Citation
The Apopka chief

Material Information

Title:
The Apopka chief
Uniform Title:
Apopka chief (Apopka, Fla. 1988)
West Orange news
Place of Publication:
Apopka, FL
Publisher:
John E. Ricketson
Creation Date:
January 7, 2005
Publication Date:
Copyright Date:
2005
Frequency:
Weekly
regular
Language:
English
Physical Description:
v. : ill. ; cm.

Subjects

Subjects / Keywords:
Newspapers -- Apopka (Fla.) ( lcsh )
Newspapers -- Orange County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Orange -- Apopka
Coordinates:
28.685808 x -81.509717

Notes

Additional Physical Form:
Also available on microfilm from the University of Florida.
Numbering Peculiarities:
Issues for <Jun. 7, 1950-Dec. 26, 1956> also have numbering of: West Orange news.
General Note:
Description based on: Vol.1,no. 12 (Jun. 7, 1950).
General Note:
Issues for <1998>-published
Funding:
Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
Copyright Apopka Chief. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
001689212 ( ALEPH )
33886036 ( OCLC )
AJA1248 ( NOTIS )
sn 95047388 ( LCCN )

Related Items

Preceded by:
Orange County chief

UFDC Membership

Aggregations:
Florida Digital Newspaper Library

Downloads

This item is only available as the following downloads:


Full Text

PAGE 1

The Apopka Chief Volume 96 Number 31 Your trusted local news source Friday, August 3, 2018 / 50 cents The Apopka Chief Lifestyle God Bless America Sports Lyle Heinz, new Apopka High principal, is preparing for the 2018-19 school year. See page 1B. An Apopka youth baseball team does well in a national tournament in New York. See page 1C. This week Section A Section B Section C Section D Opinion .................. 2A Public Notices .. 3A,3B Lifestyle ................. 1B Worship ................. 2B Bus. Rev ........... 4B,5B Kapers ................... 6B Dining & Ent .......... 8B Sports .................... 1C Legal ads ......... 2D-5D ......... 6D-8D Service Dir. ............ 8D By John Peery Apopka Chief Staff Although details are few on what might be built there, city of Apopka staff is in discussion about a special overlay dis trict on the west side of State Road 429 (Wekiva Parkway) that would allow for all types of medical uses from a hospital to a freestanding emergency department to The MEDTech Campus Overlay Dis trict proposal was discussed with Apopka staff by a representative of Orlando Health at the Development Review Committee (DRC) meeting held Wednesday, August district will come from City Council, but much of the work for the proposed district It is believed that Orlando Health is looking to purchase a 51-acre tract locat MEDTech Campus Overlay districts must be between 40 acres and 100 acres, according to the document about the pro up to eight stories under the overlay district In addition to the medical buildings, the MEDTech Campus Overlay district would be able to have commercial retail, organization that owns nine hospitals, in cluding Orlando Regional Medical Center The organization also runs urgent care, car diac and cancer care units, as well as imag Orlando Health currently has no facilities Hilton Garden Inn By John Peery Apopka Chief Staff Sample ballots for the upcoming primary are sched uled to be mailed Tuesday, August 7, three weeks ahead of Voters in Orange County will be sent a sample ballot, which includes a map and driving directions to their poll ing location, in addition to a representation of their actual Bill Cowles, Orange County supervisor of elections, said he encourages voters to review the ballot, pre-mark it, Cowles also said voters should pay special attention to their polling location as 20 polling sites across the coun ing locations that changed are located in Northwest Or The four polling places that have changed in North west Orange County are: Precinct 229 will move to Apopka Calvary Nazarene at Precinct 232 will move to Grace Pointe Church at 2051 By John Peery Apopka Chief Staff some inherent dangers, but Apopka Police Sergeant Steve Harmon add ed another one to that list this week in Departments pedestrian safety em As part of the three-day opera clothes, crossed Piedmont-Wekiwa Road on the north side crosswalk Harmon kept a keen eye on driv ers, not only to make sure he re mained safe, but to double-check that the drivers were not breaking the law that requires them to yield to pedestri were stationed near the intersection to give warnings or citations, if nec educational brochure about what the law requires from drivers regarding pedestrians, who have the right-ofBy John Peery Apopka Chief Staff A new bear management ordinance approvals would put the city of Apopka in line to receive a state grant that would help The City Council voted unanimously on Wednesday, August 1, to adopt the or dinance, citing state statistics that rate Or ange County as having the seventh-highest The vote was 4-0 as Commissioner Alex ander Smith was out of town and not at the man interactions to bears seeking food in garbage cans, pet food containers, and bird The ordinance establishes a bear man agement area in much of the city limits of The annual back-to-school sales tax holiday will be During the sales tax holiday period, qualifying items will be exempt from tax including certain school The sales tax holiday does not apply to: Sales of any eligible items in a theme park, entertain preview the Department of Revenues Tax Information Publication (TIP) on the 2018 Back-to-School Sales Senior ute player Marcela Zaragoza looks at the drum major Monday, July 30, during band camp for the Apopka Blue Darters marching band. The group has been practicing for the past two weeks to prepare for the upcoming school year. Under the direction of Jeremy Langford, the band will perform at halftime of football games this season. The preseason game is August 17 at Daytona Municipal Stadium against the Daytona Beach Mainland Buccaneers. Marching band practice City looking at medical district at Wekiva Parkway interchange See CITY Page 8A Sample ballots will be out next week See SAMPLE Page 8A Police emphasize pedestrian safety Apopka Police Sergeant Steve Harmon walks west in a crosswalk on Pied mont-Wekiwa Road at U.S. Highway 441 as a car passes behind him. See SAFETY Page 5A Sales tax holiday is set for this weekend City passes bear ordinance Mayor Bryan Nelson speaks during the meeting on Wednesday, August 1. See BEAR Page 7A PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. 407-884-1846 COMPREHENSIVE ADULT DENTISTRY Providing Extraordinary Care for Extraordinary Patients Celebrating over 20 years of exceptional service to the Apopka area! Richard Petrilli, DMD, PA

