. $11,987 877-219-9139 dlr 2004 CHEVY SSR SILVER/BLACK SUPER CLEAN 34K MILES $23,988 WILDE JAGUAR 877-216-8292 2004 NISSAN FRONTIER XE, power, bedliner, 4 cyl, 96K miles, $6,900 941-639-1843 2004 NISSAN FRONTIER, quad cab, all power, bedliner, $7988. 941-639-1601 Dlr. AUTO PARTS/ ACCESSORIES7270 ALLOY RIMS Set of 4 15 3 w/tires.great shape! $350 941-735-7360 BMW E38 740IL Parts all parts 98-01 740il seats engine etc $100 941-268-5413 CORVETTE WHEELS 17 5 spoke alloy P245/45ZR1789W tires $495 941-625-6646 COVETTE RIMS 16 set aluminum,80s good $125 786306-6335 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** JEEP FACTORY aluminum alloy wheels 15X7 5 spoke nice! $175 941-626-0680 PONTIAC GTO Motor: 67,400, lower-end $499 941-235-9885 PONTIAC GTO T runk lid $499 941-235-9885 POWER MIRROR fits 0108 Chrysler minivan drivers side. NIB $100/obo 941-626-5099 RIMS BLACK Giovanni 20 Fit various vehicles Tires avail. $395, OBO 941-716-9912 RIMSNASCAR (4) w/tires fit Chevy truck 5 lug. Clean no rust! $80 941-544-0042 TIRE 225-60-17 $20, OBO 941-623-3723 TIRES KUMHO 245/45-17 $80, OBO 941-255-1923 TOW BAR Blue Ox Aventa ll includes Tow Kit $350 201390-9544 TOW HITCH Heavy Duty Valley T owing Hitch $125 941-6272192 TRUCK BOX Mid Sized, Aluminum, Exc. Condition. $85 941-627-2192 TRUCK TIRE LIKE NEW 5,000 MILES ON IT 245-75R16 $25 941-268-9029 WATER PUMP housing for big block Chrysler, excellent cond. $75 941-626-5099 WHEELS AND tires (4) Off a 2002 Firebird, good shape $325 941-697-6456 AUTO SERVICE & REPAIR7280 Steves T owing T owing Fuel Jump starts LockoutsSteves Towing is a family owned business service serving Southwest Florida for over a decade. 941-769-4187 GET RESULTS USE CLASSIFIED! ANTIQUES/ COLLECTIBLES7250 1948 CHEVROLET 2 dr. Fleetline in storage 40+ yrs. Some disassembly. Straight body complete, shows $69K. $4,500. 941-769-2579 1963 FORD FALCON for r estoration only. Best Offer Original Title. 941-637-1369 1977 GMC Sprint (El Camino) 350/350 AT/PS/PB/Cruise. Cold air. Runs excellent. $3250. 941-204-2505 1987 MERCEDES-BENZ 560-SEL, black, 139K looks & runs great asking $6,400 941-627-0688 BUDGETBUYS7252 WE NEED USED VEHICLES TOP CASH PAID (941)-650-5785 AUTOS WANTED7260 I BUY SCRAP CARS,TRUCKS AND WRECKS 941-456-1342 WE BUY CARS $500 CASH +UP Frank 276-0204 JUNK CARSWANTED24/7 Fair $$ Paid941-286-3122, 623-5550 ALL VEHICLES WantedDead or Alive, Top $$ Paid, Starting at $400/$5000 Free pick up 941-623-2428 NEEDCASH? We Really Want Your Car, Van, SUV. No Title...No Problem!Junk to Gems! Flatbed Service.(941)-524-2448 $$ TOP CASH $$ FOR CARS & TRUCKS. DEAD OR ALIVE.4857515 AUTO PARTS/ ACCESSORIES7270 1967 PONTIAC GTO bumper,brackets,plate,Rear., $499 941-235-9885 AIR FILTER K&N Fits Carolla, V ibe, Matrix $25, OBO 941255-1923 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! NISSAN7200 2009 NISSAN 370Z Exterior : Platinum Stock #: 15698-1 CALL 888-690-8667 DLR. 2010 NISSAN MAXIMA 4 door convt, V6, 28,165 mi. $25,874 877-219-9139 dlr 2010 NISSAN SENTRA, LIKE NEW 14K MI, $14,988 941625-2141 Gorman Family SUBARU7207 1995 SUBARU LEGACY r ebuilt motor, needs air $1200 OBO 941-815-4350 leave msg SUZUKI7208 2004 SUZUKI XL-7 one owner, 6 CD changer, LOADED ex cond, 53K mi. $10,500 941-223-5691 2008 SUZUKI SX4 4 door, manual, gray, 66,276 mi. $10,950 877-219-9139 dlr TOYOTA7210 1998 TOYOTA AVALON XLS, leather, moon roof cold AC $4988. 941-639-1601 Dlr. 2005 TOYOTA PRIUS Interior : Gray, Exterior : Silver #: 60175-1 CALL 888-690-8667 2007 TOYOTA CAMRY 4 door, gray, 68,394 mi. $15,478 877-219-9139 dlr 2007 TOYOTA PRIUS 4 dr hybrid, silver, 67,060 mi. $13,875 877-219-9139 dlr 2008 TOYOTA CAMRY 4 door, white, 66,570 mi. $14,875 877-219-9139 dlr 2008 TOYOTA CAMRY gray, 38,779 mi. $15,950 877219-9139 dlr 2008 TOYOTA COROLLA CE, gray, 38,338 mi. $13,475 877-219-9139 dlr 2008 TOYOTA COROLLA LE White, 10,500 miles, $12,375. 941-456-0651 2008 TOYOTA PRIUS gray, 23,858 mi. $19,758 877219-9139 dlr 2009 TOYOTA COROLLA CE, 4 dr, manual, green, 38,498 mi. $11,950 877-219-9139 dlr 2009 TOYOTA COROLLA Interior Gray, exterior silver. #:7105P CALL 888-690-8667 DLR 2009 TOYOTA PRIUS Interior : Gray, Exterior : Blue #: 60322-1 CALL 888-690-8667 2010 TOYOTA PRIUS black, 36,116 mi. $22,950 877219-9139 dlr 2010 Toyota Prius, Hybred, 5dr. HB, extras. $20,990 Gorman Premier 941-639-7300 P.G. V OLKSWAGEN7220 2001 VW BEETLE GLX, leather, moon roof, 50K mi., $7988. 941-639-1601 Dlr. 2008 Jetta 4-dr. Sedan, $14,990 Gorman Premier 941-639-7300 ADVERTISEWITHTHE SUNCLASSIFIEDS 2010 VOLKSWAGEN CC 4 door, gold, 11,613 mi. $25,950 877-219-9139 dlr 2010 VOLKSWAGEN JETTA black, 32,246 mi. $17,950 877-219-9139 dlr 2010 VW GOLF HATCHBACK AUTO BEAUTIFUL BLUE ONLY 3,700 MILES $18,988 WILDE JAGUAR 877-216-8292 MAZDA7180 2010 MAZDA 3 Sport, manual, black, 15,208 mi. $21,987 877-219-9139 dlr MERCEDES7190 2001 MERCEDES E430 70K miles, 1 owner. $10,988. 941-639-1601 Dlr. 2006 Mercedes Benz C Class $14,990 941-639-7300 P.G. MINICOOPER7192 2004 MINI COOPER S loaded, 59kmi, mint, $14,988 941-625-2141 Gorman Family 2004 MINI COOPER S, 2 dr hardtop, red, 14,114 mi. $18,875 877-219-9139 dlr MITSUBISHI7195 2001 MITSUBISHI GALANT very well maintianed, $2,900 obo 941-916-2109 Classified = Sales 2004 MITSUBISHIECLIPSE SPYDER Conv. Low Mi! $8,988. 941-639-1601 Dlr. 2008 MITSUBISHI LANCER DE, 4 door, gray, 55,582 mi. $13,875 877-219-9139 dlr NISSAN7200 2005 NISSAN 350Z BLACK EXTERIOR : SILVER #: 11455A CALL 888-690-8667 2005 NISSAN 350Z Interior: Light camel leather, Exterior : SILVER #: 7262P CALL 888-690-8667 DLR 2005 NISSAN 350Z TWO-TONE Exterior : GRAY #: 7035P CALL 888-690-8667 2006 NISSAN 350Z BLACK, CLOTH EXTERIOR : BLACK. #: 10136A CALL 888-690-8667 2006 NISSAN ALTIMA Gray Exterior : Green #: 18059-1 CALL 888-690-8667 DLR. 2007 NISSAN 350Z TOURING ROADSTER GRAY/GRAY ONLY 19K MILES JUST $27,988 WILDE JAGUAR 877-216-8292 2007 NISSAN ALTIMA GRAY EXTERIOR : GREY #: 7045PB CALL 888-690-8667 2007 NISSAN ALTIMA GRAY Exterior : SILVER #: 7178P CALL 888-690-8667 2007 NISSAN ALTIMA Interior : Gray Exterior : Silver #: 7178P 888-690-8667 Dlr 2007 Nissan Sentra $12,990 Gorman Premier 941-639-7300 P.G. 2008 FORD FUSION, must see, $14,988 941-625-2141 Gorman Family 2008 NISSAN ALTIMA 255 4 door, white, 45,112 mi. $14,587 877-219-9139 dlr 2008 NISSAN ALTIMA 4 door, black, 49,427 mi. $17,950 877-219-9139 dlr 2008 NISSAN ALTIMA r ed, 24,996 mi. $18,950 877-2199139 dlr 2008 NISSAN MAXIMA 3.5 SL, 4 door, black, 37,287 mi. $21,857 877-219-9139 dlr 2009 NISSAN 370Z BLACK EXTERIOR : BLUE #: 11568A CALL 888-690-8667 JAGUAR7175 2004 JAGUAR X-TYPE 4 door, green, 79,124 mi. $10,987 877-219-9139 dlr 2004 Jaguar XJR, $17,990 Gorman Premier 941-639-7300 2005 JAGUAR S TYPE BLACK WITH ONLY 44K MILES $15,988 WILDE JAGUAR 877-216-8292 KIA7177 2007 KIA RONDO LX, FWD, black, 43,866 mi. $11,478 877-219-9139 dlr 2007 KIA RONDO LX, FWD, black, 43,866 mi. $10,950 877-219-9139 dlr 2008 KIA RIO 5SX like new 35kmi $10,988 941-6252141 Gorman Family PC 2009 KIA OPTIMA Interior : Exterior : Red #:15236-6 888-690-8667 DLR. 2009 KIA RIO Interior : BLACK Exterior : BLUE, #:7124P CALL 888-690-8667 DLR. 2009 KIA RIO Interior : GRAY Exterior : RED Dealer Stock #: 7224P CALL 888-690-8667 DLR. 2009 KIA RIO INTERIOR : GRAY EXTERIOR : WHITE#: 7223P 888-690-8667 DLR. 2009 KIA SEDONA Interior: TAN Exterior WHITE #: 7169 CALL 888-690-8667 2010 KIA FORTE INTERIOR : GRAY EXTERIOR : BLACK #: 7129P 888-690-8667 DLR. LEXUS7178 1997 LEXUS LS400 BEIGE/BEIGE $9,988 WILDE JAGUAR 877-216-8292 2005 LEXUS RX330 $20,990 941-639-7300 P.G. 2008 LEXUS ES350 4 door, tungsten, 43,256 mi. $24,578 877-219-9139 dlr 2008 LEXUS RX 350 Interior : Camel Leather Exterior : GOLD #:7094P CALL 888-690-8667 DLR 2010 LEXUS Interior : Beige, Exterior: Black #: 15631-1 CALL 888-690-8667 MAZDA7180 2002 MAZDA MIATA MX-5 Convert. 9,000 miles, loaded, like new. Green /Tan, $13,000 firm. 941-268-5544 2007 MAZDA 6 4 door, silver, 61,780 mi. $10,987 877219-9139 dlr 2008 MAZDA MIATA MX 5 TOURING CVT WOW 7K MILES AUTOMATIC RED/BLACK $20,988 WILDE JAGUAR 877-216-8292 2011 MAZDA 3 Maroon, 500 miles! $21,500. 941-764-7670 illillillillilllllllllIIIIIIIIIIIIIIIIIIIIINonooooooooo [IIIIIIIIIIIIIIIIIIIIilli llililllllllll llllIIIIIIIIII IIIIIIIIIIII1111111111111illillilliftooo0 0LwIllaL4wla 0 a00 )Tj /TT1 1 Tf -0.1901 Tc 244.6316 0 0 62 504 447.0226 Tm (0aLWIIO` a aB OO

PAGE 45

The Sun Classified-Section APage 20E/N/C/VSaturday, September 24, 2011 SUNCOAST BOATING BOATSPOWERED7327 09/24/11 11X60 2010 SUN DOLPHIN PRO 120Minn Kota Traxis trollin g motor, 55 lbs. thrust, 36 shaft, Hummingbird Fish Finder, color, side scan, 2 deep cycle batterie s $1,600. Call 941-625-8652. 14 CAROLINA SKIFF J14,trailer, 18HP Tohatsu eng.,bimini top, fully eqpd, elec. trling motor $1,800, OBO 941-629-5744 15 FIBERGLASS CENTE R CONSOLE 48HP Evinrude, S S prop, 2 live wells, depth finder, 40 lb. thrust, runs like new. Must sell due to health. $2,500. Call 941-575-2613. 15 KEY WEST 05, 60hp Yama ha, alum. trailer. Bimini top. Tr olling motor. Fish & depth find er. VHF radio. Fishing seat. S S props. $8,000. 941-323-0704 15 CLASSIC JET CRAF T 1996, Merc 120HP jet drive, Mich boat $4,500 248-613-8955 16 2009 CAROLINA Skif f J16, 25 HPYamaha, bimini, trailer $6,000 941-423-8156 16 SEA-N-SPORT 2009, 30HP Tohatsu, 2 bait wells, off-set helm, bimini top, accessories, flat bow for fishing. $5,900 941-538-8236 17 BASS BOAT200hp Merc Black Max 70+mph, Fresh water used, 100sx ff, elect. trolling motor, no rust trailer, garage kept perfect cond. $3,950 941-497-6615 18 6 Aggressor 88 Bass Boa t w/150 Johnson with many extras. $4,850 941-626-5481 18 BOWRIDER 110HP motor overheats, boat & trailer nice. $1,700 941-474-9821 19 REDFISHER Hewes 175 Merc Pwr Plt, Jack Plt, T rm Tbs, 2 wls, New Trailer, The One youve wanted! $14,500 863-781-2001 20 PRO SPORT 115 Yamaha, orig pack. all acc. low hrs. bimini. $5,500 941-505-5520 BOATSPOWERED7327 18 SEAARK MOD-V JON CG eqpt. E-Tec 60 Jet drive. Will Seperate. Boat or Motor $5,50 0 Both for $9,900 941-625-4456 18 WELLCRAFT SPORTSMAN 180 YAMAHA 150HP 2 STROKE VMAX, CUSTOM BIMINI TOP, VHF, GARMIN FF / CHART PLOTTER, VERY LOW HOURS. 2004. 941627-5777 19 HURRICANE 2006, 115 Y ahama 4 stroke, under 50 hr, Mint cond. $17,000 Neg 941-374-3744 or 941-286-3793 19 TROPHY BAYLINER Outboard, 1999, alum trlr, 2002 rolls, man y extras $10,000 941-698-4271 NEEDCASH? 20 1994 BAYLINER Needs Starter. Make Reasonable Offer. 5262 Lovett. NP 941268-2121 20 ANGLER centerconsule 2001 Yamaha 150 HPDI, low hours. $12,500 941-6273221 20 HURRICANE DECK BOA T 2003, 115 Yamaha 2 stk. EFI, Loaded w/options. $11,50 0 Call Chris 941-321-3110 22 CRESTLINERPONTOO N 2002 Superfish 115HP Yamaha 4 stroke, 190 hrs., bimini top. Reduced! $8,900 941-475-1275 23 1969 SCOTTIE CRAFT w / 1996 Karavan trailer. $1,20 0 Call Bob 941-429-8178 or Jess e 908-675-0501 23 CRIST CRAFT Amerospor t 1988, less than 100 orig hours, MI boat, no saltwater, DF, ship to shor e radio, stove, refrigerator, stand u p head, Chevy 260 IB/OB, trailer, $7,800, 941-697-6782 23 WELLCRAFT 2000 Sport Fisherman Tournament, 225 Y amaha 0X66 $8,995. 941474-1704 BOATSPOWERED7327 24 BAYLINER, BRAVO 3 300 HP, F/I, full cabin, lift kept, nice, $14,900 941-613-1903 24 DORAL 1999 WALK AROUND CUTTY CABIN HEAD SINK TABLE SLEEPS 2 TWIN 150 HP MERCS EFI OB OO9 NEW CONTINENTAL TRAILER VERY LOW HOURS, GREAT COND. FISH FINDER VHF RADIO $17,900 941456-8304 PUNTA GORDA REDUCED 24 STRATOS, cuddy, head, 2 150HP E-Tec (2007), 39 hrs. ne w gauges, controls and canvas, 1 owner, lift kept. Excellent. $33,900. 941-460-9698 24.5 AQUASPORT 1994, Cain &fiberglass top, 225 Evinrude, anchor winch, trim tabs, radio, fish finder, live bait well, large cockpit, cover & more. Great fishing boat, professionally maint. $10,000 941-697-7029 26 PENNYAN Flying Bridge, New Eng. Turn key, Under 100h r $10,200. 941-223-4368 CLASSIFIED SELLSCALLTODAY!941-207-1200 V enice/Englewood Nor th Port areas OR 941-206-1200P t. Charlotte Areas 26 REGAL EXPRESS 2007 lo a 29, air/heat, vacuflush toilet, glass top burner, microwave, r efrig., flat scrn. tv, sleeps 4, alum arch w/rod hldrs, GPS, elect. windlass, camper canvas, 5.7 Volvo w/new composite out drive. $49,000. 941-637-0147 27 BURPEE Pocket Cruiser, 1986, 165 Volvo Diesel, Custom Interior, $49,000 919-247-2482 26ft 1986 sea ox twin 200 merc efi,tri axle trl, stainless props new batterys,recent engine service,full bimini encloser $8500 tell 941 629-4777 27 MAYCRAFT DUAL station, fully rigged, twin Johnson O/bs. + Many extras Alum tripple axel trailer $42,000 941-575-7589 BOATSPOWERED7327 27.55 FT BAYLINER 1991,toi let, shower, fridge, stove, ho t H2O, lift kept, built-in batter y charger, fully equip, very low hrs. 941-627-5777 27.6 2000 TROPHY W alk-a r ound 225HP Merc. cuddy with sink, burner & cooler, head/mac erator, water sys., dual batteries, very good fishing boat, bait well, fishboxes, lots of storage, onl y $14,900. 941-698-5722. REDUCED 28 2001 SEA SPRITE aft cabin, 310 dual prop AC, GPS, bridg e encl. elec. head, full galley, 45 mph, only 90 hrs. lift kept, exc. cond. $28,500. 941-639-7890. 28 BOSTON WHALER CON QUEST 2000, T -250HP, Yama has, top electronics, A-C, Gen., pristine, $69,000 941-966-540 0 28' HYDRA-SPORTS Twin 225hp Yamaha 4-strokes, LOADED, 5Kw Generator, GPS, Radar, AutoPilo t $69,500. 513-659-2025 ADVERTISEWITHTHE SUNCLASSIFIEDS 28 RAMPAGE Sport Fisherman, 1989 (Nokomis), T/270 Chrysle r I/B,Garmin color plotter, V birth & pilot birth, enc. head. $26,900. Bob Nordstrom CPYB. 978-852 4844 World Class Yacht Sales 29 6 REGAL COMMODOR E 2002 Twin IO Radar, GPS, AC, Loaded. $41,000 508-942-4600 30 MAKO 2001 282cc, twin 225 Merc Optimax, 46 hrs on r ebuilds, 1 yr warr. Triaxle trail er. Many extras $39,900.w ould consider partial trad e down for a 1975-85 criscraf t commander 31or 1975-85 31 34silverton 941-473-2150 Reduced!! 30 PURSUIT 3000 Offshor e 2001. Great All-around Boat $110,000. Tower w/controls, twin Volvo diesels, low hours, 5k w W esterbeke gen., head w/show er, galley w/microwave & ele c stove, sleeps 4. Call 941-697 5808 for more info. BOATSPOWERED7327 32 GLACIER BAY Cat 200 7 Center Console, loaded, twin 250HP Suzuki 4 strokes w/war ranty, Raymarine electronics. $149,000 941-628-3712 32 WELLCRAFT3200 ST TROPEZ 1987, UPDATED TWIN 454 MERCRUISERS. GOING NORTH, MUST SELL! $12,900, OBO 941-223-6844 32, TROJAN, new 350/26 0 hp engines, hardtop, A/C, Heat, new GPS. Great value a t $26,900! 941-697-6258 33 CRUISERSINC. ESPIRIT 1987, Twin Merc Cruiser/ Inboards, Shallow Draft, Recent Risers, New Canvas, New Upholstery, GPS..ETC! Nice Vessel. Lif t Kept. Professionally Maintained. A Must See Boat! $22,900 941-685-2399 Port Charlotte. 34 2001 BAYLINER MY T/250hp/Cummins diesels (900 hrs.), thrusters, CLEAN W ell-equipped Great Cond. Kept on a Lift. $93,500 941-697-0940 ck70@embarqmail.com 35 CONTENDER, 1998, sid e console, T-250, air & generator, loaded, $75,000 941-575-786 7 NEEDAJOB? CHECKTHE CLASSIFIEDS! 35 SEA RAY 350 Sundance r 1990 (Venice). T/340 Merc. I/B. Lg. open cock pit & spa cious int. Sleeps 6, 6.5 K W gen. Full electronics,*SOLD* Bob Nordstrom CPYB 978 852-4844 World Class Yach t Sales 35 SUNDANCER 310 2001, 2 350 gas inboard engines, camper top, fully equiped w / extras. $79,900. 972-569-7661 38 SEA RAY 2003 Sundance r T/370 Mercs, 325 hrs, top elec tronics, gen, 2 TVs, Central vac, Icemaker, new batts, camper can vas, new bottom 7/10, and much more, $139,900 OBO, PG, owne r motivated, 941-380-7077 BOATSPOWERED7327 40 EAGLE TRAWLER 1972 T otally Refurbished with rebuil t diesel Ford Lehman, fiberglas s hull. Full new tanks. Askin g $75,000. Call 941-408-9572 52 VISTA MOTORYACHT 15.5 beam, diesel, live-aboard/cruiser. Excellent Condition. $115,000 Englewood 941-266-6321 JUST REDUCED BEST DEAL IN TOWN, MUST SELL! 1986 Mako Fisherman 25'6"',Twin 1992 200 HP Y amaha Engines, AM/FM CD Player, GPS Garmin Map/185 Sounder,Solara VHS Radio, Lenco Trim Tabs, Outriggers,Two new batteries, Located in Venice. $18,000. Contact Mike @ 941-650-4895 PUTCLASSIFIEDS TOW ORKFORYOUV enice,Englewood, North Port 2 2 0 0 7 7 1 1 2 2 0 0 0 0Pt.Charlotte Areas Call 2 2 0 0 6 6 1 1 2 2 0 0 0 0 Charlotte RV & Marine Sales & RepairsFloridas largest indoor pre-owned boat showroom! Consignments wanted: W ell sell your boat for FREE! Full-service Repairs: insurance claims, engine, electrical, hull, trailers. US 41 at Kings Hwy, Port Charlotte 941-883-5555 www.CharlotteMarine.com SELLING YOUR BOAT??? Let us help YOU!!! HURRY LIMITED TIME OFFER!!!Selling your boat for UNDER $5,000.??? For ONLY $60. we will run a 3 line classified ad & a black & white photo of your boat, IN OUR NEWSPAPERS & OUR WEBSITE EVERY OTHER DAY & INCLUDE a 1 1/2 x 2 1/4 BOATER`S BARGAINS AD with a COLOR Photo to appear in Thursday`s Waterline! FOR 90 DAYS!! HURRY....THIS IS A LIMITED PROMOTION!!! Selling your boat for $5,000. or OVER??? For ONLY $90. we will run a 3 line classified ad & a black & white photo of your boat, IN OUR NEWSPAPERS & OUR WEBSITE EVERY OTHER DAY & INCLUDE a 1 1/2 x 2 1/4 BOATER`S BARGAINS AD with a COLOR Photo to appear in Thursday`s Waterline! FOR 90 DAYS!! HURRY....THIS IS A LIMITED PROMOTION!!! Let US help YOU sell YOUR boat!! Call the Sun at 866-463-1638 and ask about our NEWRUNMY BOAT PROGRAM 1ALOwl,MPT-MO IL70106-614pi g ,THMM061O%AWice.-)143(` -,,;: i _---_.. __ Y T1 )Tj /TT2 1 Tf 0.0581 Tc 12.5861 0 0 6 334 576.5187 Tm [(twoPOW,a1 4.' 7 M

