<%BANNER%>

The Independent Florida alligator

MISSING IMAGE

Material Information

Title:
The Independent Florida alligator
Portion of title:
Florida allgator
Alligator
Alternate Title:
University digest
University of Florida digest
Physical Description:
v. : ill. (some col.) ; 36 cm.
Language:
English
Creator:
Independent Florida Alligator
Publisher:
The students of the University of Florida
Campus Communications, Inc.
Place of Publication:
Gainesville, Fla.
Gainesville, Fla
Publication Date:

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.)   ( lcsh )
Newspapers -- Alachua County (Fla.)   ( lcsh )
Genre:
newspaper   ( sobekcm )
newspaper   ( marcgt )
Spatial Coverage:
United States of America -- Florida -- Alachua -- Gainesville

Notes

Additional Physical Form:
Also available on microfilm from the University of Florida.
Additional Physical Form:
Online ed. available via the World Wide Web.
Dates or Sequential Designation:
Vol. 65, no. 75 (Feb. 1, 1973)-
General Note:
"Not officially associated with the University of Florida."

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
All applicable rights reserved by the source institution and holding location.
Resource Identifier:
oclc - 13827512
alephbibnum - 000470760
lccn - sn 86010448
issn - 0889-2423
lccn - sn 86010448
System ID:
UF00028290:01720

Related Items

Preceded by:
Florida alligator

MISSING IMAGE

Material Information

Title:
The Independent Florida alligator
Portion of title:
Florida allgator
Alligator
Alternate Title:
University digest
University of Florida digest
Physical Description:
v. : ill. (some col.) ; 36 cm.
Language:
English
Creator:
Independent Florida Alligator
Publisher:
The students of the University of Florida
Campus Communications, Inc.
Place of Publication:
Gainesville, Fla.
Gainesville, Fla
Publication Date:

Subjects

Subjects / Keywords:
Newspapers -- Gainesville (Fla.)   ( lcsh )
Newspapers -- Alachua County (Fla.)   ( lcsh )
Genre:
newspaper   ( sobekcm )
newspaper   ( marcgt )
Spatial Coverage:
United States of America -- Florida -- Alachua -- Gainesville

Notes

Additional Physical Form:
Also available on microfilm from the University of Florida.
Additional Physical Form:
Online ed. available via the World Wide Web.
Dates or Sequential Designation:
Vol. 65, no. 75 (Feb. 1, 1973)-
General Note:
"Not officially associated with the University of Florida."

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
All applicable rights reserved by the source institution and holding location.
Resource Identifier:
oclc - 13827512
alephbibnum - 000470760
lccn - sn 86010448
issn - 0889-2423
lccn - sn 86010448
System ID:
UF00028290:01720

Related Items

Preceded by:
Florida alligator


This item is only available as the following downloads:


Full Text

PAGE 1

FORECAST 2 OPINIONS 6 the AVENUE 10 CLASSIFIEDS 15 CROSSWORD 19 SPORTS 23 VOLUME 107 ISSUE 150 WWW.ALLIGATOR.ORG TUESDAY, JUNE 4, 2013 Today We Inform. You Decide.Not officially associated with the University of Florida Published by Campus Communications, Inc. of Gainesville, Florida 94 /84 $87,000 in Kickstarter donations saves theaterIt raised most of the money in the last month, pg 5. UF professors chosen for arts and sciences academyTheyll join Robert De Niro and Bruce Springsteen, pg 8. Gators eliminated from WCWSFlorida batters struck out 14 times in a 3-0 loss to Texas in the Womens College World Series on Sunday, pg 15. Sunscreen labels are changing. Read the story on page 3. Ryan Jones / Alligator StaffKnight RidersLiz Jones, left, breaks her lance on an opponents shield during a Knights of Mayhem jousting tournament at Patriots Ranch in Florahome, Fla., on Sunday. ELLEN VILLAFUERTEAlligator Contributing WriterUFs Webmail will soon be a thing of the past thanks to a Although there is no set date, UF Information Technology The new service will include email, 25 GB of mailbox storage, an integrated calendar and access to UFs global email adReducing the universitys carbon footprint and electricity bill as well as providing more storage and portability for students and faculty are among the many reasons UF is making the switch to the cloud, said Tracy Gale, UFIT communications The way that email is set up here there are dozens of email services so the time to manage that and the software By the start of the Fall semester, Microsoft SharePoint will beBecause the entire service is Internet-based, there will be no needed, it also is kind of like a one-stop shop that allows for betMicrosoft Lync, an instant message service, will also be availMicrosoft SkyDrive Cloud storage and browser-based verI think this new email service will be much better, said The goal is to move about 2,000 students per week to the Microsoft Office 365 to replace UF Webmail system PATRICK KELLYAlligator Contributing WriterWatch out while jaywalking local police In May, members of the Gainesville Police can Grill at the intersection of West University Avenue and Northwest 15th Street writing The longer we stay here, though, the a pedestrian shall obey the instructions of applicable to the pedestrian unless otherwise Madelyn Thiele, a 20-year-old UF mathematics junior, was one of the students who Thiele said the polices efforts to encourage lawful use of the crosswalks are in vain because people will continue to cross streets at GPD issues tickets for jaywalking near UF campusCAMPUS SWAMP HEAD BEER WAS THE SECRET INGREDIENT. OLIVIA LANGDONAlligator Contributing WriterThe room was silent as an eager crowd circled a covered table in the watched as the announcer counted down to unveil the secret ingredient: The Iron Chef Gainesville competition began at the Hilton University Taste of Gainesville and HOME Magazine held its fourth annual fundraising event Sunday evening, The main attraction was a local rendition of the Food Network show Iron Chef America, judged by previous winners from another The three competing executive chefs had one hour to prepare an appetizer, main course and dessert incorporating locally brewed Swamp ries and coffee were the secret ingreTwo-time defending champion Briton Dumas, executive chef at Embers Wood Grill, was up against two new contenders: Ray Leung, and Patrick Jones, executive chef at The longer we stay here, though, the more folks start using the crosswalk. Thats the whole point.Joe RaulersonGainesville Police sergeant SEE CHEF, PAGE 4 SEE EMAIL, PAGE 4Leung

PAGE 2

News Today Subscription Rate: Full Year (All Semesters) $100The Independent Florida Alligator is a student newspaper serving the University of Florida, pubThe Alligator The Alligator is The Alligator VOLUME 107 ISSUE 150 ISSN 0889-2423 The Alligator The Alligator 2, ALLIGATOR TUESDAY, JUNE 4, 2013 SATURDAY FRIDAY THURSDAY WEDNESDAY TODAYFORECASTTHUNDER STORMS 91/73 THUNDER STORMS 89/74 THUNDER STORMS 83/72 THUNDER STORMS 86/72 THUNDER STORMS 87/70 WHATS HAPPENING?Life (and Pet) planning seminar From 6 p.m. to 7:30 p.m. at the Millhopper Branch Library, the Roark Law Firm is hosting a free and open discussion about wills, trusts, living wills, pet trusts and the steps people can take to reduce the burdens created by the death or incapacity of a loved one. The firm will talk about what happens if people pass away or become incapacitated in Florida and also touch on a couple of things parents can put in place for their children. The talk will also focus on what people can do to better provide for the care of pets in the event of death or disability. Drinks and snacks will be provided and a Q-and-A session will follow. OAS talent show Come out to the OAS Summer Talent Show on July 6. Participants will be judged for originality, content, presentation, audience response and overall talent. Applications are available on the Application Clearinghouse at www.studentinvolvement.ufl.edu/Resources/ ApplicationClearinghouse. Contact Urvashi Singh at urvashisingh78@ufl.edu for more information. Got something going on? Want to see it in this space? Send an email with Whats Happening in the subject line and 150 words or fewer about the event to jglum@alligator.org. To ensure publication in the next days newspaper, please submit before 5 p.m. and model your submission after above events. Improperly formatted Whats Happening submissions may not appear in the paper.BRIEFSMatt Smith leaving lead role in BBCs Doctor WhoLONDON Who will be the new Who? The BBC says Matt Smith is stepping down from the lead role tor Who, spurring intense speculation about his replacement. The broadcaster said Sunday that Smith will leave after a November episode to mark the shows 50th anniversary and a Christmas special. The titular Doctor is a timetraveling, extra-terrestrial Time Lord who can regenerate into new bodies. Smith is the 11th actor to play the character since the series began in 1963. Smith, who took over the role from David Tennant in 2010, said playing the Doctor had been the most brilliant experience for me as an actor and a bloke. Doctor Who is one of the BBCs most popular programs, of a Danube steamboat company captain. DPA reports such words have been so rarely used, however, that theyre not in the dictionary. There the longest word honor tversicherung: automobile liability insurance.For sale in NYC: fridge with morbid history NEW YORK Its a fridge big enough for a family of four. Services has turned to eBay in an attempt to sell off a huge, steel morgue refrigerator now located at a Manhattan psychiatric hospital. Bidding on Saturday afternoon was up to $475 for the four-drawer unit, but that price doesnt include delivery. Buyers have to be willing to remove the fridge themselves from the Manhattan Psychiatric Center. tells the New York Post that the ad is no hoax. She says the agency does get unusual surplus items to sell from time to time, including barber chairs from prisons and police cars, but she doesnt recall a previous sale of a morgue cooler. The auction runs through June 6.Austrian drives flaming car to fire station VIENNA (AP) Some Ausleave their station to deal with a recent alarm. The blaze came to them instead. Fireman Roland Brandl says that colleagues were doing chores at the station in the town of Pregarten on Wednesday when a from beneath it. One man grabbed an extinone was hurt. The blaze was apparently caused by a cleaning cloth which was left under the hood. State broadcaster ORF says the 1 kilometer (0.6 mile) to the station after a passer-by alerted him THE ASSOCIATED PRESS and Smiths tenure has seen the show gain new fans in the United States, where it is shown on BBC America. The BBC did not announce Smiths replacement, but fans took to the Internet to speculate about casting of the 12th Doctor. Bookmaker William Hill made Being Human star Russell Tovey and Harry Potfavorites, followed by stage star Rory Kinnear and Homeland actor David Harewood. William Hill also offered 8-1 odds on the next Doctor being female.Cat detained on illegal mission at Russian prison MOSCOW Inmates at Russias prisons have been known to bribe guards to obtain cellphones, but this may be cat as an accomplice. colony in Russias north saw a cat on the fence and it seemed to be carrying something. On a closer look, they found a few cellphones and chargers taped to the cats belly. The federal prison service said Monday that this happened on Friday at the Penal Colony No. 1 near the city of Syktyvkar in the Komi province, 1,000 kilometers (some 600 miles) northeast of Moscow. It wasnt clear how the cat was supposed to drop off its loot.Law change kills Germanys longest wordBERLIN A tweak to state Mecklenburg-Western Pomerania to conform with current EU regulations has caused an unexpected casualty: the longest tierungsueberwachungsaufgabenuebertragungsgesetz is no more. The law delegating beef label monitoring was introduced by the state in 1999 as part of measures against mad cow disease. But the DPA news agency reported Monday the law was removed from the books last week because European Union regulations have changed. like the very robust Donaudampfschifffahrtsgesellschaftskapitaenswitwe to fall back on meaning widow Melissa Kahan, Kelsey Meany, VOLUME 107 ISSUE 150

PAGE 3

JEANNA ARROYOAlligator Contributing WriterNew labels on sunscreen designed to shine light on the effects of the suns rays will soon hit shelves. The Food and Drug Administration recently issued new regulations for sunscreen manufacturers to promote more accurate labeling of products. Catherine Seemann, communications coordinator at the UF Student Health Care Center, said knowing which sunscreen to choose can be overwhelming. You walk into a drugstore, and it is a wall a giant wall of sunscreen products from oils to zinc, she said, How do you make that decision? One of the new labeling terms consumers can look for is the phrase broad spectrum protection. This means sunscreen is at least above a sun protection factor, SPF, of 15 and protects against both types of ultraviolet light: UVA and UVB rays. Also under the new regulations, sunscreen products that are not broad spectrum or that are broad spectrum with SPF values 14 and below will be labeled with a warning that says Skin Cancer/Skin Aging Alert, according to an FDA press release. Sunscreens will no longer use the words sunblock, waterproof or sweatproof, according to the release. consumers will see a direct connection between sunscreen and prevention of those risks, said Dr. Christina L. Mitchell, assistant clinical professor of dermatology at UF. Hopefully, this will make people think more about what they are choosing to put on their skin as a sunscreen and make them ing, Mitchell said. We hope that people TUESDAY, JUNE 4, 2013 ALLIGATOR, 3 Kali Kavouklis / AlligatorUF medical student Maryam Davoodi-Semiromi and UF psychology freshman Alexis Lopez lie out by Broward Pool on May 22. NATIONALSunscreen labels changing June 7, 1966 The Alachua County Election Supervisor told the Alligator married students had better chances of registering to vote in Alachua County than their single counterparts. This is because being married seemed to point toward an intent to permanently live in Gainesville. According to the Florida Constitution, a voter must be in the state for a year and in the county for six months. June 1, 1979 Three women, roommates in UFs Buckman Hall, took out an ad in the Alligator in search of love. The ad read: WANTED: one of the male human species for the purpose of deep friendship, moderate relationship, must possess the following qualities: game playing, intelligence, wit, enjoys fooling around but not making it an olympic marathon...looks not relevant other than not excessively short or tall, not super zit-faced or extremely ugly, MCPs (male chauvinist pigs) need not apply! Must be unmarried and heterosexual. The ad was signed with a pseudonym, Nicole. June 2, 1981 Four men with masks mooned a UF accounting class of about 150 students. They ran into the room, dropped their pants and ran out. They could not be recognized as students. The professor who was teaching the class later told her husband about the incident. Her husband commented that he was familiar with streaking and didnt CHARMAINE MILLER