PAGE 2

There is an ancient proverb that says If you want to go fast, go it alone. If you want to go far, go with others. There is not only strength found in the presence of numbers, but there is power in network ing within them. For more than 100 years, the Apopka Area Chamber of Commerce has a prided itself on fos tering an environment of networking and building sustainable relationships within the business com that we spend most of our week working our business and little time working on growing our business. To some, stepping away from productivity and the dayto-day operations to attend Chamber functions may seem like it would take away from the prosper ity of their business. How ever, in reality, networking is an essential component of building your brand and your business. Not everyone may do business with you, but networking may also pro vide a greater return than were expecting. By creat ing meaningful connec tions, youll build lasting relationships that will lead to long-term success. The Apopka Area Chamber of Commerce provides many opportunities, venues and committees to meet new prospects, advocates, refer rals, and even make new friends. Over the past year, Ive seen an incredible transformation in leader ship, vision, and effec tiveness at the Apopka Area Chamber of Com merce. Additionally, Ive had the opportunity to meet with many mem bers of the Board of Direc tors, and I was encouraged by the range of businesses and sizes that were repre sented, including individ ual proprietors of Fortune 500 companies. Also, the new team at the Chamber is focused on creating ex citing events, developing membership involvement, building unique programs and an increasing mem bership ROI. Plus, theyve developed a new structure based on your investment and wont break the bank. If you arent a mem ber of the Apopka Area Chamber of Commerce, I would like to invite you to Quotable We thank the FBI for its recognition the other law enforcement agencies their work. The Apopka Chief The ultimate in governmen tal cooperation was at the forefront this week in Apopka as the Federal Bureau of Investigation showed ap preciation for the help it received last year when four violent serial criminals were apprehended and arrested as they attempted to rob a bank in Apopka. cates to several Apopka police of area law enforcement agencies, in cluding the Orange County Sher Also recognized were the bank employees who cooperated with law enforcement. Intelligence that the FBI and other agencies had re ceived told the agencies that the four men were intent on robbing the Apopka bank. The banks rep resentatives cooperated with police to the point that they showed no not to tip off the bad guys. All in all, it was as success ful an operation as one could hope for, but it could not have been done without the cooperation of every one involved. As we have seen, especial ly when it comes to governmen tal agencies, cooperation is not al ways a given. In fact, there is often a turf battle when it comes to those agencies and they not only dont want to cooperate, but they some times go out of their way to hinder the other agency and that agencys work. Keeping the four criminals off the street and in prison is impor tant for the safety of the communi ty, as these bad guys are especial ly known for their violence toward others. They have no concern for human life or the property of oth ers. We thank the FBI for its rec cers and the other law enforcement agencies for tirelessly working to apprehend those breaking the law. They all deserve congratulations and kudos for their work. While we appreciate the copi ous amounts of rain we have been receiving via this summers thun derstorms, we also know that some of the ground is becoming saturat ed to the point that we pray an ear ly hurricane doesnt come our way. If we were to get a rainmaker such as a tropical storm or a hurricane over the next couple of weeks, it for this area. Last year, Hurricane Irma dropped about a foot of rain in this immediate area and our water table has been up since then as seen by the fullness of our lakes and rivers. As much as wed rather have a little too much rain than not enough, there does come a point where too much is just, well, too much. A happy balance, of course, is best, but that doesnt always hap pen. In the meantime, keep a pon toon boat anchored in the backyard so that you and your family have a means of escape! Well, for most of us, were kidding, but, of course, for those who live near lakes and rivers, we may not be. With the bulk of the hurricane season ahead of us, now is the time to review plans and get your sup plies ready in case we get anoth er Irma this year. Take the time to plan and prepare for the safety of your family. Our position The Apopka Chief The Apopka Chief A weekly newspaper founded in 1923 August 3, 2018, Page 2A Opinion AUGUST 3 Hey, ter with a 4.1 percent rise of the economy, the low est unemployment rate for whites, blacks, and His panics in more than 30 years with millions of jobs the lowest tax rates in over 30 years, North Korea be gan returning remains of our deceased soldiers from the Korean War, the Euro pean Union plan dropping tariffs on our exports, and dealing with Russia on the road to some sort of Rea gan-Gorbachev relation, etc., etc. In spite of this being months of a presidency, the Democ-rats and portions of independents are highly critical of President Trump and his senior partner, Je sus Christ. One of the sil liest of the groups is the Hate Trump gang who zens while imitating the Third Reich of the 1930s. One of the craziest of the primary elections was hard-left Socialist Alexan dria Ocasio-Cortezs defeat of a 10-term Democrat in Brooklyn as if it was some kind of tremendous vic tory. Actually, the turnout of a tiny 10 percent of the Brooklyn voters can be at tributed to the 10-termer being considered to be a shoo-in. Im sure that the vast majority of Dem voters are shocked at Boston Univer sity bachelors degree grad Cortez and her long list of idiotic programs that sound like something out of Ven ezuela. Considering President Trumps historical rate and number of blessings on the U.S. population and the military advancements that will save or improve mil lions of lives worldwide, it is more than obvious that this is a battle between God and Satan. In many ways, this re minds me of the huge per cent of Israels population, religious leaders, and Ro man occupiers, who sim ply ignored Jesus thou sands of healings and miracles, including rais ing people from the dead, walking on water, control ling the weather, and read ing minds, still hating him to the point of crucifying Him. I remember when one of our greatest gener als in history, Gen. Dwight Eisenhower, became presi dent during the Cold War with the Soviet (Satanic) Union in 1952. The key issues of this enormous war hero who swept us to victory after uniting the international See CORBEIL Page 6A Apopka Event of the Week to School Fair will take place at the contact the center at 407-254-9449. County Commissioner District 2 Rod Love The Apopka Chief is published every Friday and entered as Periodicals, post The Apopka Chief newspaper is published by Foliage Enterprises, annual subscription is $25 in Orange County and $30 outside Orange Postmaster: Send address changes to The Apopka Chief, PO Box 880, Apopka, Fla., 32704-0880 FBI honors Apopka police and O.C. deputies for cooperation All this rain worsens hurricane damage... so prepare ahead When hate dominates political opposition, the end is near Three reasons to join the Chamber See LOVE Page 6A Mema Says immature forever. cause we love the brethren. He that loveth not his This Week In Word Publisher John Ricketson General Manager Neoma Knox Editor John Peery Reporters Richard Corbeil Teresa Sargeant Neal Fisher Photographer Tammy Keaton Marketing Director Jackie Trefcer Advertising Anita Walker Dyer Wendy Richardson By Dr. Mark Hendrickson Center for Vision & Values Full disclosure: I have never seen an episode of the long-running PBS chil drens show called Mr. Rogers Neighborhood. The only reason I went to see Wt You Be My Neighbor?, the documen tary about Mr. Rogers and his show, was because we were visiting friends who very much wanted to see it. Thank you, dear friends! The movie was very special poignant, profound, elegantly under stated and brimming with kindness, warmth, and un derstanding. In one way, the doc umentary is like the old show itself: a simple story with cheap production val ues featuring a plain va nilla un-star-like star. In another and fundamentally crucial way, the documen tary is different from the show: it is primarily for adults instead of children. Whereas Mr. Rogers Neighborhood was rat ed G, Wt You Be My Neighbor? is rated PG-13. It features adults candidly and sometimes colorful ly talking about the adults who made the TV show. t You Be My Neighbor? tells the dual stories of the long-lived 2003) himself. Along the way, we get to know Mr. Rogers real-life family his wife and two sons and his TV family. Both families share a lot of love and affection. This documentary showed me how often Mr. Rogers used his show to comfort children by cou rageously and gently ad dressing such challenges to childhood happiness as the death of a family member (including pets), divorce, scary news stories about war, etc. See HENDRICKSON Page 6A

PAGE 3

The Apopka Chief, August 3, 2018, Page 3A In an effort to ensure the Apopka Police De partment is prepared for a school-based emergency, Chief Mike McKinley at tended a scenario-based ex ercise on Tuesday, July 31, to practice the command of an emergency resulting in a multi-jurisdictional re sponse. Chief McKinley joined in the Orange County Pub lic Schools district-wide, table-top exercise designed to simulate a response to a reported school shoot ing. The exercise was de signed to practice and dis cuss command and coordi nation operations during an emergency scenario. McKinley, along with law enforcement members from OCPS, the Orange Orlando Police Depart ment, and others, as well as school administrators, sup EMS personnel, and emer gency management profes sionals worked in coordi nation to resolve the situa tions presented. This type of train ing and collaboration is in valuable, Chief McKinley said regarding the exercise, and with the heightened awareness of school-based violence, it is important we engage all the stakeholders to ensure a successful out come if we are presented with a major emergency The scenario focused on three phases of any response, and the recovery. the core competencies nec essary within the phases, having the attendees prac tice operational communi cations, agency coordina tion, public information, mass care, and situational assessments. Lt. Chris Hanstein, Apopka Polices SWAT commander, attended as well and discussed the tac tical response necessary for such emergencies with the working group. Apopka will have all Orange County public schools within its jurisdic tion assigned a School Re A town hall meeting for military veterans has been scheduled for Saturday, September 8, from 10 a.m.-2 p.m., at the Apopka Community Center/VFW Post 10147, 519 S. Central Avenue. The meeting is for veterans, veterans spouses, wid ows, and children to attend, ask questions, and learn about the Veterans Administration. The forum discussions and times are: 10 a.m., Vet erans Health Administration Orlando VA Medical Cen ter, A Medical Center and You; 10:30 a.m., Veterans Connected Disability Claim; 11 a.m., National Cemetery Administration, eteran Burial Services and You; 11:30 a.m., Questions and Answers; and 11:30 a.m., File Your Service Connected Claim. Reservations must be made as there is limited space. At 1 p.m., there will be a Vietnam pinning ceremony. For more information or to make reservations, call Annie Artis at 407-646-5037. Apopka police chief attends school-safety exercise Apopka Police Chief Mike McKinley participates in the school-safety event. August 13 when students return from summer break. This exercise along cers to the schools are but a few of the commitments to this community to cre ate a safe and livable envi ronment for the citizens of Apopka, Chief McKinley said. Meeting planned for information about Veterans Admin. August 3, 2018 Publish: The Apopka Chief 161035 NOTICE OF LAND DEVELOPMENT CODE AMENDMENT: KELLY PARK INTERCHANGE FORM-BASED CODE CITY OF APOPKA NOTICE is hereby given thathe City of Apopka Planning Commission and Apopka City Council will consider an amendment to the Kelly Park Interchange Form-Based Code. Apopka City Council Planning Commission Community Development Dept. Public Hearings on Ordinance No. 2672 will be held in the Apopka Council Chambers, 120 East Main Street, Apopka, Florida 32703 on the following dates and times, or shortly thereafter, to consider said Amendment: Planning Commission Tuesday, August 14, 2018 5:30 P.M. City Council Wednesday, September 5, 2018 1:30 P.M. City Council Wednesday, September 19, 2018 7:00 P.M. Lands that may be affected by the new overlay district are located within the Wekiva Parkway Interchange Plan Vision Area, and generally are located within or straddling the boundaries of the circle illustrated in the map below. The proposed Land Development Code Amendment may be inspected by the public at the Apopka City Hall, in the Community Development Department at 120 East Main Street, Apopka, Florida between the hours of 8:00 a.m. and 4:30 p.m. weekdays. Telephone number: 407703-1712. All interested parties may appear and be heard with respect to these hearings. Please be advised that, under State Law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act ADA, persons with disabilities needing assistance to participate in any of these Street, Apopka FL 32703, Telephone: 407-703-1704, no less than 48 hours prior to the proceeding. ORDINANCE NO. 2672 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, AMENDING THE KELLY PARK INTERCHANGE FORM BASED CODE BY CREATING A NEW OVERLAY DISTRICT ENTITLED MEDTECH CAMPUS OVERLAY DISTRICT, PROVIDING FOR DIRECTIONS TO THE CITY CLERK; SEVERABILITY; CONFLICTS; AND AN EFFECTIVE DATE. Vote at TheApopkaChief.com The Apopka Chief & The Planter Coming Soon... Voting Begins Monday, August 20thGET READY! Vote at TheApopkaChief.com The Apopka Chief & The Planter Coming Soon... Voting Begins Monday, August 20thGET READY! MISSION: IMPOSSIBLE FALLOUT 3D PG-13 10:00 3D MOVIES WEKIVA SPRINGS RD, APOPKA Fri., August 3, 2018 thru Sun., August 5, 2018 CHRISTOPHER ROBIN PG 10:15A*; 1:10; 4:10; 7:10; 9:50 THE DARKEST MINDS PG-13 10:25A*; 1:00; 4:50; 7:50; 10:35 THE SPY WHO DUMPED ME R 10:30A*; 1:20; 4:10; 7:20; 10:10 MISSION: IMPOSSIBLE FALLOUT PG-13 10:00A*; 12:00; 3:20; 6:40 TEEN TITANS GO! TO THE MOVIES PG 12:10; 2:25; 4:40; 7:00; 9:20 MAMMA MIA! HERE WE GO AGAIN PG-13 10:10A*; 12:50; 3:30; 6:30; 9:30 THE EQUALIZER 2 R) 12:30; 4:20; 7:30; 10:30 HOTEL TRANSYLVANIA 3: SUMMER VACATION PG) 1:30; 4:00; 6:50; 9:40*SUNDAY ONLY PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER: is proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. 2018 Ford Escape OR Lease For $252/mo. $0 Due at Signingfor 39 months Back-Up Camera, Remote Keyless Entry, & Sync w/ AppLink. Ford Courtesy Transportation Vehicle**39-month closed-end lease on approved credit. 10,500 miles a year. $0 due at lease signing. Tax, tag, and title fees extra. See Dealer For Details. Images Used For Illustration Purposes Only. Ford Courtesy Transportation Vehicle. Up Front Price$18,500 0% APR 72for months plus$1,000 Customer CashOR PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible.(407) 880-1007 PROVIDING EVERY FAMILY WITH THE CARE AND RESPECT THEY DESERVELOOMIS FUNERAL HOMES SERVING FAMILIES FOR OVER THREE GENERATIONS. LOOMISFUNERALHOMES.COM Tell them you saw it in The Apopka Chief Subscribe, Renew or Pay Online Today At TheApopkaChief. com STAY CURRENT WITH APOPKA