PAGE 46

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 21 SAILBOATS7328 32 CATALINA 320, 1994, Grea t weekend cruising sailboat. Details a t httt://birdsnbugs.wordpress.com/v oyager $52,000 941-639-4138 MISC. BOATS7329 PONTOON BOAT self-made fiberglass.w/ Fl. title. must see $499 941-661-2667 PERSONAL WA TER VEHICLES7332 1998 YAMAHA 760 great shape,needs batt,trailer needs work $2700 941-627-5797 OUTBOARD/ MARINE ENGINES7334 6HP NISSAN like new outboard.maybe 50 hrs. $425 941-661-2667 BOATSTORAGE/ DOCKING7336 50 Dock in PG on 70 seawall, no bridges, 20 min to Charlotte Harbor. $200/mo 941-286-5618 MARINE SUPPLY & EQUIP.7338 BOAT (2) Battery Charger GUEST 10 amp 5/5 Trolling Motor $45 941-575-7270 DAVIT by Ace,works, harness and remote $500 OBO Randy 941-493-1215 ENGINE OIL 2.5 gallon 2 stroke, sealed jug. West Marine $30 941-626-0680 EPIRBw/RapidDitch bag Battery date: 03/2014 $400 941-637-0712 NORTHERN LTS P ARTS 8kw M753K new starter & alt $149 941-505-7272 OUTBRD TILLER Ext. Helmsmate U-Joint,never used. $15 941-624-2105 MARINE SUPPLY & EQUIP.7338 FREE MERCHANDISE ADS!! To place a FREE merchandise ad go to: yoursun.com and place your ad. Click on Classifieds (LOCAL) then click on SELLSOMETHING and follow the prompts. At the end...you will NOT be asked for your credit card at all. FREE ads are for merchandise UNDER $500. and the ad must be placed online by you. One item per ad, the ad must be 3 lines or less, price must appear in the ad. Your ad will appear online & in print for 7 days! Some restrictions do apply. LIMIT4 FREEADS PERWEEK **If you have never placed an ad online, you will need to register when you get to the sign in page)** NEEDCASH? Have A Garage Sale! WHISKER POLE 6 ft. -11 ft 6 $60, OBO 941-764-9100 CANOES/ KAYAKS7339 12 MALIBU MINI X kayak, used 3 times, $400 845-3099065 IN THE SUN CLASSIFIED YOU CAN..... Find a Pet Find a Car Find a Job Find Garage Sales Find A New Employee Sell Your Home Sell Your Unwanted Merchandise Advertise Your Business or ServiceClassified its the reliable source for the right results SUNCOAST BOATING CAMPERS/ TRAVELTRAILERS7370 2005 DUTCHMENClassic 26F, 26 TT w/super slide, sleeps 6, $7950. (941)-3477171 DLR 2005 LUXURYBy Design 42 5th wheel, 3 slides, W/D, fireplace, DW, 3 axles, very spacious, $17,950. 941-3477171 DLR 2005 TIMBERLAND 27BHS, 28 TT w/slide, hardwood floors, sleeps 10, $7950. (941)-347-7171 DLR GET RESULTS USE CLASSIFIED! 2006 FOREST RIVER Flagstaff 829BHSS, 30 TT w/ slide, $6,950. (941)-347-7171 DLR 2006 JAYCO FEATHER 197, 19TT, super light weight, under 3000 lbs. $6395. (941)347-7171 DLR 2006 ROCKWOOD 8317 SS, 33 TT, 1 slide, 2 bedrm, sleeps 12, $10,500. (941)347-7171 DLR 2009 KZ Coyote Lite, 282, 29 TT w/slide, power awning, like new, sleeps 6, $13,950. (941)-347-7171 DLR Charlotte RV CenterGreat selection of pre-owned RVs! Buy-Sell-Trade-Financing W ell sell your RV FREE! Ask about our marketing. Repairs Maintenance-Parts-Body Shop US41 at Kings Hwy. Pt Charlotte (941) 883-5555www .CharlotteRVcenter .com WANTED All TTs, Motor Homes, 5th whls, Pop-Ups, V an conversion & passenger vans. Cash paid on the spot. for quick sale. 941347-7171 MOTOR HOMES/ RVs7380 1986 FLEETWOOD Jamboree, good condition, many extras, $2,900 941-255-1916 1999 UPGRADED BOUNDER Motor Home, 34, slide out, 1 owner, smoke free. $15,000. 941-916-0589 I WANT YOUR RV W ell sell it! FREE SKIP EPPERS RVs(941)-639-6969 Punta Gorda Closed Sun. & Mon. PLATINUM MOTOR HOMES Locally Manufactured Since 1985 Free tours Factory Direct T rades welcome Financing availableCOACH HOUSE, INC 3480 Technology Drive Nokomis, FL34275800-235-0984www.coachhouserv.com RV Collision RepairsModern shop, quality work! FREE ESTIMA TES RV WORLD Inc. of Nokomis 2110 US 41Nokomis 941-966-2182 RVS WANTED CASH/CONSIGN/TRADE Call: Mark RV WO RLD INC OF NOKOMIS 2110 US 41 Nokomis 941-966-2182 SATURN TOW-CARS From $2,899 CHEVY HHRs Many to choose from Blue-Ox Tow hitches. THE SATURN GUYS PRO-POWER AUTO SALES (941) 627-8822 P.C. SCHOOL BUS, 72 passgr, International 3800, 1995, white $5000 941-255-5544 TRAILER & ACCESSORIES7341 GALV. BOAT TRAILER 12 to 15 boats $350 941-7434674 or 941-585-1265 OPEN & ENCLOSED Utility T railers, Trailer Hitches & Wiring. T wo-Morrows Enterprises, 941-460-9700. ROYS TRAILER COUNTRY NewPre-Owned Storage Cargo-Utility-Trailers Parts Repairs-Tires-CustomBuilt-Trailers-Hitches/Wiring 9415752214. 4760Taylor Rd. P.G. TAN DEM AXLE heavy duty trailer 5X10 built in ramps, $500 obo 941-234-2396 TRAILERHAULMARK like new never used. $500 941-255-9788 TRAILER JACK 1000lb. capacity, swivel mt., new in box. $75, OBO 941-6265099 UTILITY TRAILER 4X8 LIGHTWEIGHT $200, OBO 863-241-9512 UTILITY TRAILERS Great Prices WEST COAST TRAILER (941)698-9902 CYCLES/MOPEDS/ SCOOTERS7360 HARLEY Road King, 63K, loaded, super clean. $9,000. 941-6503912 150CC SCOOTER, Like new, 254miles,100mpg,65mph(24 00new)$1100 941-456-5059 1995 HONDA 1100 Shadow 15K mi. Shaft dr. Wtr cooled. $2500/obo. (941)-266-7121 2002 HARLEY SPORTSTER, 1200 Custom, 8K mi. $4,900. Englewood (941)-769-1071 2007 BACCIO BX-150 Scooter 2 pass. Ex cond. $700. (941)-475-0068 2010 SCOOTER 49cc 40mph, 1200mi. Gar. kept. Like new. $800 941-623-7387 GOCART, 6.5HP, w/power band, too much to list. Asking $550. John, 941-661-4437 MOTORCYCLE HELMET cranberry red; Med; DOT approved. $35 941-474-3056 SCOOTER 49CC $499 Ken@ 941-549-0475 SMALL TRAILER: for use behind motorcycle. $499 941-474-3056 ADVERTISEWITHTHE SUNCLASSIFIEDS SPAULDING MOTORCYCLE SIDE-CAR set up for Harley $4000. View via internet. (941)-743-2161 ATV7365 2008 RANGER 700, Exc. cond. Adult driven. Loaded $7800/obo (941)-456-8571 CAMPERS/ TRAVELTRAILERS7370 2001 COLEMANTAOS popup, sleeps 6, cold air, $2695. (941)-347-7171 DLR 2001 PROWLER 25W, 26 TT w/slide, sleeps 6, $4295. (941)-347-7171 DLR 2002 SIX PACex cond. stove, r efrig, AC, fits toyota tondra, $2,700 obo 941-460-8504 2005 COACHMENCapri 27DS, Ruby edition, 27 TT w/slide, ultra light, weighs 4500 lbs. $8,450. (941)-3477171 DLR 2005 KEYSTONE HIDEOUT T oy Hauler 29FBH, Exc. condition, LOADED, Gen., Fuel Station, MUCH MORE! $14,500 941-697-6592 SPORTUTILITY/ VEHICLES7305 2008 JEEP LIBERTY 4-dr, 4x4, many extras. $17,990 Gorman Premier 941-639-7300 P.G. 2009 HONDA CRV 5 dr, LX, borrego, 29,910 mi. $18,975 877-219-9139 dlr 2009 HONDA CRV LX, black, 23,330 mi. $19,875 877-2199139 dlr 2009 HONDA CRV silver, 11,387 mi. $19,785 877219-9139 dlr 2009 HONDA CRV silver, 52,591 mi. $20,458 877219-9139 dlr 2009 KIA SEDONA Interior : GRAY Exterior BLUE #:7152P 888-690-8667 DLR 2010 HONDA CRV Certified r oyal blue, 8,174 mi. $19,875 877-219-9139 dlr 2010 HONDA CRV LX, urban titan, 24,479 mi. $18,977 877-219-9139 dlr 2010 NISSAN PATHFINDER black, 52,591 mi. $19,875 877-219-9139 dlr 2010 TOYOTA FJ CRUISER Interior :Black Exterior : Black #11461A 888-690-8667 Dlr 2011 HONDA CRV Certified LX, gray, 5,140 mi. $20,950 877-219-9139 dlr PRO-POWER AUTO SALES(941) 627-882203 Hyundai Santa Fe ..............................$4,499 03 Saturn Vue.........$5,999 02 Saturn Vue AWD..$7,399 08 Chrysler Pt Cruiser ..............................$9,499 04 Toyota Rave 4...$11,999 08 Saturn Vue 3 to choose from............. $12,999 & up 10 Chevy HHR 2 to choose from..............$12,999 & up Why Pay US 41 Prices? 4 X 4'S7310 1985 GMC SUBURBAN 4x4 3 lift, new motor, $2295/obo 941-639-0338 SPORTUTILITY/ VEHICLES7305 2007 FORD ESCAPE Interior : GRAY, CLOTH, Exterior : RED. #: 7240P CALL 888-690-8667 DLR. 2007 HONDA CRV EXL, green, 56,724 mi. $18,950 877-219-9139 dlr 2007 HONDA ELEMENT SC, silver, 37,748 mi. $17,950 877-219-9139 dlr 2007 KIA SEDONA Interior : Tan Exterior : Red #:15631-5 CALL 888-690-8667 DLR. 2007 MAZDA CX7 silver, 68,856 mi. $14,245 877-2199139 dlr 2007 SATURN OUTLOOK XE, white, 40,244 mi. $19,875 877-219-9139 dlr 2008 FORD ESCAPE Interior : TAN Exterior : RED #: 11064A CALL 888-690-8667 DLR 2008 FORD TAURUS SUV, black, 61,754 mi. $15,874 877-219-9139 dlr 2008 HONDA CRV EXL, black, 54,483 mi. $19,722 877-219-9139 dlr 2008 HONDA CRV LX, red, 29,470 mi. $16,950 877219-9139 dlr 2008 HONDA ELEMENT LX, silver, 33,152 mi. $15,878 877-219-9139 dlr 2008 HONDA ELEMENT SC, silver, 45,503 mi. $18,950 877-219-9139 dlr 2008 INFINITI EX35 brown, 37,750 mi. $25,687 877-2199139 dlr 2008 KIA RONDO Interior : TAN Exterior : BLUE #:7194P. 888-690-8667 DLR 2008 NISSAN PATHFINDER LE, blue, 29,680 mi. $23,950 877-219-9139 dlr 2008 TOYOTA HIGHLANDER LIMITED LT BLUE/TAN LTH FULLY LOADED ONLY 25K MILES $28,988 WILDE JAGUAR 877-216-8292 2008 TOYOTA RAV4 STD, gray, 69,581 mi. $17,325 877-219-9139 dlr SPORTUTILITY/ VEHICLES7305 2001 TOYOTA RAV4 SUPER LOW MILEAGE SPORT UTE $10,988 WILDE JAGUAR 877-216-8292 2003 CHEVY Suburban 4x4 LT $12,990 Gorman Premier 941-639-7300 2003 HONDA PILOT EX, silver, 154,020 mi. $8,970 877219-9139 dlr 2003 LINCOLN NAVIGATOR $13,990. Gorman Premier 941-639-7300 2003 TOYOTA RAV 4, low miles, PW/PL, auto, $10,988 941-639-1601 Dlr. 2004 GMC ENVOY black, 79,700 miles, very good condition. $7,800 941-875-4699 2004 HONDA ELEMENT EX, silver, 160,074 mi. $7,950 877-219-9139 dlr 2004 HUMMER H2 80K mi. Luxury Edition. BABIED. FL vehicle. Wholesale $17,900. Must See. Charlotte Motor Cars 941-979-9331 2004 JEEP Grand Cherokee Laredo, leather, all pwer, $9988. 941-639-1601 Dlr. 2004 NISSAN XTERRA XE, silver, 79,815 mi. $10,754 877-219-9139 dlr 2005 Expedition Limited $13,990 941-639-7300 P.G. 2005 FORD EXPEDITION Eddie Bauer, carbon, 65,457 mi. $16,358 877-219-9139 dlr 2006 ACURA MDX nav, gray, 65,726 mi. $22,458 877-2199139 dlr 2006 CHRYSLER PACIFICA leather, DVD, 3rd row, $11,988. 941-639-1601 Dlr. 2006 FORD EXPLORER EDDIE BAUER DK BROWN/TAN 51K $17,988 WILDE JAGUAR 877-216-8292 NEEDAJOB? CHECKTHE CLASSIFIEDS! 2006 HUMMER H3, 4 dr AWD, many extras. $18,990 Gorman Premier 941-639-7300 P.G. 2006 TOYOTA SEQUOIA Limited 4X4, silver, 77,035 mi. $24,875 877-219-9139 dlr TRUCKS/ PICK-UPS7300 2005 DODGE DAKOTA Quad cab, $13,990Gorman Premier 941-639-7300 P.G. 2006 FORD F150 XLT, black 46,810 mi. $16,950 877-2199139 dlr 2007 TOYOTA TUNDRA SR5, 2WD, EXT, black, 96,331 mi. $16,875 877-219-9139 dlr 2008 CHEVROLET COLORADO T ruck, 25,600 mi, 4 cyl., FWD, automatic, 4 seat, AM/FM Cassette, All season tires, Z85, champagne, auto, a/c, alarm, pwr brakes, pwr locks, pwr steering, pwr win, air bag, ABS, alloy wheels, tilt, Like new condition with low mileage. Has rear sliding window. $15,500 941-391-5805 Classified = Sales 2008 CHEVY SILVERADO Silver, 6cyl, auto, radio, 62,400 mi, New tires Asking $13,900 941-698-1053 2008 NISSAN TITAN crewcab, gray, 58,980 mi. $21,875 877-219-9139 dlr Mattas Motors 941-916-9222Buy Here Pay Here SPORTUTILITY/ VEHICLES7305 1996 FORD EXPLORER 4X4, 4 new all terrain tires, lthr, sunroof, JBL premium stereo with subwoofer, all options, extremely clean interior, mint cond. $2,200 941-468-5342 1998 FORD EXPLORER Interior : GRAY Exterior : WHITE#: 11578B CALL 888-690-8667 DLR. 1999 CHEV TAHOE, LT, leather, cold AC, all power, $4988. 941-639-1601 Dlr. 2000 EXPEDITIONEddie Bauer, tow pkg., 4X4, exc. cond$6,500. 941-661-3399 2001 Ford Expedition, leather, dual air, full power, $5988. 941-639-1601 Dlr. Yom-)Tj /TT2 1 Tf 0.0069 Tc 19.0208 0 0 33 480 441.5228 Tm (_

PAGE 47

The Sun Classified-Section APage 22E/N/C/VSaturday, September 24, 2011 ON MOST NEW VEHICLES IF YOU CURRENTLY LEASE A NON CHRYSLER VEHICLE. $1,000SAVE AN ADDITIONAL WORLD CLASS LUXURY 22 IN STOCK SAME DISCOUNT ON EVERYONE#C11220$24,9993.6l v-6, power everything including both front seats, keyless entry, tilt/telescopic steering column, uconnect voice command with bluetooth, auto temp control, 17" aluminum wheels and mor e.MSRP $28,290SALE NEW 2011 RAM 1500 QUADCABAU TO POWER WINDOWS AND LOCKS, THEFT DETERRENT, SIX SPEAKER SOUND SYSTEM, TILT STEERING WHEEL AND MUCH MORE. SALE $19,999MSRP$25,890#D11273 0% for 60 months in lieu of rebate*ALL NEW 2011 DODGE AVENGER EXPRESSAU TO POWER WINDOWS/LOCKS/MIRRORS, TILT/TELESCOPIC STEERING, SPEED CONTROL AND MUCH MORE!SALE $17,999 0% for 72 months in lieu of rebate* NEW2011RAM1500SLT CREW CAB5.7LHEMI V-8,POWER WINDOWS/LOCKS/MIRRORS, REMOTE KEYLESS WITH REMOTE START & SECURITY ALARM,ALUMINUM WHEELS,SATELLITE RADIO /W 6 SPEAKER SOUND SYSTEM, REAR POWER SLIDING WINDOW, BED LINER & MUCH MORE. SALE $25,799MSRP$34,820#D1111 0% for 60 months in lieu of rebate*NEW2011DODGECALIBER MAINSTREETLOADED WITH POWER WINDOWS/LOCKS/MIRRORS, AUTOMATIC, 17" ALUMINUM WHEELS, FOG LAMPS, TILT STEERING, MEDIA CENTER, REMOTE KEYLESS ENTRY, SPEED CONTROL AND MORESALE $15,999MSRP$19,370 NEW2011RAM2500LARAMIE CREW CAB6.7L CUMMINS TURBO DIESEL AND LOADED WITH POWER EVERYTHING INCLUDING SUNROOF, LEATHER, NAVIGATION AND MORESALE $42,779MSRP$52,780#D11273 0% for 60 months in lieu of rebate*ALL NEW 2011 JEEP GRAND CHEROKEE$27,999 0% for 60 months in lieu of rebate* ALL NEW 2011 CHRYSLER 200POWER WINDOWS/LOCKS/MIRRORS, TILT/TELESCOPIC STEERING, THEFT DETERRENT, CD/MP3 MEDIA CENTER AND MUCH MORESALE $17,999 0% for 60 months in lieu of rebate*3.6L V-6, SIX SPEED AUTOMATIC, POWER WINDOWS/LOCKS/MIRRORS, POWER LIFTGATE, SUNSCREEN GLASS, REAR A/C, REMOTE ENTRY AND MUCH MORE. SALE $24,999#C11172 0% for 60 months in lieu of rebate*ALLNEW2011CHRYSLERT&C TOURING NEW 2011 DODGE CHARGER3.6L V-6, POWER WINDOWS/LOCKS/MIRRORS/SEAT, REMOTE KEYLESS ENTRY, 17" ALUMINUM WHEELS, SPEED CONTROL, TILT/TELESCOPIC STEERING AND MUCH MORE.SALE $22,999MSRP$26,220#D11413 27 MPGHighway 2010 CHRYSLER 300 LIMITED AUTO, PW, PL, CR, TILT,AC, LEATHER AND MORE! $ 23 988#C11207A5 YRS., 4 MOS. REMAINING CERTIFIED FACTORY WARRANTY 6 AT THIS PRICE! SAVE$9,000 SAVE$10,000#D11231In STOCK from Come in and see why the experts rate the All New 2011 Jeep Grand Cherokee above every vehicle in its class. 2010 DODGE CHARGER SXTAUTO.,PW,PL,CR, TILT,A/C,ALLOY WHEELS. $ 16 9885 YRS., 6 MOS. REMAINING CERTIFIED FACTORY WARRANTY 1.9%FinancingAvailable#197641 201 DODGE DAKOTA BIGHORNAUTO,PW,PL, CR,TILT,AC,ALLOY WHEELS $ 18 9886YRS.,REMAINING CERTIFIED FACTORY WARRANTY QUADCAB#59052P#D11301 ALL NEW 2011CHRYSLER 300 #C1143 2010 JEEP LIBERTY 4X4AUTO, PW, PL, CR,TILTAND MORE! $ 18 9885 YRS., 4 MOS. REMAINING CERTIFIED FACTORY WARRANTY 1.9%FinancingAvailable#59041P 2010 JEEP LIBERTY 4X4AUTO, PW, PL, CR,TILTAND MORE! $ 18 9885 YRS., 4 MOS. REMAINING CERTIFIED FACTORY WARRANTY 1.9%FinancingAvailable#59041P Sunset Dodge Chrysler Jeep 7745 S. TAMIAMI TR AIL SARASOTA SERVICE HOURS: MON-FRI 7: 30AM-5PM, SAT 7:30AM-NOON 941.922.2400 SALES HOURS: MONFRI 8:30 AM-7 PM, SAT 9AM-6PM, CLOSED SUN WWW.SunsetDodgeCh ryslerJ eep.com *All prices include rebates. Financing with approved credit. Residency rules may apply. Vehicles may not be as pictured. 2011 JEEP 4 WHEEL DRIVE OVERLOAD, LOADED WITH ALL THE EQUIPMENT AND LEATHER $ 38,988 $ 38,988 5 YRS., 9 MONTHS REMAINING CERTIFIED WARRANTY #J1229A PA TRIOT SPORT PA TRIOT SPORT 2011 JEEP AU TO, A/C. AND, MUCH MORE! $ 14,988 $ 14,988 6 YRS., 9 MONTHS REMAINING CERTIFIED WARRANTY #J11361A GRAND CHEROKEE GRAND CHEROKEE #J11288 4W 4gqMft Erik4777-= T.00MN ABERgELEB_R_A_TION EVENT.' POW DAYSIAR)Tj /TT2 1 Tf -0.2917 Tc 20.75 0 0 9 340.2664 630.8407 Tm (.mssWOWr.f .)Tj /TT4 1 Tf -0.0584 Tc 3.7727 0 0 7 32.7664 438.8466 Tm (1 !I A,yI)Tj /TT2 1 Tf -0.0475 Tc 39.4422 0 0 36 431.7664 139.3557 Tm (Jeep

PAGE 48

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section APage 23 VISITUSONLINEAT WWW.GETTELHYUNDAI.COM -Guaranteedtrade-InValueofqualifyingvehiclebasedonindependentsource.ConsumerwillgetthehigheroftheGuaranteedTrade-InValue,lessmileagechargesanddamagecosts,ormarketvaluewhichwillbeassessedatthetimeoftradein.Marketvaluebasedonthehighestof:NADAYellowBook,Kell yB lueBook,ManheimAuctionValueordealerappraisal.Applicabletoallnew HyundaivehiclespurchasedonorafterMay1,2011.MustshowproofofvehiclemaintenancethroughanauthorizedHyundaidealerattimeoftradein.Customermustpaymileagefeeof$.20permileover15,000milesperyear.Customerresponsibleforalldamagetovehicle.Notavailableonleasedvehicles .Validonlyduringmonths24-48ofownership.Trade-invaluedollaramount mustbeappliedtowardanewHyundaivehicleandmustbefinancedthroughHyundaiMotorFinance(HMF).Seewww.hyundai.comoryourHyundaidealerforfulldetails.^^Allpricesandpaymentsplustax,tag,license,dealerfeesandfactoryinstalledoptions.Allleaseswith12kmilesperyear.Extrachargesmayapplyatleasetermination.Withapprovedcredit.Vehiclessubjecttoavailability.Photosforillustrationpurposesonly.**MustqualifyforHyundailoyaltyorcompetitiveowner.#Intheformofmanufacturerrebatesordea lerdiscounts.EPAestimatedhighwayMPG.Offersexpire09/25/11. SALEHOURS: MON-FRI8:30AM-8:00PMSATURDAY8:30AM-7:00PM-SUNDAY12:00PM-5:00PMTHEGETTELHYUNDAIFALLKICKOFFISGOING ONNOWANDWEJUSTHIREDDIESELJONESTOCHANGETHEWAYWEDOBUSINESS!GETFALLKICKOFFPRICINGONOURHUGESELECTIONOFPRE-OWNEDHYUNDAIS NEW2012 HYUNDAIGENESISSEDAN$399PER MO.^^SweetRide!PowerWindows&Locks,CD&MuchMore!$1999TOTALDOWN,36MONTHLEASE,MODEL#B0422 TheGenesisSedanisoneofthebestdealson themarket. -Edmunds.com NEW2012HY UNDAISANTAFEGLS$279PER MO.^^Tr actionControl,Front&SideAirbags,TonsofCargoRoom&MuchMore!$3000TOTALDOWN,36MONTHLEASE,MODEL#62422 Five-starratingsinbothfrontaland sideimpacts. -Edmunds.com NEW2011H YUNDAISONATAHYBRID$26,645 NEW2012 HYUNDAIELANTRA$179PER MO.^^PowerWindows&Locks,AM/FM/CD,Tilt,&MuchMore!$1999TOTALDOWN,36MONTHLEASE,MODEL#45412 High-classCabinforThePrice. -Edmunds.com NEW2012HY UNDAIACCENT$169PER MO.^^6Airb ags,Tilt&MuchMore!$1699TOTALDOWN,36MONTHLEASE,MODEL#16402 Larger,SharperandMoreFuel-Efficient. -Edmunds.com NEW2012H YUNDAISONATA$199PER MO.^^Auto,PowerWindows&Locks,AM/FM/CD,CruiseControl,Tilt&More!$2799TOTALDOWN,36MONTHLEASE,MODEL#27402 More-powerfulandmoreefficient fourcylinderengine. -Edmunds.com STARTINGFROM40MPG $13,522 2010HYUNDAIELANTRAGLS4D oor,Auto,AllPower,MintCondition PricedToSell $23,751 2010HYUNDAITUCSONLIMITEDLeather,JustTraded,AlmostNew, Only7KMiles! $22,900 2009&2010HYUNDAIGENESIS3TOCHOOSE FROMSTARTINGAT1-877-228-9195 8526967 L-Js l op-AirI f1)-49('BN Ridg. Rd.HYUNDAIAssurance

PAGE 49

The Sun Classified-Section APage 24E/N/C/VSaturday, September 24, 2011 All Harbor Advantages With Purchase BUY THE HARBOR WAY 4336 Tamiami Trail, Port Charlotte FL 941-629-1171 www.harbornissan.com36 Month Pre-paid Lease/ 12,000K per year. Stock 12070N 12 Altima, Stock 12039N 12 Sentra, Stock 11392N 1 Maxima plus tax and tag, license fee, and non-refundable acquisition fee, $599.50 dealer fee. Lessees WAC through NMAC Dealer retains a ll rebates, bonus cash and incentives. Some restrictions do apply. Bonus Cash .select new Nissans. Cannot combine Offers. Ends 9/5 Exclusively At Harbor WOW! 8788 2012 ALTIMA!start at$You Get All TheHARBOR Now! 7988 start at$ ADVANTAGESFree Service Free Full Roadside Assistance Tires For Life Loaner Cars Friends & Family Loaner Cars One to One Rewards Card Window Tint & More! WOW! 12,388 2011 MAXIMA!start at$ALL NEW! 2012 SENTRA SUPER SEPTEMBER SALE!AMAZING CASH BACK OFFERS ON REMAINING 2011 NISSANS! OPEN SUNDAY 11-4PM FOR YOUR CONVENIENCE! CALL 888-461-0950Prices exclude tax, tag, license fees, dealer doc $599.50 and reconditioning fees. See dealer for details. Some pictures are re presentative of the vehicle for sale. WWW.HARBORNISSAN.COM .| 941.629.1171 09/16/2011 Fo r Good People With Bad Credit!At BuyRight Auto Outlets we realize good, well-incomed people go through tough financial times and experience credit ch allenges. Thats why at Harbor Nissan we have our BuyRight program. We are the bank!Short term Unemployment Unexpected Medical Expenses Family Crisis Fixed Retirement Income First Time Buyer 877-4-BuyRight We ll-maintained 12 Month/12,000 Limited Mile Warranty Car Fax Report Luxury Models Available WE ARE THE BANK No embarassing turn downs Fa st, Simple On The Spot Financing right in our showroom Tr ained Factory Technicians available for future service & More!Just a simp le process so you can drive away in a new car today. Stop in and experience the ease of buying a car from BuyRight. Located at Harbor Nissan 4336 Tamiami Trail, Port Charlotte. You won t believe the BuyRight difference. You Buy Here. You Pay Here. TITANS LIMITED ,TIME OFFER WHILE SUPPLIES LAST$10,000IN DISCOUNTS! UNBELIEVABLE OFFER.up to All Harbor Advantages With Purchase All Harbor Advantages With Purchase ON ALL REMAINING 2011 DURING OUR SUPER SEPTEMBER CLEARANCE EVENT ALTIMA MAXIMA TITAN SENTRA PA THFINDER XTERRA ARMADA VERSA MURANO CUBE ROGUE QUEST Z COUPE ALTIMA HYBRID JUKE WE HAVE A CAR, VAN, TRUCK OR SUV FOR EVERYONE!While supplies last on select 2011 Nissans in-stock models or available quali ed dealer trades. Cash back offers may vary. Some restrictions will apply. Financing through NMAC, WAC. See dealer or www.harbornissan.com for details. CA LL TODAY FOR YOUR APPOINTMENT NO WAITING 888-461-0950 ASK IF YOU QUALIFY FOR A $300 DISCOUNT VOUCHER! UP TO $ 4000 CASH BACK GO GREEN WITH THE LEAFITS HERE. The 100% electric, no tailpipe, zero emission Nissan LEAF .As low as $25,280 net, after tax savings. MSRP $32,790 with federal tax savings from $0 to $7500 now. The 2011 Nissan LEAFt. Awarded a Top Safety Pick by the IIHS. See www.iihs.org.Gotta Drive It. To Believe It. 8519275 NWoJ:)]TJ -0.2045 Tc 7.5455 0 0 4 85.5634 676.0423 Tm (1 , )Tj 0 0.502 0 rg 0.621 0 Td ( )-273( `1 I B 42T )Tj -0.3158 Tc 26.2105 0 0 5 307.0634 648.0431 Tm (I ` ] B242y6Jr 1-zcZero EmissionHToutletsauto the right way to finance a car!