PAGE 4

Students will have the option to sign up for the service until Summer 2014, which is when Webmail will be retired, and everyone will be moved to the new service. Email addresses will be the same, and everything in Webmail will be transferred to the new system. Our Webmail is not the best, said Will Hsiung, an 18-year-old UF neurobiological sciences sophomore. It crashes very quickly, and its very hard to access, so this upgrade will probably make it easier to communicate and to collaborate. 4, ALLIGATOR TUESDAY, JUNE 4, 2013 Webmail to be retired in 2014 EMAIL, from page 1You cant really prepare for these kind of things, Dumas said. I kind of create menu ideas in my head of things that I Once the secret ingredient was announced, the chefs met with their assistants to develop a menu and began cooking in portable kitchens set up in the middle of the ballroom. They prepared the meals with food from a fully stocked pantry in the corner of the room. The winning entry came ung, who concocted rice sauteed for dessert, beer sorbet topped with peanut brittle. part of the competition was the adrenaline rush, attributed his success to the versatility of Dumas treated his loss lightheartedly. Ive had better days in the kitchen, he said to a laughing crowd. Proceeds from the $100 event tickets went to Child Advocacy Center, Childrens Home Society of Florida and Tylers Hope for a Dystonia Cure, said event coordinator Scott Costello. During the competition, attendees also sampled food from 33 area restaurant vendors. CHEF, from page 1CRIME KELCEE GRIFFISAlligator Staff WriterGainesville Police arrested a local man Sunday after he allegedly hit a pedestrian with his car and attempted to run over three others. Twenty-year-old Darrick Anthony Parker was driving west on Southwest Second Avenue about 3 a.m. when three men started to cross the road. Filipe Antonio Hernandez, 23, tried signaling the car to slow down, said one of the witnesses, who asked to remain anonymous. When the car drove by, Hernandez hit the mirror, one of the men said. Parker stopped the car in the road and got out, according to the arrest report, Fists were up, one of the men said. They were swinging at each other. Parker got back into the car and drove away, but he made a U-turn and came back, one of the men said. Parker drove onto the sidewalk toward the men at about 35 miles per hour, according to the report. The men jumped behind a clump of trees and narrowly avoided getting hit. Then, Parker drove back onto the road and struck Yatrik Vijaykumar Solanki while he was running across the street. Parker did not stop to help him, according to the report. block of Southwest Fourth Avenue, according to the report, and a witness identihe didnt intend to hurt anyone, and he said he was sorry if he did, according to the report. Parker was arrested on charges of a crash involving personal injury-failure to stop and aggravated assault. He was booked into the Alachua County Jail about 4:30 a.m. He was later released. Man arrested in hit-and-runParker

PAGE 5

TUESDAY, JUNE 4, 2013 ALLIGATOR, 5 BRIANNA WAGNERAlligator Contributing WriterSummer is in full swing, and for many UF students, that means frequent trips to Lake Wauburg. A busy summer day usually brings about 1,000 people, said Steven Whitman, graduate assistant for Lake Wauburg. The parks major event for the season is the Climbing Wall Challenge. The second annual challenge invites participants to climb the heights of wellknown national structures on the South Shores climbing wall. According to the RecSports website, this summers challenge is to climb its wall 28 times, which equals the heights of the Statue of Liberty, the St. Louis Arch and the Seattle Space Needle. The climbs combined equal 1,539 feet. The challenge ends July complete it get a free T-shirt. Last year we had about 100 people try it, said Whitman. But only 25 actually Participants must reach the top of the 55-foot wall each time and cannot climb more than six routes in one day. Climbers of all levels are able to take on the challenge, Whitman said. There are 19 routes ranging from very easy to very hard. Hard walls ascend at a negative slope and easy walls ascend at a positive slope. Patrick Hickey, a 22-yearold UF mechanical engineering senior completed the challenge last year. I climbed the Empire State Building, he said. After going out there a few times, I felt like I could complete the challenge if I put my mind to it. It was a fun experience. If there is thunder, lightning or heavy rain, the staff will close down the climbing wall. One of the biggest challenges was getting there on a day when it was not going to rain, Hickey said. The challenge is not open to non-UF students. The climbing wall is open Thursdays and Fridays from 1 p.m. to 5:30 p.m. and from 10 a.m. to 5:30 p.m. on Saturdays and Sundays. They say Lake Wauburg is UFs best-kept secret, Whitman said. Were here, were open, and we have plenty of stuff for people to do.Students get high at Lake Wauburg JK, theyre wall-climbingLOCAL KELCEE GRIFFISAlligator Staff WriterHIGH SPRINGS To save a 103-year-old theater, Janet Alligood said it took more than just seeing. It took believing. When major movie companies the type the Priest Theater in High Springs plays would be discontinued by the end of the year, Alligood and her family knew they would need to upgrade to digital. The $85,000 that the family set out to collect through an online Kickstarter campaign seemed like a looming obstacle. I was actually worried because I was keeping track of it, said Gary Blanton, a 58-year-old High Springs resident who takes his grandchildren to see movies at the Priest. The two-month campaign, which opened in early April, had collected $14,000, or about 16 percent of the Alligood said her family spread the vision for saving the theater against the odds, and it caught on. Faith is believing in something without being able to see it, Alligood said. We would tell people, Its going to happen. Were going to make things happen. During the fundraising process for the projector system, the Community Redevelopment Agency awarded the theater $40,000 for the year to restore the exterior and the foundation of the theater. Jeff Stevens, an assistant web manager for UF Health, said he posted about the theater on Facebook and Twitter. I might have sent an email to a couple celebrities who just never responded, he said, laughing. Last week, the campaign needed about $19,000, Stevens said. But donations started to pick up On Saturday, Stevens said, someone made a $10,000 donation. By 7 p.m. Monday the closing time of the online campaign the theater had raised $87,472, more than enough to upgrade the projector. Alligood said she and her family would spend Monday evening in the place they fought so hard to save selling tickets to Star Trek Into Darkness. $87,000 in donations saves theater Last year we had about 100 people try it, but only 25 actually Steven Whitmangraduate assistant for Lake WauburgAmy Stuart / Alligator Posters for CardsStudents for a Democratic Society members hold signs Friday by University Avenue and 13th Street. They demanded Florida drivers licenses for undocumented people and legalization for all immigrants.

PAGE 6

Reader responseThe views expressed here are not necessarily those of the Alligator Column EditorialTUESDAY, JUNE 4, 2013 WWW.ALLIGATOR.ORG/OPINIONS The Alligator will be withheld if the writer shows just cause. We reserve the right to edit for length, grammar, style and libel. Send letters to opinions@alligator.org, bring them to 1105 W. University Ave., or send them to P.O. Box 14257, Gainesville, FL 32604-2257. Columns of about 450 words about original topics and editorial cartoons are also welcome. Questions? Call 352-376-4458. Vote or post a message at www.alligator.org Todays question: Are you excited for a new email system? Fridays question: Do you think Butler Plaza should be expanded into a town center? 70% YES 30% NO 147 TOTAL VOTESBanning Manning:Should we protect whistleblowers?O Your long-distance relationship will failT Patrick Ryan is a UF English senior. His columns usually appear Thursdays. Matt Riva EDITOR Julia Glum MANAGING EDITORS Brandon Lee Gagne OPINIONS EDITOR Patrick Ryanopinions@alligator.org

PAGE 7

TUESDAY, JUNE 4, 2013 ALLIGATOR, 7 Benjamin Franklin is credited with coining the phrase, Those who give up their liberty for more security neither deserve liberty nor security. But what about trading liberty for entertainment? Microsoft unveiled its latest gaming console, the Xbox One, on May 21. During the reveal, I was hyped for the new console I was blown away by the EA Sports portion but things have gone downhill quickly since then. Aside from the Wii U and Xbox One, the best console name has been continued since 1991: Playstation 4. Wii U sounds like an accessory to the Wii, not a new console. Xbox sole not the third. est Xbox will require users to give up some liberty just to enjoy the system. Xbox One will need an Internet connection in order to play games. The second half quires an Internet connection except for single-player games, or anything that would actually make sense. One plan was Xbox One to connect daily, but Microsoft backpedaled and claims that needing to connect daily is a potential scenario. The liberty of being able to choose whether you want to be online evaporates with this. So the new Xbox will need to always be online to play games. It could be worse. Thats not a big deal when compared to the fact that it will force users to use the Kinect, which has a camera installed to track your movements. Especially egregious is the fact that Xbox One will always be on. Not always online again, just always on. How so? One of the ways to turn on the system is to utilize Kinects voice recognition software. Saying Xbox on is one of the ways that the console can be started. That means that technically, even when its off, the console is active, waiting for you. That either makes it gamings version of the overly attached girlfriend meme or Big Brother. Unplugging the system solves the problem, but that this is even a consideration is worrisome. The Xbox One is setting dangerous precedents left and right, both because of the points Ive listed and other plans that are in the works, such as a patent for Kinect to monitor the number of people watching a DVD and charging an additional fee if a limit is passed. E3 will reveal more information, but that may not be a good thing for Microsoft. That new information could further alienate gamers. Xbox One desperately wants to be an entertainment center instead of just a console, but in doing so, it risks losing the audience that has stood by it for so long. All of this said, by the time Xbox One is released, this could be an overreaction based on worst-case scenario speculation. The Internet community is extremely good about holding game companies accountable. Final Fantasy XIV had to be remade with a new staff because the game was absolutely terrible. LucasArts as a game developer was shut down by Disney. I would contend that this was mostly because LucasArts reputation was destroyed after attaching its name with Star Wars: The Force Unleashed 2 and Kinect Star Wars, two games that completely and utterly disappointed Star Wars fans because of how awful they were. Logan Ladnyk is a UF journalism junior. His columns appear Tuesdays.Trading liberty for new gamesColumn Logan Ladnykopinions@alligator.org

PAGE 8

8, ALLIGATOR TUESDAY, JUNE 4, 2013 THE INDUCTION IS OCT. 12. LAUREN FLANNERYAlligator Contributing WriterTwo UF professors are joining Robert De Niro, Bruce Springsteen and John Glenn in the American Academy of Arts and Sciences. Ecology professor Robert Holt and anthropology professor Michael Moseley will be inducted into the Academy on Oct. 12. Theyre the 11th and 12th members of UFs faculty elected to the Academy since the 1970s. The Academy serves as an independent research center that elects members to exchange and promote ideas, according to its website. Its like an adult version of an honor society, Holt said. He said his acceptance to the Academy came as a surprise because he wasnt even aware of his nomination. UF spokesman Steve Orlando wrote in an email that the university is proud of the professors. UF is extremely fortunate to have such gifted scholars, and this national university, he said.UF professors chosen for arts and sciences academy MATT RIVAAlligator Staff WriterGuy Harvey is well known for his marine wannabes. Perhaps less well known is his philanthropy and outreach arm, the Guy Harvey Ocean Foundation. Last week, two students from UF Levin College of Law, Caitlin Pomerance and Alexis Segal, jointly won a Guy Harvey Scholarship worth $5,000 for their work on marine management in the Bahamas. Pomerance, 23, said she grew up near the water and attended the University of Miami as an undergraduate. Pomerance and Segals roles are largely to create a link between locals and the people creating management plans for the Bahamas so is effective, Pomerance said. This is really going to allow us to go down to the Bahamas to meet everyone, which is crucial for long-term success in implementation, she said. According to the recommendation letter sent by UF Laws Conservation Clinic Director Tom Ankersen, they will be developing and implementing a marine managed area on Long Island in the Bahamas, which is about the same straight-line distance from Miami as the closest part of the Florida-Georgia border. Theyre the third and fourth students from UF to win the award since it was munications director Dorothy Zimmerman. These awards, in a very short time, have become very prestigious, she said. The other two UF students both recieved a scholarship last year. Contact Matt Riva at mriva@alligator.org.Guy Harvey gives Gators greenSegal Pomerance