PAGE 4

The Apopka Chief, August 3, 2018, Page 4A A long-awaited voca tional training center for South Apopka will be built near Phillis Wheatley El ementary School with Or ange County government funds. The facility will be located on the northwest corner of 18th Street and Central Avenue. County Commission er Rod Love of Apopka se cured $478,861 through the countys INVEST program. According to a press release County Public Schools has also offered to contribute to the construction cost of the facility as well as operate and maintain it. The vocational train ing center will be open to any Orange County chil dren and their families. When current Apopka Mayor Bryan Nelson was in the state House of Rep resentatives, he sponsored legislation for the project. He has also provided writ ten support for the facility. Commissioner Love, who, as a private citizen in 2014, helped conceive the project. As a result, he wants the communitys help in naming the facility. The naming of the training center may be de cided by a public vote. For more information on how to get involved in naming the facility, con 836-5850 or follow him on Facebook at https://www. facebook.com/Orange CountyDistrict2. These Apopka police ofcers were honored Wednesday, August 1, at the Apopka City Council meeting. The Federal Bureau of Investigation awarded them certicates in appreciation for their work in helping to apprehend four serial violent criminals as they attempted to rob an Apopka bank last December. The crimi nals have since been convicted and sentenced in federal court. Training center gets funding for construction 800 827 SKIN DermOrlando.com 15 LOCATIONS TO SERVE YOU W Aep Mos Healt Pan! General & Surgical Dermatology MOHS Micrographic Surgery Cosmetic Dermatology APOPKA 531 Wekiva Commons Circle PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. 800 827 SKIN DermOrlando.com 15 LOCATIONS TO SERVE YOU General & Surgical Dermatology MOHS Micrographic Surgery Cosmetic Dermatology W Aep Mos Healt Pan! APOPKA 531 Wekiva Commons Circle PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Richard Petrilli, DMD, PA COMPREHENSIVE ADULT DENTISTRYProviding Extraordinary Care for Extraordinary Patients 407-884-1846 1585 North Rock Springs Rd., Apopka (Near Publix in the Wekiva Plaza) www.petrillidmd.com Celebrating over 20 years of exceptional service to the Apopka Area! 407-884-1846 1585 North Rock Springs Rd., Apopka (Near Publix in the Wekiva Plaza)Richard Petrilli, DMD, PA COMPREHENSIVE ADULT DENTISTRY Providing Extraordinary Care for Extraordinary Patients www.petrillidmd.com Celebrating over 20 years of exceptional service to the Apopka Area! Southern Safety Services, Inc. www.sssfl.com PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. 235 East 5th Street Apopka, FL 32703 407-814-1895Book your class at www.sssfl.comWith a NRA Certified pistol instructor Locally owned and operated business Hollis H. Kendall hollis@sssfl.com Notary Services Available Apopks Choice for handgun safety& receive FREE pepper spray with this ad! Southern Safety Services, Inc. www.sssfl.com235 East 5th Street Apopka, FL 32703 407-814-1895Book your class at www.sssfl.comWith a NRA Certified pistol instructor Locally owned and operated business Hollis H. Kendall hollis@sssfl.com Notary Services Available Apopks Choice for handgun safety& receive FREE pepper spray with this ad! 316 S. Central Ave., Apopka Recovery from auto related injury. A few seconds in an auto accident can turn into years of suffering. Dr. Mark Boylan, Chiropractic Physician Dr. Boylan has earned Tier 1 participation in the OptumHealth/United HealthCare Tier 1 Advantage Program. earned Tier 1 316 S. Central Ave., Apopka Status is in consideration from practice procedures over the past years of providing safe, quality, and affordable health care services to patients by consistently incorporating the most current and best clinical evidence into their treatment plans. A few seconds in an auto accident can turn into years of suffering. Dr. Mark Boylan, Chiropractic Physician Dr. Boylan has earned Tier 1 participation in the OptumHealth/United HealthCare Tier 1 Advantage Program. Internal Medicine Clinic or Call the clinic at: 407-703-5984721 S. Orange Blossom Trail, Apopka, FL 32703For $30 a Month, Members Receive: PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Internal Medicine Clinic or Call the clinic at: 407-703-5984721 S. Orange Blossom Trail, Apopka, FL 32703For $30 a Month, Members Receive: Subscribe, Renew or Pay Online At TheApopkaChief.com Be ready to encourage your clientele to vote! website voting will be entered to win.The Apopka Chief & The Planter Newspapers Coming Soon Awards showcase and celebrate the Best of the Best in Business Excellence at www.TheApopkaChief.com & Place your votes at or the ballot can be found in The Apopka Chief & The Planter Newspapers Category # ____________________________ Be ready to encourage your clientele to vote! website voting will be entered to win.The Apopka Chief & The Planter Newspapers Awards showcase and celebrate the Best of the Best in Business Excellence at www.TheApopkaChief.com & Coming Soon State Farm Life Insurance Company (Not licensed in MA, NY or WI) State Farm Life and Accident Assurance Company (Licensed in NY and WI) Bloomington, IL State Farm Life Insurance Company (Not licensed in MA, NY or WI) State Farm Life and Accident Assurance Company (Licensed in NY and WI) Bloomington, IL Shren Yeager, Agent 49A East 3rd Street Apopka, FL 32703 Bus: 407-880-3167 theyeagerbomb.com Shren Yeager, Agent 49A East 3rd Street Apopka, FL 32703 Bus: 407-880-3167 theyeagerbomb.com Se Habla Espaol Se Habla Espaol Ill show you how life insurance can also help you reach other nancial goals, like retirement. Ill show you how life insurance can also help you reach other nancial goals, like retirement. But thats just the start. But thats just the start. 1311016 1311016 We put the life back in life insurance. CALL ME TODAY. We put the life back in life insurance. CALL ME TODAY. (407) 423-1234 | www.OrlandoFoot.com202 N Park Ave, Ste 500, Apopka, FL 32703 Specializing in: + Children Flatfoot Correction + Diabetic Foot Care + Heel Pain Treatments & MoreHigh quality foot & ankle treatments for kids .....and kids at heart. 18 Locations Dr. Douglas Childs, DPM (407) 423-1234 | www.OrlandoFoot.com202 N Park Ave, Ste 500, Apopka, FL 32703 Specializing in: + Children Flatfoot Correction + Diabetic Foot Care + Heel Pain Treatments & More 18 Locations Dr. Douglas Childs, DPMHigh quality foot & ankle treatments for kids .....and kids at heart. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Pet Care Center OF APOPKA Pet Care Center OF APOPKA Back-to-School SPECIALSLimit 1 coupon per customer, per pet, per visit. Not valid with other offers. Expires 9/30/18. $10 BATH SPECIAL or 2nd opinion for surgeries, cancer therapies or orthopedic issues FREE CONSULTATION The patient and any other person responsible for payment has a right to refuse to pay, cancel payment or be reimbursed for payment for any other service, examination or treatment which is performed as a result of and within 72 hours of responding to the advertisement for the free, discounted fee or reduced fee service, examination or treatment. Limit 1 offer per person, per pet, per visit. Not valid with other offers. The patient and any other person responsible for payment has a right to refuse to pay, cancel payment or be reimbursed for payment for any other service, examination or treatment which is performed as a result of and within 72 hours of responding to the advertisement for the free, discounted fee or reduced fee service, examination or treatment. Limit 1 offer per person, per pet, per visit. Not valid with other offers. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Back-to-School SPECIALSLimit 1 coupon per customer, per pet, per visit. Not valid with other offers. Expires 9/30/18. or 2nd opinion for surgeries, cancer therapies or orthopedic issues FREE CONSULTATION Pet Care Center OF APOPKA Pet Care Center OF APOPKA $10 BATH SPECIAL