PAGE 50

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section B Page 1 8518598 NOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMES4465DuncanRd.(Hwy17N), PuntaGorda,offI-75Exit164941-637-1122 or 877-507-1122www.prestigehomecenters.comMon.-Fri.9:00-6:00Sat.9:00-5:00Sun.12:00-5:00Pr estigeHOMECENTERS,INC.NOBILITYHOMESNOBILITYHOMES Charlotte HarborPunta GordaHwy17 orDuncanRd.PrestigeHomeCenter 3.7milesfromI-75 X I-75NOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMESNOBILITYHOMES2BR/2BA,HugeMasterw/DreamSuiteMasterBathFrom$79,9958517103 FinancingAndInsuring Y ourNewHomeWecanofferyout rueone -stop shoppingthroughourown financecompany,21stMortgage andMountainInsurance. Askaboutoutexclusive PaymentSaverProgramand findouthowyoucansave $30,000onthepurchaseand financingofyournewhome from21stMortgage. The Islander The Islander ArthurRutenbergHomes.comNo wB uildingin CharlotteCountyFor moreinformationcall:(941)505-1800orvisitourfully-furnishedmodelat 1203DeborahDrive,PuntaGordaIsles CGC055986SandStarHomes,LLCanindependentfranchise A wardWinningModel-OpenDaily!(941)505-1800VisitourBeautifullyFurnishedmodelat 5025BalHarborBlvd.,PuntaGorda,FL33950 ArthurRutenbergHomes.comSandStarHomes,LLCanindependentfranchiseMon-Sat.10:00-5:00Sun.12:00-4:00CGC013881/CGC055986 8518589 N N E E W W S S P P R R I I N N T T N N E E W W S S P P R R I I N N T T NEWSPRINT & & & & & I I N N T T E E R R N N E E T T I I N N T T E E R R N N E E T T INTERNETEachonereinforces theother Advertiseinthe SunClassifieds and Sunnewspapers.net Offersallofthefollowing online:8518597 sunnewspapers.net NEWSPAPERS ARCADIANARCADIANServingDeSotoCountysince1887 NEWSPAPERSCHARLOTTESUN VENICEGONDOLIERSUN ENGLEWOODSUN PUNTAGORDAHERALD NORTHPORTSUN ARCADIAN Rock Rock Solid Solid Service ServiceDOTTIEJOHNSON,GRI,CRS,SFRTime Time Tes ted Tes ted Results ResultsT el. 941-391-8020 Fax 941-766-0622 T T T ogether T E E Each E A A Achieves A M M More M OURTEAME-Mail dottiejohnsonteam@comcast.net (8yrsinarow) 2003-20108518596Tel. 941-391-8020 Fax 941-766-0622FEATUREDPROPERTY AGGR ESSIVELYPRICED FEATURESGALORE! NewerhighseerA/C, carpet&screening.Largeoversizedlanai, dualmasterbedroomswithseparatebaths. Supercleanandreadyforoccupancy. Recentpricereduction. $84,850 find 941.412.3323 877.337.3542 8527506 Arcadia Englewood North Port Port Charlotte Punta Gorda Venice Classifieds & Real Estate TM 866-463-1638 866-949-1426 Fax SP27195 INSIDE THIS CLASSIFIED/REAL ESTATE SECTION LOOK FOR: Classifieds: Real Estate 1000, Legal Notices 3100 Advertising: Real Estate, Showcase Of Homes TV & Movie Listings, Real Estate, Area Property T ransfers, Comics, Puzzles, Advice Columns, Horoscopes =!)!iRifSignature SothebysU3INTERNATIONAL REALTYdEND"r 1 1 `:a`.%.. G )Tj -0.0476 Tc 5.9286 0 0 6 370.3603 287.9928 Tm (' Win.:.)]TJ -0.0476 Tc 5.9286 0 0 6 681.3603 285.4929 Tm (' ,)Tj -0.0187 Tc 3.1125 0 0 6 704.3603 282.993 Tm (a)-97(r )Tj -0.1667 Tc 6.9167 0 0 5 260.8603 282.993 Tm ( )-155( ti012 "' ..)Tj -0.3381 Tc 15.3836 0 0 5 677.3603 278.9931 Tm [(r.)-693(!-iii w )Tj -0.1667 Tc 6.9167 0 0 5 718.3603 282.493 Tm ()Tj -0.0191 Tc 15.8827 0 0 10 137.3603 274.4933 Tm (W2, Zia'06.'elmM \ )Tj 1 0.502 0 rg 0.642 0 Td (` sfir. -. > I. w ] )Tj 0 0.502 0 rg 0.614 0 Td (, ...." 741w.._ Hsu Baia )Tj -0.1071 Tc 10.375 0 0 7 209.8603 140.9973 Tm (i _wu ,r)Tj /TT0 1 Tf -0.034 Tc 1.9762 0 0 7 281.3603 142.9973 Tm ( 1'.t)-43()]TJ -0.1071 Tc 10.375 0 0 7 341.8603 147.4971 Tm (. ,w ,j)Tj -0.0875 Tc 6.3038 0 0 7 551.3603 148.4971 Tm (:.. ,, ---litCharlotte,SunCharlotte SunEnglewood Sun f, )Tj /TT4 1 Tf -0.0098 Tc 11.9503 0 0 15 518.6366 617.1762 Tm (North Port Sun =5wAti1)-458(,. ---

PAGE 51

The Sun Classified-Section BPage 2E/N/C/VSaturday, September 24, 2011 Round Town in Real Estate! 8518599 Scott Coulombe scoulombe@sun-herald.com 941-429-3118 The top individual in Listings was Robert Gravatt and the top team was The French T eam. The top in individual Sales was Richard Gierulski and the top team was The French Team. The office is located at 19700 Cochran Blvd., Port Charlotte. For more information, please call 941-627-3321 or visit us online at www.century21almar.com Five Star Welcomes Brian Garcia Brian is a Charlotte County native and has spent his entire life here in Charlotte County. After spending the last eight years w orking for Lee County EMS as an EMT and Paramedic, he has decided to step out into a new adventure and join our team. With his home town knowledge Brian can show you all that Charlotte County has to offer, from the miles of great beaches, to the fishing in Charlotte Harbor, scenic wildlife and f antastic shopping and dining. If you would like to know more, please feel free to give Brian a call and he will be happy to answer any and all questions. Brian Garcia, Sales Associate Office: 941-637-6116, Cell: 941-276-7313 CENTURY 21 ALMAR & ASSOCIATES IN PORT CHARLOTTE ANNOUNCES TOP PRODUCERS FOR AUGUST TO P SALES TEAM John Littlejohn Marilyn Purcell Carolyn Depenbrock TO P LISTING AGENT Sara Youngblood TO P SALES AGENT Gary Teeple TO P LISTINGS TEAM The French Team TO P SALES TEAM The French Team Robert Gravatt TO P LISTING AGENT Richard Gierulski TO P SALES AGENT COLDWELL BANKER RESIDENTIAL REAL ESTATE T OP AGENTS FOR AUGUST TO P SALES AGENT TO P SALES AGENT 351 W. Venice Ave., V enice, FL 34285 941-485-9147 www.hackworthrealty.com Group Group Group LLC LLC LLC 8526094 Est. Since 1987 MARY ELLEN DEITER DIRECT: 809-7305 Y OU WONT BELIEVE YOUR eyes when you see this 3/2/ 2model perfect pool home that was built in 2000. Enjoy the wide open floor plan and great location in Gulf View Estates, only 2 miles to the beach! You dont want to miss this one! $254,900 CLIFF STILES DIRECT: 468-3606 CHRIS LAVOIE DIRECT: 234-8980 IF YOUVE BEEN WAITING for that perfect maintenance free home-look no further! Come enjoy the golf, friendly neighbors, heated community pool & club house all available when you own this 3/2/2 great room style home. $235,000 MARY ELLEN DEITER DIRECT: 809-7305 KEN SULA DIRECT: 544-3197 CINDY FUCSIK DIRECT: 416-5103 LOOKING FOR THAT LARGE on the water-here it is! T his 4/3.5/2 T udor Style Home w ith p ool & d ock Is j ust m inutes f rom t he Gulf of M exico! T his private setting has to be seen to truly appreciate what a fabulous location & outstanding home this is! $995,000 QUIET, PEACEFUL WOODED view from the 2 nd floor 2/2 condo! B eautifully turnkey furnished unit with open floor plan, cathedral ceilings, large kitchen & split bedroom lay out. TRULY A MUST SEE!!! $124,900 WHAT AN INCREDIBLE PRICE for this large spit plan 3/2.5/2 pool home! Gorgeous family room with wood burning fireplace on a beautiful stonewall all under a beam ceiling looking out onto the pool & lake. Large master suite, formal living & dining rooms plus eat-in kitchen & breakfast bar. $229,000 Hackworth Realty Hackworth Realty Hackworth Realty 1000REAL ESTATEWe Are Pledged To The Letter And Spirit of U.S. Policy For The Achievement Of Equal Housing Opportunity Throughout The Nation. We Encourage And Support An Affirmative Advertising And Marketing Program In Which there Are No Barriers To Obtaining Housing Because of Race, Color, Religion, Sec, Handicap, Familial Status Or National Origin. EQUAL HOUSINGOPPORTUNITY REAL EST A TE 1010 16501010Open House 1015 Real Estate Auctions 1020Homes/General For Sale 1030Waterfront Homes For Sale 1031 Foreclosures For Sale 1035 Golf Course Community For Sale 1040Condos/Villas For Sale 1060Townhouses For Sale 1070Duplexes For Sale 1075Tri-Plex For Sale 1080Apartments For Sale 1090Mobile Homes For Sale 1100Interval Ownership 1100 Out of Area Homes For Sale 1115Trade/Exchange 1120Wanted To Buy RENT 1205 Lease Option 1210 Homes 1240Condos/Villas 1280 Townhouses 1300Duplexes 1320Apartments 1330Hotel/Motel 1340Mobile Homes 1345Misc. Rentals 1350Efficiencies 1360Room ToRent 1370Rentals To Share 1390Vacation/Seasonal 1420Wanted To Rent LOTS 1500Lots & Acreage 1515Waterfront 1520Out Of Area Lots 1530Commercial Lots 1540Trade/Exchange BUSINESS 1600Business For Sale 1610Business Rentals 1615Income Property 1620 Commercial/ Industrial Prop. 1640Warehouse & Storage 1650Farm/Ranches Classified = Sales OPEN HOUSE1010 09/24/11 OPEN HOUSE1010 100 West Venice Avenue V enice, Florida 34285 941-485-0021 Sat. 2pm5pm 1200 Tarpon Center Rd. Unit 208 Venice Island $329,800 Fabulous Gulf views! Beachfront! End unit! Updated & furnished! 2nd floor! Must see! Fran LeRoux 941-445-7744 19700 Cochran Blvd Port Charlotte 941-627-3321 Sat. 11am-2pm19375 Water Oak Dr. K205 Port CharlotteHeritage Oak Park 2/2 condo with carport Lake view,fitness room, activites, heated pool tennis court. Gated community. Call for gate code Glen Jarman 941-404-9767 Fri.-Sun. 8am-3pm 14229 Marlin Ave. Port Charlotte. ESTATE SALE: All contents, '78 El Camino, even the home. CINDY SPIRK 941-429-2727 Sat. 12pm-3pm 3378 Deck Street Port Charlotte Exquisite Custom River Front Home! 4/4/5 Pool 5,234 sqft living $995,000 MLS#C696946 Donna French 941-661-1202 SELLING YOUR LOT, HOME OR CONDO??Call the Sun at 866-463-1638 and ask about our BRAND NEW Buy 2 Months Get One FREE! Real Estate Ad Program. Y our ad will run everyday in the newspaper & run online for 90 days! All for a ONE TIME low price. Hurry, Offer good thru Sept. 30, 2011. Call for details. Realtors Welcome! OPEN HOUSE1010 ALLISON JAMES Estates & Homes PRAIRIE CREEK PK 5 TO 21 ACRE LOTS MLS LISTINGS BEGAN @$38,200 /HOMES @ $175,000 ALSO Bank Owned & Short Sales 3/2 Pool/canal hm $184,900 ALLListings. SEARCH:www. PuntaGordaPropertiesforsale.com BAY INDIESRESORT COMMUNITYCOME SEE WHAT OUR LIFESTYLE HAS TO OFFER!950 RIDGEWOOD AVENUE VENICE, FL 34285 941-485-5444 OPEN HOUSE DAIL Y! MON FRI 8-5PM SATURDAY 10-2PM SUNDAY 12-4PM Bird Bay Village, Venice Saturday, September 24th 11 AM-2 PM 1112 Bird Bay Way Excellent Unit & Location Ground Floor 2/2 Corner on Lake $175,000!!! Hans Kirsten Cell: (941)350-0441 Bird Bay Realty, Inc. (941)485-4804 ADVERTISE In The Classifieds! ENGLEWOOD, SUNDAY 12-3 81 Stratford Rd.Great Location Near Historic Old Englewood & 10 Minutes to Manasota Key. 2 Bedroom, 2 Bath, 2 Car Garage Pool Home on Oversized lot. $150,000. Mary Stuart, Coldwell Banker (941)-735-1496 Opportunities are out there, subscribe to the Call 206-1200 Today!! SP29851 SS,U 3 I)14(r .i y.T)]TJ -0.0571 Tc 5.9286 0 0 5 569.5053 1130.7164 Tm (`-'j I r_o=. .tcl sa= 4 1F ) J)>< Fii1111Ja),p llio = 131 I :r))31())11+ )152((ib' ISUNS,r:llll)]TJ 0.0968 Tc 4.0161 0 0 5 400.0053 1043.2191 Tm () 2:, 1 Cn dSwoE+;kueNww ivrt vGx i )Tj -0.119 Tc 3.9524 0 0 4 669.5053 1046.719 Tm ( r! l iJ11 ")]TJ -0.0857 Tc 5.9286 0 0 10 466.0053 1004.2203 Tm ('! r_ v1fr Jlt)40(ll(l)]TJ -0.0404 Tc 9.2222 0 0 11 421.5053 972.7213 Tm (. ')31( vf =IJIt )Tj -0.0189 Tc 5.4811 0 0 12 398.0053 955.2218 Tm [()184(, pl;3111y%J ,. .)]TJ 0.078 Tc 7.8008 0 0 6 405.5053 933.7224 Tm [(ll(pt Q: is > a3s t.xif..: e.7Li+l 1411 -FBI Ian

PAGE 52

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 3 Meet Your Real Estate Agent Meet Your Real Estate Agent 8528970 4456 Tamiami Trail Po rt Charlotte, FL 33980 Ich Spreche Deutsch 941-235-5609 Free 1-800-445-7043 christamurch@hotmail.com www.sunnylandhomes.com Christa Murch, GRI Aztec & Associates Brett Barber We may not be the biggest But we are the best Located on the beach next to the Lock & Key Restaurant Office 941-474-7121 Cell 941-270-1659 T eam up with success!! We list, we sell and we are sold on serving our clients!! Our hours are flexible to fit our clients needs and we are available seven days a week. Direct: 941.628.5027 Jeremy T. Jones Broker Associate Venice Real Estate Company 941-650-9481 Lou Sauppe Realtor Office 1680 El Jobean Rd Port Charlotte, FL 33948 Cellular (941) 740-0529 e-mail: maureen@kelligroup.com To view all MLS listings, please visit my website www.kelligroup.com Maureen Duso SFR Realtor, REALTOR Blaine Harteg REALTOR REALTOR POWER BROKERS REAL ESTATE 4045 Tamiami Trail, Suite 9 Po rt Charlotte, FL 33952 Office: (941) 258-3379 Cell: (941) 740-2595 To ll Free: 1-866-463-1637 Fa x: 1-866-929-1207 Blaineha@gmail.com 25166 East Marion Ave. Punta Gorda, FL 33950 Cell: 941-769-0218 Fax: 941-766-0172 Email: cashsellsflorida@gmail.com Web: http:// angelacash.mfr.mlxchange.com/ Angela Cash Search All Listings, Bank Owned & Short Sales www.puntagordapropertiesforsale.com JUDY PETKEWICZ GRI, CRS Your Neighborhood REALTOR 305-304-8304 CORAL SHORES REALTY INC., FL P.O. Box 1740, 2538 SW Hwy. 17 Arcadia, FL 34265-1740 Cell: (863) 990-1877 Office: (863) 494-2211 Fax: (863) 494-2632 Toll Free: (888) 741-2632 peggymardis@remax.net www.peggymardis.com Margaret A. (Peggy) Mardis GRI, ABR, Realtor D EBORAH M ILLER REALTOR CDPE, SFR, SRES TheDeborahAndDickMillerTeam.com 941-876-7777 4456 Tamiami Trail Charlotte Harbor, FL 33980 941-457-7072 Website: www.loriannmertens.com Each Office Is Independently Owned & Operated. Lori Ann Mertens Realtor TheWatersideGroup941.268.4999 EllenBaker Specializingin L uxuryHomesTheWatersideGroup@gmail.com P ATTY G ILLESPIE 941-875-2755 REALTOR, GRI, SRES, e-PRO, CSSS www.CallTheCaptain.net Capt. Chuck Eichner CALL THE CAPTAIN! 941-833-4234 Marge Tra yner Your Hometown Realtor 941-380-2823 www.budtraynerrealty.com 1531 Rio de Janeiro Ave. Deep Creek Bud Trayner Realty, P.A. T O P LACE Y OUR A D O N T HIS P AGE T O P LACE Y OUR A D O N T HIS P AGE F OR S EPTEMBER F OR S EPTEMBER P LEASE C ALL 866-463-1638 P LEASE C ALL 866-463-1638 Lorraine Anderson Realtor 941-875-5657 We Keep in Touch 4additionalinfo@gmail.com Mark Anderson Realtor 941-875-5657 We Keep in Touch 4additionalinfo@gmail.com ADVERTISE! MLS,Ta Pines RedIty