PAGE 9

TUESDAY, JUNE 4, 2013 ALLIGATOR, 9

PAGE 10

BUY IT. SELL IT. FIND IT. 373-FIND TUESDAY, JUNE 4, 2013 WWW.ALLIGATOR.ORG/CLASSIFIEDSClassifieds Get that rent money rolling in. Place an ad in the Alligator Classifieds to get your place rented out. Call 373-FIND. 2 BLOCKS FROM UF!Starting @ $375/BR All inclusive! Furnished Cable Internet Utilities www.campuswalk.co 352-337-9098 8-14-25-1 Countryside 4 Bd/4 Bth furnished condo on bus route. Bball, vball, pool, spa and fitness room. $425/room, includes $50 utility allowance per/room. Ellie (561)3619600 or ebelliveau@sgczklaw.com 6-6-13-33-1 COLLEGE ROOMS STARTING AT $400.00 MONTH, 1/1, 2/2, 3/2's UTILITIES INCLUDED NO MOVE IN COST. WE DO SEMISTER LEASING Frances 352-375-8787 Rent Florida Realty 2-7-13-150-1A CLEAN ROOM$475/mo. Close to schools, shopping, banks. Nice shade tree. Serious NS student 377-5555 6-18-13-8-1 Empty Space? Find your next tenants in the Alligator Classifieds. Call 373-FIND to place your ad today! LOW COST MOVE IN Some utilities furnished. 1BR $350 $380. Call 352-372-1201 or 352-213-3901 8-1412-25-2 Deluxe, Large 1, 2, 3, 4, 5, 6, 7BR apt/ house, 60 second walk to UF. Remodeled, Old House charm. Central AC, washer/dryer included. Wood floors. With Parking. By Private Owner. 352-538-2181 lv message 8-14-13-25-2 ELLIES HOUSES Quality single family homes. Walk or bike to UF. www.ellieshouses.com 352-215-4991 or 352-215-4990 12-11-13-167-2 Now you can easily submit your classified adfor print and/or web editionsright thru our website!Just go to www.alligator.org/classifiedsVisa and Mastercard accepted. Now leasing 1 & 2 BR AptsJust off SW 20th Ave & 34th Street. 1BR/$450, 2BR/$570. Call 335-7066, visit us on Facebook or Twitter or at madisonon20th.com. 8-14-1325-2 Spacious 1, 2, & 3br starting at $475. Many floor plans, some w/ enclosed patios or balconies. Italian tile, BRs carpeted. DW, W/D hk-ups, verticals, CH/AC. Near bus rte, some walk to UF. Sec 8 accepted 352-332-7700 8-14-13-25-2 Centerpoint 1220 NW 12 ST $450 1BR/1BA 530 SQ.FT. Bike to UF through-tree lined streets or ride the bus located one block away! A true 1/1 close but far enough away from the ruckus of the student ghetto. No application fee, most pets ok. E.F.N. Properties, 352-371-3636 or www.efnproperties.com rentals@efnproperties.com 8-14-13-25-2 LAKEWOOD VILLASLarge 1,2 & 3BR floorplans starting at $665. Free Hi-Speed internet, washer/dryer, fitness center, computer lab, swimming pool etc. M-F 9-6, Sat. 10-3 700 SW 62nd Blvd. 352-371-8009 www.lakewoodvillas.com 8-14-13-25-2UPPER WESTSIDESpacious 1 & 2 bdrm luxury apts. Walking distance to UF & stadium. Now leasing for fall 2013. Free Hi-Speed internet. Parking avail. 328 NW 14th Street 352-872-4644 www.upperwestsideuf.com 8-14-13-25-2 SPYGLASSIndividual Leases. Furniture pkgs. incl Washer/Dryer & FREE Hi-Speed internet. Rates start at $399. Every unit an end unit. Mon-Fri 9-6 Sat. 10-5 701 SW 62nd Blvd. 352-373-6330 www.spyglassapts.com 8-14-13-25-2 WALK TO UF START SUMMER OR FALL Studios $450-$400 1BR/1BA $550 $525 2BR $650-$850 1 yr lease. SD, NS, NP. Call/Text 352-870-7256 gvll32601@gmail.com 6-20-13-55-2 PETS PARADISE$390 $650. No app or pet fee. 1 & 2BR, privacy fenced. SW. 352-331-2099 6-6-13-41-2 AVAILABLE Summer & Fall WALK TO UF Studios $410 1BRs $405-$510 2BRs $485 Gore Rabell Real Estate 378-1387 www.Gore-Rabell.com 8-14-13-25-2 ** LOCATION, LOCATION, LOCATION ** 1,2,3 and 4 bedroom houses & apartments available for August. All near UF. Most pets accepted. Call 870-2760 8-14-13-42-2 2br/2ba, 1000sq' house for rent in quiet n'hood; June; close to campus, downtown, I75; built-in bkcases, desk, storage; w/d; galley kitch w/ eat-in counter, stools; encl porch 3625 sw 19 street. call: 352-870-1195 6-413-25-2 COUNTRYSIDE 4BR/4BA, furnished common area. Individual leases available. Main bus route. Unit next to pool. $375/room/mo incl all utils & internet. Available mid-May. 561-718-7637 or 561-582-1031 6-20-1128-2 Walk 1 block to Shands, VA, Vet, dental, nursing, pharmacy Schools; UF Campus. $550 mo. Spacious, Pool, Laundry, One BR $550, 2 BR 650. New carpet, tile, paint, cabinets. 352 284 3873;postj@bellsouth.net 7-30-13-36-21BR cottage w/ screened porch.Low cost move in some utils furnished. $475/ mo. Call 352-372-1201 or 352-213-3901 8-14-13-25-2 **LARGE APARTMENT NEAR UF **3 or 4 bedrooms & 2 baths. Wood floors, Central heat & air. 116 NW 7th Terrace. $1175/mth. Call 870-2760 or 371-3260 7-213-14-2 Great Location! 3BR home in quiet SW area for August. Wood floors, CH/Air, carport, washer/dryer, huge yard-most pets OK. $990/ mo. Email 3912@cozygator.com; call/text (352)575-4395. Visit www.CozyGator.com 6-20-13-13-2 August: Cute vintage 3BR/2BA house on quiet street in NW; bike to UF/Downtown, wood floors,CH/AC,laundry,D/W. $1200/mo. Email Anita: 1119@cozygator.com, Call/text (352) 575-4395, visit www.cozygator.com 6-20-13-13-2 1BR/1.5BA LOFT APT Fully remodeled. Sparrow condo. Mininmum 1 year lease. Adult or grad student. No pets. $575/mo + 1 mo sec dep in advnce. Available immediately 352-339-4600 6-20-13-12-2 WALK TO CAMPUS! CLOSE TO SHANDS! 2-3-4 bedroom houses and condos avail able! Call today to set up an appointment to see your new home. Campus Realty 352692-3800 rentals.campusrealtygroup.com 7-30-13-20-2 $350 Newly Remodeled! ALL INCLUSIVE: Utils, Std CableTV, SecureWiFi, Pvt BR/BA, W/D. Full/Kitchen Furnished Common Area, 43"LCD TV/Stereo. On UF Bus Rte. OPEN MINDED. 954-854-9445, UTGcondos.comy 6-20-13-12-2 COUNTRY VILLAGE APTSGRAD STUDENTS OR UNDERGRADS 1/1, $615/mo incl water & gas. Walk-in or call 352-373-2700 8-14-13-25-2 Apt for rent 2BR/2BA, close to UF. $1100/ mo begins August 2013. Well-maintained by landlord. 2 parking spaces, W/D, no pets. Call Carolyn 352-538-3556 6-13-13-10-2 Live Across from UF! Walk to Midtown! Studios, 1 & 2 Bedrooms Apartments W/D Available* Call Today 371-7777 6-6-13-8-2 2 BEDROOM HOUSES & APARTMENTS* Close to UF & Downtown. Starting at $660/mth. Call 870-2760 8-14-11-24-2 2 bed/2 bath condo at Treehouse Village. New tile floors thru out, washer/dryer, close to UF on bus route, pool, fitness center. See www.treehousevillage.com for layout and info. Email cindy.choate@comcast.net, 813340-8982. $675/mo, $500 deposit. Most pets ok. 6-18-13-10-2 2BR/2BA w Study, Screened porch, end unit (Rockwood Villas) $750/m, close to UF, I-75, shopping and bus; partially furnished, W/D, 904.874.5774 8-29-13-30-2 1BR $500. ADORABLE, SPACIOUS, SPOTLESS, GREEN SPACE, PRIVATE PATIO; ONE STORY; NEAR DOWNTOWN & CAMPUS. QUIET; PREFER GRAD OR MATURE PERSON; NO DOGS; 1807 NW 10TH ST. AVAILABLE NOW; 352 284 3873; POSTJ@BELLSOUTH.NET 7-30-13-19-2 August: Cute & Funky upstairs loft behind Leonardo's 706, six blocks to UF/downtown, rent is $525/mo. Contact Anita: voice/text (352) 575-4395; Email: loft@cozygator.com, Visit www.cozygator.com for more info 6-2013-10-2 Several cute & clean houses & apartments available for August, located in quiet NW areas near UF/Downtown. Rates from $455 per month. Call/Text Anita: 352-575-4395; Anita@cozygator.com; www.cozygator.com 6-20-13-10-2 RIGHT PLACE RIGHT PRICE! 1br from $350 2br from $475 Close to I75,Oaks Mall, Santa Fe, RTS 75, CALL TODAY 352-332-5070 9-3-13-20-2 8 BLOCKS TO UFLarge 2BR apt. W/D, Island kitchen. Lots of parking. $750/mo Call 339-4862 8-14-1321-2 3Bd/2Ba Spacious House for Rent $1450/ mo. Features: New roof, updated kitchen & baths, wood/tile throughout, quiet neighbor hood, washer/dryer, lawn service included. Contact Amber at ufgal4186@aol.com 7-16-13-10-2 1 For Rent: Furnished 2 For Rent: Unfurnished 3 Sublease 4 Roommates 5 Real Estate 6 Furnishings 7 Computers 8 Electronics 9 Bicycles 10 For Sale 11 Motorcycles, Mopeds 12 Autos 13 Wanted 14 Help Wanted 15 Services 16 Health Services 17 Typing Services 18 Personals 19 Connections 20 Event Notices 21 Entertainment 22 Tickets 23 Rides 24 Pets 25 Lost & FoundAll real estate advertised herein is subject to the Federal Fair Housing Act, which makes it illegal to advertise any preference, limitation, or discrimination because of color, religion, sex, handicap, familial status, or national origin, or intention to make limitation, or discrimination. We will newspaper uses great care in accepting or rejecting advertising according to its suitability, we cannot verify that all advertising claims or offers are completely valid in every case and, therefore, cannot assume any responsibility for any injury or loss arising from offers and acceptance of offers of goods and/or services through any advertising contained herein.In Person:Cash, Check, MC, or Visa 1105 W. University Ave. M-F, 8am 4pmBy E-mail :By Fax: (352) 376-3015 By Mail:Call 352-373-FIND for information. Sorry, no cash by mail. MasterCard, Visa or checks only.By Phone: (352) 373-FIND M-F, 8am 4pmWhen Will Your Ad Run?Ads placed by 4 pm will appear two publica tion days later. Ads may run for any length of time and be cancelled at any time. Sorry, but there can be no refunds or credits for cancelled ads. Corrections and Cancellations: Cancellations: Call 373-FIND M-F, 8am 4pm. No refunds or credits can be given. Alligator errors: corrections before noon. THE ALLIGATOR IS ONLY RESPONSIBLE FOR THE FIRST DAY THE AD RUNS INCORRECTLY. Corrected ads will be extended one day. No refunds or credits can be given after placing the ad. Corrections called in Customer error or changes: Online:

PAGE 11

ALLIGATORDont get stuck with an extra rent payment. Advertise your subleases in the Alligator Classifieds and save yourself some cash. Call 373-FIND. IVE HAD IT WITH YOUR LOUD MUSIC! Is your roommate driving you crazy? Find a replacement in the Alligator Classifieds! Beautifully renovated, furnished condo,1 mile from UF, $369/MO includes cable, internet, utilities, pool + fitness room and on bus route, Female roommate needed, 352 262-3291 6-20-13-23-4 1BR in a 2BR/1.5BATH for $300 Monthly Grad Student or Mature Upperclassman Tanglewood Apartments 5 Minutes to UF Private Entrance, Bus Route, Laundry, Kitchen, Basketball & Tennis Courts, Utilities, Internet included 443-939-6198 7-9-13-14-4 AVAILABLE IMMEDIATELY PERFECT FOR GRAD STUDENT. 2 ROOMS, PRIVATE BATHS. 5 min to UF, laundry facilities available. $500/mo, share utilities. Call 352-284-0979 7-3013-20-4 Sell your house, condo, acreage, mobile home and much more in the ALLIGATOR CLASSIFIEDS! Reach thousands of possible buyers! Mastercard and Visa accepted over the phone, by fax, email or CHECK OUT PLACING YOUR AD THRU OUR ONLINE AT www.alligator.org. or please call 373Find (373-3463) NEW CONDOS-WALK TO UFFor Info on ALL Condos for Sale, Visit www.UFCONDOS.COM or Matt Price, University Realty, 352-281-3551 8-14-25-5 Condo in gated community fee $126 1b/1b w screen porch w storage room. club house, sports facilities, pool, sauna, Jacuzzi, fitness 24/7, new AC in 2010, Minutes from shopping, restaurants and UF. call Bomsa Florida Homes Realty&Mortgage 352 6658687 6-6-13-7-5 Concrete blk home, 2 lge bedrms,remodeled & updated. Fncd,covered patio,2nd small house for workshop,in-laws? Move in ready. Worth a look! $59,900. Irene Larsson RE Services, 352-373-2605 6-6-13-5-5 Got a new couch?. Sell your old one in the Alligator Classifieds. Call 373-FIND (3463) to place your ad today. BED QUEEN $120 ORTHOPEDIC Pillow-top, mattress & box. Name brand, new, still in plastic. Call 352-372-7490 will deliver. 8-14-13-25-6 BED FULL SIZE $100 ORTHOPEDIC Pillow-top mattress & box. New, unused, still in plastic w/warranty. Can deliver. Call 352377-9846 8-14-13-25-6 MICROFIBER SOFA & LOVESEAT $400 Brand new still packaged w/warranty. Must sell. Can deliver. Retail $1600. 352-3727490 8-14-13-25-6 BED KING $200 PILLOWTOP mattress & box springs. Orthopedic rated. Name brand, new, never been used, in plastic with warranty. Call 352-372-8588. Can deliver. 8-14-25-6 BEDROOM SET. 7pc Cherry, Queen/ king bed, dresser w/mirror, 2 nightstands, chests avail. Dovetail const. New, in boxes. Can deliver. Retail $4500, must sell, sacrifice $850 (352) 372-7490 8-14-25-6 SOFA & LOVESEAT 100% Italian leather. Brand new in plastic w/warranty. Retail $1800. Sacrifice $700. Call 352-377-9846 8-14-25-6 FUTON Solid oak mission-style frame w/mattress. New, in box. $160 332-9899 ___________________________________. DINETTE SET 5pc $120 Brand new in box. Never used. 352-377-9846 8-14-25-6 **BEDS ALL BRAND NEW** **Full $100 Queen $125 King $200** Orthopedic pillow-top sets. Brand name matching sets not used or refurbished. Still in plastic, direct from factory! 352-333-7516. 8-14-25-6 BEDQUEEN New orthopedic pillowtop mattress and boxspring set. Brand name, brand new, still in plastic with warranty. Can deliver. $130 352-377-9846. 8-14-25-6 BEDROOM SET$300 BRAND NEW Still in boxes! 5 pieces include: Headboard, Nightstand, Dresser, Mirror, Chest. Must sell, can deliver. 352-377-9846. 8-14-13-25-6 Selling computers, parts, or repair services or just looking for that new rig? Look in the Alligator Classifieds. Call 373-FIND for more information. COMPUTER & LAPTOP REPAIRS Network specialists We buy computers and laptops Working and Non-working 378-4009, 607 NW 13th Street 8-14-13-22-7 Sell your old stereo, cell phone, and more in the Electronics Section of the Alligator Classifieds. 373-FIND In the market for a new set of wheels or just looking to add a second to that collection? Want personalized handlebars or a fitted seat? Check in the Alligator Classifieds UF Surplus On-Line Auctionsare underwaybikes, computers, furniture, vehicles & more. All individuals interested in bidding go to: SURPLUS.UFL.EDU 392-0370 8-14-13-25-10GOATS FOR SALECharlie 352-514-9858 8-14-25-10 Guitars and Musical Instruments New, Used and Factory Refurbished Check Us Out Before You Buy!! Leonardo's Music, Micanopy, FL 352-450-0928 Leonardos302.com 8-14-13-25-10 Alligator Classifieds is the way to get your 2 wheels on the road. Show off your bikes, scooters, and repair services. Call 373-FIND to get your classified in. 8-14-13-25-11 NEW SCOOTERS 4 LESS Great Scooters, Service & Prices! 118 NW 14th Ave, Ste D, 336-1271 Vespa, Genuine, GMW, & More! NS4L.com facebook.com/newscooters4less 8-14-13-25-11 SCOOTER REPAIRNew Scooters 4 Less has LOW repair rates! Will repair any make/model. Close to UF! Pick-ups avail. Cheap oil changes!! 336-1271 8-14-13-25-11 Road Rat Motors Largest Scooter Store in Town! Run by Gator Grads! New scooters starting at $999. 1-2yr warranties with roadside assistance includ ed. 376-6275 RoadRatMotors.com 8-1413-25-11 Road Rat Motors offers FREE pickup service for any paid scooter repair. LOWEST labor rate, quickest turnaround in town! Will repair ANY brand scooter. Free estimates. 3766275. RoadRatMotors.com 8-14-13-25-11SCOOTER RENTALSRent for a day, week, month or semester. Now renting Buddy scooters too! 352-336-1271 www.gainesvillescooterrentals.com 8-14-13-25-11