PAGE 5

points on their license. The timing of the special emphasis was purposeful by the Apopka Police De partment. Schools about to start so we want ed to make sure the kids are safe, but also pedestrians in general, Sgt. Harmon said. e try to do different details. This partic ular time we wanted to make sure we are good on pedestrian safety. Let the citizens know the laws as well. We made up the stop, we can hand out the materials. Depending on what the stop is for, most people are given warnings. They might get a verbal warning, a written warn ing, or a citation. al intersections Tuesday, July 31, through Thursday, August 2, on the special detail, the Hiawassee Road/Piedmont-Wekiwa Road intersection with U.S. 441 was of special concern because that intersection is There are pretty consistent violations at this intersection. There are times where if I were to step off and not pay attention, as a pedestrian, I could get hit, Sgt. Har mon said. A pedestrian was killed at the intersec tion earlier this year in the early-morning hours. An investigation determined that the pedestrian was at fault, although the driver left the scene of the accident, but was later caught and charged with leaving the scene. Harmon said thats not unusual. For most of our accidents of vehi cle vs. pedestrian, especially fatalities, They need to do just as much to make sure theyre safe by paying attention and being alert. Even though this operation focused on educating drivers, Harmon said pedestrians must be proactive to keep themselves safe. The pedestrians need to pay attention and not just assume the cars are going to stop, make eye contact with the driver of the vehicle and make sure they see you be fore you walk out in front of them, the ser geant said. While the emphasis was on pedestri other issues during their detail. At these intersections, were still watching for other violations, whether s speeding or red-light running or something else, Harmon said. Deputy Chief Randy Fernandez said the operation was necessary. Crosswalk enforcement actions are an effective way to communicate pedes trian right-of-way laws to both drivers and pedestrians, he said. The police department conducts en forcement actions in response to communi ty requests and to educate the general pub lic on the rules at marked and unmarked crossings. Those who choose to ignore the law and the message, however, will be de terred from future violations through en forcement. As is the case with any other this case, simply yield the right-of-way to pedestrians who are in a crosswalk. The Apopka Chief, August 3, 2018, Page 5A Safety: Students will be walking soon Continued from page 1A Apopka Sgt. Steve Harmon walks through a crosswalk at Piedmont-Weki wa Road and U.S. Highway 441 as a car turns ahead of him. C HINA Deco Gallery Innovative Ideas for the Home & Garden N. Park Ave. Orange Blossom Trail 429 Binion Rd. 407-410-0888 Monday thru Saturday 9AM 5PM Sunday 12 PM 5PM2640 W. OBT, Apopka Just West of Home DepotSPLENDID SPLENDID CHINA @ Craigslist Orlando SEARCH KEYWORDS: (Miniature Buildings from the Original Attraction)SELLING ALL OUR SPLENDID CHINA BUILDINGS PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Funeral and cemetery services at one location. Stop by for a tour of our newly designed funeral home lo cated in Apopka.A FREE FUNERAL PLANNING GUIDE is available upon request or online at www.highlandfh.com. HIGHLAND FUNERAL HOME 3x5 High.Were.Open Funeral Home NOW OPEN PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. The Apopka Chief & The Planter COMING SOON AND Two Exciting Publications Published August 9 & 10 Published August 23 & 24 Membership Directory & Annual Report to the Community Fall Ball Sports & Recreation! Apopk That would be the person you believe is truthful and shoots straight, right? Outside our personal and close social relationships, though, our choices may be few and far between because, unfortunately, gone are the days when you could believe the news as reported, or the words out of a partiing over my shoulder at the past, I can see government integrity may have existed, allowed myself to believe it Yes, in spite of my often cynical views and my (more frequent) sarcasm, I am still a bit tween painting everyone with the same broad brush or throwing the baby out hanging on to a modicum of naivete enough to feel a little actually have some leaders with enough character to wholeheartedly engage in the battle between good and evil good of the country and We Washington out there someMore than one, in What was to become sion with self-improvement and character-building had already begun while he was cerned himself with rules of civility and decent behavior in company and conversation 1 which he learned from a seventeenth-century English translation by a French a rural society to his brothhe felt those rules would help him not disgrace himself at Mount Vernon, and other self the rules dealing with in business, and moderation learned in those young years later became his standards rected at what he saw as his vulnerability, and at which he would strike back he also had what was universally observed and what John Adams called, the gift of silence, which contributed to his reputation as a man I can accept that leaders are only human and have nor respect their leadership fact, more than mere self-serving manipulation, See It, those denote a total which our country cannot continue to function as, for far too long in its efforts Manipulation in Congress, Congress holds hearings on trivialities or why it focuses on a new freebie when exposure seems imminent those are nothing more than spotlight shining on their bad, and even illegal, even, locally simply gridnot must not! Compromise their principles, their character or the truth. Not for party, Comments Welcomebarefootwahine1@yahoo.com Patti Bankson Who Can You Trust?The Way I See It Patti Bankson PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. NOW ENROLLING FOR THE 2018-2019 SCHOOL YEAR! VPK (limited spots available) Before & After School Care SCHOOLS WE SERVICE: 441 S Highland Ave. Apopka, Florida 32703 | 407-886-0015 OFFERING Hours of Operation: 6 a.m. 6 p.m. (Activities, Teacher Directed) PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. FOR A FEE ADVERTISED MINIMUM FEE ONLOR FOR FREE SERVICE: THE PATIENT AND ANY OTHER PERSON RESPONSIBLE FOR PAYMENT HAS THE RIGHT TO PAY, CANCEL PAYMENT, OR BE REIMBURSED FOR PAYMENT FOR ANY OTHER SERVICE, EXAMINATION, OR TREATMENT THAT IS PERFORMED AS A RESULT OF AND WITHIN 72 HOURS OF RESPONDING TO THE ADVERTISEMENT FOR THE FREE, DISCOUNTED FEE, OR REDUCED FEE SERVICE, EXAMINATION OR TREATMENT. ONLY VALID WHEN INSURANCE COVERAGE IS NOT APPLICABLE. FOR A FEE ADVERTISED MINIMUM FEE ONLOR FOR FREE SERVICE: THE PATIENT AND ANY OTHER PERSON RESPONSIBLE FOR PAYMENT HAS THE RIGHT TO PAY, CANCEL PAYMENT, OR BE REIMBURSED FOR PAYMENT FOR ANY OTHER SERVICE, EXAMINATION, OR TREATMENT THAT IS PERFORMED AS A RESULT OF AND WITHIN 72 HOURS OF RESPONDING TO THE ADVERTISEMENT FOR THE FREE, DISCOUNTED FEE, OR REDUCED FEE SERVICE, EXAMINATION OR TREATMENT. ONLY VALID WHEN INSURANCE COVERAGE IS NOT APPLICABLE. Con dence StartsWITH A SMILE FREE CONSULTATION Full Exam (D0330 D0340, D0150) Cannot be combined with any other offer, insurance, or discounts. Must present coupon at time of initial consultation Premier www.TheModernSmile.comSE HABLA ESPAOL Con dence StartsWITH A SMILE FREE CONSULTATION Exam (D0330 D0340, D0150) Cannot be combined with any other offer, insurance, or discounts. Must present coupon at time of initial consultation www.TheModernSmile.com GIVE YOUR CHILD A BEAUTIFUL SMILE THAT WILL BENEFIT THEM FOR A LIFETIME. GIVE YOUR CHILD A BEAUTIFUL SMILE THAT WILL BENEFIT THEM FOR A LIFETIME. Premier SE HABLA ESPAOL