PAGE 53

The Sun Classified-Section BPage 4E/N/C/VSaturday, September 24, 2011 SP29553 RENTALS HOMES FOR RENT1210 209 Stebbins Tr, PC Lg. 4/3/2, pool, sailboat access w/dock.........$1295 2040 Winningway, PC Lg 4/2/2, fenced, corner lot, mstr.BR/sitting/TV rm $975 116 Colonial SW, PC Lg. 4/3/2, pool, canal harbor access, dock, tile.....$1300 102 Colonial SW, PC 2/2/1 all tile, newly remodeled, upgrd kit, corner lot.............................$800 109 Leland SE, PC 3/2/1 all tile, on canal w/dock harbor access ................$950 3084 Key Ln, PC 2/1 Carprt, CHA, tile,fam. rm, scrnd lanai, laund rm.. $600 23340 Jason St, PC 3/2, window AC, tile, W/D, stained wood deck .....$550 22186 Belinda, PC 3/2/ carport, CHA, all tile, appl., W/D, fncd yard...........$725 Contact Diane @ 941626-7090 or Kathy @ 941-628-8855Paradise Properties & Rentals 46 UNFURNISHED UNITSSHORT TERM FURNISHED AVAILABLEWWW.ALMAR-RENTALS.COM WE NEED MORE LISTINGS ALMAR RENTALS & MGMT. SERVICESPORT CHARLOTTE/NORTH PORT/ PUNTA GORDA/ENGLEWOOD 941-627-1465 800-964-3095 A A F F F F O O R R D D A A B B L L E E H H O O U U S S I I N N G G ! ! 4 4 b b r r / / 2 2 b b a a / / 2 2 c c g g N N o o r r t t h h P P o o r r t t *On Selected single family homesNow Open Mon Fri 8-4 Sat. By appt. only (941) 613-1469 S S E E P P T T E E M M B B E E R R M M o o v v e e i i n n f f o o r r s s e e c c u u r r i i t t y y O O n n l l y y ! ANNUAL RENT ALS R O T OND A WEST 2/2 Oakland Hills $675 3/2 Flower $1200 GULF COVE 2/1 Hogan $550 ENGLEW OOD 1/1 Quails Run $600 POR T CHARLO TTE 3/2 Cannolot $825 NORTH PORT 3/2 Goodrich $995 3/2 Oasis $900 3/2 Monday $9002012 SEASONAL RENTALSEnglewood, N. Port & Pt.Char 1/1 Condo, waterview $1400 2/2 Condo $1800 2/2 Home $1600 3/2 Mobile Home $1300 2/2 Home $1500 2/2 Pool Home $1800 Diana Legg/Michele Ross Y our Rental Experts 941-475-7011 941-681-1189 website: www.icre.us NEED RENTAL HOMES FOR QUALIFIED TENANTS ARCADIA 1B/1B Duplex N of town, large yard, lawn care, sewer, water included $450 mthly $450 Sec. 863-5581130 PORT CHARLOTTE 2/1 CP home, FR, LR, upgraded, new, clean $650. 423-255-1612 HOMES FOR RENT1210 ARCADIA 4B/2B 1Car Garage, carport, CHA, Fenced yard, Just remodeled! In country but close to town $1100 mth Plus sec. 863-558-1130 BURNT STORE ISLES 4/2/2 w/pool & dock w/boat lift, sunset views, unfurn.,1st & last. $1600 mo. 603-491-9292 DEEP CREEK 4/2/2 $950 Lanai, cul-de-sac, Quiet Realty Executives Mainstream 941-979-8915 EAST ENGLEWOOD clean 3/2/2 Home w/lanai in quiet nhood. Bch + Shopping close $900 mo. 941-662-7874 ENGLEWOOD Rentals M&MProperty MGMT CALL 941 473-9616 or mmpr oper tymgmt.com ENGLEWOOD 1/1, Unfurn, Stove, Fridge, Air, W&Dhookup. $500/mo +util, Cell: 517358-1422 or 517-529-4533. Englewood 2/2/1 $725 Lanai, Quiet Area Realty Executives Mainstream 941-979-8915 ENGLEWOOD 3/3/1 North Englewood pool home.Fenced yard, dead end street. includes pool service. Possible in-law suite. leave message. $895 941-539-0746 ENGLEWOOD AREA: 3/2/2 Split N. Eng 2583 sqft poolw/ service $1200 3/2/2 Rotonda, living Dining, family & Extra (poss. game rm) with pool service $1050 2/1.5 Duplex N Eng new paint & tile, $600 W est Coast Property Mgt. www.rentalsFlorida.net 941-473-0718 ANNUAL & SEASONALRENTALSC all The Pineapple Girls 941-473-0333Pineapple Gulf Prop. Mgmt. Inc.www.RentEnglewood.com For a Complete List Go To eraportcharlotte.com$1000...3+/2.5/2..1713 SF..NP $900....3/2/1..Townhome.... NP $875...3/2/2..1478 SF.........NP $800..2/2/2..1356 SF...PC/ROT $750...3/2/1.....998 SF.........NP LET US RENT YOUR HOME Agent Available On Weekends We Forgive Foreclosures For Renters FULL SERVICE PROPERTY MANAGEMENT Only $59 p/m, (flat fee) 877-400-0354 RENTMEFLORIDA.COM KINGS HWY 3-4BR/2BA HOME. $500; NEEDS TLC 1ST&SEC. 941-624-0355 NEED A RENTALParadise Properties & Rentals,Inc941-625-RENT North Port 3/2/2 $875 Screened Lanai Close to Schools. Realty Executives Mainstream 941-979-8915 HOMES FOR RENT1210 NORTH PORT BRAND NEW 3/2/2 ON CITY WATER. LARGE YARD! 1500+SF $950/MO 941-350-1288 NORTH PORT Extra Clean 3/2/2 laundry room, screened Lanai, $850 Lease & Deposit. 941-379-4463 NORTH PORT NEWER 3/2/2 w/ family room on canal. 3104 Tonkin $900/mo Investment RE492-5050 NORTH PORT New 3/2/2, $875 Mo.1st & sec No pets/ smoke. 1829 New London St. Avail. 9/1/11. 941-625-9065 NORTHPORT, 3/2/2 w/pool. Built in 2005, near schools, I75, US 41 and shopping. $1350/mo. 941-426-6217 or 347-721-2958 Available Now. Sec. 8 Welcome NORTH PORT 3/2/2 Extra clean, all appliances, great central location. 1st/ last/sec, avail now $875/ mo. 305910-1829 or 941-237-8399 PORT CHARLOTTE 3/3/Den/1 newly remodeled, jacuzzi, laundry rm, huge backyd $800. No pets. 941-204-3197 or 407556-5288 DEEP CREEK 2br/2ba, 2ndflr, Lake view, GATED Clubhouse,Annual. $700/mo 941-483-9093 PORT CHARLOTTE 3/2/2 on Kim/Comstock. $975. mo. Avail. 9/1. 941-627-1000 Haley or Cathy 941-456-4159 PORT CHARLOTTE 2/2, DW, W/D hook up, all tile, lrg yard, fireplace, quite area $700 mo. (207)-590-6897 PORT CHARLOTTE 2BR/ 1BA/CP, new carpets, updated kitchen, FL rm, LR, DR $595, avail Oct. 1. 516-508-8181 PORT CHARLOTTE 3/1/ CP, CHA,$600 mo. No pets. 1st., last, sec. 941-629-7056 PORT CHARLOTTE 2/1 house, $590 mo; 2/2 duplex $500 mo 1st, last, and security required. No pets. 941-621-3389. PORT CHARLOTTE 2 Hms Great area 3/2/CP & 2/2/1 $800/$750 All tile, Avail. Now Flex terms 941-629-0157 PORT CHARLOTTE2/2 or 3/2, tile, lanai, appl. w/d $695$995 mo. 1st + sec. Ann. Sm. pet ok (941)-626-1514 941743-0386 PORT CHARLOTTE 2/2/1 on fresh water canal 1628 Abscott St. $750/mo, $1,000 Sec. no pets 941-815-7450 PORT CHARLOTTE 3/2/2 $1700 Salt Canal, Pool, Furn. Dock. Realty Executives Mainstream 941-979-8915 GET RESULTS USE CLASSIFIED! PORT CHARLOTTE 3/2/2 sailboat canal htd. pool dock lift long or short term $1,000 941-255-0554 PORT CHARLOTTE 3/2/CP, Newly Decorated. appliances, lg lanai, storage $795, Pet neg 941-456-3439 PORT CHARLOTTE Murdock Nice 3/2/2,POOLserv incl. tile, pets negot. N/S $1000 mo + sec 941-769-1604 PORT CHARLOTTE Y early, great 2/1/1 lanai, nice area, $650 1st & last. 508-8887869 or 508-274-5945 PORT CHARLOTTE Lrg., 2 Bdrm, 1 Bath central heat & air NEW blinds & carpets, No Pets $550. 941-743-3489 PUNTA GORDA ISLES, newer 3/2/2, living rm, dining rm, lanai, fenced yard, pets neg. $900 mo 317-702-2290 HOMES FOR RENT1210 PUNTA GORDA Live in luxury in a new construction pool home. Prices starting at $1,200/mo Call Robyn 941-747-7261 PUNTA GORDA, Riviera Lagoons. 771 Coral Dr. 3/2 split floorplan. 261 ft of Sailboat waterfront. Seawall, 2 docks & boat lift $1,000/mth, contact Tiffany Monday Sunbelt Home Services,LLC (941) 625-6120 a greHouses start @ $600 Condos start @ $550 www.allfloridarealty.com (941)629-1121 Real Living All Florida Realty ROTONDA 3/2/2 golf course/lake views. Pets negotiable. $1,000 941626-0858 ROTONDA 3/2/2 Pool and spa on golf course & canal. $1,450 941-270-2199 ROTONDA AREA 3/2/2 $1000 1846 sq ft, Screened Lanai Realty Executives Mainstream 941-979-8915 SOUTH VENICE ENCL POO L W ell designed 2/2 tiled, alarm, j acuzzi tub, semi furn. $115 0 mo+dep 866-653-6417 CONDOS/VILLAS FOR RENT1240 12 UNFURNISHED CONDOS Almar Rentals & Mgt. Services 941-627-1465 Almar-Rentals.com 175 Kings Hwy, PC 2/2, 3rd fl, elev, furn/unfurn ann., comm pool, clbhse.....$750 21320 Brinson PC 1/1, 55+ amenities, cls to hosp, shpg, Cult.Ctr............$475 820 Kings Ct. PGI, 1/1 PG Hist. area, close to Fishermens Vill. & downtown, no water bill..........$500 $575 25100 Sandhill Blvd, PG 2/2 2nd fl, no elev. all appl amenities, incl water....$550 900 E. Marion Ave. PG 3/2 lg new condo overlooks Peace River, dock, gated, amenities, upgrades, undrgrnd park,3rd fl, Elev.$1000 ALL CONDOS NO PETS Contact Diane @ 941626-7090 or Kathy @ 941-628-8855Paradise Properties & Rentals ANNUAL & SEASONAL RENTALSIN BIRD BAY VILLAGE BIRD BAY REALTY (Venice) 484-6777 or 800-464-8497 NEEDAJOB? CHECKTHE CLASSIFIEDS! DEEP CREEK2/2 lanai, cath. ceil., tile, wood cab., granite, w/d inc. Pets ok $695+ up. 941-661-4539 DEEP CREEK Gardens, 2/2, 1st floor end, screened lanai, $650/month, plus utilities, 1st, last, sec. ReMax Anchor Realty 941-628-1572 ENGLEWOOD 55+ Comm. To sublet for 4 mo. 1BR/ 1.5BA, walk-in closets,, lanai. $625 per mo. Cable TV incl. Avail Oct.1. 920-857-4673. CONDOS/VILLAS FOR RENT1240 ***CONDOS *** 1/1 Oak Forrest 55+ Comm., W ater Inc., Comm. Pool Forrest Nelson, P .C. $400 Mo *we welcome new listings* AWARD WINNINGSUNBELT MGT. SERVICES RENTALS COMPLETE LISTINGS (941) 764-7777sunbeltmgtser vices.com LIVE IN style in beautiful Fountain Ct, PGI. Gorgeous 3BR, amenities galore, unfurn. $850. Realty Management 941-625-3131 PORT CHARLOTTE 1/1, 55+Comm.Pool, Lndry, storage. $475. 941-223-0290 PORT CHARLOTTE 2/2 off Kings Hwy, ground floor, includes water, pool, & tennis. Sm pets ok, $675 +sec 941-286-9888 PORT CHARLOTTE 2BR/2BA Appliances. Across from Cultural Center, Available Now $600/mo + 1st & sec. No Pets. 941-575-3543 PORT CHARLOTTE, 2/2 ground floor, All amenities & appl, Military, Med. & Sr. dis. wtr/incl $700 941-627-1414 ROTONDA 2/2/1 Patio & Lanai, W/D, Quiet Area. No Pets. Unfurnished. $825/mo 941-763-3700 ROTONDA Newer 2 BR condos from $800 incl Wtr/Swr/Cbl. Sm pets ok. Fiddlers Green Rentals. 941-698-4111 or 941-539-1838 VENICE 2/2 beautifully furn, 1st fl, pool/golf, remodeled, annual. $850 mo. 1st, last, sec. 828-766-6448 DUPLEXES FOR RENT1300 ENGLEWOOD 1/1 $450; 2/1 $550 Remodeled, Lanai, All Tile NS/NP. 941-400-1670 ADVERTISEWITHTHE SUNCLASSIFIEDS ENGLEWOOD 1/1 CLEAN & ONLY 1 BLOCK TO BEACH! 1st/last/sec. $725 941-661-4871 ENGLEWOOD NICE CLEAN 1/1 LANAI,with W/D & lawn maint. incl $550/ mo. + 1mo sec 941-460-9403 NORTH PORT 2/1 near stores, buses, good condition, tile floors $700/mo + last month. 941-426-2942 PORT CHARLOTTE 2/2 $700 inc Lawn maint/ $50 of water bill Realty Executives Mainstream 941-979-8915 PORT CHARLOTTE/NORTH Port299-B Longley Dr. 2/2 garage, CHA $600 Mo + $500 dep 941-284-2917 APARTMENTS FOR RENT1320 ENGLEWOOD RESERVE NOW! 1ST MONTH ONL Y $375 12 mins from Venice 2br w/ den 2 ba 1300sf, Swimming pool $750/mo 941-473-0450 APARTMENTS FOR RENT1320 MARIAN MANOR APTS. 2/1 Starting at $595. ** Pets Welcome **Restrictions And **Income Limits Apply Call 941-391-5669 N. PORT$500.00 MOVES YOU IN! $900/MO w/ ann Lse. 3/2/1 luxury condo 1425SF. Sm Pets OK Call for apt 941-350-2704 TTJ Invest. -Emerald Oaks 4520 S Biscayne Dr NEW LUXURY APARTMENT COMMUNITY Located at 125 Airport A ve on Venice Island Just a short walk to the BEACH!! Apartment Homes are Completely Remodeled. New Stainless Steel Appliances, Tile Flooring, much More! Resort Pool, Fitness & Business Center. Pets Welcome! CLASS AAANon Smoking Community Starting at $680/mo. Call 941-412-4963 Professionally Managed by Gallina Management,Inc CITADEL APARTMENTS OF VENICE NORTH PORT VICTORIA POINTE APTS. at Sumter & Appomattox between US 41 & I-75. Accepting application s for 1BR & 2BR Apts. Conve niently located close t o schools, shopping entertainment & beaches 941-423-8720 Available Soon Studio Apts Income-Based Housing for those, 62 and older. Please call 941-624-2266 Limited availability, Restrictions Apply. TTY:1-800-955-8771 EQUAL HOUSINGOPPORTUNITY PORT CHARLOTTE 1/1 very good condition, asking $490 month. water included. 1st, last security. 941-380-9212 No pets!! PORT CHARLOTTE north end, furn mother-in-law apt, all util incld, no pets/drugs/ smoking. Avail 10/1 $600 mo. + $600 sec. 585-729-5884 PUNTA GORDA Clean 1 BR, LR, Fl rm, patio, large yard, garage available. Quiet area. Riverside Dr. $385 /mo with discount! 941-740-4769 PUNTA GORDA Downtown, walk to everything, 3/2/1, $975/mo. Call 941-456-4159 PUNTA GORDA 2BR/1BA/CP Corner of Taylor & Ann St. $700/mo incl. water 1st mo+ sec to move in. 941-740-0491 The Fountains 1/1 from $580 2/2 from $680 3/2 from $795 Call for specials 941-429-9799 VENICE ISLAND APTS 1 bedr oom apt avail. Close to beach & downtown. No pets, no smoking. 941-451-3175 Ki,,)Tj -0.0077 Tc 4.4865 0 0 7 131 1121.002 Tm (4 .e /fir )Tj -0.4248 Tc 23.2652 0 0 7 583 1114.0023 Tm [()-234(I1)Tj -0.1071 Tc 10.375 0 0 7 722 1115.5022 Tm (Io s Iftt 1 )Tj 1 0.502 0 rg 0.567 0 Td ( -_ ,mes dos tments aMoreo ri N Cori l a 1 And)]TJ /TT3 1 Tf -0.0081 Tc 6.7558 0 0 10 590.5 1077.0034 Tm (Pr ONTHREERENT)-480(NER:1..11 )-579(IC )Tj /TT4 1 Tf -0.0868 Tc 5.8962 0 0 6 174 206.03 Tm [(0.EN7 ME FLORID,,

PAGE 54

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 5 SP31029 LAKE SUZY ESTATES Pool Home. 3/2.5/3.5 Custom Built 2004. 2 Story, 3400 sf on Double Lot. Master on 1st Floor, Granite, Tile, Gourmet Kitchen, Bonus Room, Office & MORE! $389,000 941-204-0074 UNIQUE CUSTOM BUILT HOME REDUCED!! EXTENSIVELY REMODELED with 500 SF Master Suite addition, heated pool,new kitchen and so much mor e. Estate has priced to sell $265,000 MLS#A3940834 Stevens & Salt, Inc. 941-349-6636/800-326-9114 NOKOMIS ON ST.ANDREWS GOLF COURSE Why Wait? Immediate possession of custom b uilt home with spectacular view and privacy. Pristine condition inside and out, Great r oom,Heated pool Call for Private showing401-769-4073$289,000 PUNTA GORDA ISLES Check out the Fish Finder e very Thursday,only in Wa terLine,only in APARTMENTS FOR RENT1320 TOLEDO CLUB APARTMENTS SUMMER SPECIAL!RESERVE YOUR NEW HOME UP TO 4 MONTHS IN ADVANCEFREE RENTAVAILABLE ON ALL APARTMENT HOMES!! STARTING AT $555/MO!! 2 POOLS, SPA, 24 HR FITNESS CENTERS, WIFI INTERNET ACCESS & PETS WELCOME LOCATED OFF T OLEDO BLADE BLVD IN NORTH PORT T OLEDOCLUBAPTS.COM SPECIAL ENDS SOON!! 941-423-6600 VENICE CLUBSIDE APTS. 1 Bedrooms Available. $199 Move in Fee. Call (941)-488-7766. VENICEISLAND Efficiency 1 & 2 br, Immed. occup. No pets, 1 yr lease 941-416-5757or 323-6466 ADVERTISE In The Classifieds! VENICE STUDIO & 1 Bedroom Accepting Section 8 Vouchers 941-488-7766 EQUAL HOUSING OPPORTUNITY VENICE V ery clean 1BR/1BA Newly Remodeled, covd parking, pool, Walk to shops $695/mo+ deps 941-544-3388 V ENICE-SPACIOUS 2BR/1.5, Unfurn, Close to shopping, $650mo 1st, Last + Sec (941)-966-2762 APARTMENTS FOR RENT1320 VILLA SAN CARLOS II 22250 Vick St. Affordable-Income based One bedroom apartments for 62 or older Income Limits Apply Call 941-624-4404TTY-1-800-955-8771 VILLA SAN CARLOS 2550 Easy Street Income based 62+ or needing features of accessible unit Income Limits Apply Call 941-624-2266 TTY-1-800-955-8771 EQUAL HOUSINGOPPORTUNITY VILLAS OF NORTH PORT 5200 S. BISCAYNE DR. NORTH PORT, FL 34287 (941) 426-2266 Phone Now accepting applications for seniors 62 and over and individuals with disabilities at any age. 1BR $485. $250 Sec. We allow Pets! $300. pet security deposit. Water, Sewer and garbage incl. $25.00 Application FeeEQUAL HOUSING OPPORTUNITY WOODMERE APARTMENTS OF VENICEStarting in the low 700s. Call 941-496-4161www.woodmereapartmentsofvenice.comResort Style Pool Clubhouse, Fitness, And Business Center with WiFi. Pets Welcome Professionally managed by Gallina Management, Inc MOBILE HOMES FOR RENT1340 NOCATEE MOBILE HOMES 3 BR, $550. mo. & 1 BR $400. mo. KINGSHWY. 2 BR. $400. mo. 941-624-0355 PUNTA GORDA 55+, 2/2, lake view, furn, near Hwy 75. 1st mo + sec. dep.$750. 941505-2960 or 262-498-5882 VENICE Ranch, priced to sell! Doublewide 2br/2ba/walk in closet, Furnished MUSTSELL MOVING! 941-485-2949 EFFICIENCIES FOR RENT1350 ENGLEWOOD Furnished $425/mo including utilities w/ year lease 55+ Park No pets lease (941)-474-1353 HARBOUR HEIGHTS close to river, newly renovated efficiencies with cable & internet, Sunnybrook Motel 941-625-6400 PORT CHARLOTTE 2 room suites, waterfront, weekly rates with Wifi. Between $200 & $240. Call 941-661-4262. GET RESULTS USE CLASSIFIED! PORT CHARLOTTE, Private entrance. Pool. Canal front. Furn. Nice area. Includes all. $135/wk. Ref/sec 941-624-0169 ROOMS FOR RENT1360 ENGLEWOOD $110 wk. Close to Manasota Bch & 776. No sec./util/lease, 941-473-0543 ROOMS FOR RENT1360 ENGLEWOOD FURNISHED ROOM WITH BATH, POOL UTILITIES INCLUDED. $400/MO. 941-474-4891 ENGLEWOOD, EAST senior welcome, CNA care available, quiet & clean, house privileges. 941-475-0742 ADVERTISEWITHTHE SUNCLASSIFIEDS NOKOMIS full house priv, shared bath, off street parking, quiet, no drinking, drugs, childern, or pets, $375 mo, $100 sec. 941-929-5745 NORTH PORT Furnd room & bath. Pool. Utilities incl. House privileges. Pets OK. $500/mo 941-423-6104 or 941-356-0985 PORTCHARLOTTE Furn. Nice. Close to all. Incl. util. kit privl. $125wk+dep. 941-626-2832 PORT CHARLOTTE V ery clean Lg room, Priv. bath, Priv. ent., utilities incl., no smoking, $400/mo plus deposits. 941-627-5382 PUNTA GORDA accomodataton. $50/$80/$120 per wk. Give me a call. 941-575-9577 VENICE GARDENS $435 + sec. Util, kit, & parking privilages. Reliable male. No drugs, smoking, pets. 941-497-4609 RENTALS TO SHARE1370 EAST ENGLEWOOD area, private bath & furn BR full priv. W/D $500 941-916-4058 NORTH PORT, F/seeks m/f to share furn. home. Inclds util. cable, phone, W/D, spa, across from lake. $125/wk. 941-429-1271 SP29553 RENTALS OPEN HOUSE1010 HERIT AGE LAKE P ARK Sales Office Open Daily MON.-SUN. 10:00 AM 4:00 PM Condos & Villas from Unbelievably low prices. Starting at $63,000 Summer Specials Buyers Incentives Sharon Kerr 941-286-7315 BURNT STORE ISLES Sat. 09/25 & Sun. 09/25 12:00 PM 4:00 PM 341 Monaco Dr. Captiva Professionally Decorated If you are planning to build, Y ou MUST see this home. ENGLEWOOD Sat. 09/24 & Sun. 09/25 12:00 PM 3:00 PM 4260 Placida Rd. #22D $117,500 Forest Park Pristine 2BR/2BA New 2 car carport, Lots of amenities. Room to store your boat. Jerry Curless 941-412-5123 Por t Charlotte Sun. 09/25 1:00 PM 4:00 PM 3128 Pinetree St. $89,000 Freshly painted inside & out 2/BR 2/BA Spacious home. Barrel tiled roof on a large Fenced corner lot. Anne Kyer 941-661-5272 PUTCLASSIFIEDS TOWORK FORYOU! FIND A JOB! BUY A HOME! BUY A CAR! NEEDCASH? OPEN HOUSE1010 OPEN HOUSE SAT. 10am 2pm3600 Middletown St. $89,900Must See! Large 3B/2.5B pool home on freshwater canal (North 41, R Gardner, R Westchester Blvd., L Middletown) OPEN HOUSE SAT. 11am 2pm7196 N. Plum Tree #326 Punta Gorda $119,000 3/2 condo, Plum Creek, larger corner unit upstairs w/cath. ceiling. (US 41 S to R on Royal Poinciana, R on N. Plum Tree.)OPEN HOUSE SAT. 10am 2pm333 Severin SE Road Port Charlotte $599,900 Large 5/3.5/2 on Charlotte Harbor. You will not get close to this view any where for this price!! (41 N to Edgewater, R Severin)OPEN HOUSE SAT. 11am 2pm23213 Elmira $69,900 2 Bed, 2 Bath recently updated. (Kings Hwy to Elmira or Beacon) ADVERTISE In The Classifieds! R.E. AUCTION1015 REAL EST A TE AUCTION Nominal Opening Bid: $50,000 Punta Gorda, FL 3210 South Shore Dr #12A 3BR 2BA 2,400sf+/Sells: 2:00PM Tue., Sep. 27 on site Inspections: 1-4pm Sun Sep. 18th, 25thwilliamsauction.com/september800-801-8003 Many properties now available for online bidding! A Buyers Premium may apply. Wi lliams & Williams FL Broker: Daniel S Nelson Re Lic BK3223097; W illiams & Williams Re Lic 1032049 Auctioneer: Wi lliams & Williams Auc Lic AB-0000760 Advertise Today! SHOWCASE OF FIND YOUR0 -)1 IES HOME TODAY,SUN,"= L

PAGE 55

The Sun Classified-Section BPage 6E/N/C/VSaturday, September 24, 2011 SP31029 Open Sunday 12-3pm 1424 Lemon Bay Dr. Englewood on Red Fish Cove 4/2.5 split; dock w/lift; breathtaking water views!Stephen L. Lingley 941-809-7580 LIVE IN LUXURY ENGLEWOOD $384,9001116 S McCall Road, Unit 132 T op floor Penthouse Suite w/amenities galore including 24 marble tile, granite counters, upgraded cabinets, crown molding, plantation shutters & more. Deeded boat slip, quick access to Stump Pass & less than 2 mi to Englewood Beach!Floridian Realty ServicesLinda Futch 941-270-2978 / Steve Avila 941-525-3195 OPEN HOUSE SAT. 12-3 LAKE SUZY 2005 3/2/2 Perfect Full Time or seasonal home, all app 1 yr old, Plantation shutters, Wood floors, many extras. Near golf course, Private yet convenient. Great Location. Low Taxes. $124,900. 941-286-1233 LAKESUZY ROTONDA Golf home 3/2/2, Living 1873, total 3051 Hi ceiling w/7 fans, open-split plan with untold amenities. Must See! 941-698-9652. REDUCED! $145,900 ROTONDAGOLFHOME Immaculate 2008 3/2/2 patio home, private heated pool, lakefront lot. Maint. free. HOA. $279,000. 941266-0206 SARASOTA PALMER RANCH PORT CHARLOTTE Harbor Heights. 3/2/Car Port. Completely Remodeled including New Kitchen, New Bathrooms, New Flooring, ETC! 1990 sf. on 15,000 sf. lot. Movivated seller! Owner financing available. Only $64,900. 786-223-0404 HARBOR HEIGHTS BEAUTY!! Beautiful 3 Acre Mini Ranch Special Rural FINANCING! 10 Mins to shopping, restaurants, etc..., yet offers the best of country living. Stocked pond, fenced, new appliances, completely redone. BUYERS HOME WARRANTY INCLUDED. FANTASTIC NEW PRICE @ BEAUTIFUL 3 ACRE MINI RANCH! Back on the market! CAPE HAZE AREA New seawall, Bay views, back yard faces west spectacular sunsets over the water. Possible owner financing at 3-1/2%. Reduced to $189,900K. MLS# U7516944 DEEPSALTWATERLOT 198 Hibiscus Drive #521 3/2 with 2 car garage. 2nd Floor with private elevator.Over 2400 sq. ft. of A/C. Open Floor plan, soaring ceilings Affordable luxury. $274,750 Harry Rowe 941-457-0508www.PGILiving.com PGITARPON COVE Harbor Realty LARGE TOP FLOOR END UNIT, gated, very private, no condo neighbors visible, excellent private bay & sunset views, nearly new 3 BR/2 BA, plus den. Choicest 2-1/2 car garage parking (next to elevator) w/2 large storage lockers & mini space for golf cart, motorbike, etc. Loaded w/extras. Choice Placida area with new boat slip. NOW the only bay front penthouse with its own private boat dock right at your front door. Over $800K invested, REDUCED to $429K. Possible owner financing at 3-1/2%. MLS #U7516743 Call 941-769-1017. BAYFRONTPENTHOUSECONDO 2408 Starlite Lane, Port CharlotteT otally updated, Move in Ready, 3-bedroom, 2bath pool home on Lake Betty. NOT a Short Sale, just an unbeatable value! (MLS#C7025432). REDUCED: $69,900 P atty Gillespie Realtor,Bringing Buyers and Sellers Together 941-875-2755 MOVEINREADY REDUCED LOWEST PRICED direct bayfront of its kind on Floridas West Coast. Rare, extremely deep sailboat water (10+ ft) at your lot. Spectacular one-of-a-kind BIG 180-degree water views. Price JUST REDUCED to $429,900. Possible owner financing at 3-1/2%. MLS #U7516841 Call: 941-769-0200 DIRECT BAYFRONT PROPERTY Nearly 1 acre on Lemon Bay! Best direct bay front lot in Englewood zoned so it can be split into 2 single-family home sites. Includes brand new 90ft. boat dock. Possible owner financing at 3-1/2%. MLS# U7516833 NEARLY 1 ACREONLEMONBAY P P O O R R T T C C H H A A R R L L O O T T T T E E 2.5 acres, 4 miles on Kings Hwy.to Port Charlotte WalMart at I-75.Private, 3/2/CP, Fleetwood split plan, W/D, refrigerator, stove, dishwasher, 3 bay detached carport &storage building, well & septic, metal roof.$149,900For appointment please call 941-743-6601 COUNTRYLIVING ON ST.ANDREWS GOLF COURSE Why Wait? Immediate possession of custom b uilt home with spectacular view and privacy. Pristine condition inside and out,Great r oom,Heated pool Call for Private showing401-769-4073$289,000 PUNTA GORDA ISLES MAYLEASE-PURCHASE or owner finance this beautiful large, 3/2/2 Port Charlotte pool home on canal to Gulf. Completely furnished. $274,900. Agent Owned. MLS# C7012328 Call OnlyJudy Barkhurst, Sun Realty 941-286-3473www.bonitasprings-esteroflhomes.com WATERFRONTPOOLHOME IN 3 GOLF COURSE COMMUNITY AND ITS WATERFRONT, TOO! REDUCED TO ONLY $13,900. ZONED FOR 1 TO 5 UNITS. POSSIBLE OWNER FINANCING AT 3-1/2%941-769-1017. BEST LOT BUY MAYLEASE-PURCHASE or owner finance this beautiful large, 3/2/2 Port Charlotte pool home on canal to Gulf. Completely furnished. $274,900. Agent Owned. MLS# C7012328 Call OnlyJudy Barkhurst, Sun Realty 941-286-3473www.bonitasprings-esteroflhomes.com WATERFRONTPOOLHOME 1261 SF, 55+ Golf, pool, clubhouse2/2/CP. New floors & paint, immaculate! $59,900 941-637-7803 PUNTAGORDA BLUEHERONPINES North Port 3246 Mill Run Ct., TOTALLY UPDATED 3-bedroom, 2bath with 1-car garage and spacious FL room overlooking preserve area on cul de sac in Jockey Club $69,900 Patti Gillespie, RealtorBringing Buyers and Sellers Together941-875-2755 JOCKEYCLUB SHOWCASE OF FIND YOURHOM TODAY,0 )22(-V-I As www.welcome-home.comPAW-:4 'Ah.lt5ter`.?A oaf 1 )Tj 0 0.502 0 rg 1.807 0 Td ()Tj /TT0 1 Tf -0.0293 Tc 16.1951 0 0 20 569.0634 714.8381 Tm [(44q WU41 _ _.Il i airltL%4j AN 47 ts--)Tj 1 0.502 0 rg 0.848 0 Td ( 's'ue . t. i. ,,., ...rug T )57(' 9