PAGE 12

12, ALLIGATOR Campus Scooters Mobile Sales and Scooter Service. We offer free estimates on all repairs and we come to you. We also have new scooters starting at $799.00 Call us today at 352-263-0425 8-14-13-25-11 SWAMP CYCLES Experienced, Friendly, Affordable Sales/Service Scooters, Motorcycles, ATVs MMI Certfied Staff, Warranty on Repairs swampcycles.com 373-8823 633 NW 13th St 8-14-25-11 Unload your lot. Sell your cars through Alligator Advertising for cheap. 373-FIND or place your ad online at www.alligator.org/ classifieds We Buy Junk Cars Trucks, Vans Titled only Call KT 352-281-9980 or 352-215-3191 8-14-25-12 SUN CITY AUTO SALES ALL VEHICLES $0 DOWN! NO CREDIT CHECK!!!! VEHICLES $800 AND UP! 352-338-1999 8-14-25-12 SUN CITY AUTO SALES ALL VEHICLES $0 DOWN OVER 150 VEHICLES IN STOCK! CARS, TRUCKS, SUVS, & VANS! 352-338-1999 8-14-25-12 BUY FOR BLOWOUT PRICES & SAVE BIG!!!! VEHICLES STARTING $800!! PRICES NEGOTIABLE!!! 352-338-1999 8-14-25-12 88 LINCOLN TOWNCAR $1999 98 CHEVY ASTRO VAN $2999 00 DODGE INTREPID $2999 00 CHEVY CAVALIER $3999 352-338-1999 8-14-25-12 03 CHEVY MALIBU $3999 04 DODGE INTREPID $4999 04 FORD TAURUS $5999 02 FORD EXPOLORER $6999 352-338-1999 8-14-25-12 SUNRISE AUTO SALES NO CREDIT CHECKS!!! CARS, TRUCKS, SUV'S & VANS! 30 DAY WARRANTY!!! 352-375-9090 8-14-25-12 04 NISSAN SENTRA $6999 06 PONTIAC MONTANA $7999 04 GMC ENVOY $8999 04 HONDA ACCORD $8999 352-375-9090 8-14-25-12 03 NISSAN ALTIMA $8999 04 VOLVO S40 $8999 04 FORD F150 $8999 99 MERCEDES ML430 $9999 352-375-9090 8-14-25-12CASH PAID $300 AND UP!!!ANY CONDITION-RUNNING OR NOT!!! FREE TOWING & SAME DAY PICK-UP NO TITLE NEEDED. Call Brandy 352-771-6191 8-14-13-25-12 This newspaper assumes no responsibility for injury or loss arising from contacts made through advertising. We suggest that any reader who responds to advertising use caution and investigate the sincerity of the advertiser before giving out personal information or arranging meetings or investing money. GOLD GEMS ETCFree Appraisals Top Cash or Trade 40 years in Business OZZIE 352-318-4007 8-14-25-13 UF GRAD PAYS MOREfor gold jewelry, scrap gold, Rolex, diamonds, guitars, etc. Top $$$. Get my offer before you sell! Call Jim 376-8090 or 222-8090 8-14-25-13 The American Cancer Society Road to Recovery Volunteers Needed!VOLUNTEER DRIVERS NEEDEDto transport cancer patients to treatment. Flexible schedule. Training and liability insurance provided. Please call 352-240-5062 if interested. St. Francis House is a homeless shelter and soup kitchen located in downtown Gainesville, and we are looking for help from volunteers like you. St. Francis House depends on monetary support from individual donors and community businesses in order to help feed the homeless and the hungry.If you are interested in volunteering,please contact Stephanie Breval at (352) 378-9079 or sfhcoor@stfrancis.cfcoxmail.comTo make a donation by mail,please send checks payable to St. Francis House P.O. Box 12491 Gainesville, FL 32604 CASH PAID $300 AND UP!!!ANY CONDITION-RUNNING OR NOT!!! FREE TOWING & SAME DAY PICK-UP NO TITLE NEEDED CALL 352-771-6191 8-14-13-25-13 VOLUNTEERS NEEDED I AM BLIND & WOULD LIKE HELP WITH: Rides to church: Mass at Queen of Peace. Learning to rake knit hats to send to Haiti & other places. Call 352-219-6948 6-20-13-25-13 WORK AT YOUR LOCATION AND GET Up to $500/$1,000 month PT $2,000/$5,000 month FT No experience needed. Will Train! www.ecobusiness.com/sa Interviews (954) 297-0344 6-6-13-2-13 This newspaper assumes no responsibility for injury or loss arising from contacts made through advertising. We suggest that any reader who responds to advertising use caution and investigate the sincerity of the advertiser before giving out personal information or arranging meetings or investing money. WEB PRODUCTIONSeeking staff members for the web produc tion team at alligator.org. Interested candi dates should possess the following: Familiarity with media production tools such as Adobe InDesign, Photoshop, Premiere, etc. Familiarity with a web-based CMS and/or web coding basics will receive extra consideration. An ability to learn and work with new programs quickly and efficiently Deep interest in the growth and develop ment of new media Skill in producing not only the written, but audio and visual components of media segments and graphics. The desire to make a lasting impact on a UF tradition in a shifting media landscape. Send all inquiries with resume direct to Evan Walker, Managing Editor/Online at ewalker@alligator.org Daytime Advertising ProductionThe Independent Florida Alligator Advertising Production Department is accepting student applications. Duties include graphic design and organizational layout. Will train, but experience with Adobe InDesign, Photoshop and Illustrator is preferred. Friendly work environment, flexible schedule, with hours between 9 am 5 pm M-F. Must be available to work Summer C and be currently enrolled in classes. A one-year commitment is expected. Fill out an application at the front desk of The Alligator, 1105 W University Ave, M-F 9 am 5 pm. No phone calls, please. Include available work schedule and references. Previous applicants are welcome to reapply with current schedule. EOE BARTENDING$300 A DAY POTENTIALNo experience necessary, training provided. 800-965-6520 ext 138 8-14-13-25-14 Students in Accounting, Aviation, Business/ Sales and computer science needed for various positions. Flexible schedules and competitive pay. Join our team! Learn more at www.gleim.com/employment 8-14-1325-14 Food Science and Human Nutrition at the University of Florida is conducting a research study for women 20-40 yo on birth control pills. Compensation given. For details call Bonnie Coats at 273-9014 8-14-13-25-14 CUTTING-EDGE UF RESEARCH STUDY Smokers wanted (1 pack a day for 5 years) Periodontal (gum line) sampling only 5 visits over 2 years; up to 1.5 hr each visit FREE oral exam, up to $160 compensation Call: 352-392-2945 7-30-13-50-14 Go to www.IncomeAtCollege.com now to see how you can work for yourself on your own time. Don't let this opportunity pass you by! 6-11-13-15-14 ATTENTION SEDENTARY SMOKERS! UF Smoking Lab & Clinic needs you to participate in study on use of advanced devices to monitor smoking and exercise behavior. If interested, call 336-406-3706 or email fitbit10000@gmail.com 6-20-15-14 SUMMER WORK GREAT PAY$14.50 base/appt -FT/PT openings Customer sales/service all ages 17+ CALL NOW 352-505-9105 8-14-13-26-14RGIS, LLC PT Hourly Work Flexible schedules$8/hr to start, apply online at RGIS.com 6-14-13-7-14 UNIQUE BUSINESS make money with your own business-unique products-no start-up fee-set your own hours-free website-free lead page-free training-www.funtoberich. com/garya 6-13-13-10-14 Lifeguard, $12.00 hour.Requires current Red Cross Certification. Works weekends in institutional setting. Contact Grady Carthon at (352) 264-8248. 6-20-13-12-14 ASSISTANT/TUTOR Looking an energetic student (math or education major) to tutor girls ages 7, 10, 12 in math/algebra part time as well as providing clerical assistance at a 35 year old publishing company. The position can be part or full time over the summer. Tutoring will be sporadic based on the girls activities over the summer and the down time will be spent doing office support. Please apply online at www.gleim. com/employment. 8-14-13-25-14 STAY IN GAINESVILLE A 35 year old publishing company in Gainesville is looking for the following candidates: Admin Asst Software Developer Linux Administrator Customer Service/Sales Reps Marketing/Sales Accounting Editor Accounting Assistant Flight Instructor/Marketing SAT/ACT coordinator Full or part time. Please apply online at www.gleim.com/employment. 8-14-13-2514

PAGE 13

ALLIGATOR VIDEO ASSISTANT / EDITOR wanted at the University of Florida's Center for Instructional Technology and Training. The Video Assistant position requires experience with recording video, lighting, and editing with Premiere. Minimum 20 hours per week, $12.50/hr., between 8am and 6pm, M-F. Please send resume to Joe Nicholson joebn@ufl.edu. 6-14-13-5-14 University of Florida Survey Research Center 720 SW 2nd Ave. Suite 156 Mon-Fri 9am-8pm 392-2908 ext. 105 $9.00/$9.50/hr + Intentive + Paid Training Telephone Interviewing NO SALES Bilinguial SPANISH Speakers Needed http://www.bebr.ufl.edu/survey/hiring 6-6-13-6-14 Earn $15 cash for completing a 90-minute study. To get study details and find out if you qualify, e-mail Stefani at smpila@ufl.edu. After June 12, e-mail Sabra at spelham@ufl. edu. 6-20-13-9-14 DATA ENTRY/CLERICAL POSITION Full or part time Please apply in person Institute of Veterinary Spec 3603 NW 98th St. Suite A 6-6-5-14 PERSONAL TRAINING 300 Personal and Group Training Flexible Scheduling Exclusive Facility Call for a free workout 339-2199 8-14-25-15NEED A LAWYER?SiddiquiLegal.com Private Experienced Affordable 8-14-2515 HIV ANTIBODY TESTINGAlachua County Health Dept. Call 334-7960 for appt (optional $20 fee) THE TRUE YOU! Lose 8-15 pounds in 4 weeks Only $119! Gain muscle while you lose fat Groups forming now. 339-2199 8-14-25-16 SUMMER SPECIAL!! Advanced Cardiac Life Support $99 and Basic Life Support $35. American Heart Assoc. card issued. Training Gators for 17yrs!! Call (352)494-4217 or (800)319-5708 7-30-13-15-16 Another Saturday night without a date? Read The Alligator. Furry, feathery, scaly...no, not your roommate...pets. Find or advertise your pets or pet products here in the Pets section of the Alligator. IVE HAD IT WITH YOUR LOUD MUSIC! Is your roommate driving you crazy? Find a Finders Keepers? If you find something, you can place a FREE FOUND AD in our lost & found section. Be kind to someone whos lost what youve found. Call 373-FIND.Now you can easily submit your classified adfor print and/or web editionsright thru our website!Just go to www.alligator.org/classifiedsVisa and Mastercard accepted. HIV ANTIBODY TESTINGAlachua County Health Dept. Call 334-7960 for appt (optional $20 fee)Family Chiropractic Since 1977. Two blocks from U.F. 373-7070 8-14-25-18 Want to make a connection?Place your ad here to look for someone to share a common interest with or for your true love IS YOUR BUSINESS, CLUB OR ORGANIZATION HAVING AN EVENT? DO YOU HAVE A SPECIAL ANNOUNCEMENT? PLACE YOUR AD HERE AND GET IT NOTICED! Get the party started! Place your Entertainment classified today to get people up and about. Call 373-FIND. Trying to get to and from somewhere? Want to cut back on that gas bill? Place an ad or show off your bus and shuttle service. 373-FIND GET PAID TO TYPE!! Fast, accurate typists needed for audio transcription. Create your own schedule M-F, 7am to midnight. Pay based on speed and accuracy, $7.79 to over $12. Walking distance to campus. Ideal for PT and Students! Apply online: www.sbsgrp.com 7-11-13-1014 EARN UP To $67/Hr! No Previous Experience Needed. Start Right Away. Send a Text "Make EZ Money" To 90210 6-11-13-4-14 MEDICAL ASSISTANTPT for a doctor's office. Experience preferred. Email resume to: snpohani@gmail. com 6-18-13-5-14LIFEGUARD $10 hr.June 10-July 19 9am 2:30pm weekdays Email soundsop@aol.com with resume and proof of certifications 6-6-13-2-14 Want to be a CNA, phlebotomist or pharm tech? Express Training offers courses, days, eve, weekend. All classes live, no videos. Call 352-338-1193 or expresstrainingservices.com 8-14-13-25-15

PAGE 14

reached third for the remainder of the game. The pitchers were really, really, really good this weekend, Haeger said. You come here and the pitcher, its their ace every single time you face them. nale for the second consecutive year. But not all was lost. If you had asked me at the beginning of the season, Could this team do this? my answer would have been no very early and easy, Walton said. The team just got better and worked hard, got stronger. Contact Chuck Kingsbury at ckingsbury@alligator.org. 14, ALLIGATOR TUESDAY, JUNE 4, 2013 FLORIDA SHOT AN 857 (+17) OVERALL. RICHARD JOHNSONAlligator WriterThe Florida mens golf team had a week to forget at the NCAA Championships in Woodstock, Ga., and Alabama had one it will remember forever. UF put itself in a deep hole after it shot a 291 (+11) in the opening round, and the Gators never recovered. Their 857 (+17) after three rounds was good enough for only 25th place far from the eighth-place cutoff needed to advance into the weekends match play. Unfortunately, more of the same, coach Buddy Alexander said in a release. We actually got off to a great start this morning. Theres a tough stretch of holes, the 15th through the 18th. I knew if we got by that then maybe we could have a special day, but those holes just ate us alive. The last nine was just so-so. The Crimson Tides Day 1 and Day 2 scores of 275 (-5) and 276 (-4) were good enough to offset an average third round of 282 (+2). On Day 3, it ended that portion of the competition tied for third overall. After defeating New Mexico in the match Bobby Wyatts performance dominated match play at one point he won seven straight holes. He clinched his round after only 13 holes, winning 6-5. Fellow junior Cory Whitsett also exhibited at 5-up. Illini sophomore Alex Burge did not go down quietly, however, closing the gap to three holes. But in the end, a missed par putt on Hole 15 resulted in a halved hole and a conceded match to the Crimson Tide. The win is redemption for an Alabama team that came within one hole of winning the championship last season, and the title other than football. I think (what happened last year) makes it more special, Alabama coach Jay Seawell said in a release. It makes you appreciate it a great deal more. It is so hard to even get here. This team has been on a mission, a mission, a mission. That is the leadership of [senior] Scott Strohmeyer and all of the guys on this team. It is their championships, and we won today because of them.the Gators in an early hole. But Magliozzi turned his outing around, holding Valparaiso scoreless until the seventh inning, including a stretch where he retired seven straight batters. uncomfortable, Magliozzi said. Then I got in a rhythm. But the Gators lost control of the strike zone in the seventh. Magliozzi surrendered two singles and a walk to load the bases, and OSullivan brought in left-hander Daniel Gibson. The junior allowed one run to score when third baseman Josh Tobias couldnt control a ground ball. Gibson walked the next two batters on nine pitches to tie the game at 4. It just hit off my chest and kind of got behind me, Tobias said. I should have stayed down better and kept it in front to get an out, but I didnt. Sophomore Ryan Harris came in to relieve Gibson, and the Crusaders scored choice on a ball hit up the middle. Although the Gators trailed, they still had opportunities to tie and possibly win on Saturday. Tobias got his fourth hit of the game in the eighth and advanced to second on a walk to Zack Powers. But pinch hitter Christian Dicks struck out swinging and to end the threat. Second baseman Casey Turgeon walked to start the ninth, and Justin Shafer singled. A bunt by Vickash Ramjit advanced the runners, bringing catcher Taylor Gushue to the plate. The sophomore was mired in a 0-for-23 slump when he came to bat. He worked the count to 2-2 before he swung and missed a changeup down and away. The Gators batting leader, Harrison Bader, came up next with two outs and Floridas season on the line. The freshman also got into a 2-2 count before grounding out weakly to third. The loss eliminated the Gators from Tallahassee Regional that year. straight losses and only two wins in their last eight games. We saw both sides, assistant coach Brad Weitzel said. We played well against Ole Miss and South Carolina in there in the middle. We got hot; things went our way I thought it would carry over to the second part of the season, but it didnt. A radio broadcast contributed to this report. Contact Adam Lichtenstein at alichtenstein@alligator.org. BASE, from page 15 UF Golf SOFT, from page 15 BASEBALL