PAGE 6

community and different factions of the Republican Party. He routed the Dems, promising to kick out al leged crooks and com munists in D.C., waged against commies world wide, and then went to Ko rea, implying that he had a plan to end that war. He beat Adlai Steven time and by 16 percent the second time. But, the dif ference was our nation re against communism. Ike expanded Social Security, created the De partment of Health, Educa tion and Welfare, and wise ly spent billions on public housing and the building of the interstate highways and freeways. He pointedly stressed religion devotion and fought for desegregation, sending paratroopers to en force it in Little Rock, Ar kansas, in 1957. He accomplished all this plus more with the Dems controlling Congress for six of his eight years in Todays Democratic Party of nay-saying haters, despite the needs, would have driven Ike to an Obamanation lifestyle on the golf courses of our na tion and been Hate Ikers, despite major accomplish ments per todays treat ment of Trump. Jesus made sure he selected a man with plenty of his own money and golf courses. Be assured that the Dems campaigns of this year and 2020 will be lessons in lies and hate speech, addressing the de plorables (Hillarys term for conservatives and, I as sume, Jesus) as the princi pal subject. I can remember the campaigns prior to the transition of the Dems to the party of hate and na mecalling. Even in my lib eral home state of Massa chusetts, candidates cam paign themes were not ly ing accusations or insulting names of opponents. In the 1950s it was Dever Forever, and a campaign music tune to HA-DOUBLE N-I-G-A-N spells HANNIGAN. Like many Mass. Re publicans, I occasionally changed my political party registration to Democrat to be able to vote for the least liberal Dem. since there would occasionally be no Republicans on the ballot for my district. I would estimate that the hate stuff came into play with the arrival of the Clintons, and has worsened to the domination it ex presses now. The next phase is, of course, the assassination policy that you can see with the rocket rise in mur ders and suicides in addi tion to the slaying of our being shot nationwide dou bling in number over last year. And another angel came out from the altar, and cried with a loud cry to him that had the sharp sickle, saying, Thrust in thy sharp sickle, and gath er the clusters of the vine are fully ripe. And the an gel thrust in his sickle into the earth, and gathered the vine of the earth, and cast it into the great winepress of the wrath of God. Rev elation 14:18 and 19. Corbeil: Past campaigns were not so hateful Continued from page 2A The Apopka Chief, August 3, 2018, Page 6A ALL ABOUT APOPKA (USPS 545-440) The Apopka Chief is published every Friday and entered as Periodicals, postage paid at Apopka 1879. The Apopka Chief newspaper is published by Foliage Enterprises, Inc., every Friday at 400 North side Orange County. Phone 407-886-2777. Post master: Send address changes to The Apopka Chief The Apopka Chief is a consistent award-winning community weekly newspaper and a member of the Florida Press Association. The newspaper won the groups award as its best newspaper in 1982, 1987, and 1988, the only three-time winner. Letters to the editor are welcome, but must be signed and include a daytime telephone number, address,, or ters. www.theapopkachief.com, news@theapopkachief.com City of Apopka Telephone Numbers Orange County Telephone Numbers Other Area Numbers of Note City Hall ............................ .................. City Administrator ............ City Clerk .......................... Community Devel. ............ Code Enforcement ............ Finance Dept. .................... Fire (non-emerg.) .............. Parks and Rec. Dept. ......... Police Chief ....................... Police (non-emerg.) ........... Job Line ............................. Solid Waste Collect. .......... Street Maintenance ............ Utility Billing .................... ..................... 911 The city of Apopka was chartered in 1882. 150 feet above sea level. Its population is about 48,000 and its total area is more www.apopka.net Animal Services .......... 407-254-9140 Auto/Boat Tags ........... Building Dept. ............. County Chairman ........ County Commission .... County Attorney .......... Clerk of the Court ....... Elections Supervisor ... Fire/Rescue ................. Garbage Collecting ..... Health Dept. ................ Hunting/Fishing Lic. ... Parks and Rec. Dept. ... Property Appraiser ...... Sheriff Administrative 407-254-7000 Non-Emerg. Complaint Utilities ........................ All other departments .. ............... 911 U.S. Senators Bill Nelson (Dem.) ........... 407-872-7161 Marco Rubio (Rep.) ......... U.S. Representative Val Demings (Dist. 10) .... State Representatives Kamia Brown (Dist. 45) ... State Senators Randolph Bracy (Dist. 11) 407-656-6716 Orange County Commissioner Rod Love .......................... Orange County Public Schools Pupil assignment .............. Bus routes ......................... Superintendent ................. School Board .................... Miscellaneous The Apopka Chief ............. 407-886-2777 Museum of the Apopkans Chamber of Commerce ..... 407-886-1441 The Apopka Chief Established 1923 www.theapopkachief.com Your Opinion Counts! Send a letter to the Editor at CITY OF APOPKA PUBLIC HEARING NOTICEThe following ordinance will be read and considered for adoption at the City Council meeting in the Apopka City Hall Council Chambers on Wednesday, August 15, 2018, 7:00 p.m., or as soon thereafter as possible. ORDINANCE NO. 2669 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, AMENDING CHAPTER 66 SOLID WASTE OF THE CODE OF ORDINANCES OF THE CITY OF APOPKA, BY AMENDING ARTICLE II, DIVISION 1, SECTION 66-36 DEFINITIONS; SECTION 66-37 AUTHORITY OF PUBLIC SERVICES DIRECTOR; SECTION 66-40 SPECIAL COLLECTION PROBLEMS; SECTION 66-65 PREPARATION OF MATERIALS FOR COLLECTION; SECTION 66-66 PLACEMENT OF MATERIALS FOR COLLECTION; SECTION 66-68 FEE SCHEDULE RESIDENTIAL; AND SECTION 66-90 PREPARATION OF MATERIALS FOR COLLECTIONS; AND; PROVIDING DEFINITIONS; PROVIDING FOR APPLICABILITY; PROVIDING FOR A BEAR MANAGEMENT AREA; PROVIDING FOR ENFORCEMENT AND FINES; PROVIDING FOR PENALTIES; PROVIDING FOR CONFLICT, SEVERABILITY; AND AN EFFECTIVE DATE. Interested parties may appear at this meeting and be heard with respect to the proposed ordinance. The proposed ordinance is available in the City Clerks Please be advised that, under State law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act (ADA), persons with disabilities needing assistance to participate in any of these Linda F. Goff, City Clerk City of Apopka, Florida Publish: The Apopka Chief 161020 WA D.A. M BSpecializing in Now Accepting New Patients PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Lyne Sy Tangco, D.D.S.Complete Family Dentistry New Patients WelcomeLanguages Spoken: Creole and TagalogMon., Tues., and Thurs. 8:00 a.m. to 5:00 p.m. Wednesday and Friday 8:00 a.m. to 2:00 p.m.1706 E. Semoran Blvd, Suite 106, Apopka 407-886-8817 Apopka Dental Art, P.A. Keep SmilingSpecial Introductory Offer $49 Most Insurance Acceptedincludes full exam Fmx, Panoramic & Consultation apopkadentalart.comuninsured patients only PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. CARDS CARDS CARDS CARDS The way the documen tary makers weave ele ments of Fred Rogers per sonal life into the narrative about the show is refresh ingly original. Wt You nitely not an everything you ever wanted to know about Fred Rogers indul gence. The little we learn about his childhood ap pears late in the documen tary. The rumor that I had heard about Mr. Rogers military record was de bunked. We come to see a man whose work was the embodiment of his life and values. What surprised me most in this documentary was that Mr. Rogers was the target of denunciations and protests. Some adults vehemently attacked him for thwarting human devel opment through the sub children, I like you just the way you are. Huh? All I can say is that those critics must not have ever had chil dren themselves. One of the most important things a parent can do for children is to help them feel com fortable in their own skin. Mr. Rogers wasnt telling 5-year-olds that they would never have to grow up and get a job. He was giving them the reassurance that s OK to be a child today, and not to feel that they had to have the adult world were still in kindergar ten. Fred Rogers had the wisdom to realize that the world can be a very con fusing, even threatening, place to children, who lack the emotional and rational maturity to cope with all of lifes challenges. How im mensely important, then, was his gentle, comfort ing voice reassuring kids that despite its bumps and bruises, life can still turn out well. Others condemned Fred Rogers for not being condemnatory. The docu mentary makes clear that Mr. Rogers, an ordained Presbyterian minister, up held Christian standards in his life and on his show, but refrained from blustery denunciations. It becomes clear in the documentary that Mr. Rogers saw his ministry as not to sit in judgment and condemn, but simply to love others. He was content to leave the ultimate judgment of indi viduals to God. Like many in the cin ema where I saw Wt You Be My Neighbor? I had some tears in my eyes. I was deeply moved by how beautiful and power ful a loving heart can be. As I left the cinema, I al most felt a sense of culture shock. At a time when Hol lywood relies on over-thetop stimulation to entertain us, this low-key documen tary about an unpretentious man and his unpretentious show delivered a deeper, more genuine emotional experience. If your faith in the goodness of man kind needs a boost, go see t You Be My Neigh bor? Dr. Mark W. Hendrick son is an adjunct faculty member, economist, and fellow for economic and social policy with The Cen ter for Vision & Values at Grove City College. explore three reasons why you should be. First, the Apopka Area Chamber of Commerce is the voice of the Apopka business community. This starts with Robert Agrusa, the new president of the Chamber. Over the past the Chamber provide gen uine leadership in order and governmental issues impacting our communi ty. Plus, the new vision of the Chamber is to build a prosperous and sustainable community through leader ship and service. Secondly, the Apop ka Area Chamber of Com merce connects business and people. With more than 470 members, theres a high probability that youll connect with some one new in our community. Additionally, by providing a network of resources and opportunities, the Chamber can promote business suc cess by leveraging partner ships, collaboration, and credibility with our mem bers and the greater Apop ka community. Lastly, the Apopka Area Chamber of Com merce serves the business es and people of our com munity. By acting with in tegrity, theyve been able to give back to our com munity in times of need, including post-Hurricane Irma, by generously donat ing to each of the restau rants that won in each of the four Best Of award categories at the 12th an lice Departments Shop with a Cop program which helped provide a holi and partnered with Vic tory Church in Apopka to help gather and send hun dreds of relief supplies to the people of Puerto Rico, St. Thomas and St. Martin, who were directly affected by the devastation of Hur ricane Maria. Finally, the Chamber has been able to bring a diversity of per spectives together in order to promote and grow the visibility of our communi portunities and challeng es and provide trusted re sources and support for our members. In closing, the Apop ka Area Chamber of Com merce is more than just a Chamber. It is a collec tion of great organizations, cials, community leaders and an awesome new staff that is focused on meeting your needs and ensuring your business success, all while enhancing our broad er community. Hendrickson: Rogers portrayal on TV was real Continued from page 2A Love: Chamber serves business and citizens Continued from page 2A