PAGE 56

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 7 BEETLEBAILEYByMortWalker HIANDLOISByBrianandGregWalker HAGARTHEHORRIBLEByChrisBrowne THEWIZARDOFIDByBrantParkerandJohnnyHart B.C.ByMastroianni&Hart MOTHERGOOSEANDGRIMMByMikePeters PICKLESByBrianCrane MARMADUKEByBradAnderson Cryptoquip2011byKingFeaturesSyndicate Challenger Ye sterdays Challenger Answers WE NEED TO WHAT DO THIS LOOKS WATCHING7 START VISITING YOU THINK LIKE A COLLEGEDIRECTIONS: 0 ,W NICE CAMPUS. FOOTBALLFill each square with a number, one through nine. /flA)-148()155(rRSOME COLLEGES. WE'REHorizontal squares should add to totals on right. Z DOING? DOESN'T Vertical squares should add to totals on bottom. Diagonal squares through center should add to g COUNT.total in upper and lower right. 24 ll '_THERE MAY BE MORE v 5 cTHAN ONE SOLUTION. 6 18H-24Today's Challenge 5 22Time 9 Minutes37 Seconds 5 26Your Working e )17(wTime Minutes 8 30 eaow eSeconds 18 22 26 30 242011 by King Features Syndicate, Inc. World rights reserved. ON YOUR WAY TO WORK, YOU WORE IT HOMEiii1 DROP THIS OFF AT THE WHY? = AFTER HIS PARTY iK R3 2W 'tAT9-24 tilAOWTHBO FJO OGHVFOUiN lE WOR05 of )Tj -0.1602 Tc 17.2917 0 0 13 443 797.5119 Tm ('NEVR A BoR2oanlE2 nX S P W T C S B P T X T WGOTFOU T )4 A Y n 6 R E A r v x w & A I O R 1f (ER"PN/LOaPHb4.rrUDBFDCWF POXOPB, D BHVVSBODF JTU AHGBF DCFS FDOGB.Yesterday's Cryptoquip: MUSICAL GROUPWHOSE MEMBERS ARE WILD ABOUT EATING APARTICULAR NUT: THE ALMOND BROTHERSBAND. Q,5Today's Cryptoquip Clue: F equals T 9 Z crNNcNEVER TRY $ErNl7 Y. )107('A COURT J5TEK71. IN A FOOD COURT li c,.;I r ( ,)-88(.1)]TJ -0.1316 Tc 8.7368 0 0 4 276.5 511.5206 Tm (( 1_ s1 byl TCdro'S SyT(1li a1V N"h1YfOlfIH3'CSt:Id105. CDfl '/ E7_.ATTI LA, HOW DOSOU KNOW CATS HAVENINE LlVE5 ?"His game is bigger than your game."FORMGIt LARGE,;, C )-5(` iii)Tj -0.1667 Tc 13.8333 0 0 10 544.5 349.5256 Tm (';,. .WORD c t DENOMINATION "' ` )Tj -0.1125 Tc 31.125 0 0 10 559.5 340.0259 Tm (''" ,)Tj 0.0186 Tc 25.5169 0 0 20 24 326.0263 Tm (SLEUTH U.S. CURRENCYN B Y V T Q O N 1. 1 (i D Y R B 1' M BACK AMYTRING UMM,,,1 KIND OF Donl`T 071, AND I (NIt,KHAPPEt4 WHILE I STARTEV THE v NAT / f U r THE SMOKE ALARMY O CD 1 S C 0 N T I N U F, D 1, WAG CONE, EARL? MICROWAVE IT5ALL MAY NEEDAON FIRE, RIGHT, I NEW gATTERY)Tj -0.0123 Tc 9.2222 0 0 9 30 273.0279 Tm (W T S N O S L I W O R V L P L -'/ PUT 11 OUTS M K K 1 0 1 1, T F 0 D N I. ID F 1,B M Y D C W I I 1 R U S I 1 B Q O A N M A I I G B K B K I 0I M I D H M ,I B F D 0 B C B 0 -Z L E S A 11 C 0 X 0 W 0 M 0 0U S R H Q 0 N 0 0 L J H 0 0 0 THIS IS OUP NEW WHAT KIND 27 YARDSF A D C A Y W 5 V T S Q P 0 0 NYBF-.ID GAS MODEL, of MILEAGE DO P6iz I3U2leITo1J You GET ?M N L K 1 11 F E C B Z Y W I IFriday's unlisted clue: I IARVI-S"I'Lind the listed words n the diagram. They run in all directions IIC, V c okrrd, backward, up, doian and diagonally rr(( )Tj -0.017 Tc 0.9881 0 0 7 301 82.5337 Tm ()Tj -0.085 Tc 4.9405 0 0 7 303 83.0337 Tm ( fi` (-+t It 'i(J)]TJ 0.0767 Tc 6.5743 0 0 6 36 80.5338 Tm [(waSaturday's unlisted clue hint: CLEVELAND$1,000 bill $5,000 bill Hamilton Marshall 1$10,000 bill Adams Jackson McKinley$100.000 bill Chase Lincoln Wilson s 1$500 bill Discontinued Madison ag .it {`1'4rvj Jf' '\J2011 Kin, Features, Inc. 9/24 02011 John L. Hart FLP9)85(z4

PAGE 57

The Sun Classified-Section BPage 8E/N/C/VSaturday, September 24, 2011 ZITSByJerryScott&JimBorgman GARFIELDByJimDavis FRESHLYSQUEEZEDByEdStein DILBERTByScottAdams REXM O R G ANByWoodyW i lsonand G rahamNolan MARYWORTHByKarenMoyandJoeGiellaS pecific training improves sport performanceDEAR DR. DONOHUE: Last school term, before summer vacation, I asked my coach what I could do to improve the distance I throw a football. I would be rst-string quarterback if I could throw farther. He told me to lift w eights during the summer. I did all summer long. I can throw a bit farther, but not enough to get me to the rst string. Why not? B.Z. ANSWER: It s a funny thing about weightlifting. It always is a stimulus for muscle growth and muscle strength. Its not always a benet to sport performance. The reason is that muscle training to improve a specic sport task requires the athlete to mimic the actual movements and sequence of muscle contraction that takes place when doing that task. In other words, to throw a football farther, you have to imitate the throwing motion with weights. Thats not always easy. S port-specic motions are complicated and quite hard to imitate with w eights. You can, however, approximate the motions by using light w eights held in one hand. Dont go overboard with this at the start. You can hurt muscles and joints that are not used to this kind of overloading. You not only have to imitate the motion, you have to duplicate the speed of the motion, too. S pecicity of training applies to all sports. It holds for swinging a bat, hitting a tennis ball, driving a golf ball, swimming and every sport endeavor. Overall strength training is a must. But so is sportspecic training if you want to improve a particular aspect of a sport. DEAR DR. DONOHUE: I am a 49-year-old female. I weigh 250 pounds and am 5 feet 3 inches tall. I work ve days a week in health care. My doctor tells me I have arthritis in my hips, knees, feet and back. I take Aleve. I walk two miles. It takes me an hour. By then, my joint pain is 10 on a scale of 1 to 10. I am considering having lap band surgery. If I do, do you think the w eight loss will help much with my joint pain? I cannot lose weight because of my joint pain. I have tried many ways to treat it. All I ever get is short-term results. Anon. ANSWER: I can almost guarantee you that your joint pain will greatly decrease if you lose weight Weight loss is one of the things every doctor advises osteoarthritic patients to do. Providing a guarantee in medicine is close to impossible. I did put an almost in front of my guarantee. Yo ur body mass index puts you in the category of dangerous obesity. Not only will you benet your joints, youll benet your heart and all body organs. If surgery is the only way that you can take off pounds, Id seriously consider having it done. DEAR DR. DONOHUE: I work in a cubicle with a guy who says he exercises at his desk. Hes quite muscular, so I believe him. Our desks are rmly attached to a cement oor. He exercises by trying to push his desk. He says it builds muscles even though the desk doesnt budge an inch. Is this possible? R.R. ANSWER: It is The exercise is isometrics. With isometrics, muscles dont shorten or lengthen as they do in standard exercise. If yo u perform a biceps curl, for example, you hold the barbell at waist level, bend your elbows and lift the bar to your shoulders. When at that position, your biceps bulge. Theyve contracted. When you lower it, the bulge goes. The muscle has lengthened. In isometrics, muscles dont move. A near-maximal strain against an immovable object strengthens muscles. You have to vary the position of your hands if you want to get symmetrical growth and improvement in muscles through isometrics. It works, but not as well as weightlifting works. Dr. Donohue regrets that he is unable to answer individual letters, but he will incorporate them in his column whenever possible. R eaders may write him or reques t an order form of available health newsletters at P.O. Box 536475, Or lando, FL 32853-6475. R eaders may also order health newsletters from www.rbmamall.com.Dr DonohueRe aders may write Dr. D onohue at P .O. Box 536475, Or lando, FL 32853-6475 2009 Pontiac G5 btnfrbnbrbbbn12,000 MILES!ONLY End of Summer Markdowns! MUST SEE!STK#239538 8529035 ffo T"-oilt. U11tillE F Fr: 4 3i mom mow, 0 AutoJk1.TOM Am M mwmmmw

PAGE 58

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 9 BORNLOSERByArtandChipSansom BLONDIEByDeanYoungandJohnMarshall BABYBLUESByRickKirkmanandJerryScott MUTTSByPatrickMcDonnell DOONSBURYByGarryTrudeau FORBETTERORFORWORSEByLynnJohnston Ideas worth more than a buckD ear Readers: Fifty y ears of Hints From H eloise in newspapers around the world! This w eek marks the anniversary of this columns very first week of newspaper syndication by King F eatures Syndicate. My mother, the original Heloise (1919-1977), started w r iting her column in H awaii when my father (and our family) was stationed there (19581962) with the Air Force. I thought it would be fun to revisit some hints printed in that first year to see how they hold up today. The following hint is one that I just love! K eep an eye out in the coming weeks for more! Heloise (the daughter, 2011)Tw o ideasD ear Heloise: One of my favorite ideas: If two people each had a dollar and exchanged them they would still have only a dollar each. On the other hand, if they exchanged ideas, they w ould have two ideas! Doris Bond (1961)Dry towelsD ear Heloise: I use a standing tree-style coat rack in my guest bathroom for overnight guests and their towels. Long ago, I sewed loops on my towels at the middle, along their lengths, for when I use them at the gym. These loops will ensure that the towels dont hit the floor, and they will air out more quickly. Laura G., Springfield, Mo.Help!D ear Heloise: Almost all men think your column is only for women. Wake up, guys! Ive been reading the paper for many years. I am 57 years old and married. I do the shopping, cleaning, cooking, etc. Ive learned so much from your columns! Just a sample: Years ago, I had trouble opening the plastic bags in the produce section. Your column said, Lick yo ur ngers. Same can be done with trash bags. Start re ading the column, guys. You know, if you help your wives in the house, then Heloise Hints will make it a lot easier on you. Yo ur wife will be surprised at your knowledge! John S. from Florida Thanks for the endorsement, John. However, a lot of my readers are male! Lifestyle helpful hints are genderless. Heloise Hints from Heloise FINANCING AV AILABLEbtnffrfftrtffrfft rtrtttrtt ft!rbrbt!rbt "t#rt$t(941) 629-1888 We treat you like family, like it or not! btnnfrbbn2008 Dodge Ram 150042,000 MILES!Low, LowSTK#617763 Te st Drive Today! 8529036 iii MENSGIs looms,I)Tj -0.0739 Tc 14.9975 0 0 12 149.0634 1031.2195 Tm [(YQTQu1)]TJ -0.0355 Tc 9.645 0 0 12 217.5634 1031.2195 Tm [(ITfTTTR)]TJ -0.0842 Tc 19.8278 0 0 14 274.5634 1030.7195 Tm (II a 'Ive lLll t you psi f yq m) At of IDla loo

PAGE 59

The Sun Classified-Section BPage 10E/N/C/VSaturday, September 24, 2011 MALLARDFILLMOREByBruceTinsley PEANUTSByCharlesSchulz CRANKSHAFTByTomBatiuk&ChuckAyers SHOEByMacNellyProductions ARIES (March21-April19).Youwillfeelempoweredtoexperiment.Youlleatdierentfood,talk to newpeopleandreadaboutsubjectsyounever c onsideredbefore.Youlllikehowthisdevelopsyou. TA URUS (A pril20-May20).Peoplelikewhatthey canbeinvolvedin.Youmaystartoutalone,but dontnishallbyyourself,too,oryoullbesetting y ourselfupforjudgmentandpossiblyrejection. GEMINI (May21-June21).Youaredeeplyaverseto inconveniencin g others.What y oufailtounderstand isthatbeinginconveniencedcanbethemost interestingpartofapersonsday. C ANCER (J une22-July22).Yourcommitmentsare sonumerousthatifyoudontwritethemdown orputthemintoagoodsystem,youlllikelylose yourway. LEO (J uly23-Aug.22).Itishardtobeniceto someonewhenyouthinkthatpersonisbehaving likeanidiot.Buttry.Detach,stepback,andseethe dynamicfromahigherplace. VIRGO (A ug.23-Sept.22).Theworldisputobyillmannered p ushiness.Needin g r esultstocomefaster thantheyseemtowanttocomecreatesstruggle andnegativity.Gotheotherway. LIBRA (Sept.23-Oct.23).Afriendlyinvitation c omesyourway,andyouwouldbewisetoaccept it,mostlybecauseyoullhaveagoodtime.Social anticswillbeanadventure. SCORPIO (O ct .2 4-Nov.21).Everythinghappensin itsowntime.Rushingmakesitharderforyou.Dont letstressandstraincreepin.Rememberwhatyou learnedfromthefrustrationsofyourparents. SAGITTARIUS (Nov.22-Dec.21).Sitaroundatable withfriends c ollea g uesorlovedones.Relaxand unwindtogether.Talkaboutyourday.Youwill discoversomethingyoudidntknowbefore. CA PRICORN (Dec.22-Jan.19).Yourprioritieswill shiftagain,andastheydo,youllthinkabouthow we llyourcurrentlifestylereallysuitsyou.Youdont havetogureitoutinoneday.Thisprocessof evaluationwillgoonforweekstocome. AQUARIUS (J an.20-Feb.18).Friendsmaydisappointyou,soyoullhavetocutthemsomeslack. You llultimatelybebetterolettingthembe themselvesinsteadofmakingthemfeeltheyhave to p erformorwalkone gg shellsaround y ou. PISCES (Feb.19-March20).Youfeelrelaxed,and yo uc re at ear elaxedenvironmentaroundyou.You feelyoucansharehonestlywithyourlovedones withoutbeingattacked. TODAYSB IRTHDAY (Sept.24).Youllmakeyourself useful.Thishabitwillkeepyouatthecenterofthe socialswirlandinaprimeprofessionalposition. Refusingtotakethingspersonally,youllsailpast nancialandpoliticalobstacles.Decemberfeatures travelandstellarentertainment.GeminiandAries peopleadoreyou.Yourluckynumbersare:4,14, 39,11and29. HOROSCOPE BIBLE He that by usury and unjust gain increaseth his substance, he shall gather it for him that will pity the poor. Proverbs 28:8. No matter how it looks from the top, God has the nal say over the bottom line. Venice Gondolie r Sun r eaders: Look for the puzzle solution in the Our Town section. D aughters third pregnancy crosses the line for parentsDEAR ABBY: Our daughter Bree has just announced that shes pregnant with her third child. H er other children are 1 and 2. My wife and I are in our 60s and provide chi1d care three days a week, while the other grandma baby-sits for two days. We also pay for preschool and swimming lessons, as well as cook dinner for them on the days when we baby-sit. Br ee and her husband do not earn enough money to support even one child. W e know well be expected to nance college for the children. When we agreed to help out, we asked them to promise they would not have more than two kids. This third one will cause us to use up our savings, increase our child care r esponsibilities and take us into our 80s to continue helping. Is it wrong to feel used? I am very depressed ov er this. OVERW HELMED IN SAN DIEGO DEAR OVERW HELMED: Y our depression is understandable. If you dont draw the line now by telling your daughter you cant handle baby-sitting three small children and this wasnt part of the bargain, she may hand you a fourth or fth to take care of. Y ou should not sacrice y our retirement savings in order to nance your grandchildrens education. There are other options than your paying for it. The r esponsibilities you have assumed were not yours in the rst place. If you dont insist your daughter and son-in-law stand on their o wn two feet, you will wind up old, broke, and living on S ocial Security with nothing to supplement it because y our savings will be gone. DEAR ABBY: My a nce, J ohnny, and I have been together for four years and engaged for 16 months. O ur wedding is in a few months. Until recently, J ohnny didnt have access to a car. That means for the past four years I have done all the driving, including visiting him at school two hours from my home every three to four weeks. It didnt bother me because it was out of Johnnys control; his money went to pay for his education. Howe ve r, because he has a car now, I feel its reasonable to ask that he do most though not all of the driving. We live in the same town now and our homes are a mile apart. Jo hnny seems to take offense at the suggestion and acts as if I am punishing him. Im not, but Im tired of driving all the time and would like a break now that he can give me one. What do you think? AT THE WHEEL AGAINST MY WILL DEAR AT THE WHEEL: Jo hnny has grown accustomed to, and spoiled by, the chauffeur service you have provided. That he should assume responsibility for his share of the driving now that he has a car of his own is not an onerous request. Although you have been together four years, the two of you need to have a talk and work this out. And because you have been apart for the years he has been in school, I also recommend that you schedule premarital counseling before the w edding in case there are any other differences of opinion that need to be worked out. Dear Ab by is wr itten by Abig ail Van Buren, also known as Jeanne Phillips, and was founded by her mother, Pauline Phillips. Writ e Dear Abby at www. DearAb by .com or P.O. Box 69440, Los Angeles, CA 90069. For ev erything you need to know about wedding planning, order How to Have a Lovely Wedding. Send a business-sized, selfaddressed envelope, plus check or money order for $6 (U.S. funds only) to: Dear Abby We dding Booklet, P. O. Bo x 447, Mount Morris, IL 610540447. (Postage is included in the price.) Dear Abby wt CNly-A y W 'Ckt 4 KstGNER a '''5tGt1)115(R )Tj 0 0.502 0 rg 0.554 0 Td (,,CARICAKEOKAY, u,IHATs HE GOING TO TRY? I TOLD HIM THAT WHEN THE PACE HE 5 THE k;ND (OHO WILLWriYDoNTw 1 AJIL 0 = LIFE6ET5TOBET00,41Ua1HE REALL.'' HEAR IT!TR 1 j T ? SHOULD R XT AND JUST LIE ANDUSTE N TO T)58(kE ERASS 6R0O...1 yC21ISLILLIAN z.1 WAh1TQ00 TD co -FA LKIN670 TAL-KNGTOA SPECIAL FAVO(L 0eP'-%LF NOT HERSELF GYDULDFOR mE, LIL, XRCTL)76(,., 1 BETTER.cl niC.r r.jl A1 -tSKYLER, I ASKED YOU TO GET AND YOU ONLY GAVE ME YOU NEVER SAID HOW MUCHME GNANGE FOR A TWENTY... 6ACK SEVEN DOLLARS i GHANGE YOU WANTED.IN QUARTERS! oJANRIC CLASSIC SUDOKUFill in the blank cells using numbers 1 to 9. Each number can appear only once in each row,column and 3x3 block. Use logic and process of elimination to solve the puzzle. The difficultylevel ranges from Bronze (easiest) to Silver to Gold (hardest).2 6 5 Rating: GOLD5 7 3 Solution to 9/23/116 3 4 E 5 7 8 4 913 1 2 63 6 2 8 711 4 9 52 5 11 9 4 6 2 5 8 7 31 4 2 8 2 9 7 514 3 6 18 5 4 4 5 1 9 3 6 2 8 77 3 6 2 118 9 5 4a9 4 3 w 6 8 7 3 412 5 1 94 5 7 2 1 3 5 6 9 7 4 89 4 511 817 6 3 L 2JN2 8 6-4141 1