PAGE 15

TUESDAY, JUNE 4, 2013 WWW.ALLIGATORSPORTS.ORG Steve Spurrier received an award at Ben Hill Thursday. Read the story online at alligator.org.Baseball players awarded Gators in the NWSL CHUCK KINGSBURY Ryan Jones / Alligator StaffSophomore Lauren Haeger swings and misses against FSU at Katie Seashole Pressly Stadium on March 27. Haeger went 0 for 2 in Floridas 3-0 loss to Texas in the Womens College World Series on Sunday. Longhorns pitcher blanks Gators in WCWS ADAM LICHTENSTEIN UF falls in RegionalsTRA CK AND FIELD GORDON STREISAND Florida ready for NCAA OutdoorsSEE BASE, P A GE 14Holloway Johnny MagliozziUF starterSEE SOFT, P A GE 14 UF Sof tball

PAGE 16

16, ALLIGATOR TUESDAY, JUNE 4, 2013



PAGE 1

FORECAST 2 OPINIONS 6 the AVENUE 10 CLASSIFIEDS 15 CROSSWORD 19 SPORTS 23 VOLUME 107 ISSUE 150 WWW.ALLIGATOR.ORG TUESDAY, JUNE 4, 2013 Today We Inform. You Decide.Not officially associated with the University of Florida Published by Campus Communications, Inc. of Gainesville, Florida 94 /84 $87,000 in Kickstarter donations saves theaterIt raised most of the money in the last month, pg 5. UF professors chosen for arts and sciences academyTheyll join Robert De Niro and Bruce Springsteen, pg 8. Gators eliminated from WCWSFlorida batters struck out 14 times in a 3-0 loss to Texas in the Womens College World Series on Sunday, pg 15. Sunscreen labels are changing. Read the story on page 3. Ryan Jones / Alligator StaffKnight RidersLiz Jones, left, breaks her lance on an opponents shield during a Knights of Mayhem jousting tournament at Patriots Ranch in Florahome, Fla., on Sunday. ELLEN VILLAFUERTEAlligator Contributing WriterUFs Webmail will soon be a thing of the past thanks to a Although there is no set date, UF Information Technology The new service will include email, 25 GB of mailbox storage, an integrated calendar and access to UFs global email adReducing the universitys carbon footprint and electricity bill as well as providing more storage and portability for students and faculty are among the many reasons UF is making the switch to the cloud, said Tracy Gale, UFIT communications The way that email is set up here there are dozens of email services so the time to manage that and the software By the start of the Fall semester, Microsoft SharePoint will beBecause the entire service is Internet-based, there will be no needed, it also is kind of like a one-stop shop that allows for betMicrosoft Lync, an instant message service, will also be availMicrosoft SkyDrive Cloud storage and browser-based verI think this new email service will be much better, said The goal is to move about 2,000 students per week to the Microsoft Office 365 to replace UF Webmail system PATRICK KELLYAlligator Contributing WriterWatch out while jaywalking local police In May, members of the Gainesville Police can Grill at the intersection of West University Avenue and Northwest 15th Street writing The longer we stay here, though, the a pedestrian shall obey the instructions of applicable to the pedestrian unless otherwise Madelyn Thiele, a 20-year-old UF mathematics junior, was one of the students who Thiele said the polices efforts to encourage lawful use of the crosswalks are in vain because people will continue to cross streets at GPD issues tickets for jaywalking near UF campusCAMPUS SWAMP HEAD BEER WAS THE SECRET INGREDIENT. OLIVIA LANGDONAlligator Contributing WriterThe room was silent as an eager crowd circled a covered table in the watched as the announcer counted down to unveil the secret ingredient: The Iron Chef Gainesville competition began at the Hilton University Taste of Gainesville and HOME Magazine held its fourth annual fundraising event Sunday evening, The main attraction was a local rendition of the Food Network show Iron Chef America, judged by previous winners from another The three competing executive chefs had one hour to prepare an appetizer, main course and dessert incorporating locally brewed Swamp ries and coffee were the secret ingreTwo-time defending champion Briton Dumas, executive chef at Embers Wood Grill, was up against two new contenders: Ray Leung, and Patrick Jones, executive chef at The longer we stay here, though, the more folks start using the crosswalk. Thats the whole point.Joe RaulersonGainesville Police sergeant SEE CHEF, PAGE 4 SEE EMAIL, PAGE 4Leung

PAGE 2

News Today Subscription Rate: Full Year (All Semesters) $100The Independent Florida Alligator is a student newspaper serving the University of Florida, pubThe Alligator The Alligator is The Alligator VOLUME 107 ISSUE 150 ISSN 0889-2423 The Alligator The Alligator 2, ALLIGATOR TUESDAY, JUNE 4, 2013 SATURDAY FRIDAY THURSDAY WEDNESDAY TODAYFORECASTTHUNDER STORMS 91/73 THUNDER STORMS 89/74 THUNDERSTORMS 83/72 THUNDER STORMS 86/72 THUNDER STORMS 87/70 WHATS HAPPENING?Life (and Pet) planning seminar From 6 p.m. to 7:30 p.m. at the Millhopper Branch Library, the Roark Law Firm is hosting a free and open discussion about wills, trusts, living wills, pet trusts and the steps people can take to reduce the burdens created by the death or incapacity of a loved one. The firm will talk about what happens if people pass away or become incapacitated in Florida and also touch on a couple of things parents can put in place for their children. The talk will also focus on what people can do to better provide for the care of pets in the event of death or disability. Drinks and snacks will be provided and a Q-and-A session will follow. OAS talent show Come out to the OAS Summer Talent Show on July 6. Participants will be judged for originality, content, presentation, audience response and overall talent. Applications are available on the Application Clearinghouse at www.studentinvolvement.ufl.edu/Resources/ ApplicationClearinghouse. Contact Urvashi Singh at urvashisingh78@ufl.edu for more information. Got something going on? Want to see it in this space? Send an email with Whats Happening in the subject line and 150 words or fewer about the event to jglum@alligator.org. To ensure publication in the next days newspaper, please submit before 5 p.m. and model your submission after above events. Improperly formatted Whats Happening submissions may not appear in the paper.BRIEFSMatt Smith leaving lead role in BBCs Doctor WhoLONDON Who will be the new Who? The BBC says Matt Smith is stepping down from the lead role tor Who, spurring intense speculation about his replacement. The broadcaster said Sunday that Smith will leave after a November episode to mark the shows 50th anniversary and a Christmas special. The titular Doctor is a timetraveling, extra-terrestrial Time Lord who can regenerate into new bodies. Smith is the 11th actor to play the character since the series began in 1963. Smith, who took over the role from David Tennant in 2010, said playing the Doctor had been the most brilliant experience for me as an actor and a bloke. Doctor Who is one of the BBCs most popular programs, of a Danube steamboat company captain. DPA reports such words have been so rarely used, however, that theyre not in the dictionary. There the longest word honor tversicherung: automobile liability insurance.For sale in NYC: fridge with morbid history NEW YORK Its a fridge big enough for a family of four. Services has turned to eBay in an attempt to sell off a huge, steel morgue refrigerator now located at a Manhattan psychiatric hospital. Bidding on Saturday afternoon was up to $475 for the four-drawer unit, but that price doesnt include delivery. Buyers have to be willing to remove the fridge themselves from the Manhattan Psychiatric Center. tells the New York Post that the ad is no hoax. She says the agency does get unusual surplus items to sell from time to time, including barber chairs from prisons and police cars, but she doesnt recall a previous sale of a morgue cooler. The auction runs through June 6.Austrian drives flaming car to fire station VIENNA (AP) Some Ausleave their station to deal with a recent alarm. The blaze came to them instead. Fireman Roland Brandl says that colleagues were doing chores at the station in the town of Pregarten on Wednesday when a from beneath it. One man grabbed an extinone was hurt. The blaze was apparently caused by a cleaning cloth which was left under the hood. State broadcaster ORF says the 1 kilometer (0.6 mile) to the station after a passer-by alerted him THE ASSOCIATED PRESS and Smiths tenure has seen the show gain new fans in the United States, where it is shown on BBC America. The BBC did not announce Smiths replacement, but fans took to the Internet to speculate about casting of the 12th Doctor. Bookmaker William Hill made Being Human star Russell Tovey and Harry Potfavorites, followed by stage star Rory Kinnear and Homeland actor David Harewood. William Hill also offered 8-1 odds on the next Doctor being female.Cat detained on illegal mission at Russian prison MOSCOW Inmates at Russias prisons have been known to bribe guards to obtain cellphones, but this may be cat as an accomplice. colony in Russias north saw a cat on the fence and it seemed to be carrying something. On a closer look, they found a few cellphones and chargers taped to the cats belly. The federal prison service said Monday that this happened on Friday at the Penal Colony No. 1 near the city of Syktyvkar in the Komi province, 1,000 kilometers (some 600 miles) northeast of Moscow. It wasnt clear how the cat was supposed to drop off its loot.Law change kills Germanys longest wordBERLIN A tweak to state Mecklenburg-Western Pomerania to conform with current EU regulations has caused an unexpected casualty: the longest tierungsueberwachungsaufgabenuebertragungsgesetz is no more. The law delegating beef label monitoring was introduced by the state in 1999 as part of measures against mad cow disease. But the DPA news agency reported Monday the law was removed from the books last week because European Union regulations have changed. like the very robust Donaudampfschifffahrtsgesellschaftskapitaenswitwe to fall back on meaning widow Melissa Kahan, Kelsey Meany, VOLUME 107 ISSUE 150

PAGE 3

JEANNA ARROYOAlligator Contributing WriterNew labels on sunscreen designed to shine light on the effects of the suns rays will soon hit shelves. The Food and Drug Administration recently issued new regulations for sunscreen manufacturers to promote more accurate labeling of products. Catherine Seemann, communications coordinator at the UF Student Health Care Center, said knowing which sunscreen to choose can be overwhelming. You walk into a drugstore, and it is a wall a giant wall of sunscreen products from oils to zinc, she said, How do you make that decision? One of the new labeling terms consumers can look for is the phrase broad spectrum protection. This means sunscreen is at least above a sun protection factor, SPF, of 15 and protects against both types of ultraviolet light: UVA and UVB rays. Also under the new regulations, sunscreen products that are not broad spectrum or that are broad spectrum with SPF values 14 and below will be labeled with a warning that says Skin Cancer/Skin Aging Alert, according to an FDA press release. Sunscreens will no longer use the words sunblock, waterproof or sweatproof, according to the release. consumers will see a direct connection between sunscreen and prevention of those risks, said Dr. Christina L. Mitchell, assistant clinical professor of dermatology at UF. Hopefully, this will make people think more about what they are choosing to put on their skin as a sunscreen and make them ing, Mitchell said. We hope that people TUESDAY, JUNE 4, 2013 ALLIGATOR, 3 Kali Kavouklis / AlligatorUF medical student Maryam Davoodi-Semiromi and UF psychology freshman Alexis Lopez lie out by Broward Pool on May 22. NATIONALSunscreen labels changing June 7, 1966 The Alachua County Election Supervisor told the Alligator married students had better chances of registering to vote in Alachua County than their single counterparts. This is because being married seemed to point toward an intent to permanently live in Gainesville. According to the Florida Constitution, a voter must be in the state for a year and in the county for six months. June 1, 1979 Three women, roommates in UFs Buckman Hall, took out an ad in the Alligator in search of love. The ad read: WANTED: one of the male human species for the purpose of deep friendship, moderate relationship, must possess the following qualities: game playing, intelligence, wit, enjoys fooling around but not making it an olympic marathon...looks not relevant other than not excessively short or tall, not super zit-faced or extremely ugly, MCPs (male chauvinist pigs) need not apply! Must be unmarried and heterosexual. The ad was signed with a pseudonym, Nicole. June 2, 1981 Four men with masks mooned a UF accounting class of about 150 students. They ran into the room, dropped their pants and ran out. They could not be recognized as students. The professor who was teaching the class later told her husband about the incident. Her husband commented that he was familiar with streaking and didnt CHARMAINE MILLER

PAGE 4

Students will have the option to sign up for the service until Summer 2014, which is when Webmail will be retired, and everyone will be moved to the new service. Email addresses will be the same, and everything in Webmail will be transferred to the new system. Our Webmail is not the best, said Will Hsiung, an 18-year-old UF neurobiological sciences sophomore. It crashes very quickly, and its very hard to access, so this upgrade will probably make it easier to communicate and to collaborate. 4, ALLIGATOR TUESDAY, JUNE 4, 2013 Webmail to be retired in 2014 EMAIL, from page 1You cant really prepare for these kind of things, Dumas said. I kind of create menu ideas in my head of things that I Once the secret ingredient was announced, the chefs met with their assistants to develop a menu and began cooking in portable kitchens set up in the middle of the ballroom. They prepared the meals with food from a fully stocked pantry in the corner of the room. The winning entry came ung, who concocted rice sauteed for dessert, beer sorbet topped with peanut brittle. part of the competition was the adrenaline rush, attributed his success to the versatility of Dumas treated his loss lightheartedly. Ive had better days in the kitchen, he said to a laughing crowd. Proceeds from the $100 event tickets went to Child Advocacy Center, Childrens Home Society of Florida and Tylers Hope for a Dystonia Cure, said event coordinator Scott Costello. During the competition, attendees also sampled food from 33 area restaurant vendors. CHeEF, from page 1CCRIME KELCEE GRIFFISAlligator Staff WriterGainesville Police arrested a local man Sunday after he allegedly hit a pedestrian with his car and attempted to run over three others. Twenty-year-old Darrick Anthony Parker was driving west on Southwest Second Avenue about 3 a.m. when three men started to cross the road. Filipe Antonio Hernandez, 23, tried signaling the car to slow down, said one of the witnesses, who asked to remain anonymous. When the car drove by, Hernandez hit the mirror, one of the men said. Parker stopped the car in the road and got out, according to the arrest report, Fists were up, one of the men said. They were swinging at each other. Parker got back into the car and drove away, but he made a U-turn and came back, one of the men said. Parker drove onto the sidewalk toward the men at about 35 miles per hour, according to the report. The men jumped behind a clump of trees and narrowly avoided getting hit. Then, Parker drove back onto the road and struck Yatrik Vijaykumar Solanki while he was running across the street. Parker did not stop to help him, according to the report. block of Southwest Fourth Avenue, according to the report, and a witness identihe didnt intend to hurt anyone, and he said he was sorry if he did, according to the report. Parker was arrested on charges of a crash involving personal injury-failure to stop and aggravated assault. He was booked into the Alachua County Jail about 4:30 a.m. He was later released. Man arrested in hit-and-runParker