PAGE 7

The Apopka Chief, August 3, 2018, Page 7A grant for the bear-resistant garbage cans, it will allow citizens to purchase the containers for $50 each. However, those who have the bear-resistant cans will have only a two-hour window in which to take their containers to the roadside for pickup by the city. In an effort to keep the bears from possibly going after the containers, the bear-resistant cans may be placed at the roadside only from 5-7 a.m. on the day of pickup. The ordinance is expected to re cils August 15 meeting. FBI recognizes APD Several members of the Apopka Police Department and other law en forcement agencies were recognized their work in help capturing serial bank robbers. Several weeks worth of surveil lance paid off on December 7, 2017, when four suspects were arrested as they attempted a bank robbery at Ibe ria bank, 1420 W. Orange Blossom Trail, Apopka. Along with the FBI, Florida De partment of Law Enforcement and other agencies, the Apopka police fol lowed and watched the robbers for several weeks prior to their arrest as they attempted to rob the Iberia bank in Apopka. The four men were taken into custody as they approached the front door of the bank. No one was injured in the takedown of the men described by police as violent serial criminals. Fireworks Dubbed as Sunday Fun Day, the and other activities on Sunday, Sep tember 2, over Labor Day weekend. The special event came as the re 4 at the citys Independence Day cel ebration at the Apopka Amphitheater located at the Northwest Recreation vendors as Zambelli Fireworks, a na The selection (of Zambelli) is based on their history as a reputable pyro technic company and past perfor mance experience with the city of Apopka, stated the request from the Apopka Recreation Department to the Sunday Fun Day will replicate those of the Independence Day cel ebration, but on a smaller scale, city documents stated. There will be live ing, a balloon artist, and food ven dors. Edward Bass, city administra tor, said the city has not yet received a technics, but that the city will take le gal action, if necessary. e are going to go after him for the moneyBass technics in advance. There may be a possibility that, the citys insurance carrier for the event may cover that cost, Bass said. There will be no charge for park ing for Sunday Fun Day as there was for the Independence Day event. The city expects $1,350 in revenue from vendors, while spending $23,543.12. The funds will come from the Recre ation Department budget. while the city will spend $4,350 on entertainment. At its meeting on Wednesday, Lorena Potter, recreation director, say bor Day weekend is about half that of Independence Day because so many Dollar General Apopkas fourth Dollar General store missioner Kyle Becker voted against study that accompanied the proposal. The store will be located at the north west corner of the intersection of Park Avenue and Michael Gladden Boule vard. the level of service for the roads in that immediate area is F, which is the worst. ere going to perpetuate the issues by approving this project, Becker said. sues at the intersection, studies show there. The Dollar General will be the fourth in the city of Apopka. The building will be 7,600 sq. ft. and will sit on a one-acre parcel. cil ends the approval process for the store, which began in March 2017. Developent items Several projects that developers are looking to bring out of the ground were given unanimous approval by self-storage facility that will go on the same parcel were approved for a 12acre parcel at 1616 E. Semoran Blvd., behind the Aldi grocery store. pool, while the self-storage building will be three stories. Lakeshore of Wekiva, formerly known as Sandpiper Road subdivi sion, was given approval for a revised over what developers said was a mis take made when a dry retention pond ter Management District was left off documents drawn up by the develop er. That retention pond required that more trees be torn down, which was a bone of contention during the original approval process. lives near the development, ques tioned the developers motives, say ing they may be asking for forgive ness rather than permission. The de velopers representatives said they were embarrassed to have to seek due to the mistake. Beazer Homes will develop the which are developable. A new church building for Great unanimous approval with little dis cussion. gregation are looking to build a sanc tuary, fellowship hall, and classrooms cel is at the southeast corner of the intersection of Martin Street and Vick Road across from Apopka High School. Funds given mous approval to the Apopka Police Departments request to donate funds to programs at Apopka High School. Through its Law Enforcement Trust Funds, the Apopka Police De partment donated a total of $3,000 to a pair of programs at Apopka High. The department will donate tium of Scholars, which is a program that provides incentives for student academic success. Another $1,500 will go from the Law Enforcement Trust Funds to the athletic department at Apopka High. Trust fund rules allow local law enforcement agencies to use a per centage of the total shared monies re ceived for the costs associated with drug abuse treatment, drug and crime prevention education, or other non activities that are formally approved The Apopka Police Department supports initiatives that promote youth activities that are consistent with a healthy, anti-drug lifestyle. These expenditures are supportive of and consis tent with the departments support of local school ac McKinley wrote in his re quest for approval from the Bear: Continued from page 1A The gray-shaded areas outlined in black show the general areas where the bear ordinance will be effective within the city of Apopka. JAMES MALTBY Owner Licensed & Insured 321-689-5866 MALTBYSTree Service & Landscaping Maintenance PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible.SMILE WITH COSMETIC & GENERAL DENTISTRY Get-Acquainted Special! Valid for new patients only. Not to be combined with any other offer. Transferable. Please share with your family and friends. Exp. 8/31/18. New Patients Welcome! Schroeder Dental Group C o dence! Valid for new patients only. Subject to exam by doctor. Does not include periodontal gum disease treatment. Not to be combined with any other offer. Transferable. Please share with your family and friends. Expires 8/31/18. SMILE WITH COSMETIC & GENERAL DENTISTRY New Patients Welcome! Schroeder Dental Group C o dence! Get the sensational smile you deserve! Transferable. Please share with your family, friends and co-workers! Offer good for 30 days. Expires 8/31/18.SMILE WITH COSMETIC & GENERAL DENTISTRY New Patients Welcome! Schroeder Dental Group C o dence! PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. When Quality Service Matters D O BROTHERSLandscaping & Maintenance Corp.26 years of service with Full Service Landscape and Maintenance C o n t r o l S U M M E R g r o w t h You pay: Fair PricesWe pay: Close Attention to Detail!You call: Don at 407-369-0431 We give: References and free estimates. Licensed & Insured PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. STUDY SERVICE 10:00 AM 11:30 AM Community Church 407-218-5155 STUDY SERVICE Community Church 407-218-5155 STUDY SERVICE 10:00 AM 11:30 AM Community Church 407-218-5155 PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER: is proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. GOLF CLUB Golf Special www.ZellwoodGolf.comCall 407-886-3303 today for your Tee Time! Valid for up to 4 players. Not valid with any other offer. Must present coupon at check-in. Expires 8/31/18. $ 25 18 HOLES THREE-MONTH TRIAL MEMBERSHIP Plus TaxINCLUDES: Green Fees & Cart Fees. One Sleeve of Golf Balls. Unlimited Golf Cart Fees & Range Balls Included Single $650 tax included Family $976 tax included Dance Gear is located inside KidzDance in Victoria Plaza, 1007 W. US 441, Apopka407-889-9898 Bring in this ad for 10% OFF Come Visit or Give us a Call! PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. CAPEZIO ~ BLOCH ~ LEOS ~ HARMONIE ~ JO + JAX ~ HEART + SOUL ~ HONEYCUT SASSI DESIGNS ~ SUGAR + BRUNO ~ SO DANCA ~ REVOLUTION ~ AND MORE!~ T R E N D Y T R E N D Z ~ ~ B O D Y W R A P P E R S ~ PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible.