PAGE 60

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 11 S aturday TelevisionVEN-VENICE E-N-ENGLEWOOD SAR-SARASOTA PC-PORT CHARLOTTE ARC-ARCADIA SPG-SOUTH PUNTA GORDASEP. 24PRIME TIME VEN E-N SAR PC ARC SPG FIOS 6 PM6:307 PM7:308 PM8:309 PM9:3010 PM10:3011 PM11:30 BROADCASTABC 7771077College Football(Live) (HD)FootballPost Game(HD)ABC7 Weekend Edition(N)Jeopardy!(R) (HD)(:06)CollegeFootball: LouisianaStateTigersatWestVirginiaMountaineersfromMountaineer Field(Live) (HD)ABC7News at11(N) ABC 7117College Football(Live) (HD)FootballPost Game(HD)TheInsider(HD)ABC7News @7 :30pm(N)(:06)CollegeFootball: LouisianaStateTigersatWestVirginiaMountaineersfromMountaineer Field(Live) (HD)ABC7News @11: 00pm(N) CBS 213213555(3:30)College Football: Arkansasvs Alabama(Live) (HD)WINKNews at7(N)InsideEdition Alternative news. PersonofInterest: PilotYoung prosecutorinmidstofacrime.(R) (HD)Unforgettable: PilotWoman solvesmurderswithmemory.(R) (HD)48HoursMystery: Arturo GattisLastFightMysterious death.(N)Newsat 11pm(N)(HD) (:35)Criminal Minds: Paradise CBS 10101010(3:30)College Football: Arkansasvs Alabama(Live) (HD)10News The latestnews.(N)TheYoung Icons PersonofInterest: PilotYoung prosecutorinmidstofacrime.(R) (HD)Unforgettable: PilotWoman solvesmurderswithmemory.(R) (HD)48HoursMystery: Arturo GattisLastFightMysterious death.(N)10News, 11pm(N) (:35)Paid Program Sponsored. NBC 232232222NBC2News @ 6pm(N)(HD)NBCNightly News Weekend Wheel: Give MeaBreak!(R)Jeopardy!(R) (HD)HarrysLaw: Hosanna RoseannaDARoseanna Remmick.(R) (HD)PrimeSuspect: Episode1 Janefindsauniqueangleona case.(R)Law&Order:SpecialVictims Unit: ScorchedEarthHotel maid.(R)NBC2News @11pm(N) (HD) (:29)Saturday NightLive(N) NBC 888888NewsChannel 8at6:00(N)NBCNightly News Weekend EntertainmentTonight Celebritygossipandshow business. HarrysLaw: Hosanna RoseannaDARoseanna Remmick.(R) (HD)PrimeSuspect: Episode1 Janefindsauniqueangleona case.(R)Law&Order:SpecialVictims Unit: ScorchedEarthHotel maid.(R)NewsChannel 8at11:00(N) (:29)Saturday NightLive(N) FOX 222222444MLBBaseball: BostonRed SoxatNewYorkYankees(Live) (HD)TheCloser: InCustodyPopes chancetobecome commissioner.(HD)Cops Hitman case.(N)(HD)Cops Inhouse withgun.(R)American Dad! Redecorating. Cleveland Show: Beer Walk! FOX4NewsatTen Local newsreportandweather update.(N)HellsKitchen: 18Chefs CompeteSignaturedishes.(R) (HD) FOX 131313131313MLBBaseball: BostonRed SoxatNewYorkYankees(Live) (HD)FOX13NewsSaturday News eventsofthedayarereported(N)(HD)Cops Hitman case.(N)(HD)Cops Inhouse withgun.(R)American Dad! Redecorating. Cleveland Show: Beer Walk! FOX1310:00News The topnewsstoriesare updated.(N)(HD)HellsKitchen: 18Chefs CompeteSignaturedishes.(R) (HD) PBS 333(5:30)Mexico: TheRoyal Tour StoriesTheLawrenceWelkShow Musicofbigbands. AntiquesRoadshow: Jackpot! Astonishingdealsandvaluable finds. AsTimeGoes By: TheAffair Appearances Indoor barbecue. TheOldGuys Triviacontest. AreYou Being Served? GlobeTrekker: DeepSouth U.S.AFreedomWalk;Elvis. WEDU 3333MyMusic: MagicMoments: TheBestofsPops musicreunion. TheLawrenceWelkShow Musicofbigbands. AreYou Being Served? Appearances The christening. AsTime Lionel plansatrip. AsTimeGoes By: Pardon? OldGuys Former boyfriend. WorstWeek: Monday GlobeTrekker: Peruand AmazonFestival;monkey.(N) CW 11216Thats Show Blonde Donna. Thats Show Hydes father. Two1/2 Late fathersplea.(HD)Two1/2 Custodyofdog.(HD)BrothersandSisters: Bad NewsSarahstruggleswith Joesinfidelity. TheBigBang Theory(HD)TheBigBang Theory(HD)WINKNews@10pm(N)(HD)HowIMet Barneysnude.(HD)New Adventures Christine(HD) CW 9994Kingof Queens: DougieNights TilDeath: Dream Getaway Two1/2 Late fathersplea.(HD)Two1/2 Custodyofdog.(HD)CriminalMinds: ExitWounds GarciahelpsincaseofAlaska murders. ColdCase: FactoryGirlsThe 1946deathofafactoryworker.(HD)Numb3rs: BrutusArevenge plotdiscoveredagainstgovt.(HD)TheUnit: InquisitionA terroristexposeshis accomplices.(HD) MYN 11111114Hollyscoop Hollywood gossip. PaidProgram Sponsored. RingofHonorWrestling(N) (HD)Thats Show Blonde Donna. Thats Show Hydes father. Futurama Cryogenic sleep. Futurama First spacetrip. RingofHonorWrestling(R) (HD)Bones: ThePerfectPiecesin thePurplePondHeadless writer.(TVPG) MYN 898AccessHollywood(N)(HD)Seinfeld Apartment robbed. Seinfeld Insidestock tip. WelcometoMooseport (,Comedy) Ray Romano.HeatedmayoralraceensuesbetweenformerUS presidentandstoreowner.(PG-13)FamilyGuy Brianthecop. ItsAlways Sunny Four friends. Futurama Futurehijinx. Futurama Futurehijinx. IND 12124123812FamilyGuy Brianthecop. FamilyGuy Braintriesto act. TheBigBang Theory(HD)TheBigBang Theory(HD)House: FoolsforLoveHusband andwifesharesymptoms.(HD)House: QueSeraSeraTeam treatsseverelyobeseman.(HD)RushHour2 (,Action) JackieChan,Chris Tucker.DetectivesLeeandCarterinvestigateaconspiracy involvingaChinesekingpin.(PG-13) ION 22226 1817Monk: Mr.MonkMakesa FriendShadyfriend. Monk: Mr.MonkIsatYour ServiceMonktheButler. Monk: Mr.MonkIsontheAir MonkconvincedDJmurdered wife. Monk: Mr.MonkVisitsaFarm Dishermovestofarmafter uncledies. psych: ShawnTakesaShot intheDarkPlansgoawry. psych: YouCantHandle ThisEpisodePrivates suicide. CABLEA&E262626263950181StorageStorageStorageStorageStorageStorageStorageStorageStorageStorageStorageStorage AMC565656563053231(5:30)TheExorcismofEmilyRose (,Horror) A priesttriestoaidayoungwoman.(PG-13)TheOthers (,Drama) NicoleKidman.Awomanandhertwo photosensitivechildrenbelievetheirhomeishaunted. TheOthers (,Drama) Af amily fearstheirhouseishaunted.(HD) APL444444443668130BadDog! Deliverydog. BadDog!: Houdinis(R)TooCute!Puppies(R)BadDog Crooningdog. BadDog! Fastturtle. BadDog Crooningdog. BET353535354022270ParkersParkersParkersB.A.P.S. ()Awomanposesasrichmansheir. HarlemNights ()Harlemclubownersoutfoxagangster.(R) BRAVO6868686851185Housewives(R)Housewives(R)Housewives(R)TheBourneSupremacy ()Bourneisframedformurder. BourneS. COM666666661527190(5:30)BlueCollarComedyTour:OnefortheRoad (, Comedy)ABlueCollarcomedyconcert. JeffDunhamsChristmas Ventriloquist.(R)JeffDunham:Arguingwith Myself(TV14)(R)TheComedyCentralRoastofCharlie Sheen JokesaboutSheen.(R) (:37)Workaholic(R) DISC404040402543120Chopper Contestends. Chopper(R) (HD)Chopper(R) (HD)Chopper: Downsizing Chopper(R) (HD)Chopper: Downsizing E!464646462726196(4:00)Titanic () Loveanddisaster.(PG-13)MeanGirls2 Teenstakeonsocialhierarchy. E!Story(R)Soup(R)C.Lately FAM555555551046199Bolt ()Adogundertakesahazardousjourney. FindingNemo ()Afishsearchestheoceanforhisson.(G)HomeAlone2:LostinNewYork FOOD37373737-76164Challenge(R)Chopped(R)Chopped: MyWay(R)Chopped(R)Chopped(R)IronChef(R) FX51515151584953(5:00)TheIncredibleHulk (,Thriller)EdwardNorton,Liv Tyler.TheHulkbattlesanewmonster.College Football: Missouri Tigers at Oklahoma Sooners from Gaylord Family-Oklahoma Memorial Stadium(Live)League(R) (HD) GSN17917917917934179184NoDealLingo(R)Lingo(R)Chain Fam.FeudFam.FeudFam.FeudFam.FeudMil.P asswordHighStakesPoker(R) HALL5551773 240GoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirlGoldGirl HGTV414141415342165GreatRoom HuntersOurMagazine(N)HGTVdHighLowSecretsNovogratzDinas(N)Donna(N)OurMagazine(R) HIST818181813365128DeadlyRoad: ThinAir DeadlyRoad: CutOff! DeadlyRoad(R) (HD)DeadlyRoad(R) (HD)DeadlyRoad(R) (HD)IceRoad(TV14)(R) LIFE363636365241140TheNannyDiaries () Mom,DadandHer ()Teen&stepmom.(NR)AW alktoRemember () Disdaintolove. TheNannyDiaries () NICK252525252444252iCarly(R)iCarly(R)iCarly(R)PlayDayiCarly(N)BigTimeSupah(N)iCarly(R)FriendsFriendsFriendsFriends OWN5858585847103161Half-TonTeen(HD)Half-TonMom(R) (HD)Dr.Phil(HD)Dr.Phil(HD)Confronting...(N)(HD)Dr.Phil(HD) QVCJoanRiversClassicsAnIntimateAffairB.MakowskyClarksFootwearSpanxSlimmingB.Makowsky SPIKE57575757296354UFC135 UFCUnleashed(R)UFC135Prelims(Live)CrocodileDundee AnAustralianbushtrackerinNewYork. DundeeII SYFY6767676764180(5:00)Roadkill () JeepersCreepersII () Feedingtimeagain. Morlocks Futuristichumanoidswreakhavoc. TheLostTribe ()(R) TBS59595959326252BigBangBigBangBigBangBigBangObserveandReport (,Drama) ObserveandReport (,Drama) HaroldandKumar () TCM65656565169230(5:30)TheSpiritofSt.Louis ()JamesStewart,Patricia Smith.AviatortriestocrosstheAtlantic. LoveMeTonight ()AFrenchtailortriestocollectthe moneythatawealthyclientoweshim. Hallelujah,ImaBum (,Musical) Vagrantfallsformayorsgirlfriend. Hollywood Party TLC45454545577213948Hrs. Webofvices. 48Hrs.(HD)20/20TLC(N)(HD)20/20TLC(N)(HD)Prison Romanticrival. 20/20TLC(R) (HD) TNT61616161285551TheFastandtheFurious:TokyoDrift (,Action) Youngmaninvolvedindangerousracing. TheFastandtheFurious (,Thriller) Paul Walker,VinDiesel.Streetgangsracefastcars. 2F ast2Furious ()Anundercovercopandanex-con takeonamoneylaunderingoperation. TOON124801241244620257AdventureAdventureSpyKids3-D:GameOver ()Gametrapsgirl. OblongsKingKingFamilyBoondcksBoondcks TRAV6969696966170FoodParad(R)FoodParad(R)Ghost(R)Ghost Formerhotel.(R)Ghost HospitalinL.A. Ghost(R) TRUTV636363635030183MostShock(R)Top20(R)Top20(R)Dumbest(R)Dumbest(R)ForensicForensic TVL626262623154244(:19)S anford SanfordAllFam.AllFam.AllFam.RaymondRaymondRaymondRaymondRaymondRaymond USA34343434225250SVU Murderedteens. SVU Illkidnapvictim. SVU Repeatrapist. SVU Terrorthreat.(HD)SVU Blackmail.(TV14)SVU AIDSpatients. WE117117117117117149GhostWhisperer(HD)GhostWhisperer(HD)GhostWhisperer(HD)Whisperer: DeadAir GhostWhisperer(HD)GhostWhisperer(HD) WGN1616161641119Order:CI: TruLove Bones Wiccaremains. HomeVideos(TVPG)HomeVideos(TVPG)WGNNewsatNine(N)30RockScrubs NEWSCNBC3939383837102PaidProg.PaidProg. Money(R)Greed(R)DebtSuzeOrman(N)Princess: Julie(N)Greed(R) CNN323232321838100SituationRoom(N)CNNNewsroom(N)Restoringthe(R)PiersTonight(R) (HD)CNNNewsroom(N)Restoringthe(R) CSPAN181818183712109PresidentCommuni.America&theCourtsAmericanPerspectives Politicalandculturalissuesdiscussed.(N)AmericanPerspectives FNC646464644871118AmericasHQ(N)FOXReportSaturdayHuckabee(N)Justice(N)GeraldoatLarge(N)FoxNewsReport(N) MSNBC8383838340103Lockup(R) (HD)Lockup Inmatesspeak. Lockup(R) (HD)Lockup Ac ouplesplits. Lockup Revengeinjail. Lockup(R) (HD) SPORTSCSS282828284970(4:30)CollegeFootball(Live)CollegeFootball: GeorgiaStatePanthersatHoustonCougars(Live)WrapUp ESPN29292929125870Coll.FtblScoreboardCollegeFootball: FloridaGatorsatKentuckyWildcats(Live) (HD)CollegeFootball: USCvsArizonaState(Live) ESPN23030303065974Coll.FtblScoreboardCollegeFootball: VanderbiltvsSouthCarolina(Live) (HD)CollegeFootball: OregonvsArizona(Live) (HD) FSN727272725677CollegeFootball(Live)MLBBaseball: FloridaMarlinsatMilwaukeeBrewers(Live) (HD)MarlinsMarlinsWrldPoker(Replay) GOLF494949495560304GolfCentral(HD)LPGATournament: SolheimCup:DayTwo(Replay)PGATournament(Replay) (HD) SPEED48484848426983(5:30)BarrettJacksonAuction: LasVegas(N)SPEEDNASCAR SUN3838401401455776CollegeFootball(Live)CollegeFootball: FloridaAtlanticOwlsatAuburnTigers(Live)FootballSaturdaysFightSports VS71717171546190CollegeFootball: TeamsTBA(Live)CollegeFootball: NebraskaCornhuskersatWyomingCowboys(Live)NFLTurningPoint PREMIUMDISN1361361361369945250SoRandom!(R)ShakeItUp! Fearoffiring.(R)GoodLuck Termite costume. Wizards Asteroid mission.(R)WaverlyPlace Beingawizard. A.N.T.Farm Webathon money. PrankStars Pirate restaurant. GoodLuck Charlie: Ditch Day A.N.T.Farm: BadRomANTs SoRandom!(R)GoodLuck Termite costume. Wizards Asteroid mission.(R) ENC150150150150150350Tightrope (,Drama) ClintEastwood,Genevive Bujold.Acopseessimilaritiesbetweenhimselfandthe murdererheisstalking.(R)HeartbreakRidge (,Drama) ClintEastwood, MarshaMason.AhardboiledMarinesergeantpreparesa platoonofgreenrecruitsforcombat.(:15)AbsolutePower (,Thriller) ClintEastwood, GeneHackman.Athiefbecomesentangledinpoliticalintrigue afterwitnessingamurder. HBO30230230230217302400(:15)LotteryTicket (,Comedy)BowWow,BrandonT. Jackson.Ayoungmanfromtheprojectswins$370million dollarsinthenationallottery. LittleFockers (,Comedy)Aman focusesonbeingagoodfatherwhiletrying toimpresshisfather-in-law.(:45)WorldChampionshipBoxing: MayweathervsOrtiz(Taped) (HD)LittleFockers (,Comedy) Mantriestoimpresshis father-in-law. HBO2303303303303303402(5:30)Conviction (,Drama) A brothersfalse conviction.(R) (HD) (:15)Unstoppable (,Action) DenzelWashington, ChrisPine.Anexpertengineerandanoviceconductorraceto stoparunawaytoxictrain. Hung Mike accusesRay.(HD)Hung Ray mightquit.(HD)BoardwalkEmpire: A Return toNormalcyThe1920 elections.(HD)Treme: EverythingIDoGonh BeFunkyTonitakesacase.(HD) HBO3304304304304304404Devil () Trapped strangers. PublicEnemies () In1930sChicago,aspecialagentis commissionedbythedirectoroftheFBItoapprehendtheelusiveand notoriousbankrobberJohnDillingerandhisgang. OurFamilyWedding () Aw edding threatenstobesabotagedbyafeud betweenthecouplesfathers. Boardwalk Fashion; costumes. SomethingsGottaGive () Bachelorfondof girlfriendsmother. MAX32032032032063320420(4:30)Inception (,Drama) Enteringdreams andstealingideas. Terminator3:RiseoftheMachines (,Science Fiction) Ac yborgfromthefutureissenttobackto savethehumanrace.(R) (HD)StrikeBack Lookingfor Clare;huntedbyJanjaweed.(R) (HD)HatchetII (,Horror) A woman returnswithanarmytokillthemurderer whonearlyendedherlife.(R)StrikeBack Lookingfor Clare. MAX2321321321321321422(5:00)IndecentProposal (, Drama)Acouplefacesa difficultchoice. ScottPilgrimvs.TheWorld (,Comedy) MichaelCera.InToronto,anerdybassguitaristisforcedto battleagirlssevenevilexes.(PG-13)MySoultoTake (,Horror) Murderervowstokillkidsbornonnighthe died,&terrorstrikesyearslater.(:50)DueDate (,Comedy) An expectantfatherandanaspiringactorembark uponaroadtrip.(R) (HD) SHO34034034034019340365(5:40)TheHurtLocker (,War) JeremyRenner, AnthonyMackie.AnArmybombsquadinIraqtriestosurvive ar ecklessnewteamleader. Push (,Thriller) ChrisEvans,DjimonHounsou. Peoplewithspecialpowersteamuptodefeatasecret governmentorganization.(PG-13)NextDayAir (,Comedy)Acourier mistakenlydeliversaboxcontaining cocainetotheincorrecthouse.(R)PattonOswalt FinestHour(R) TMC35035035035020350385(:15)InglouriousBasterds (,War) BradPitt,MlanieLaurent.InWWII,aspecial unitcomposedofJewish-AmericansoldiersviolentlyattacksandkillsmembersoftheThird Reichtoinstillfearintheirregime.(R)Altitude (,Horror) A small twin-engineplanecarryingfiveteensbegins toclimbuncontrollably.(R) (HD) (:35)BuriedAlive (,Horror)Aranchs caretakerliberatestheangryspiritofawitch whowasburiedalive. 6 PM6:307 PM7:308 PM8:309 PM9:3010 PM10:3011 PM11:30 KIDS NEWS SPORTS SPECIALS MOVIES7:30 a.m. ESPN2 English Premier League Soccer Everton at Manchester City. (L) 10 a.m. SPEED Formula One Qualifying Singapore Grand Prix from Streets of Singapore. (L) 11:30 a.m. SPEED NASCAR Sprint Cup Practice Sylvania 300 Final from New Hampshire Motor Speedway. (L) 12 p.m. ABC College Football Notre Dame Fighting Irish at Pittsburgh Panthers. (L) ESPN College Football North Carolina Tar Heels at Georgia Tech Yellow Jackets. (L) ESPN2 College Football Eastern Michigan Eagles at Penn State Nittany Lions. (L) FSN College Football Southern Methodist Mustangs at Memphis Tigers. (L) MYN College Football Georgia Bulldogs at Mississippi Rebels. (L) 12:30 p.m. CW College Football (L) 1 p.m. CSS College Football Presbyterian Blue Hose at Furman Paladins. (L) GOLF PGA Tournament The TOUR Championship: Third Round from East Lake Golf Club in Atlanta. (L) SPEED NASCAR Whelen Modied Series New Hampshire 100 from New Hampshire International Speedway. (T) WGN MLB Baseball Chicago Cubs at St. Louis Cardinals. (L) 2 p.m. GOLF European Golf Tour Austrian GolfOpen: Third Round from Diamond Country Club in Atzenbrugg, Austria. (T) NBC PGA Tournament The TOUR Championship: Third Round from East Lake Golf Club in Atlanta. (L) 3 p.m. SPEED NASCAR Camping World Truck Series F.W. Webb 175 from New Hampshire Motor Speedway. (L) 3:30 p.m. ABC College Football Oklahoma State Cowboys at Texas A&M Aggies. (L) CBS College Football Arkansas Razorbacks at Alabama Crimson Tide. (L) ESPN College Football Florida State at Clemson. (L) ESPN2 College Football Regional Coverage. (L) FSN College Football California Golden Bears at Washington Huskies. (L) SUN College Football Southern Mississippi at Virginia. (L) 4 p.m. FOX MLB Baseball Boston Red Sox at New York Yankees. (L) 4:30 p.m. CSS College Football Middle Tennessee State Blue Raiders at Troy Trojans. (L) 7 p.m. ESPN College Football Florida at Kentucky. (L) ESPN2 College Football Vanderbilt at South Carolina. (L) FSN MLB Baseball Florida Marlins at Milwaukee Brewers. (L) GOLF LPGA Tournament Solheim Cup: Day Two from Killeen Castle in Co. Meath, Ireland. (R) SUN College Football Florida Atlantic at Auburn. (L) 8 p.m. CSS College Football Georgia State at Houston. (L) SPIKE UFC 135 Prelims (L) 8:06 p.m. ABC College Football Louisiana State Tigers at West Vir ginia Mountaineers. (L) 9:45 p.m. HBO World Championship Boxing Mayweather vs Ortiz. (T) 10:15 p.m. ESPN College Football USC at Arizona State. (L) ESPN2 College Football Oregon at Arizona. (L) 5 a.m. GOLF LPGA Tournament Solheim Cup: Final Day from Killeen Castle in Co. Todays Live Sports Convenient Complete SatelliteONLINE TV Listingswww.sun-herald.com/tv CIE9EcluL6]

PAGE 61

The Sun Classified-Section BPage 12E/N/C/VSaturday, September 24, 2011 V enice Gondolier Sun re aders: Look for the puzzle solution in the Our Town section. Regal Town Center 16941 1441 Tamiami TrailAbduction (PG-13, 106 min.) 12:25 pm, 1:00 pm, 3:30 pm, 4:30 pm, 7:05 pm, 7:35 pm, 9:40 pm, 10:15 pm Colombiana (PG-13, 107 min.) 4:00 pm, 9:30 pm Contagion (PG-13, 105 min.) 1:25 pm, 4:40 pm, 7:15 pm, 9:50 pm The Debt (R, 113 min.) 1:20 pm, 6:50 pm Dolphin Tale (PG, 112 min.) 12:40 pm, 3:25 pm, 7:20 pm Dolphin Tale 3D (PG, 112 min.) 1:10 pm, 3:55 pm, 7:50 pm, 10:30 pm Drive (R, 100 min.) 1:05 pm, 4:15 pm, 7:25 pm, 9:45 pm The Help (PG-13, 137 min.) 12:15 pm, 3:35 pm, 6:45 pm, 10:20 pm I Dont Know How She Does It (PG-13, 95 min.) 12:35 pm, 2:50 pm, 5:05 pm, 8:00 pm, 10:15 pm Killer Elite (R, 100 min.) 12:45 pm, 1:15 pm, 4:05 pm, 4:35 pm, 7:10 pm, 7:40 pm, 9:55 pm, 10:25 pm TheLionKing 3D (G, 89 min.) 12:30 pm, 2:55 pm, 5:10 pm, 7:45 pm, 10:10 pm Moneyball (PG-13, 126 min.) 12:20 pm, 12:50 pm, 3:50 pm, 4:20 pm, 7:00 pm, 7:30 pm, 10:05 pm, 10:35 pm Shark Night 3D (PG-13, 95 min.) 9:35 pm The Smurfs (PG, 102 min.) 12:55 pm, 3:45 pm, 6:55 pm Straw Dogs (R, 105 min.) 1:30 pm, 4:50 pm, 7:55 pm, 10:30 pm Wa rrior (PG-13, 139 min.) 10:00 pmFrank Theatres Galleria Stadium 12941 2111 Tamiami TrailAbduction (PG-13, 106 min.) 1:10 pm, 4:30 pm, 7:10 pm, 9:30 pm Contagion (PG-13, 105 min.) 1:25 pm, 4:40 pm, 7:25 pm, 9:40 pm Dolphin Tale (PG, 112 min.) 4:35 pm, 10:15 pm Dolphin Tale 3D (PG, 112 min.) 1:35 pm, 7:35 pm Drive (R, 100 min.) 1:50 pm, 4:50 pm, 7:50 pm, 10:10 pm The Help (PG-13, 137 min.) 1:05 pm, 4:05 pm, 7:05 pm, 10:05 pm I Dont Know How She Does It (PG-13, 95 min.) 1:20 pm, 4:45 pm, 7:20 pm, 9:45 pm Killer Elite (R, 100 min.) 1:30 pm, 4:00 pm, 7:30 pm, 10:00 pm The Lion King 3D (G, 89 min.) 1:00 pm, 4:20 pm, 7:00 pm, 9:20 pm Moneyball (PG-13, 126 min.) 1:15 pm, 4:15 pm, 7:15 pm, 10:15 pm Shark Night 3D (PG-13, 95 min.) 9:35 pm Straw Dogs (R, 105 min.) 1:05 pm, 7:05 pm Wa rrior (PG-13, 139 min.) 4:05 pmAMC Merchants Crossing 16888AMCFUN US 41 and Pine Island Rd.Abduction (PG-13, 106 min.) 11:30 am, 2:00 pm, 4:45 pm, 7:20 pm, 10:05 pm Apollo 18 (PG-13, 86 min.) 10:45 am, 3:30 pm, 8:05 pm Colombiana (PG-13, 107 min.) 11:50 am, 2:40 pm, 5:10 pm, 7:40 pm, 10:10 pm Contagion (PG-13, 105 min.) 11:00 am, 1:30 pm, 4:05 pm, 6:35 pm, 9:05 pm The Debt (R, 113 min.) 11:35 am, 2:05 pm, 4:40 pm, 7:10 pm, 9:50 pm Dolphin Tale (PG, 112 min.) 4:20 pm, 9:45 pm Dolphin Tale 3D (PG, 112 min.) 10:00 am, 1:50 pm, 6:55 pm Dont Be Afraid of the Dark (R, 100 min.) 2:10 pm, 7:25 pm Drive (R, 100 min.) 10:30 am, 12:55 pm, 3:15 pm, 5:35 pm, 8:05 pm, 10:30 pm The Help (PG-13, 137 min.) 10:55 am, 2:20 pm, 5:55 pm, 9:10 pm I Dont Know How She Does It (PG-13, 95 min.) 10:40 am, 1:00 pm, 3:10 pm, 5:20 pm, 7:30 pm, 9:55 pm Kevin Hart: Laugh At My Pain (R, 88 min.) 1:05 pm, 5:40 pm, 10:20 pm Killer Elite (R, 100 min.) 11:45 am, 2:25 pm, 5:00 pm, 7:50 pm, 10:25 pm The Lion King 3D (G, 89 min.) 10:35 am, 3:00 pm, 5:05 pm, 7:15 pm, 9:30 pm The Lion King (G, 87 min.) 12:45 pm Moneyball (PG-13, 126 min.) 10:50 am, 1:45 pm, 4:35 pm, 7:35 pm, 10:30 pm Rise of the Planet of the Apes (PG-13, 104 min.) 11:40 am, 4:55 pm, 10:15 pm Shark Night 3D (PG-13, 95 min.) 7:55 pm, 10:05 pm The Smurfs (PG, 102 min.) 11:10 am, 1:35 pm, 4:10 pm, 6:40 pm, 9:20 pm Spy Kids: All the Time in the W orld 3D (PG, 89 min.) 11:05 am, 1:15 pm, 3:25 pm, 5:40 pm Straw Dogs (R, 105 min.) 11:20 am, 1:55 pm, 4:30 pm, 7:00 pm, 9:35 pm MOVIE LISTINGS HOMES FOR SALE1020 SELLING YOUR LOT, HOME OR CONDO??Call the Sun at 866-463-1638 and ask about our BRAND NEW Buy 2 Months Get One FREE! Real Estate Ad Program. Y our ad will run everyday in the newspaper & run online for 90 days! All for a ONE TIME low price. Offer good through Sept. 30, 2011. Call for details. Realtors Welcome! ADVERTISEWITHTHE SUNCLASSIFIEDS HOMES FOR SALE1020 ENGLEWOOD AREA 11869 Oceanspray Blvd. Newer 3/2/2, Canal lot. $147k 21 Clubhouse Place 3/2.5/ 3 + Den, office & Pool. $278k Call Terry Long Always Lon g on Service @ Keller William s 941-830-2347 to find ou t what your home is worth. Classified = Sales HomeVestors Global Property Resource Services We Buy The Good, The Bad and The Ugly 866-250-9457 HOMES FOR SALE1020 ENGLEWOOD AREA 129 Mariner Ln. Updated 3/2/2 Pool. $169K 1149 Brown St Updated WATERFRONT $125 Call Terry Long Always Lon g on Service! @ Keller William s 941-830-2347 to find ou t what your home is worth. CLASSIFIED ADSSELL NORTH PORT 2/1 $43,000 1152 Sq ft New carpet/paint/ a/c & Fence Realty Executives Mainstream 941-979-8915 HOMES FOR SALE1020 ENGLEWOODon Red Fish Cove 4/2.5 split; dock w/lift; breathtaking water views Call Stephen at Signature Sothebys 941-809-7580 GET RESULTS USE CLASSIFIED! PORTCHARLOTTE: UNFINISHED HOME!! Concrete Shell Only, Sec. 15. 23156 Lark Ave. $49,900. obo 941-628-2883 HOMES FOR SALE1020 ENGLEWOOD SPECTACULAR CUSTOM HTD POOL HM. 4BR/3BA/2Cg 3258 SQ.FT. ON 4 L O T S IN SARASOTA CO. O nly $389,900 941-474-4279 ADVERTISEWITHTHE SUNCLASSIFIEDS PORT CHARLOTTE $2,000 down, $530 PITI, buys beautiful 3/2/1 at 21680 EdgewaterDr. Open Sun. 2-5 Call Jim 941-896-7435 Agent HOMES FOR SALE1020 ENGL/ROTONDABrand new2011 Coastal Cottage,Upgrades throughout Energy Star Certified$199,400. 941-725-1355 BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! PORT CHARLOTTE 3BR/ 3BA, all rooms large, bedrm suite is rented, fenced yard, 10x20 shed, 2 screened porches. 941-743-0813 _14GOREN BRIDGEWITH TANNAH HIRSCH0;2011 Tribune Media Services, Inc.WEEKLY BRIDGE QUIZQ 1 Neither vulnerable, as South The bidding has proceeded:you hold: SOUTH WEST NORTH EAST1 Pass lot Pass6K9`)70(O AQ85,:KQ 10746KJ6 ')Tj 0.0611 Tc 9.2486 0 0 10 202 765.5129 Tm (What do you hid now?Partner opens the bidding with threehearts. What do you respond? Q 5 Neither vulnerable, as Southyou hold:Q 2 Neither vulnerable, as Southyou hold: 4109540A8 10246A8762*Q8 `J82 1 K J 9 8 6 46 A K 7 Partner opens the bidding with onediamond. What do you respond?The bidding has proceeded:SOUTH WEST NORTH EAST Q 6 Both vulnerable, as South you1 Pass 26 Pass hold:9What do you hid now'? 6K 10932 -'J100 A446AK107Q 3 Neither vulnerable, as South The bidding has proceeded:you hold: SOUTH WEST NORTH EAST1* Pass 2C Pass6108`:?AQJ7652 ;>Void44KJ93 ?What do you bid now?The bidding has proceeded:SOUTH EST NORTH EAST Look for answers on Monday.1(1, Pass 16 Pass200% Pass 3C? Pass? (Tannah Hirsch welcomes readers'What do you hid now? responses sent in care of this newspaperor to Tribune Media Services Inc., 2225Q 4 As South, vulnerable, you hold: Kenmore Ave., Suite 114, Buf jalo, NY.14207. E-mail responses may be sent to4 K102 0) AJ630>AJ86547 gorenbridge@aol.(-om.)TODAY'S 1 2 3 4 5 6 7 8 9 10 11 12 13CROSSWORD PUZZLE 14 15 1617 18 19ACROSS locale PREVIOUS PUZZLE SOLVED1 Price tag 52 Upset 20 21 226 Quick lunch 54 PCapote lay about V O L G AA I K U Q T Y9Afresh AREAS OLDEN TO014 Rolex rival 57 Weaker, as an 23 24 2515 Funny Charlotte excuse L 0 A D S P L A N S I R I K58 Learning U R E Y C 0 P S E16 Open-air lob61 PABA part S C H E M E' S P A R A S'01 126 127 28 29 30bies 62 de plume PEEPED P U G E T17 Extinct herbi63 Swindlevore 64 Yummy pie L I AID S 0 M E W H A T 31 32 33 34 351 9 Mull over 65 Coast Guard T E D S T R A D L O S20 Clairvoyance off. B I V O U A' C S N U T T Y21 Slave girl of 66 Water, in comI R I S H CAREEN22 Lemony flavors 36 37 38 39opera bos BRIEADTH D I VERISE 23 Relax, as rules DOWN RUBLE TAD A 40 41 42 43 4425 Beatles drum1 Misplace A P B RAWER J I V E Dmer 2Tsp. andoz. WEE E LATE ORATE26 Shelved indefi3 Pager's sound 45 46nitely 4 Turtle-to-be L E, D D I N E D SANE R29 Winter woe 5 Philosopher 9-24-11 (02011 UFS, Dist by Univ. Uclick for UFS 47 148 49 5031 Harvests wool -tzu32 Book source 6 Uniform trim 26 Naughty, 44 Wrathful feeling36 Zen riddle 7 Extol naughty! 47 Embarrass 151 52 153 54 155 15637 Wassail alterna8 Prefix for "tril27 Crow's-nest cry 48 Copytive lion 28 Belle's boyfriend 49 Ms. Verdugo38 Apply a mud9 More spiffy 29 In quarantine 50 Purple fruits 57 58 59 160pack 10 Fictional Frome 30 Club stint 51 Show apprecia-40 Cancun's penin11 Twist forcibly 33 Cope with tionsula 12 Parlance change 52 Magritte or 61 62 6343 Swamp gases 13 Talks on and on 34 Headstrong Russo45 "Bus Stop" 18 Treats an icy 35 Arizona city 53 Dietary needauthor road 37 Pester 54 Laced up 64 65 6646 Dogie 23 Chamonix's 39 Make illegal 55 Waterfall sound47 Silvery fish Mont 41 Pilot's flap 56 A law itself50 Bard or minstrel 24 Always in verse 42 Big bang letters 59 I, to Fritz Want more puzzles?51 Atacama Desert 25 Burnish 43 Lowed 60 Ye olden "your" Check out the "Just Right Crossword Puzzles" booksat QuillDriverBooks.com