PAGE 5

TUESDAY, JUNE 4, 2013 ALLIGATOR, 5 BRIANNA WAGNERAlligator Contributing WriterSummer is in full swing, and for many UF students, that means frequent trips to Lake Wauburg. A busy summer day usually brings about 1,000 people, said Steven Whitman, graduate assistant for Lake Wauburg. The parks major event for the season is the Climbing Wall Challenge. The second annual challenge invites participants to climb the heights of wellknown national structures on the South Shores climbing wall. According to the RecSports website, this summers challenge is to climb its wall 28 times, which equals the heights of the Statue of Liberty, the St. Louis Arch and the Seattle Space Needle. The climbs combined equal 1,539 feet. The challenge ends July complete it get a free T-shirt. Last year we had about 100 people try it, said Whitman. But only 25 actually Participants must reach the top of the 55-foot wall each time and cannot climb more than six routes in one day. Climbers of all levels are able to take on the challenge, Whitman said. There are 19 routes ranging from very easy to very hard. Hard walls ascend at a negative slope and easy walls ascend at a positive slope. Patrick Hickey, a 22-yearold UF mechanical engineering senior completed the challenge last year. I climbed the Empire State Building, he said. After going out there a few times, I felt like I could complete the challenge if I put my mind to it. It was a fun experience. If there is thunder, lightning or heavy rain, the staff will close down the climbing wall. One of the biggest challenges was getting there on a day when it was not going to rain, Hickey said. The challenge is not open to non-UF students. The climbing wall is open Thursdays and Fridays from 1 p.m. to 5:30 p.m. and from 10 a.m. to 5:30 p.m. on Saturdays and Sundays. They say Lake Wauburg is UFs best-kept secret, Whitman said. Were here, were open, and we have plenty of stuff for people to do.Students get high at Lake Wauburg JK, theyre wall-climbingLOCAL KELCEE GRIFFISAlligator Staff WriterHIGH SPRINGS To save a 103-year-old theater, Janet Alligood said it took more than just seeing. It took believing. When major movie companies the type the Priest Theater in High Springs plays would be discontinued by the end of the year, Alligood and her family knew they would need to upgrade to digital. The $85,000 that the family set out to collect through an online Kickstarter campaign seemed like a looming obstacle. I was actually worried because I was keeping track of it, said Gary Blanton, a 58-year-old High Springs resident who takes his grandchildren to see movies at the Priest. The two-month campaign, which opened in early April, had collected $14,000, or about 16 percent of the Alligood said her family spread the vision for saving the theater against the odds, and it caught on. Faith is believing in something without being able to see it, Alligood said. We would tell people, Its going to happen. Were going to make things happen. During the fundraising process for the projector system, the Community Redevelopment Agency awarded the theater $40,000 for the year to restore the exterior and the foundation of the theater. Jeff Stevens, an assistant web manager for UF Health, said he posted about the theater on Facebook and Twitter. I might have sent an email to a couple celebrities who just never responded, he said, laughing. Last week, the campaign needed about $19,000, Stevens said. But donations started to pick up On Saturday, Stevens said, someone made a $10,000 donation. By 7 p.m. Monday the closing time of the online campaign the theater had raised $87,472, more than enough to upgrade the projector. Alligood said she and her family would spend Monday evening in the place they fought so hard to save selling tickets to Star Trek Into Darkness. $87,000 in donations saves theater Last year we had about 100 people try it, but only 25 actually Steven Whitmangraduate assistant for Lake WauburgAmy Stuart / Alligator Posters for CardsStudents for a Democratic Society members hold signs Friday by University Avenue and 13th Street. They demanded Florida drivers licenses for undocumented people and legalization for all immigrants.

PAGE 6

Reader responseThe views expressed here are not necessarily those of the Alligator Column EditorialTUESDAY, JUNE 4, 2013 WWW.ALLIGATOR.ORG/OPINIONS The Alligator will be withheld if the writer shows just cause. We reserve the right to edit for length, grammar, style and libel. Send letters to opinions@alligator.org, bring them to 1105 W. University Ave., or send them to P.O. Box 14257, Gainesville, FL 32604-2257. Columns of about 450 words about original topics and editorial cartoons are also welcome. Questions? Call 352-376-4458. Vote or post a message at www.alligator.org Todays question: Are you excited for a new email system? Fridays question: Do you think Butler Plaza should be expanded into a town center? 70% YES 30% NO 147 TOTAL VOTESBanning Manning:Should we protect whistleblowers?O Your long-distance relationship will failT Patrick Ryan is a UF English senior. His columns usually appear Thursdays. Matt Riva EDITOR Julia Glum MANAGING EDITORS Brandon Lee Gagne OPINIONS EDITOR Patrick Ryanopinions@alligator.org

PAGE 7

TUESDAY, JUNE 4, 2013 ALLIGATOR, 7 Benjamin Franklin is credited with coining the phrase, Those who give up their liberty for more security neither deserve liberty nor security. But what about trading liberty for entertainment? Microsoft unveiled its latest gaming console, the Xbox One, on May 21. During the reveal, I was hyped for the new console I was blown away by the EA Sports portion but things have gone downhill quickly since then. Aside from the Wii U and Xbox One, the best console name has been continued since 1991: Playstation 4. Wii U sounds like an accessory to the Wii, not a new console. Xbox sole not the third. est Xbox will require users to give up some liberty just to enjoy the system. Xbox One will need an Internet connection in order to play games. The second half quires an Internet connection except for single-player games, or anything that would actually make sense. One plan was Xbox One to connect daily, but Microsoft backpedaled and claims that needing to connect daily is a potential scenario. The liberty of being able to choose whether you want to be online evaporates with this. So the new Xbox will need to always be online to play games. It could be worse. Thats not a big deal when compared to the fact that it will force users to use the Kinect, which has a camera installed to track your movements. Especially egregious is the fact that Xbox One will always be on. Not always online again, just always on. How so? One of the ways to turn on the system is to utilize Kinects voice recognition software. Saying Xbox on is one of the ways that the console can be started. That means that technically, even when its off, the console is active, waiting for you. That either makes it gamings version of the overly attached girlfriend meme or Big Brother. Unplugging the system solves the problem, but that this is even a consideration is worrisome. The Xbox One is setting dangerous precedents left and right, both because of the points Ive listed and other plans that are in the works, such as a patent for Kinect to monitor the number of people watching a DVD and charging an additional fee if a limit is passed. E3 will reveal more information, but that may not be a good thing for Microsoft. That new information could further alienate gamers. Xbox One desperately wants to be an entertainment center instead of just a console, but in doing so, it risks losing the audience that has stood by it for so long. All of this said, by the time Xbox One is released, this could be an overreaction based on worst-case scenario speculation. The Internet community is extremely good about holding game companies accountable. Final Fantasy XIV had to be remade with a new staff because the game was absolutely terrible. LucasArts as a game developer was shut down by Disney. I would contend that this was mostly because LucasArts reputation was destroyed after attaching its name with Star Wars: The Force Unleashed 2 and Kinect Star Wars, two games that completely and utterly disappointed Star Wars fans because of how awful they were. Logan Ladnyk is a UF journalism junior. His columns appear Tuesdays.Trading liberty for new gamesColumn Logan Ladnykopinions@alligator.org

PAGE 8

8, ALLIGATOR TUESDAY, JUNE 4, 2013 THE INDUCTION IS OCT. 12. LAUREN FLANNERYAlligator Contributing WriterTwo UF professors are joining Robert De Niro, Bruce Springsteen and John Glenn in the American Academy of Arts and Sciences. Ecology professor Robert Holt and anthropology professor Michael Moseley will be inducted into the Academy on Oct. 12. Theyre the 11th and 12th members of UFs faculty elected to the Academy since the 1970s. The Academy serves as an independent research center that elects members to exchange and promote ideas, according to its website. Its like an adult version of an honor society, Holt said. He said his acceptance to the Academy came as a surprise because he wasnt even aware of his nomination. UF spokesman Steve Orlando wrote in an email that the university is proud of the professors. UF is extremely fortunate to have such gifted scholars, and this national university, he said.UF professors chosen for arts and sciences academy MATT RIVAAlligator Staff WriterGuy Harvey is well known for his marine wannabes. Perhaps less well known is his philanthropy and outreach arm, the Guy Harvey Ocean Foundation. Last week, two students from UF Levin College of Law, Caitlin Pomerance and Alexis Segal, jointly won a Guy Harvey Scholarship worth $5,000 for their work on marine management in the Bahamas. Pomerance, 23, said she grew up near the water and attended the University of Miami as an undergraduate. Pomerance and Segals roles are largely to create a link between locals and the people creating management plans for the Bahamas so is effective, Pomerance said. This is really going to allow us to go down to the Bahamas to meet everyone, which is crucial for long-term success in implementation, she said. According to the recommendation letter sent by UF Laws Conservation Clinic Director Tom Ankersen, they will be developing and implementing a marine managed area on Long Island in the Bahamas, which is about the same straight-line distance from Miami as the closest part of the Florida-Georgia border. Theyre the third and fourth students from UF to win the award since it was munications director Dorothy Zimmerman. These awards, in a very short time, have become very prestigious, she said. The other two UF students both recieved a scholarship last year. Contact Matt Riva at mriva@alligator.org.Guy Harvey gives Gators greenSegal Pomerance