PAGE 8

The Apopka Chief, August 3, 2018, Page 8A plans for a proposed Hilton Garden Inn at the city center area located near the inter section of U.S. 441 (Main Street) and State Road 436 (Semoran Boulevard). The four-story, 114-room hotel is planned to be built facing McGee Avenue on the west side of the city center proper ty with access also to Sixth Street on the south side of the property. The main difference with the city cen ter project is that, due to the agreement be tween the city of Apopka and Taurus South ern Investments, the developer of the proj ect, approvals for the various buildings and businesses in the city center do not have to go before the Planning Commission or the City Council. Only city staff has to give approval for the project. The faade of the hotel was a negotia tion between Hilton and Eleven 18 Archi tecture, which is working with Taurus on various aspects of the city center. Because of the topography of the land, the area where the hotel will be built will be lowered, as will McGee Avenue, which drops in elevation from north to south. Jeff McFadden of Taurus said that the plans for the hotel are about 75 percent completed and that site work on the prop erty should begin in about 30 days. The site work is expected to take about eight weeks and construction will begin af ter that. Precinct 233 will move to Word of Life at 1853 Vick Road from Northside Baptist Church. Precinct 239 will move to Zellwood United Methodist Church at 5538 W Jones Avenue from St Patrick Catholic Church. Topping the ballot for residents of Northwest Orange County is the race for Or ange County Commission District 2. The winner of this four-person race will replace Rod Love, who was appointed by an Nelson, who had to resign that position to run for mayor of Apopka, a race Nelson won in March. Love decided not to run in the up coming election. Three of the candidates are Apopka resi dents and one lives in the Pine Hills area of Orlando. Fred Brummer, Mark Byrd, and Chris tine Moore all live in Apopka, while Patricia Rumph lives in Orlando. Moores resignation from the School Board to run for the Orange County Commis sion has four people seeking to replace her for the remaining two years on her term. Two people from Northwest Orange County are on the ballot, while one is from Ocoee and one from Winter Garden. Chan-Denise Budhoo has a Plymouth address, while Melissa Mitchell Byrd lives in Apopka. Jeffrey Lynn Richardson lists Ocoee as his home and Eric Schwalbach is from Winter Garden. All are political newcomers. Two countywide races also likely to at tract plenty of attention from voters in North west Orange County are the Orange County mayors race, and the battle for chair of the Orange County School Board. In both cases, term limits have opened up the races. Orange County Mayor Teresa Jacobs cannot run for a third term, but she is in the race for School Board chair as current Chair Bill Sublette is term-limited and cannot run again. Running to replace Jacobs as Orange ers Orange County Sheriff Jerry Demings and Orange County District 3 Commission er Pete Clarke. Winter Park businessman Rob Panepinto is also running for Orange County mayor. Jacobs is one of three Orlando residents running for School Board chair. Nancy Rob binson, School Board member from District 6, is also in the race as is Robert Prater, a dean at an Orlando elementary school. Apopka resident Matthew Fitzpatrick is also running for the seat. ing two years of Demings term. One of the candidates is a Democrat with one of those the most well-known of those running. The Democrat is Darryl B. Sheppard of Orlando. Orlando Police Chief John Mina, who lists an Ocoee address, is running for sheriff. is Joe Lopez of Orlando. Apopka-area state representatives in the Florida Legislature include incumbents Ka mia Brown of District 45 and Jennifer Sulli van in District 31. Brown is unopposed in her re-election bid while Sullivan is the lone Republican in her race for re-election. She faces a general election battle from Democrat Debra Kaplan of Eustis. Kaplan, who lists her occupation as a business developer, was a reporter for The Apopka Chief several years ago. A truck hauling rocks fell on its side Thursday, August 2, after a collision with a box truck at the interchange of State Road 429 (Wekiva Parkway) and Kelly Park road. The box truck driver was cited. Neither driver had life-threatening injuries. Wekiva Parkway crash Continued from page 1A Continued from page 1A City: Hotel plans coming along Sample: Some polling sites changed PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Perrys Decorative Glass352-751-0883www.EntryPointbyPerrys.com*Not good with sales, promos or closeouts already marked down. Not good on prior purchases. Lic# SCC131151683 Change out those old sliding glass doors with new French doors with blinds! FREE In-House Estimates FRONT ENTRY DOOR w/ 1 SIDELIGHT or 2 SIDELIGHTS NEW DOORS WITH YOUR CHOICE OF or FULL GLASS Many other designs to choose from at close-out prices until gone. Limited quantity (Prices Good For In Stock Only) Till Gone Many More Designs To Pick From Mismatch & one of a kinds. Many 8 side light to choose from. Laurel PL 22x64 Reg. $799Sale $599 Tripoli 22x64 Reg. $799Sale $549 Discount Discount Close-Out Until Gone Until Gone Low-E Trillion 22x64 Reg. $799Sale $499 More Close-Outs Just Arrived Are your Entry Doors wearing out?COMPLETE DOOR REPLACEMENTS NOW AVAILABLE! CLASSIC CAR Show Top 5 picks Trophies 50/50 Drawing 601 S. Highland Ave. Apopka, FL 32703 407-886-1740At The Episcopal Church of the Holy SpiritAUG 4, 2018 9 AM 1 PMA portion of the proceeds will Free Admission Family Fun DJJR Goodman Kids Bounce HouseGet More Information & Register at HolySpiritApopka.comSponsored By 1551 East Semoran Blvd., Apopka 407-889-7600PRE REGISTRATION $12 DAY OF SHOW $15 Open to all makes and models Co-Sponsors CENTRAL FLORIDA CLASSIC TRUCK CLUB PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Frame and Lens PurchaseNot combinable with insurance or other discounts. With coupon. Expires 8/31/18. Reimbursement of your eye exam up to $59.00 Value.* With the purchase of frame and lenses. Cannot be combined with insurance or other discounts. With coupon. Expires 8/31/18. $50 OFF 407-880-0335 407-880-0335 Personalized Service from our Family to Yours. Personalized Service from our Family to Yours.EYE EXAM FREE Frame and Lens PurchaseNot combinable with insurance or other discounts. With coupon. Expires 8/31/18. Reimbursement of your eye exam up to $59.00 Value.* With the purchase of frame and lenses. Cannot be combined with insurance or other discounts. With coupon. Expires 8/31/18. $50 OFF EYE EXAM FREE 730 S. Orange Blossom Trail Apopka, FL 32703 730 S. Orange Blossom Trail Apopka, FL 32703 www.OpticalEyeland.com www.OpticalEyeland.com Everybody has an opinion. Why not share yours! Send a letter to the Editor online www.theapopkachief.com PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. CHAMBER CONNECTION Pamela Nabors 390 North Orange Avenue, Suite #700 Orlando, Florida 32801 407-531-1222 878 Evergreen Avenue Altamonte Springs, Florida 32701 407-595-2592 Wednesday July 18, 2018, marked the rst Board of Directors meeting for our new Chairman, Ken Croston Jr., from Electronic Locksmith. We would like to thank our outgoing Chairwoman Deborah Perez for her incredible leadership and her unwavering support of the Apopka Area Chamber of Commerce, over this past year! Additionally, we want to thank and congratulate Raymond McLeod, David Rankin, Pam Dionne, and Heather Baker, for their countless hours of time, dedication and guidance to this organization over the past twenty-plus years! Each of you will be truly missed and we are grateful for your service! Lastly, we would like to welcome our new Board Members including Chris Dawson, Brent Hill, Frances Portalatin, and Michelle Hinden and we look forward to an exciting year ahead! 2166 South Orange Blossom Trail Apopka, Florida 32703 407-464-0555