PAGE 62

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 13 SP29630 Sell It, Buy It IN THE Call Classified 941-206-1200 Can Only Get Easier Through The CLASSIFIED SECTION CLASSIFIED SECTION CLASSIFIED SECTION Why Not Get Them Working For You! Why Not Get Them Working For You! Dont Buy It Delay Today HOMES FOR SALE1020 Beautiful 3 Acre Mini Ranch Special Rural FINANCING! 10 Mins to shopping, r estaurants, etc..., yet offers the best of country living. Stocked pond, fenced, new appliances, completely redone. BUYERS HOME WARRANTY INCLUDED. F ANTASTIC NEW PRICE @ 169,500 Call R&R Consulting to view 941-916-1662 Back on the market! Breathtaking Golf Course views from every room!ROTONDA3/2.5/2.5 w Den, 2144sf, large Pool. Beautiful lg kitchen w Island, Jacuzzi tub, dual vanities in both bath with granite. All bedrooms have walk in closets. Dry bar, lg. pantry, solid surface counter tops. New up graded stainless steel appliances, sod, 18 porcelin tile, carpet, fans & fixtures. All for $229,900 Ron McGuire Tarpon Coast Realty 941-223-4781 HUD REGISTERED BROKER941-475-7011R OTONDA 2/1 Rotonda Cir.....$53,000NORTH PORT 4/2 Maurbach Ter ...$53,000PORT CHARLOTTE2/2 Blanchard Ave...$45,000 3/2 Peachland Blvd.$64,000 3/2 Koala Ave..........$68,000 2/2Morrison Ave ....$47,700 3/2 Laramore Ave ...$25,200 PUNTA GORDA 2/2 Carmalita St.....$36,900 2/2 Roanoke Cir ....$60,000 Y ou could save $1000s Call for a list of properties. PROPERTY MANGEMENT SERVICES ALSO AVAILABLE. G G O O V V T T R R E E S S A A L L E E S S F F o o r r e e c c l l o o s s u u r r e e s s / / R R E E O O s s EQUAL HOUSINGOPPORTUNITY LAKE SUZYESTATES Pool Home.3/2.5/3.5 Custom Buil t 2004. 2 Story, 3400 sf on Dbl. Lot. Mstr on 1st Flr., Granite, Tile, Gourmet Kit, Bonus Rm, Office & MORE! $389,000. 941-204-0074 REDUCED!! NEEDCASH? Have A Garage Sale! Enter your classified ad online and pay with your credit card. Its fast, easy, and convenient. Go to: yoursun.com and click on Classifieds *Fast Easy * Convenient (Visa or Mastercard) Need To Place a Classified Ad? Enter your classified ad and pay with your credit card24 hours a day,7 days week VILA .)83(.ff 1 1SUNtPEWS)94(r" )Tj 0 0.502 0 rg /TT2 1 Tf 0.2645 Tc 15.0909 0 0 11 183.0702 559.3429 Tm [(gaitSU 2dinN%ddmlkkLl-lb drr. .NEWSPAPERSr .)Tj EMC ET

PAGE 63

The Sun Classified-Section BPage 14E/N/C/VSaturday, September 24, 2011 AREA PROPERTY TRANSFERS ENGLEWOOD COURTESY OF ENGLEWOOD AREA BOARD OF RELATORSML# Status Address Zip Code Subdivision Name List Price Pool Sold Price BE FB HB Built Property Style Sold Terms Sold Date LP/S qFt LP/SP RatioD5783678 SLD 2811 PLACIDA RD 34224 GROVE CITY 19,000 Y 23,100 3 1 0 1959 Single Family Home All Cash 09/14/11 23.34 121.58 N5773224 SLD 1655 FLORENCE AVE 34223 CLINTWOOD ACRES 38,500 N 34,000 2 2 0 1974 1/2 Duplex All Cash 09/14/11 34.5 88.31 D5784153 SLD 170 LAKEVIEW LN 34223 LAKEVIEW TERRACE 41,900 N 42,000 3 2 0 1959 Single Family Home All Cash 09/12/11 29.89 100.2 4 N5773834 SLD 12538 FELDMAN AVE 33981 PORT CHARLOTTE SEC 56 59,900 N 65,200 3 2 0 1999 Single Family Home All Cash 09/16/11 50.2 5 108.85 D5784000 SLD 62 S BUENA VISTA AVE 34223 ALAMEDA ISLES 77,500 N 73,000 2 2 0 1979 Manufactured/Mobile Home All Cash 09/16/11 73.39 94.19 C7006186 SLD 62 BUNKER LN 33947 ROTONDA PEBBLE BEACH 85,000 N 86,000 2 2 1986 Single Family Home All Cash 09/15/11 67.73 101 .18 C7021748 SLD 7301 HART ST 34224 PORT CHARLOTTE SEC 64 86,900 N 83,000 3 2 0 1993 Single Family Home All Cash 09/15/11 54.28 95. 51 D5782781 SLD 6800 PLACIDA RD # 181 34224 FIDDLERS GREEN II CONDO 89,500 N 77,500 2 2 0 1987 Condo All Cash 09/15/11 81.96 86.59 C7024880 SLD 14303 ALLENSWORTH AVE 33981 PORT CHARLOTTE SEC 87 89,900 N 75,000 3 2 0 2007 Single Family Home All Cash 09/15/11 56.19 83.43 D5776094 SLD 4260 PLACIDA RD # 14-B 34224 FOREST PARK 109,900 N 109,900 2 2 1996 Condo All Cash 09/15/11 96.74 100 D5777033 SLD 7022 BEARDSLEY ST 34224 PORT CHARLOTTE SEC 64 118,000 Y 87,500 2 3 1982 Single Family Home All Cash 09/13/11 85 .51 74.15 O5049356 SLD 12028 NEWGATE AVE 33981 PORT CHARLOTTE SEC 72 118,500 N 105,000 3 2 0 2007 Single Family Home All Cash 09/12/11 64 .37 88.61 N5773236 SLD 10176 WILLOWOOD AVE 34224 PORT CHARLOTTE SEC 64 134,900 Y 136,000 2 2 0 1992 Single Family Home New FHA 09/14/11 8 8.23 100.82 D5781057 SLD 9371 HEARTWELLVILLE AVE 34224 PORT CHARLOTTE SEC 84 139,900 Y 125,000 4 3 0 1985 Single Family Home All Cash 09/12 /11 98.24 89.35 A3947335 SLD 8571 AMBERJACK CIR # 202 34224 HAMMOCKS PRESERVE PH 14 149,500 N 149,500 3 2 0 2007 Condo Other 09/16/11 89.31 100 N5771946 SLD 2560 LEMON AVE 34223 MANASOTA GARDENS 1ST ADD 149,900 Y 160,000 3 2 0 1992 Single Family Home New Conventional 09/ 16/11 93.51 106.74 D5783727 SLD 3 BRIDGE ST 34223 ENGLEWOOD ISLES 159,900 Y 155,000 3 2 0 1982 Single Family Home New Conventional 09/16/11 77.25 96.94 C7019837 SLD 14226 WHITCOMB LN 33981 PORT CHARLOTTE SEC 71 172,000 Y 172,000 3 2 0 2006 Single Family Home All Cash 09/14/11 82 .1 100 D5778340 SLD 474 TOMOKA DR 34223 PARK FOREST PH 5 172,900 N 172,900 2 2 2010 Single Family Home Balloon Mortgage 09/15/11 10 1.47 100 R4596174 SLD 7454 PALM IS DR # 3324 33946 BEACH VILLAS 185,000 N 123,000 1 1 0 1985 Condo All Cash 09/13/11 276.95 66.49 C7025955 SLD 221 N GULF BLVD # B 33946 PALM ISLAND ESTS 225,000 N 221,000 2 2 0 1986 Condo All Cash 09/15/11 152.03 98.22 N5772183 SLD 1550 BAYSHORE DR 34223 ENGLEWOOD GARDENS UNIT 5 247,000 Y 223,000 3 2 1 1980 Single Family Home All Cash 09/15/11 132.8 90.28 D5783410 SLD 2700 N BEACH RD # A205 34223 PELICAN LANDING 249,900 N 225,000 2 2 0 1981 Condo New Conventional 09/13/11 193.72 9 0.04 D5784438 SLD 2955 N BEACH RD # A-521 34223 TAMARIND GULF & BAY 299,900 Y 250,000 2 2 0 1981 Condo New Conventional 09/13/11 258 .31 83.36 C7021521 SLD 3418 DECK ST 33981 PORT CHARLOTTE SEC 60 695,000 Y 625,000 4 3 1 1988 Single Family Home New Conventional 09/16/11 174.8 89.93 D5768834 SLD 6421 MANASOTA KEY ROAD 34223 MANASOTA KEY 750,000 N 685,000 4 4 0 1968 Single Family Home All Cash 09/12/11 302.18 91.33 D5776131 SLD 251 GILCHRIST AVE 33921 BOCA GRANDE 2,850,000 Y 2,600,000 8 8 1 1924 Single Family Home New Conventional 09/16/11 508.93 91.23CHARLOTTE COUNTY/NORTH PORT COURTESY OF PUNTA GORDA, PORT CHARLOTTE, NORTH PORT ASSOCIATION OF REALTORSML# Status Address Zip Code City List Price Pool Sold Price BE FB HB Built Property Style Sold Terms Sold Date LP/SqFt LP/SP Ra tioC7026559 SLD 21150 GERTRUDE AVE # A1 33952 PORT CHARLOTTE 19,900 N 19,900 2 2 0 1977 Condo All Cash 09/16/11 24.12 100 D5784116 SLD 6174 GILLOT BLVD 33981 PORT CHARLOTTE 23,999 N 25,000 2 2 0 1975 Single Family Home All Cash 09/20/11 21.39 104.17 D5783804 SLD 22335 LASALLE RD 33952 PORT CHARLOTTE 26,800 N 28,000 2 1 0 1963 Single Family Home All Cash 09/15/11 27.35 104.48 C7026536 SLD 8243 GALLO AVE 34287 NORTH PORT 36,000 N 36,000 2 1 0 1977 Single Family Home All Cash 09/21/11 30 100 N5773721 SLD 2 QUAILS RUN BLVD # 2103 34223 ENGLEWOOD 36,900 N 36,000 1 1 0 1977 Condo All Cash 09/19/11 64.51 97.56 D5783272 SLD 30437 HOLLY RD 33982 PUNTA GORDA 37,900 N 35,000 3 2 0 1991 Single Family Home All Cash 09/16/11 30.71 92.35 A3947361 SLD 20988 CORNELL AVE 33952 PORT CHARLOTTE 38,000 N 36,777 2 2 0 1979 Single Family Home All Cash 09/16/11 30.35 96.78 C7024772 SLD 4158 TAMIAMI TRL # M7 33952 PORT CHARLOTTE 39,000 N 37,500 2 2 0 1970 Condo All Cash 09/15/11 40.75 96.15 C7023984 SLD 2395 HARBOR BLVD # 107 33952 PORT CHARLOTTE 44,500 N 42,500 2 2 0 1984 Condo New Conventional 09/15/11 42.62 95.51 C7020454 SLD 4106 MICHEL TREE ST 33948 PORT CHARLOTTE 48,000 Y 48,000 3 2 0 1972 Single Family Home All Cash 09/16/11 41.03 100 C7026686 SLD 20200 TAPPAN ZEE DRIVE 33952 PORT CHARLOTTE 49,900 N 48,000 2 1 1 1984 Single Family Home All Cash 09/19/11 54.71 96.19 C7026725 SLD 2258 LAKESHORE CIR 33952 PORT CHARLOTTE 52,900 N 46,500 2 2 0 1981 Single Family Home All Cash 09/19/11 49.35 87.9 A3946357 SLD 2771 STRAWBERRY TER 34286 NORTH PORT 55,000 N 56,100 3 2 0 2001 Single Family Home New FHA 09/16/11 46.14 102 C7026711 SLD 3231 BOHIO ST 34287 NORTH PORT 55,000 N 55,000 3 2 0 1977 Single Family Home All Cash 09/15/11 41.29 100 T2482033 SLD 7843 SWISS AVE 34291 NORTH PORT 56,000 N 66,100 3 2 0 2001 Single Family Home All Cash 09/19/11 35.15 118.04 C7024951 SLD 1232 S CRANBERRY BLVD 34286 NORTH PORT 59,500 N 65,000 3 2 0 1992 Single Family Home All Cash 09/19/11 37.61 109.2 4 C7024946 SLD 965 MCMAHON NW AVE 33948 PORT CHARLOTTE 59,900 N 59,900 4 3 0 1981 Single Family Home All Cash 09/15/11 42.48 100 N5773834 SLD 12538 FELDMAN AVE 33981 PORT CHARLOTTE 59,900 N 65,200 3 2 0 1999 Single Family Home All Cash 09/16/11 50.25 108.8 5 C7018105 SLD 6039 N CRANBERRY BLVD 34286 NORTH PORT 60,000 N 60,000 3 2 0 1999 Single Family Home All Cash 09/16/11 40.84 100 C7013076 SLD 3300 LOVELAND BLVD # 2301 33980 PORT CHARLOTTE 61,000 N 48,000 2 2 0 1991 Condo All Cash 09/15/11 57.01 78.69 C7023201 SLD 2140 HERON LAKE DR # 204 33983 PUNTA GORDA 63,000 N 60,000 2 2 0 2006 Condo All Cash 09/16/11 79.95 95.24 N5773372 SLD 2539 VALKARIA AVE 34286 NORTH PORT 64,000 N 66,500 3 2 0 2003 Single Family Home All Cash 09/16/11 50.35 103.91 D5780666 SLD 590 ARTISTS AVE 34223 ENGLEWOOD 64,900 N 57,000 2 2 0 1973 Single Family Home All Cash 09/19/11 72.35 87.83 C7014671 SLD 900 MARLIN DR 33950 PUNTA GORDA 65,000 N 65,000 3 2 1978 Single Family Home All Cash 09/15/11 53.63 100 C7006129 SLD 3310 LOVELAND BLVD # 1204 33980 PORT CHARLOTTE 69,900 N 54,000 2 2 0 1989 Condo New Conventional 09/15/11 66.95 77 .25 C7025012 SLD 3433 SARDINIA AVE 34286 NORTH PORT 70,500 N 80,600 3 2 0 2006 Single Family Home All Cash 09/19/11 42.86 114.33 C7026221 SLD 3865 BEEBER ST 34287 NORTH PORT 71,900 N 61,000 2 2 0 1980 Single Family Home All Cash 09/16/11 63.52 84.84 C7025254 SLD 177 DOWLING NE AVE 33952 PORT CHARLOTTE 74,900 Y 66,500 5 3 0 1970 Single Family Home All Cash 09/16/11 32.57 88.7 9 C7024807 SLD 25118 PALISADE RD 33983 PUNTA GORDA 75,000 Y 75,100 3 2 0 1991 Single Family Home All Cash 09/15/11 54.51 100.13 N5773694 SLD 1066 MALAY NW TER 33948 PORT CHARLOTTE 79,900 N 75,000 3 3 0 1985 Single Family Home All Cash 09/15/11 47.84 93.87 C7025857 SLD 3121 SHEBOYGAN AVE 34286 NORTH PORT 83,000 N 86,000 3 2 0 2004 Single Family Home New FHA 09/21/11 46.76 103.61 C7024880 SLD 14303 ALLENSWORTH AVE 33981 PORT CHARLOTTE 89,900 N 75,000 3 2 0 2007 Single Family Home All Cash 09/15/11 56.19 8 3.43 A3946379 SLD 2347 PONCE DE LEON BLVD 34291 NORTH PORT 89,900 Y 87,000 3 2 0 1992 Single Family Home New Conventional 09/20/11 7 2.85 96.77 A3942495 SLD 3168 SAINT JAMES ST 33952 PORT CHARLOTTE 94,900 Y 87,000 3 2 0 1979 Single Family Home All Cash 09/15/11 60.79 91. 68 C7025767 SLD 3257 SUNRISE TRL 33952 PORT CHARLOTTE 95,000 Y 96,000 3 2 0 1972 Single Family Home New Conventional 09/16/11 59.6 101.05 C7008633 SLD 150 HARBORSIDE AVE # 316 33950 PUNTA GORDA 99,000 N 75,000 2 2 0 1974 Condo All Cash 09/16/11 78.57 75.76 A3935157 SLD 2426 HOMESTEAD CIR 34286 NORTH PORT 99,000 N 90,000 3 2 0 2005 Single Family Home New Conventional 09/16/11 48.65 90.91 C7026179 SLD 2274 BRIANT ST 34287 NORTH PORT 109,900 Y 105,000 3 2 0 1995 Single Family Home New Conventional 09/16/11 77.89 95 .54 C7026041 SLD 1906 LAMONT ST 34288 NORTH PORT 114,900 N 113,900 4 3 0 2007 Single Family Home All Cash 09/15/11 50.44 99.13 C7023319 SLD 1362 N CARABOA S LN 33953 PORT CHARLOTTE 115,000 Y 100,000 3 2 0 2007 Single Family Home All Cash 09/21/11 61.14 8 6.96 C7013658 SLD 3512 DISCOVERY DRIVE 33983 PUNTA GORDA 118,000 N 107,500 1 1 1964 Single Family Home All Cash 09/16/11 165.5 91 .1 N5763532 SLD 17435 HILLSBOROUGH BLVD 33954 PORT CHARLOTTE 125,100 Y 125,100 3 2 2007 Single Family Home Combination 09/21/11 68.81 100 C7026048 SLD 2552 GREENLAND ST 34288 NORTH PORT 128,000 Y 129,000 3 2 0 2006 Single Family Home All Cash 09/16/11 65.07 100.78 C7024690 SLD 10177 GASPARILLA RD 33981 PORT CHARLOTTE 128,900 N 116,500 3 2 0 2009 Single Family Home New FHA 09/20/11 65.04 90 .38 N5772919 SLD 1545 GAUGUIN RD 34288 NORTH PORT 139,900 N 129,900 4 2 0 2006 Single Family Home New VA 09/15/11 63.05 92.85 C7024740 SLD 2844 ALHAVEN TERR 34286 NORTH PORT 139,900 N 139,900 3 2 0 2005 Single Family Home Combination 09/20/11 88.54 100 M5821735 SLD 2588 HOBBLEBRUSH DR 34289 NORTH PORT 140,000 N 136,000 4 2 0 2006 Single Family Home All Cash 09/15/11 58.14 97.14 N5771946 SLD 2560 LEMON AVE 34223 ENGLEWOOD 149,900 Y 160,000 3 2 0 1992 Single Family Home New Conventional 09/16/11 93.51 106.74 C7018837 SLD 311 GARVIN ST # 405B 33950 PUNTA GORDA 153,000 Y 145,000 2 2 0 1973 Condo All Cash 09/19/11 139.09 94.77 C7024248 SLD 1690 NUREMBERG BLVD 33983 PUNTA GORDA 154,900 Y 144,000 3 2 0 1991 Single Family Home All Cash 09/20/11 90.01 92.9 6 N5773649 SLD 201 CHAMPION ST 33953 PORT CHARLOTTE 156,750 Y 150,000 3 2 0 2009 Single Family Home All Cash 09/16/11 86.89 95.69 D5783727 SLD 3 BRIDGE ST 34223 ENGLEWOOD 159,900 Y 155,000 3 2 0 1982 Single Family Home New Conventional 09/16/11 77.25 96.94 C7025917 SLD 2801 CARMELA AVE 34286 NORTH PORT 159,900 Y 159,000 3 2 0 2004 Single Family Home New VA 09/20/11 97.44 99.44 D5778340 SLD 474 TOMOKA DR 34223 ENGLEWOOD 172,900 N 172,900 2 2 2010 Single Family Home Balloon Mortgage 09/15/11 101.47 100 C7026729 SLD 1010 SHEEHAN BLVD 33952 PORT CHARLOTTE 175,500 Y 168,000 3 2 0 2003 Single Family Home All Cash 09/19/11 84.74 95. 73 C7022296 SLD 84 MCCABE ST 33953 PORT CHARLOTTE 177,500 Y 180,000 3 2 0 1984 Single Family Home New VA 09/15/11 93.77 101.41 C7021599 SLD 495 RAVENSWOOD BLVD 33954 PORT CHARLOTTE 210,000 Y 170,000 3 2 0 1999 Single Family Home All Cash 09/16/11 98.22 8 0.95 C7024636 SLD 4331 BLUE HERON CIR 34287 NORTH PORT 233,300 N 228,300 3 2 1 2004 Single Family Home All Cash 09/16/11 107.31 97.8 6 D5777698 SLD 6664 OLD COURT ST 34291 NORTH PORT 239,000 N 239,000 4 3 1 2004 Single Family Home New Conventional 09/16/11 59.42 100 N5772183 SLD 1550 BAYSHORE DR 34223 ENGLEWOOD 247,000 Y 223,000 3 2 1 1980 Single Family Home All Cash 09/15/11 132.8 90.28 C7025250 SLD 9060 GROVE BLVD 33982 PUNTA GORDA 259,000 N 241,000 3 2 0 1992 Single Family Home All Cash 09/16/11 96.35 93.05 C7004299 SLD 164 BALDWIN SE CT 33952 PORT CHARLOTTE 299,000 Y 290,000 3 2 2006 Single Family Home All Cash 09/21/11 146.43 9 6.99 D5778934 SLD 203 LAKE VICTORIA CT 34223 ENGLEWOOD 299,000 Y 277,500 3 2 2005 Single Family Home All Cash 09/20/11 147.44 92. 81 C7026232 SLD 2531 RIO LARGO CT 33950 PUNTA GORDA 347,900 Y 365,200 3 2 0 1991 Single Family Home All Cash 09/15/11 172.57 104.9 7 C7022697 SLD 15576 MELPORT CIR 33981 PORT CHARLOTTE 349,900 Y 325,000 3 2 0 2008 Single Family Home Balloon Mortgage 09/21/11 1 46.71 92.88 C7016600 SLD 5575 RIVERSIDE DR 33982 PUNTA GORDA 397,500 Y 375,000 3 2 0 1998 Single Family Home New VA 09/15/11 169.29 94.34 C7021521 SLD 3418 DECK ST 33981 PORT CHARLOTTE 695,000 Y 625,000 4 3 1 1988 Single Family Home New Conventional 09/16/11 174.8 89.93