PAGE 9

TUESDAY, JUNE 4, 2013 ALLIGATOR, 9

PAGE 10

BUY IT. SELL IT. FIND IT. 373-FIND TUESDAY, JUNE 4, 2013 WWW.ALLIGATOR.ORG/CLASSIFIEDSClassifieds Get that rent money rolling in. Place an ad in the Alligator Classifieds to get your place rented out. Call 373-FIND. 2 BLOCKS FROM UF!Starting @ $375/BR All inclusive! Furnished Cable Internet Utilities www.campuswalk.co 352-337-9098 8-14-25-1 Countryside 4 Bd/4 Bth furnished condo on bus route. Bball, vball, pool, spa and fitness room. $425/room, includes $50 utility allowance per/room. Ellie (561)3619600 or ebelliveau@sgczklaw.com  6-6-13-33-1 COLLEGE ROOMS STARTING AT $400.00 MONTH, 1/1, 2/2, 3/2's UTILITIES INCLUDED NO MOVE IN COST. WE DO SEMISTER LEASING Frances 352-375-8787 Rent Florida Realty 2-7-13-150-1A CLEAN ROOM$475/mo. Close to schools, shopping, banks. Nice shade tree. Serious NS student 377-5555 6-18-13-8-1 Empty Space? Find your next tenants in the Alligator Classifieds. Call 373-FIND to place your ad today! LOW COST MOVE IN Some utilities furnished. 1BR $350 $380. Call 352-372-1201 or 352-213-3901 8-1412-25-2 Deluxe, Large 1, 2, 3, 4, 5, 6, 7BR apt/ house, 60 second walk to UF. Remodeled, Old House charm. Central AC, washer/dryer included. Wood floors. With Parking. By Private Owner. 352-538-2181 lv message 8-14-13-25-2 ELLIES HOUSES Quality single family homes. Walk or bike to UF. www.ellieshouses.com 352-215-4991 or 352-215-4990 12-11-13-167-2 Now you can easily submit your classified adfor print and/or web editionsright thru our website!Just go to www.alligator.org/classifiedsVisa and Mastercard accepted. Now leasing 1 & 2 BR AptsJust off SW 20th Ave & 34th Street. 1BR/$450, 2BR/$570. Call 335-7066, visit us on Facebook or Twitter or at madisonon20th.com. 8-14-1325-2 Spacious 1, 2, & 3br starting at $475. Many floor plans, some w/ enclosed patios or balconies. Italian tile, BRs carpeted. DW, W/D hk-ups, verticals, CH/AC. Near bus rte, some walk to UF. Sec 8 accepted 352-332-7700 8-14-13-25-2 Centerpoint 1220 NW 12 ST $450 1BR/1BA 530 SQ.FT. Bike to UF through-tree lined streets or ride the bus located one block away! A true 1/1 close but far enough away from the ruckus of the student ghetto. No application fee, most pets ok. E.F.N. Properties, 352-371-3636 or www.efnproperties.com rentals@efnproperties.com 8-14-13-25-2 LAKEWOOD VILLASLarge 1,2 & 3BR floorplans starting at $665. Free Hi-Speed internet, washer/dryer, fitness center, computer lab, swimming pool etc. M-F 9-6, Sat. 10-3 700 SW 62nd Blvd. 352-371-8009 www.lakewoodvillas.com 8-14-13-25-2UPPER WESTSIDESpacious 1 & 2 bdrm luxury apts. Walking distance to UF & stadium. Now leasing for fall 2013. Free Hi-Speed internet. Parking avail. 328 NW 14th Street 352-872-4644 www.upperwestsideuf.com 8-14-13-25-2 SPYGLASSIndividual Leases. Furniture pkgs. incl Washer/Dryer & FREE Hi-Speed internet. Rates start at $399. Every unit an end unit. Mon-Fri 9-6 Sat. 10-5 701 SW 62nd Blvd. 352-373-6330 www.spyglassapts.com 8-14-13-25-2 WALK TO UF START SUMMER OR FALL Studios $450-$400 1BR/1BA $550 $525 2BR $650-$850 1 yr lease. SD, NS, NP. Call/Text 352-870-7256 gvll32601@gmail.com 6-20-13-55-2 PETS PARADISE$390 $650. No app or pet fee. 1 & 2BR, privacy fenced. SW. 352-331-2099 6-6-13-41-2 AVAILABLE Summer & Fall WALK TO UF Studios $410 1BRs $405-$510 2BRs $485 Gore Rabell Real Estate 378-1387 www.Gore-Rabell.com 8-14-13-25-2 ** LOCATION, LOCATION, LOCATION ** 1,2,3 and 4 bedroom houses & apartments available for August. All near UF. Most pets accepted. Call 870-2760 8-14-13-42-2 2br/2ba, 1000sq' house for rent in quiet n'hood; June; close to campus, downtown, I75; built-in bkcases, desk, storage; w/d; galley kitch w/ eat-in counter, stools; encl porch 3625 sw 19 street. call: 352-870-1195 6-413-25-2 COUNTRYSIDE 4BR/4BA, furnished common area. Individual leases available. Main bus route. Unit next to pool. $375/room/mo incl all utils & internet. Available mid-May. 561-718-7637 or 561-582-1031 6-20-1128-2 Walk 1 block to Shands, VA, Vet, dental, nursing, pharmacy Schools; UF Campus. $550 mo. Spacious, Pool, Laundry, One BR $550, 2 BR 650. New carpet, tile, paint, cabinets. 352 284 3873;postj@bellsouth.net 7-30-13-36-21BR cottage w/ screened porch.Low cost move in some utils furnished. $475/ mo. Call 352-372-1201 or 352-213-3901 8-14-13-25-2 **LARGE APARTMENT NEAR UF **3 or 4 bedrooms & 2 baths. Wood floors, Central heat & air. 116 NW 7th Terrace. $1175/mth. Call 870-2760 or 371-3260 7-213-14-2 Great Location! 3BR home in quiet SW area for August. Wood floors, CH/Air, carport, washer/dryer, huge yard-most pets OK. $990/ mo. Email 3912@cozygator.com; call/text (352)575-4395. Visit www.CozyGator.com 6-20-13-13-2 August: Cute vintage 3BR/2BA house on quiet street in NW; bike to UF/Downtown, wood floors,CH/AC,laundry,D/W. $1200/mo. Email Anita: 1119@cozygator.com, Call/text (352) 575-4395, visit www.cozygator.com 6-20-13-13-2 1BR/1.5BA LOFT APT Fully remodeled. Sparrow condo. Mininmum 1 year lease. Adult or grad student. No pets. $575/mo + 1 mo sec dep in advnce. Available immediately 352-339-4600 6-20-13-12-2 WALK TO CAMPUS! CLOSE TO SHANDS! 2-3-4 bedroom houses and condos available! Call today to set up an appointment to see your new home. Campus Realty 352692-3800 rentals.campusrealtygroup.com 7-30-13-20-2 $350 Newly Remodeled! ALL INCLUSIVE: Utils, Std CableTV, SecureWiFi, Pvt BR/BA, W/D. Full/Kitchen Furnished Common Area, 43"LCD TV/Stereo. On UF Bus Rte. OPEN MINDED. 954-854-9445, UTGcondos.comy 6-20-13-12-2 COUNTRY VILLAGE APTSGRAD STUDENTS OR UNDERGRADS 1/1, $615/mo incl water & gas. Walk-in or call 352-373-2700 8-14-13-25-2 Apt for rent 2BR/2BA, close to UF. $1100/ mo begins August 2013. Well-maintained by landlord. 2 parking spaces, W/D, no pets. Call Carolyn 352-538-3556 6-13-13-10-2 Live Across from UF! Walk to Midtown! Studios, 1 & 2 Bedrooms Apartments W/D Available* Call Today 371-7777 6-6-13-8-2 2 BEDROOM HOUSES & APARTMENTS* Close to UF & Downtown. Starting at $660/mth. Call 870-2760 8-14-11-24-2 2 bed/2 bath condo at Treehouse Village. New tile floors thru out, washer/dryer, close to UF on bus route, pool, fitness center. See www.treehousevillage.com for layout and info. Email cindy.choate@comcast.net, 813340-8982. $675/mo, $500 deposit. Most pets ok. 6-18-13-10-2 2BR/2BA w Study, Screened porch, end unit (Rockwood Villas) $750/m, close to UF, I-75, shopping and bus; partially furnished, W/D, 904.874.5774 8-29-13-30-2 1BR $500. ADORABLE, SPACIOUS, SPOTLESS, GREEN SPACE, PRIVATE PATIO; ONE STORY; NEAR DOWNTOWN & CAMPUS. QUIET; PREFER GRAD OR MATURE PERSON; NO DOGS; 1807 NW 10TH ST. AVAILABLE NOW; 352 284 3873; POSTJ@BELLSOUTH.NET 7-30-13-19-2 August: Cute & Funky upstairs loft behind Leonardo's 706, six blocks to UF/downtown, rent is $525/mo. Contact Anita: voice/text (352) 575-4395; Email: loft@cozygator.com, Visit www.cozygator.com for more info 6-2013-10-2 Several cute & clean houses & apartments available for August, located in quiet NW areas near UF/Downtown. Rates from $455 per month. Call/Text Anita: 352-575-4395; Anita@cozygator.com; www.cozygator.com 6-20-13-10-2 RIGHT PLACE RIGHT PRICE! 1br from $350 2br from $475 Close to I75,Oaks Mall, Santa Fe, RTS 75, CALL TODAY 352-332-5070 9-3-13-20-2 8 BLOCKS TO UFLarge 2BR apt. W/D, Island kitchen. Lots of parking. $750/mo Call 339-4862 8-14-1321-2 3Bd/2Ba Spacious House for Rent $1450/ mo. Features: New roof, updated kitchen & baths, wood/tile throughout, quiet neighborhood, washer/dryer, lawn service included. Contact Amber at ufgal4186@aol.com 7-16-13-10-2 1 For Rent: Furnished 2 For Rent: Unfurnished 3 Sublease 4 Roommates 5 Real Estate 6 Furnishings 7 Computers 8 Electronics 9 Bicycles 10 For Sale 11 Motorcycles, Mopeds 12 Autos 13 Wanted 14 Help Wanted 15 Services 16 Health Services 17 Typing Services 18 Personals 19 Connections 20 Event Notices 21 Entertainment 22 Tickets 23 Rides 24 Pets 25 Lost & FoundAll real estate advertised herein is subject to the Federal Fair Housing Act, which makes it illegal to advertise any preference, limitation, or discrimination because of color, religion, sex, handicap, familial status, or national origin, or intention to make limitation, or discrimination. We will newspaper uses great care in accepting or rejecting advertising according to its suitability, we cannot verify that all advertising claims or offers are completely valid in every case and, therefore, cannot assume any responsibility for any injury or loss arising from offers and acceptance of offers of goods and/or services through any advertising contained herein.In Person:Cash, Check, MC, or Visa 1105 W. University Ave. M-F, 8am 4pmBy E-mail :By Fax: (352) 376-3015 By Mail:Call 352-373-FIND for information. Sorry, no cash by mail. MasterCard, Visa or checks only.By Phone: (352) 373-FIND M-F, 8am 4pmWhen Will Your Ad Run?Ads placed by 4 pm will appear two publication days later. Ads may run for any length of time and be cancelled at any time. Sorry, but there can be no refunds or credits for cancelled ads. Corrections and Cancellations: Cancellations: Call 373-FIND M-F, 8am 4pm. No refunds or credits can be given. Alligator errors: corrections before noon. THE ALLIGATOR IS ONLY RESPONSIBLE FOR THE FIRST DAY THE AD RUNS INCORRECTLY. Corrected ads will be extended one day. No refunds or credits can be given after placing the ad. Corrections called in Customer error or changes: Online:

PAGE 11

ALLIGATORDont get stuck with an extra rent payment. Advertise your subleases in the Alligator Classifieds and save yourself some cash. Call 373-FIND. IVE HAD IT WITH YOUR LOUD MUSIC! Is your roommate driving you crazy? Find a replacement in the Alligator Classifieds! Beautifully renovated, furnished condo,1 mile from UF, $369/MO includes cable, internet, utilities, pool + fitness room and on bus route, Female roommate needed, 352 262-3291 6-20-13-23-4 1BR in a 2BR/1.5BATH for $300 Monthly Grad Student or Mature Upperclassman Tanglewood Apartments 5 Minutes to UF Private Entrance, Bus Route, Laundry, Kitchen, Basketball & Tennis Courts, Utilities, Internet included 443-939-6198 7-9-13-14-4 AVAILABLE IMMEDIATELY PERFECT FOR GRAD STUDENT. 2 ROOMS, PRIVATE BATHS. 5 min to UF, laundry facilities available. $500/mo, share utilities. Call 352-284-0979 7-3013-20-4 Sell your house, condo, acreage, mobile home and much more in the ALLIGATOR CLASSIFIEDS! Reach thousands of possible buyers! Mastercard and Visa accepted over the phone, by fax, email or CHECK OUT PLACING YOUR AD THRU OUR ONLINE AT www.alligator.org. or please call 373Find (373-3463) NEW CONDOS-WALK TO UFFor Info on ALL Condos for Sale, Visit www.UFCONDOS.COM or Matt Price, University Realty, 352-281-3551 8-14-25-5 Condo in gated community fee $126 1b/1b w screen porch w storage room. club house, sports facilities, pool, sauna, Jacuzzi, fitness 24/7, new AC in 2010, Minutes from shopping, restaurants and UF. call Bomsa Florida Homes Realty&Mortgage 352 6658687 6-6-13-7-5 Concrete blk home, 2 lge bedrms,remodeled & updated. Fncd,covered patio,2nd small house for workshop,in-laws? Move in ready. Worth a look! $59,900. Irene Larsson RE Services, 352-373-2605 6-6-13-5-5 Got a new couch?. Sell your old one in the Alligator Classifieds. Call 373-FIND (3463) to place your ad today. BED QUEEN $120 ORTHOPEDIC Pillow-top, mattress & box. Name brand, new, still in plastic. Call 352-372-7490 will deliver. 8-14-13-25-6 BED FULL SIZE $100 ORTHOPEDIC Pillow-top mattress & box. New, unused, still in plastic w/warranty. Can deliver. Call 352377-9846 8-14-13-25-6 MICROFIBER SOFA & LOVESEAT $400 Brand new still packaged w/warranty. Must sell. Can deliver. Retail $1600. 352-3727490 8-14-13-25-6 BED KING $200 PILLOWTOP mattress & box springs. Orthopedic rated. Name brand, new, never been used, in plastic with warranty. Call 352-372-8588. Can deliver. 8-14-25-6 BEDROOM SET. 7pc Cherry, Queen/ king bed, dresser w/mirror, 2 nightstands, chests avail. Dovetail const. New, in boxes. Can deliver. Retail $4500, must sell, sacrifice $850 (352) 372-7490 8-14-25-6 SOFA & LOVESEAT 100% Italian leather. Brand new in plastic w/warranty. Retail $1800. Sacrifice $700. Call 352-377-9846 8-14-25-6 FUTON Solid oak mission-style frame w/mattress. New, in box. $160 332-9899 ___________________________________. DINETTE SET 5pc $120 Brand new in box. Never used. 352-377-9846 8-14-25-6 **BEDS ALL BRAND NEW** **Full $100 Queen $125 King $200** Orthopedic pillow-top sets. Brand name matching sets not used or refurbished. Still in plastic, direct from factory! 352-333-7516. 8-14-25-6 BEDQUEEN New orthopedic pillowtop mattress and boxspring set. Brand name, brand new, still in plastic with warranty. Can deliver. $130 352-377-9846. 8-14-25-6 BEDROOM SET$300 BRAND NEW Still in boxes! 5 pieces include: Headboard, Nightstand, Dresser, Mirror, Chest. Must sell, can deliver. 352-377-9846. 8-14-13-25-6 Selling computers, parts, or repair services or just looking for that new rig? Look in the Alligator Classifieds. Call 373-FIND for more information. COMPUTER & LAPTOP REPAIRS Network specialists We buy computers and laptops Working and Non-working 378-4009, 607 NW 13th Street 8-14-13-22-7 Sell your old stereo, cell phone, and more in the Electronics Section of the Alligator Classifieds. 373-FIND In the market for a new set of wheels or just looking to add a second to that collection? Want personalized handlebars or a fitted seat? Check in the Alligator Classifieds UF Surplus On-Line Auctionsare underwaybikes, computers, furniture, vehicles & more. All individuals interested in bidding go to: SURPLUS.UFL.EDU 392-0370 8-14-13-25-10GOATS FOR SALECharlie 352-514-9858 8-14-25-10 Guitars and Musical Instruments New, Used and Factory Refurbished Check Us Out Before You Buy!! Leonardo's Music, Micanopy, FL 352-450-0928 Leonardos302.com 8-14-13-25-10 Alligator Classifieds is the way to get your 2 wheels on the road. Show off your bikes, scooters, and repair services. Call 373-FIND to get your classified in. 8-14-13-25-11 NEW SCOOTERS 4 LESS Great Scooters, Service & Prices! 118 NW 14th Ave, Ste D, 336-1271 Vespa, Genuine, GMW, & More! NS4L.com facebook.com/newscooters4less 8-14-13-25-11 SCOOTER REPAIRNew Scooters 4 Less has LOW repair rates! Will repair any make/model. Close to UF! Pick-ups avail. Cheap oil changes!! 336-1271 8-14-13-25-11 Road Rat Motors Largest Scooter Store in Town! Run by Gator Grads! New scooters starting at $999. 1-2yr warranties with roadside assistance included. 376-6275 RoadRatMotors.com 8-1413-25-11 Road Rat Motors offers FREE pickup service for any paid scooter repair. LOWEST labor rate, quickest turnaround in town! Will repair ANY brand scooter. Free estimates. 3766275. RoadRatMotors.com 8-14-13-25-11SCOOTER RENTALSRent for a day, week, month or semester. Now renting Buddy scooters too! 352-336-1271 www.gainesvillescooterrentals.com 8-14-13-25-11