PAGE 64

Saturday, September 24, 2011E/N/C/V The Sun Classified-Section BPage 15 AREA PROPERTY TRANSFERS CONTINUED SOUTH SARASOTA COUNTY SOUTH SARASOTA COUNTY COURTESY OF VENICE AREA BOARD OF REALTORSML# Status Address Zip Code Subdivision Name List Price Pool Sold Price BE FB HB Built Property Style Sold Terms Sold Date LP/S qFt LP/SP RatioA3947260 SLD 624 CORONADO RD 34293 SOUTH VENICE UNIT 3 62,900 N 63,000 2 2 0 1978 Single Family Home All Cash 9/15/2011 45.75 1 00.16 N5773662 SLD 1065 HUDSON RD 34293 SOUTH VENICE UNIT 25 74,900 N 70,000 3 1 0 1960 Single Family Home All Cash 9/16/2011 75.43 9 3.46 A3947286 SLD 290 PELICAN RD 34293 SOUTH VENICE UNIT 17 74,900 N 72,900 2 2 0 1986 Single Family Home Other 9/16/2011 58.88 97.3 3 D5783954 SLD 347 TIHAMI RD 34293 VENICE GARDENS UNIT 3 98,500 N 85,000 2 2 0 1959 Single Family Home New Conventional 9/16/2011 86.71 86.29 N5772400 SLD 3490 SIESTA DR 34293 SOUTH VENICE UNIT 35 99,999 Y 98,000 2 2 1 1965 Single Family Home New Conventional 9/13/2011 70.37 98 M5822067 SLD 106 COROT DR 34275 SORRENTO EAST UNIT 3 109,000 N 110,000 3 2 0 1973 Single Family Home New Conventional 9/15/2011 55.44 100.92 N5771878 SLD 433 CERROMAR LN # 538 34293 FARMINGTON VISTAS 114,900 N 95,000 2 2 0 1982 Condo All Cash 9/15/2011 106.88 82.68 N5768617 SLD 603 TANGERINE ST 34275 CITRUS HIGHLANDS 119,000 Y 100,000 2 2 1960 Single Family Home All Cash 9/14/2011 78.96 84.03 A3946169 SLD 5040 LARRY ST 34293 MANASOTA 129,900 Y 127,000 3 2 0 1983 Single Family Home All Cash 9/13/2011 76.41 97.77 N5773738 SLD 305 ANGELICO DR 34275 SORRENTO EAST UNIT 2 144,900 N 140,000 3 2 0 1979 Single Family Home All Cash 9/16/2011 76.5 5 96.62 N5773591 SLD 1613 E CYPRESS POINT DR 34293 VENICE GARDENS UNIT 33 149,900 Y 140,000 2 2 0 1976 Single Family Home New Conventio nal 9/12/2011 97.21 93.4 N5773474 SLD 3425 KENNEDY DR 34292 NORTH VENICE FARMS 150,000 N 150,000 2 1 0 1932 Single Family Home All Cash 9/15/2011 167.41 100 N5771867 SLD 201 AUBURN LAKES CIRCLE # 1 34292 AUBURN LAKES 159,900 N 145,000 3 2 0 2000 Condo All Cash 9/12/2011 115.62 90.68 C7023402 SLD 1010 JOYCE CT 34293 VENICE GARDENS UNIT 34 SEC 3 159,900 Y 159,900 3 2 0 1993 Single Family Home New Conventional 9/14/2011 79.16 100 T2463555 SLD 19270 LAPPACIO ST 34293 ISLANDWALK AT THE WEST VILLAGES 186,525 N 174,165 2 2 0 2011 Single Family Home All Cash 9 /15/2011 130.53 93.37 N5772600 SLD 973 GONDOLA CT 34293 VENICE GARDENS UNIT 34 SEC 2 199,500 Y 185,000 3 2 0 1978 Single Family Home All Cash 9/16/20 11 107.61 92.73 N5773568 SLD 24793 BONIFAY PLACE 34293 PENNINGTON PLACE 219,990 N 219,990 3 2 0 2011 Single Family Home All Cash 9/13/2011 121. 95 100 N5771706 SLD 5053 SEAGRASS DR 34293 WHITESTONE AT SOUTHWOOD UNIT 2 PH 3 268,000 N 241,000 3 2 0 1997 Single Family Home All Cas h 9/15/2011 117.18 89.93 N5773599 SLD 516 SANTE JOSEPH ST 34285 BEACH PARK 279,000 Y 265,000 2 2 0 1956 Single Family Home All Cash 9/14/2011 171.8 94.9 8 N5772677 SLD 202 TREVISO CT 34275 VENETIAN GOLF & RIVER CLUB PH 2B 279,500 N 235,000 2 2 0 2003 Single Family Home All Cash 9/1 2/2011 147.81 84.08 N5773620 SLD 405 ALHAMBRA RD 34285 VENICE SOUTH GULF VIEW 325,000 Y 295,000 2 2 0 1968 Single Family Home New Conventional 9/13/2011 265.52 90.77 N5773625 SLD 507 PARK ESTATES SQ 34293 PARK ESTS 325,000 Y 310,000 3 2 0 1996 Single Family Home All Cash 9/15/2011 151.09 95.3 8 N5768677 SLD 414 MONTELLUNA DR 34275 VENETIAN GOLF & RIVER CLUB PH 2F 349,000 N 325,000 3 2 2004 Single Family Home Combinat ion 9/15/2011 168.03 93.12 N5773064 SLD 422 MARSH CREEK RD 34292 SAWGRASS UNIT 5 399,900 Y 380,000 3 2 0 2002 Single Family Home All Cash 9/16/2011 194.69 95.02 N5774063 SLD 19733 COBBLESTONE CIR 34292 STONE WALK 431,648 Y 431,648 3 3 0 2011 Single Family Home Combination 9/13/2011 165.0 7 100 N5772086 SLD 620 BARCELONA AVE 34285 VENICE GULF VIEW 649,000 N 600,000 3 2 0 2011 Single Famil y Home New Conventional 9/16/2011 298.39 92.45 HOMES FOR SALE1020 NORTH PORT 3/2/2 1834SF, Lanai, all appls & W/D, fenced, Sprinkler sys, Low maint & taxes. $149,500. 941-429-9305 Eves CLASSIFIED W ORKS! Owner Financing $699/mo Nor th Por t Ready to move in! 3/2 FL room, Gar, $99k 941-716-0040 PORT CHARLOTTERent to Ow n 3/1 Shows like a Model Hom e Many New Features: $68,00 0 Poss. Finance. 941-629-6329 PUNTA GORDA Remodeled 2/2/2 pool home with dockage for 65' plus sailboat, depth maintained by city, dead end street in restricted neighborhood. $229,900. Lisa Laflamme, Micheal Saunders and Assoc., 941-916-0538, Lisala@earthlink.net PRAIRIE CREEK,PUNTA GORDAEquestrian Country Estate 4BR/4.5BA, Htd pool/spa, gazebo. Gated on 5+ acres w/ stocked bass pond & more 17400 White W ater Ct. 941-575-4783 or 637-1673 $675,900. For virtual tour:www.floridaneighborhoods.net REDUCED WA TERFRONT HOMES 1030 PORT CHARLOTTE 3/2 Fresh W aterCanal, new: r oof, AC, floors, cabinets. lanai, $79k 941-6296329 poss finance WA TERFRONT HOMES 1030 ENGLEWOOD/VENICE Beautiful home in Waterfront community with dock. No bridges out. Lg. Fl room, Many new upgrades including: tile roof, wood kitchen cabinets, upgraded stainless steel appliances, granite, gutters, 18 porcelin tile, carpet, fans light fixtures, doors, sinks, faucets and new paint! $229,900 Ron McGuire T ARPON COAST REALTY 941-223-4781 PORT CHARLOTTE Executive, furnished, 3/2/2 pool, canal to Gulf. May Lease-Purchase, owner finance. $274,900 Judy Barkhurst, Sun Realty, 941-286-3473 PUNTA GORDA WATERFRONT Great View, Boat Dock, newer 2/2/CP, & 12x12 lanai. Res Owned, htd pool, Lg club house. no pets. 55+, $78,000. Selling due to health, 941-833-8370 VENICE AREAFULLY REMODELED WATERFRONT HOME,pool w spa, pavered deck & driveway. Dock, $199,900 Call Ron McGuire T arpon Coast Realty 941-223-4781 CLASSIFIED SELLSCALLTODAY!941-207-1200 V enice/Englewood Nor th Port areas OR 941-206-1200P t. Charlotte Areas GOLFCOURSE COMMUNITY1035 PG BLUE HERON PINES 1261 SF, 55+ Golf, pool, clubhouse, 2/2/CP, New floors, paint, $59,900 941-637-7803 CONDOS/VILLAS FOR SALE1040 SELLING YOUR LOT, HOME OR CONDO??Call the Sun at 866-463-1638 and ask about our BRAND NEW Buy 2 Months Get One FREE! Real Estate Ad Program. Y our ad will run everyday in the newspaper & run online for 90 days! All for a ONE TIME low price. Hurry, Offer good through Sept. 30, 2011. Call for details. Realtors Welcome! NEEDAJOB? CHECKTHE CLASSIFIEDS! 414 CONDOS/VILLAS FOR SALE IN VENICEAvailability changes per wk/MLSWe are Condo/Villa SpecialistsBIRDBAYREALTY, INC.485-4804/1-800-464-8497 Bay Front Penthouse Condo Large top floor end unit, gated, very private, no condo neighbor s visible, excellent private bay & sunset views, nearly new 3 BR/2 BA, plus den. Choices t 2-1/2 car garage parking (nex t to elevator) w/2 large storag e lockers & mini space for gol f cart, motorbike, etc. Loaded w/extras. Choice Placida are a with new boat slip. NOW the onl y bay front penthouse with its own private boat dock right at you r front door. Over $800K invest ed, REDUCED to $429K. Possible owner financing at 3-1/2%. MLS #U7516743 941-769-1017. PUNTA GORDA ISLES WA TERFRONT! **5 MINS TO** FISHERMANS VILLAGE By Boat Beautiful lg furnished 2/2 condo,boat slip,htd pool,large lanai,$159,900 T arpon Coast Realty Call Ron McGurie 941-223-4781 ENGLEWOOD 2/2/1 Gulf W inds on Oyster Creek w/dock, access to Intercoastal, Clubhouse, Rol-Safe shutters, All tile. Reduced to: $125,000. FSBO 941-4600669 CONDOS/VILLAS FOR SALE1040 THISIS THE ONE ROTONDA 2BR/2BA CONDOMINIUM Built in 2005.Granite counter tops,Brand new Upgraded Stainless Steel appliances, Beautiful new flooring.Tennis courts,Large pool & beautiful c lub house with walk/ biking trail right next door $103,900. T arpon Coast Realty Call Ron McGurie 941-223-4781 PORT CHARLOTTE CONDO Ground floor, furn, 2BR/2BA/CP Pool, Jacuzzi, Te nnis, Shuffle Board, Rec Hall, etc $39,900. (941)-613-2940 NEEDCASH? PUNTA GORDA Emerald Pointe Condo, 4th flr. Canal view. 2/1, Beautifully appointed. Tu rnkey. Boat Slip.$127.9K 941-637-1422. To Advertise in The Showcase of Homes Please Call 866-463-1638 or Email; special@sunnewspapers.net WA TERSIDE VILLAGE:2nd fl condo,2/2+den,water view. $143.900.Barb Gahry, Michael Saunders & Co 941-586-3936 T OWNHOUSES FOR SALE1060 PUNTA GORDA ISLES T arpon Cove 3/2/2 car garage. 2nd Flr. w/ private elevator. 2400+ sf. of A/C. Open Floor plan. Affordable luxury. $279,750. RE/MAX Harbor Harry Row e 941-457-0508 DUPLEXES FOR SALE1070 E.ENGLEWOOD 3/2/2 on each side. All appliances. Very Nice. Looks Like new. Only 4 yrs old. $230K 941-809-1820 Furnished duplex in Englewood. Close to town. $130k Tennants in place. $18k income. Owner will consider holding mortg. with 30k down. Broker protected. Bill941-492-6025 Great Annual Investment! MOBILE HOMES FOR SALE 1090 INVESTORS Oyster Creek, 2 Dblewides on canal, private area, fully furnished, rented $150,000, 941-356-0391 LAKE SUZY Country Living 4 mi. to PC, I-75, Wal Mart, PRI VA TE 2 1/2 acres, 3/2/CP, well, septic $149,900. 941 743-6601. P ALM HARBOR HOMES Red Tag SALE Over 10 stock units must go Save up to 35K! 800-622-2832 ADVERTISE In The Classifieds! PUNTA GORDA 1/1 14x40 furn, 55+ Resident owned SR. Park. RIVER HAVEN MHP 10100 Burnt Store Rd Unit 129 Low maint. fees REDUCED $25,000/obo 516-850-0576 PUNTAGORDA Resident Owned 55+ Socially Active Boating Community. W aterfront & interior newer homes and lots, from $12,000, in Windmill Village MHP. 215 Rio Villa Dr. Visit windmillvillagehomes.comJim Schappe Gulf Access Homes Inc. (941)-380-3230 VENICE ISLE REAL ESTATE SALES, INC. 55+ Resident Owned Comm. Lic. R.E. Broker. 941-485-7743 Many homes to choose from. 941-485-7744 MOBILE HOMES FOR SALE 1090 VENICE RANCH M.H.E.Community is being Renovated! Lot rental community Singlewide homes starting @ $500.00 down Doublewide homes starting @ $4,000.00 WALKING DISTANCE TO PUBLIX & CVS 55+ comm. No pets Call Dick or Steve 941-488-5672 www.VeniceRanch.com MANUFACTURED HOMES FOR SALE1095 A RCADIAVILLAGE, 55+ Gated, 2/2/Den, fans, Large shed, vinyl porch, 1500 sq ft on golf course. $65,800. 941-429-2316. ASKUS HOW you can place a PICTURE of your item for sale in your classified ad! LETTUCE LAKE AREA 5 acre s zoned AG, fenced & cleared, 28x64 1800 sf, 24x20 metal garage $187,500/OBO 941-624 0275 SETTLE ESTATE $27,980!!! Furnished Move in today! Call 941-356-5308 PUNTA GORDA Tr opical Palms 2/2, huge closets, 2004, new appl., window treatments, lanai, porch. Mint. Low lot rent. 239-543-5857 PUNTA GORDA Lakewood V illage, Lot #42. 2/2/CP, kit., LR, DR, FL rm., CHA, Amenities. $29,500. 941-204-7548 PUNTA GORDA Nice remodeled 2bed/2bath, large carport, screenroom, utility shed, $14,900 941-626-7829 Greg. LW44 F--f \)Tj -0.0162 Tc 7.5455 0 0 28 68.5 921.5081 Tm (tvrte:-,.r.:,,m.._..)Tj 0 Tc 0 0 0 6 70.5 763.513 Tm (. ',)]TJ -0.2932 Tc 12.5 0 0 6 281.5 767.0128 Tm [()-63(a)-360()]TJ -0.1879 Tc 8.4694 0 0 6 305 772.0127 Tm (, #)-530()-213( 8.,, `Z7F .7 urY fam M . ,Vol42R 9Irk,

PAGE 65

The Sun Classified-Section BPage 16E/N/C/VSaturday, September 24, 2011 SAME DAY A PPROVAL WITH NO A PPLICAT ION F EES Tony M oore Michelle Hanna h Sandra Hoy Mark Piet raniec Susan Hogr efe 807 US 41 ByPa ss South, Sui t e A Veni ce, FL 34285 PH ( 941)485-4222 FX ( 941)485-4223 www. gul fsi demt g. com www. MyFl ori daMort gage. com The People to Know, for the Mortgage you need VOTED #1 VOTED #1 Mort gage Mortga ge Company Company 8 Years In A Row 8 Years In A Row Mi che lle Ha nnah Tony M oore 8527505 Welcome HomeFOR 25 YEARS THE#1 REALESTATE MAGAZINE INTHEMARKETPLACE!www.welcome-home.com (941) 206-1200 Classified Ads (941) 206-1000 Display Ads Thinking about advertising ? Thinking about advertising ? Now is the time! OUTOFAREA HOMES1110 CHIMNEY ROCK, NC 1328sf log chalet unfinished on 4+ acres $94,800 or on 2 acres only $79,900 your choice.Call owner for details 828-286-1666 Classified = Sales LOTS & ACREAGE1500 NORTH PORTSumter Blvd. Great location. New home area. $6,900 941-457-6811 CLASSIFIED ADSSELL PUNTA GORDA 1.25 Acres. 10 minutes from exit 164. $12,900/obo. 239-777-3447 LOTS & ACREAGE1500 SELLING YOUR LOT, HOME OR CONDO??Call the Sun at 866-463-1638 and ask about our BRAND NEW Buy 2 Months Get One FREE! Real Estate Ad Program. Y our ad will run everyday in the newspaper & run online for 90 days! All for a ONE TIME low price. Hurry, Offer good thru Sept. 30, 2011. Call for details. Realtors Welcome! PUNTA GORDA 1.25Acres Country living Bring your livestock! Close to I-75 & shops $22,900. 941-637-7776 BUYIT! SELLIT! FINDIT! SUN CLASSIFIEDS! WA TERFRONT1515 BEST LOT BUY in 3 golf course community and its waterfront, too! Reduced to only $13,900. Zoned for 1 to 5 units. Possible owner financ ing @ 3-1/2% 941-769-1017 BYOWNER, Sailboat Lot, 3472 Discovery 33983 Great Location. $39,900 941-6778550 details at KL30.com WA TERFRONT1515 DEEP SALTWATER LOT Cape Haze area, new seawall, Bay views, back yard faces west spectacular sunsets over the water. Possible owner financing at 3-1/2%. Reduced to $189,900K. MLS# U7516944 Call 941769-0200 DIRECT BAYFRONT PROPERTY LOWEST PRICED direc t bayfront of its kind on Florida s W est Coast. Rare, extremel y deep sailboat water (10+ ft) a t your lot. Spectacular one-of-a kind BIG 180-degree wate r views. Price JUST REDUCE D to $429,900. Possible owne r financing at 3-1/2%. MLS #U7516841 Call: 941-769-0200 LEMON BA Y at your fr ont door Build your dream home on 100 x 287 lot. W alk to beach. A steal at $139,900 Call Diane Newland 941 223 5387 Palm Realty Group MANASOTA KEY Building lot 4th from Gulf. $499,000 401-596-0614 GET RESULTS USE CLASSIFIED! Nearly 1 acre on Lemon Bay! Best direct bay front lot in Engle wood zoned so it can be spli t into 2 single-family home sites. Includes brand new 90ft. boa t dock. Possible owner financin g at 3-1/2%. MLS# U7516833 Call 941-769-0200 BUSINESS FOR SALE1600 NORTH PORT, Pool Route. $45K + year. Will train & guarantee accounts. $36K full price. Other routes available. www.poolroutesales.com 772-220-3306. National Pool Route Sales, Inc. Broker. BUSINESS FOR SALE1600 VENICERESTAURANT 90 seats, Fully equipped, $59,900 MaryBeth, Preferred Properties, Realtors. 941-416-3829 BUSINESS RENTALS1610 DAYCARE approved for up to 40 children, on 4 acres in V enice near I-75 interchange, 1st mo. free, $2,200. 941-488-6210 P AULSON CENTREEXECUTIVE OFFICE SUITES18245 Paulson Drive. P.C 25% off first Year Rent 80 s.f. to 230 s.f. Offices Vir tual Offices available Info call (941)-206-2200 PUNTA GORDA on US 41 CEDAR POINT OFFICES Near downtown 1,250 sqft $1,400 Smaller spaces avail. Flip, 941-505-0482 a GREAT day! ~JIllMurdock Prof. Plaza. US 41 frontage, Approx. 650SF, Free Rent, Call for details. (941)629-1121 Real Living All Florida RealtyiA INCOME PROPERTY1615 NOCATEE, 11 Homes on 5 Acres. 1/2 Rented. Will Pay for Itself! Great Investment! $125,000. 941-624-0355 ADVERTISEWITHTHE SUNCLASSIFIEDS VENICE MINI STORAGE F ACILITY, 425 Units, $1.1M. MaryBeth, Preferred Properties, Realtors 941-416-3829 COMMERCIAL/ INDUSTRIALPROP1620 ENGLEWOOD ROUTE 776 55K SQFT AVAILABLE RETAIL/STORAGE. $250/PER MO FOR TEMPMPOARY LEASE. CALL TIM 440-334-8371 PORT CHARLOTTE 1,000 sq.ft. Commercial units for lease. $642 Contact Kevin. 941-548-7882 PORT CHARLOTTE AAA location, 3,000sq ft, call 941628-2883 PORT CHARLOTTE-Prime office space, 3 units 1,000sf. ea. Brand new. Sandhill Blvd. Turnkey/Fully built out. (941)-624-5992 COMMERCIAL/ INDUSTRIALPROP1620 VENICEISLAND Eff, 1 & 2 br, Immed occup. No pets, 1 yr lse 941-416-5757 or 941-323-6466 VENICEWAREHOUSES USER OR INCOME 4000Sqft; 7,000 sq ft, 10,000 & 20,000 MaryBeth, Preferred Properties, Realtors 941-416-3829 IN THE SUN CLASSIFIED YOU CAN..... Find a Pet Find a Car Find a Job Find Garage Sales Find A New Employee Sell Your Home Sell Your Unwanted Merchandise Advertise Your Business or ServiceClassified its the reliable source for the right results WA REHOUSE & STORAGE1640 CHARLOTTE HARBOR 20X40warehouse/business, AC office, city water, dumpster, 23250 Harper Ave. #2 $460/mo. 715-367-8236. NORTH PORT-800 SF Warehouse, $400 + tax.; 800sf w/ electric & small office $500/ mo + tax. 941-661-6720 PORT CHARLOTTEWarehouse For Lease 800 or 1600 sq ft. available. Starting at $330 941-380-9212 PUNTA GORDA, 1600 sf. with interior office & lg overhead drs $600/mo+Tax.239-248-0020 VENICE 400ft to 7,000 ft $6.00 per foot MaryBeth, Preferred Properties, Realtors 941-416-3829 VENICE Warehouse Complex Bay Rentals Starting at $200/per mo. 941-4858402 NiL )Tj -0.4583 Tc 38.0417 0 0 4 102.5634 679.2762 Tm [(-T,it I/GULFSIDE)Tj -0.1391 Tc 28.8696 0 0 15 52.2664 433.5523 Tm (r MORTGAGE SERncEa..1 \\7n,E.fieofiGe CUAKO[U/ r v )75(or t era a/e)85(ou Keee()Tj /TT1 1 Tf -0.011 Tc 5.0303 0 0 11 65.7664 384.5538 Tm (J 1SUNNEWSPAPERS

PAGE 66

September 25, 2011

PAGE 67

Comics Page 2 D/E/N/C/V www.sun-herald.com The Sun /Sunday,September 25, 2011

PAGE 68

Sunday,September 25,2011/ The Sun www.sun-herald.comD/E/N/C/V Comics Page 3

PAGE 69

The Sun /Sunday, September 25, 2011 Comics Page 4 D/E/N/C/V www.sun-herald.com

PAGE 70

Sunday,September 25,2011/ The Sun www.sun-herald.comD/E/N/C/V Comics Page 5

PAGE 71

Comics Page 6 D/E/N/C/V www.sun-herald.com The Sun /Sunday,September 25, 2011

PAGE 72

Sunday,September 25,2011/ The Sun www.sun-herald.comD/E/N/C/V Comics Page 7

PAGE 73

Comics Page 8 D/E/N/C/V www.sun-herald.com The Sun /Sunday,September 25, 2011


University of Florida Home Page
© 2004 - 2011 University of Florida George A. Smathers Libraries.
All rights reserved.

Acceptable Use, Copyright, and Disclaimer Statement
Powered by SobekCM