PAGE 12

12, ALLIGATOR Campus Scooters Mobile Sales and Scooter Service. We offer free estimates on all repairs and we come to you. We also have new scooters starting at $799.00 Call us today at 352-263-0425 8-14-13-25-11 SWAMP CYCLES Experienced, Friendly, Affordable Sales/Service Scooters, Motorcycles, ATVs MMI Certfied Staff, Warranty on Repairs swampcycles.com 373-8823 633 NW 13th St 8-14-25-11 Unload your lot. Sell your cars through Alligator Advertising for cheap. 373-FIND or place your ad online at www.alligator.org/ classifieds We Buy Junk Cars Trucks, Vans Titled only Call KT 352-281-9980 or 352-215-3191 8-14-25-12 SUN CITY AUTO SALES ALL VEHICLES $0 DOWN! NO CREDIT CHECK!!!! VEHICLES $800 AND UP! 352-338-1999 8-14-25-12 SUN CITY AUTO SALES ALL VEHICLES $0 DOWN OVER 150 VEHICLES IN STOCK! CARS, TRUCKS, SUVS, & VANS! 352-338-1999 8-14-25-12 BUY FOR BLOWOUT PRICES & SAVE BIG!!!! VEHICLES STARTING $800!! PRICES NEGOTIABLE!!! 352-338-1999 8-14-25-12 88 LINCOLN TOWNCAR $1999 98 CHEVY ASTRO VAN $2999 00 DODGE INTREPID $2999 00 CHEVY CAVALIER $3999 352-338-1999 8-14-25-12 03 CHEVY MALIBU $3999 04 DODGE INTREPID $4999 04 FORD TAURUS $5999 02 FORD EXPOLORER $6999 352-338-1999 8-14-25-12 SUNRISE AUTO SALES NO CREDIT CHECKS!!! CARS, TRUCKS, SUV'S & VANS! 30 DAY WARRANTY!!! 352-375-9090 8-14-25-12 04 NISSAN SENTRA $6999 06 PONTIAC MONTANA $7999 04 GMC ENVOY $8999 04 HONDA ACCORD $8999 352-375-9090 8-14-25-12 03 NISSAN ALTIMA $8999 04 VOLVO S40 $8999 04 FORD F150 $8999 99 MERCEDES ML430 $9999 352-375-9090 8-14-25-12CASH PAID $300 AND UP!!!ANY CONDITION-RUNNING OR NOT!!! FREE TOWING & SAME DAY PICK-UP NO TITLE NEEDED. Call Brandy 352-771-6191 8-14-13-25-12 This newspaper assumes no responsibility for injury or loss arising from contacts made through advertising. We suggest that any reader who responds to advertising use caution and investigate the sincerity of the advertiser before giving out personal information or arranging meetings or investing money. GOLD GEMS ETCFree Appraisals Top Cash or Trade 40 years in Business OZZIE 352-318-4007 8-14-25-13 UF GRAD PAYS MOREfor gold jewelry, scrap gold, Rolex, diamonds, guitars, etc. Top $$$. Get my offer before you sell! Call Jim 376-8090 or 222-8090 8-14-25-13 The American Cancer Society Road to Recovery Volunteers Needed!VOLUNTEER DRIVERS NEEDEDto transport cancer patients to treatment. Flexible schedule. Training and liability insurance provided. Please call 352-240-5062 if interested. St. Francis House is a homeless shelter and soup kitchen located in downtown Gainesville, and we are looking for help from volunteers like you. St. Francis House depends on monetary support from individual donors and community businesses in order to help feed the homeless and the hungry.If you are interested in volunteering,please contact Stephanie Breval at (352) 378-9079 or sfhcoor@stfrancis.cfcoxmail.comTo make a donation by mail,please send checks payable to St. Francis House P.O. Box 12491 Gainesville, FL 32604 CASH PAID $300 AND UP!!!ANY CONDITION-RUNNING OR NOT!!! FREE TOWING & SAME DAY PICK-UP NO TITLE NEEDED CALL 352-771-6191 8-14-13-25-13 VOLUNTEERS NEEDED I AM BLIND & WOULD LIKE HELP WITH: Rides to church: Mass at Queen of Peace. Learning to rake knit hats to send to Haiti & other places. Call 352-219-6948 6-20-13-25-13 WORK AT YOUR LOCATION AND GET Up to $500/$1,000 month PT $2,000/$5,000 month FT No experience needed. Will Train! www.ecobusiness.com/sa Interviews (954) 297-0344 6-6-13-2-13 This newspaper assumes no responsibility for injury or loss arising from contacts made through advertising. We suggest that any reader who responds to advertising use caution and investigate the sincerity of the advertiser before giving out personal information or arranging meetings or investing money. WEB PRODUCTIONSeeking staff members for the web production team at alligator.org. Interested candidates should possess the following: Familiarity with media production tools such as Adobe InDesign, Photoshop, Premiere, etc. Familiarity with a web-based CMS and/or web coding basics will receive extra consideration. An ability to learn and work with new programs quickly and efficiently Deep interest in the growth and development of new media Skill in producing not only the written, but audio and visual components of media segments and graphics. The desire to make a lasting impact on a UF tradition in a shifting media landscape. Send all inquiries with resume direct to Evan Walker, Managing Editor/Online at ewalker@alligator.org Daytime Advertising ProductionThe Independent Florida Alligator Advertising Production Department is accepting student applications. Duties include graphic design and organizational layout. Will train, but experience with Adobe InDesign, Photoshop and Illustrator is preferred. Friendly work environment, flexible schedule, with hours between 9 am 5 pm M-F. Must be available to work Summer C and be currently enrolled in classes. A one-year commitment is expected. Fill out an application at the front desk of The Alligator, 1105 W University Ave, M-F 9 am 5 pm. No phone calls, please. Include available work schedule and references. Previous applicants are welcome to reapply with current schedule. EOE BARTENDING$300 A DAY POTENTIALNo experience necessary, training provided. 800-965-6520 ext 138 8-14-13-25-14 Students in Accounting, Aviation, Business/ Sales and computer science needed for various positions. Flexible schedules and competitive pay. Join our team! Learn more at www.gleim.com/employment 8-14-1325-14 Food Science and Human Nutrition at the University of Florida is conducting a research study for women 20-40 yo on birth control pills. Compensation given. For details call Bonnie Coats at 273-9014 8-14-13-25-14 CUTTING-EDGE UF RESEARCH STUDY Smokers wanted (1 pack a day for 5 years) Periodontal (gum line) sampling only 5 visits over 2 years; up to 1.5 hr each visit FREE oral exam, up to $160 compensation Call: 352-392-2945 7-30-13-50-14 Go to www.IncomeAtCollege.com now to see how you can work for yourself on your own time. Don't let this opportunity pass you by! 6-11-13-15-14 ATTENTION SEDENTARY SMOKERS! UF Smoking Lab & Clinic needs you to participate in study on use of advanced devices to monitor smoking and exercise behavior. If interested, call 336-406-3706 or email fitbit10000@gmail.com 6-20-15-14 SUMMER WORK GREAT PAY$14.50 base/appt -FT/PT openings Customer sales/service all ages 17+ CALL NOW 352-505-9105 8-14-13-26-14RGIS, LLC PT Hourly Work Flexible schedules$8/hr to start, apply online at RGIS.com 6-14-13-7-14 UNIQUE BUSINESS make money with your own business-unique products-no start-up fee-set your own hours-free website-free lead page-free training-www.funtoberich. com/garya 6-13-13-10-14 Lifeguard, $12.00 hour.Requires current Red Cross Certification. Works weekends in institutional setting. Contact Grady Carthon at (352) 264-8248. 6-20-13-12-14 ASSISTANT/TUTOR Looking an energetic student (math or education major) to tutor girls ages 7, 10, 12 in math/algebra part time as well as providing clerical assistance at a 35 year old publishing company. The position can be part or full time over the summer. Tutoring will be sporadic based on the girls activities over the summer and the down time will be spent doing office support. Please apply online at www.gleim. com/employment. 8-14-13-25-14 STAY IN GAINESVILLE A 35 year old publishing company in Gainesville is looking for the following candidates: Admin Asst Software Developer Linux Administrator Customer Service/Sales Reps Marketing/Sales Accounting Editor Accounting Assistant Flight Instructor/Marketing SAT/ACT coordinator Full or part time. Please apply online at www.gleim.com/employment. 8-14-13-2514

PAGE 13

ALLIGATOR VIDEO ASSISTANT / EDITOR wanted at the University of Florida's Center for Instructional Technology and Training. The Video Assistant position requires experience with recording video, lighting, and editing with Premiere. Minimum 20 hours per week, $12.50/hr., between 8am and 6pm, M-F. Please send resume to Joe Nicholson joebn@ufl.edu. 6-14-13-5-14 University of Florida Survey Research Center 720 SW 2nd Ave. Suite 156 Mon-Fri 9am-8pm 392-2908 ext. 105 $9.00/$9.50/hr + Intentive + Paid Training Telephone Interviewing NO SALES Bilinguial SPANISH Speakers Needed http://www.bebr.ufl.edu/survey/hiring 6-6-13-6-14 Earn $15 cash for completing a 90-minute study. To get study details and find out if you qualify, e-mail Stefani at smpila@ufl.edu. After June 12, e-mail Sabra at spelham@ufl. edu. 6-20-13-9-14 DATA ENTRY/CLERICAL POSITION Full or part time Please apply in person Institute of Veterinary Spec 3603 NW 98th St. Suite A 6-6-5-14 PERSONAL TRAINING 300 Personal and Group Training Flexible Scheduling Exclusive Facility Call for a free workout 339-2199 8-14-25-15NEED A LAWYER?SiddiquiLegal.com Private Experienced Affordable 8-14-2515 HIV ANTIBODY TESTINGAlachua County Health Dept. Call 334-7960 for appt (optional $20 fee) THE TRUE YOU! Lose 8-15 pounds in 4 weeks Only $119! Gain muscle while you lose fat Groups forming now. 339-2199 8-14-25-16 SUMMER SPECIAL!! Advanced Cardiac Life Support $99 and Basic Life Support $35. American Heart Assoc. card issued. Training Gators for 17yrs!! Call (352)494-4217 or (800)319-5708 7-30-13-15-16 Another Saturday night without a date? Read The Alligator. Furry, feathery, scaly...no, not your roommate...pets. Find or advertise your pets or pet products here in the Pets section of the Alligator. IVE HAD IT WITH YOUR LOUD MUSIC! Is your roommate driving you crazy? Find a Finders Keepers? If you find something, you can place a FREE FOUND AD in our lost & found section. Be kind to someone whos lost what youve found. Call 373-FIND.Now you can easily submit your classified adfor print and/or web editionsright thru our website!Just go to www.alligator.org/classifiedsVisa and Mastercard accepted. HIV ANTIBODY TESTINGAlachua County Health Dept. Call 334-7960 for appt (optional $20 fee)Family Chiropractic Since 1977. Two blocks from U.F. 373-7070 8-14-25-18 Want to make a connection?Place your ad here to look for someone to share a common interest with or for your true love IS YOUR BUSINESS, CLUB OR ORGANIZATION HAVING AN EVENT? DO YOU HAVE A SPECIAL ANNOUNCEMENT? PLACE YOUR AD HERE AND GET IT NOTICED! Get the party started! Place your Entertainment classified today to get people up and about. Call 373-FIND. Trying to get to and from somewhere? Want to cut back on that gas bill? Place an ad or show off your bus and shuttle service. 373-FIND GET PAID TO TYPE!! Fast, accurate typists needed for audio transcription. Create your own schedule M-F, 7am to midnight. Pay based on speed and accuracy, $7.79 to over $12. Walking distance to campus. Ideal for PT and Students! Apply online: www.sbsgrp.com 7-11-13-1014 EARN UP To $67/Hr! No Previous Experience Needed. Start Right Away. Send a Text "Make EZ Money" To 90210 6-11-13-4-14 MEDICAL ASSISTANTPT for a doctor's office. Experience preferred. Email resume to: snpohani@gmail. com 6-18-13-5-14LIFEGUARD $10 hr.June 10-July 19 9am 2:30pm weekdays Email soundsop@aol.com with resume and proof of certifications 6-6-13-2-14 Want to be a CNA, phlebotomist or pharm tech? Express Training offers courses, days, eve, weekend. All classes live, no videos. Call 352-338-1193 or expresstrainingservices.com 8-14-13-25-15

PAGE 14

reached third for the remainder of the game.  The pitchers were really, really, really good this weekend, Haeger said. You come here and the pitcher, its their ace every single time you face them. nale for the second consecutive year. But not all was lost. If you had asked me at the beginning of the season, Could this team do this? my answer would have been no very early and easy, Walton said. The team just got better and worked hard, got stronger. Contact Chuck Kingsbury at ckingsbury@alligator.org. 14, ALLIGATOR TUESDAY, JUNE 4, 2013 FLORIDA SHOT AN 857 (+17) OVERALL. RICHARD JOHNSONAlligator WriterThe Florida mens golf team had a week to forget at the NCAA Championships in Woodstock, Ga., and Alabama had one it will remember forever. UF put itself in a deep hole after it shot a 291 (+11) in the opening round, and the Gators never recovered. Their 857 (+17) after three rounds was good enough for only 25th place far from the eighth-place cutoff needed to advance into the weekends match play. Unfortunately, more of the same, coach Buddy Alexander said in a release. We actually got off to a great start this morning. Theres a tough stretch of holes, the 15th through the 18th. I knew if we got by that then maybe we could have a special day, but those holes just ate us alive. The last nine was just so-so. The Crimson Tides Day 1 and Day 2 scores of 275 (-5) and 276 (-4) were good enough to offset an average third round of 282 (+2). On Day 3, it ended that portion of the competition tied for third overall. After defeating New Mexico in the match Bobby Wyatts performance dominated match play at one point he won seven straight holes. He clinched his round after only 13 holes, winning 6-5. Fellow junior Cory Whitsett also exhibited at 5-up. Illini sophomore Alex Burge did not go down quietly, however, closing the gap to three holes. But in the end, a missed par putt on Hole 15 resulted in a halved hole and a conceded match to the Crimson Tide. The win is redemption for an Alabama team that came within one hole of winning the championship last season, and the title other than football. I think (what happened last year) makes it more special, Alabama coach Jay Seawell said in a release. It makes you appreciate it a great deal more. It is so hard to even get here. This team has been on a mission, a mission, a mission. That is the leadership of [senior] Scott Strohmeyer and all of the guys on this team. It is their championships, and we won today because of them.the Gators in an early hole. But Magliozzi turned his outing around, holding Valparaiso scoreless until the seventh inning, including a stretch where he retired seven straight batters. uncomfortable, Magliozzi said. Then I got in a rhythm. But the Gators lost control of the strike zone in the seventh. Magliozzi surrendered two singles and a walk to load the bases, and OSullivan brought in left-hander Daniel Gibson. The junior allowed one run to score when third baseman Josh Tobias couldnt control a ground ball. Gibson walked the next two batters on nine pitches to tie the game at 4. It just hit off my chest and kind of got behind me, Tobias said. I should have stayed down better and kept it in front to get an out, but I didnt. Sophomore Ryan Harris came in to relieve Gibson, and the Crusaders scored choice on a ball hit up the middle. Although the Gators trailed, they still had opportunities to tie and possibly win on Saturday. Tobias got his fourth hit of the game in the eighth and advanced to second on a walk to Zack Powers. But pinch hitter Christian Dicks struck out swinging and to end the threat. Second baseman Casey Turgeon walked to start the ninth, and Justin Shafer singled. A bunt by Vickash Ramjit advanced the runners, bringing catcher Taylor Gushue to the plate. The sophomore was mired in a 0-for-23 slump when he came to bat. He worked the count to 2-2 before he swung and missed a changeup down and away. The Gators batting leader, Harrison Bader, came up next with two outs and Floridas season on the line. The freshman also got into a 2-2 count before grounding out weakly to third. The loss eliminated the Gators from Tallahassee Regional that year. straight losses and only two wins in their last eight games. We saw both sides, assistant coach Brad Weitzel said. We played well against Ole Miss and South Carolina in there in the middle. We got hot; things went our way I thought it would carry over to the second part of the season, but it didnt.  A radio broadcast contributed to this report.  Contact Adam Lichtenstein at alichtenstein@alligator.org. BASE, from page 15 UF Golf SSOFT, from page 15 BASEBALL

PAGE 15

TUESDAY, JUNE 4, 2013 WWW.ALLIGATORSPORTS.ORG Steve Spurrier received an award at Ben Hill Thursday. Read the story online at alligator.org.Baseball players awarded Gators in the NWSL CHUCK KINGSBURY Ryan Jones / Alligator StaffSophomore Lauren Haeger swings and misses against FSU at Katie Seashole Pressly Stadium on March 27. Haeger went 0 for 2 in Floridas 3-0 loss to Texas in the Womens College World Series on Sunday. Longhorns pitcher blanks Gators in WCWS ADAM LICHTENSTEIN UF falls in RegionalsTraRA CK aAND FIELD GORDON STREISAND Florida ready for NCAA OutdoorssSEE BasASE, Pa A GE 14Holloway Johnny MagliozziUF startersSEE SOFT, Pa A GE 14 UF Softball

PAGE 16

16, ALLIGATOR TUESDAY, JUNE 4, 2013