PAGE 9

!"#$!%&'()'$*!+&#(,-#$)!'.!/0#1)&'$,1!2'13(4,)5*!6$17*!58(!9##$!#0#1)#-!158,&!'.!)5#!:'8&-!'.!;,)'&(!.'&!)5#!<+'+38!<!%584=9#&!'.!%'44#&1#7!>6!84!5?490#-!)'!9#!#$)&?()#-!)'!158,&!)5,(!,$=1&#-,90#!'&@8$,A8),'$!8$-!B#&C!#D1,)#-!89'?)!)5#!'+=+'&)?$,),#(!85#8-*E!(8,-!%&'()'$7!F#!$')#-!)58)!'B#&!)5#!+8()!C#8&*!%5849#&!0#8-#&(!58B#!9##$!58&-!8)!G'&3!?+-8),$@!)5#!'&@8$,=A8),'$H(!()&8)#@,1!+08$!8$-!G,00!(''$!9#!08C,$@!'?)!8$!849,),'?(!B,(,'$!98(#-!'$!,$+?)*!'44#$-8),'$(*!8$-!,-#8(!)58)!58B#!9##$!&#=1#,B#-!.&'4!9'8&-!8$-!@#$=#&80!4#49#&(7!!I$-#&!%&'()'$H(!0#8-=#&(5,+*!8!&#B,#G!1'44,))##!58(!9##$!)8++#-!)'!.81,0,)8)#!)5#!,$=-#+)5!G'&3!&#J?,&#-! 9C!()&8)#@,1!+08$$,$@7!K5#!@&'?+!58(!80('!#D+0'&#-!9#()!+&81),1#(!.&'4!')5#&!15849#&(!8$-!(?11#((.?0!'&@8$,A8),'$(7!>K5,(!+08$!G,00!#$(?&#!)58)!G#!1'$),$?#!)'!0#8-*!1'$$#1)*!8$-!(#&B#!8)!)5#!5,@5#()!0#B#0!8(!G#!G'&3!)'!+'(,),'$!'?&!%5849#&!.'&! )5#!.?)?&#*E!%&'()'$!(8,-7!><(!8!(?11#((.?0!<+'+=38=98(#-!9?(,$#((!'G$#&*!%&'()'$!,(!G#00!+'(,),'$#-!)'!0#8-!)5#!<+'+38!<!%5849#&!,$)'!)5#!.?)?!F#!?$-#&()8$-(!)5#!15800#$@#(!9?(,$#((!'G$#&(!.81#!8$-!NQRZVUVWKDQGWKHLP = +'&)8$1#!8!%5849#&!18$! +08C!,$!5#0+,$@!)5'(#!9?(,=$#((#(!(?11##-7!<(!.'?$-=#&!'.!/0#1)&'$,1!2'13(4,)5*!'&,@,$800C!3$'G$!8(!L'&0-!%08((!6$()8008),'$(*!6$17*!5#!58(!@&'G$!)5#!1'4+8=$C!.&'4!8!)G'=48$!4'9,0#!9?(,$#((!)'!$'G!,$10?-#!8!MN*NNN=(J?8&#!.'')!'+#&=8),'$!)58)!#4+0'C(!$#8&=0C!ON!+#'+0#*E!8!%5849#&!(+'3#(48$!(8,-7!/0#1)&'$,1!2'13(4,)5!,(!3$'G$!G'&0-G,-#!.'&!#0#1)&'$,1!0'-@,$@!0'13(!8$-!+8&)(7!!K5#!1'4+8$C!()'13(!8$-!(?++0,#(!P$,)C*!Q,$@=&DUG6DRNDQGPDQ\')5#&!5')#0!0'13!(C()#4(!8(!G#00!8(!#0#1)&,1!()&,3#(*!48@$#),1!0'13(!8$-!18&-!-#&(7!R'&!4'&#!,$.'&48),'$!89'?)!)5#!%5849#&*!1800!SNT=UUV=WOMO7 !"#$%&'()"#*+',,'#-+&&'.<+'+38!%5,#.!6$)#&$!K5#&#!,(!8!0,))0#!4'&#!)58$!8!G##3!0#.)!?$),0!(15''0!()8&)(!,$!P&8$@#!%'?$)C!'$!X'$-8C*!K5#!&'0#!'.!)5#!8(=(,()8$)!+&,$1,+80!,(!)'!(?+=+'&)!)5#!B,(,'$!'.!)5#!+&,$=1,+80!8$-!0#8-!G,)5!)58)!B,=(,'$!,$!4,$-*E!F#,$A!(8,-7!>6!G8(!.'&)?$8)#!8(!8$!8(=(,()8$)!+&,$1,+80!)'!@8,$!#D=+#&,#$1#!,$!48$C!-,..#&#$)!8(!)'!5#0+!4#!-#B#0'+!8!B,(,'$!)58)!,(!,$!)5#!9#()!,$=)#&#()!'.!'?&!()?-#$)(*!()8..*!8$-!1'44?$,)C7E!F#,$A!(8,-!)58)!)5#!+&#+8&8),'$!.'&!)5#!(15''0!,$B'0B#-!8!0')!'.!1'0089'=&8),'$!G,)5!)5#!@?,-8$1#!1'?$(#0'&(!8$-!)#815#&(!)'!#$(?&#!)58)!)5#!()?-#$)(!G,00!)5&,B#!8$-![NMU=[NMW!G,00!9#!8!@)!(15''0!C#8&7!>K5#&#!58B#!$')!9##$!8$C!48Z'&!158$@#(7!<+'+38! F,@5!Y15''0!,4+&'B#-!)'!8!:!&8),$@!,$![NMU!8$-!)5#&#!8&#!8!0')!'.!@)!)5,$@(!@'=,$@!'$!5#!L#!1'$),$?#!)'!#B80?8)#!800!8(+#1)(!8$-!G,00!9#!(?&#!)'!8-Z?()!)'!1'$),$?#!)'!,4+&'B#*E!)5#!+&,$1,+80!(8,-7!F#,$A!(8,-!5#!,(!G'&3=,$@!B#&C!58&-!G,)5!5,(!()8..!,$!,4+&'B,$@!)5#!(15''0*!818-#4,1800C!8$-!8(!8!()?= -#$)!9'-C7!!>6!18$H)!(8C!)58)!)5#&#!58(!9##$!8!9,@@#()!1580=0#$@#*E!5#!(8,-7!>K5#&#!,(!80G8C(!8$!8-Z?()4#$)!+#=&,'-!G5#$!$#G!0#8-#&=(5,+!1'4#(!,$*!9?)!6!.##0!G#!58B#!80-C!9#@?$!)'!1'4#!)'@#)5#&!8(!8$!8-4,$=,()&8),'$!)#84!)'!+&#+8&#!.'&!)5#!?+1'4,$@!(15''0!C#8&7!6)!,(!8!15800#$@#!)'! G'&3!.&'4!8!0,()!'.!$84#(!8$-!$')!C#)!3$'G!800!'.!)5#!)#815#&(!8$-!()8..7!6!-'!='@$,A#!48$C!'.!)5#!$84#(!8$-!3$'G!)5#,&!.81#(*!9?)!6!0''3!.'&G8&-!)'!G'&3,$@!G,)5!#B#&C'$#!)'!1'$),$?#!)5#!(?11#((!8)!<+'+38!F,@5!Y15''07E!F#,$A!(8,-!)58)!,)!,(!,4=+'&)8$)!)58)!C'?!18$!G'&3!G,)5!8$-!1'44?$,18)#! G,)5!C'?&!()8..!,$!'&-#&!)'!+?(5!.'&G8&-!8$-!5#!58(!9##$!G'&3,$@!'$!)58)!(,$1#!5#!G8(!5,&#-!8(!+&,$1,+80!8)!<+'+38!F,@5!Y15''07!F,(!B,(,'$!,(!B#&C!10#8&!8(!.'&!G'&3,$@!G,)5!5,(!)#84!)'!+&'B,-#!#815!()?=-#$)!G,)5!(?++'&)7!>K5#&#!8&#!@)!)5,$@(!@',$@!'$!5#&#!8)!<+'+38!F,@5!Y15''0*E!F#,$A!(8,-7!>K5#&#!,(!80G8C(!8$!8-Z?()=4#$)!8(!#D+#1)8),'$(!8$-!)5#!B,(,'$!'.!)5#!+&,$1,+80!G,00!-,..#&!.&'4!+#&('$!)'!+#&('$7!6!)5,$3!,)!,(!,4+'&=)8$)!)58)!6!1'44?$,18)#!4C!B,(,'$!10#8&0C!)'!)5#!)#84!('!8!+08$!18$!9#!,$!+081#!)'!+&'B,-#!#815!()?-#$)!G,)5!)5#!(?++'&)!$##-#-!)'!58B#!(?11#((!5#!>6.!G#!+&'B,-#!(?++'&)!8$-!4##)!)5#!$##-(!'.!'?&!()?-#$)(*!)5#$!#B#&C)5,$@!G,00!9#!?$-#&!1'$)&'0!8$-!0#8-!'?&!()?-#$)(!)'!(?1=1#((7E !&'$);?$@'9#$+;$#A#;/. Lyle Heinz, (c), spoke to parents when he was named principal of Apopka High School in June. Heinz has a vision for the school and is planning to implement that vision with the support of his administration and staff. Pictured above is Ken Croston of Electronic Locksmith, (l), and last year's Chamber Chair Deborah Perez of Waste Management. Part of the proceeds from the Classic Car Show will benet Apopka's Debbie Turner Cancer Care Center and N.A.O.M.I.'s KIDS. &ODVVLF&DU6KRZZLOOEHQHWFKDULWLHV %B2$&9+;8+&)1:$-01#$B#+;C:$+.$9#)?0$/'$./)9/$/"#$.8"''1$0#)9 Apopka High School held its band camp for a cou-ple of weeks before school starts. Band members, such as this piccolo player, practice holding their instruments while marching Monday, July 30. 2(8$+&36$;&<9 Over the weekend, the Apopka Police Department was invited to Pleasant View Baptist Church for a Law Enforcement Appreciation event. Members of the church met Chief Mike McKinley who gave the opening speech and introduction. After the service, mem-bers walked outside to see the static displays of emergency vehicles and were able to collect crime prevention and safety material for the children and adults as well. The Apopka Citizens Police Academy Alumni volunteered their time to help ngerprint the children. Thank you to everyone for support of the community and the APD. 2=>$&%$=4.&'&3%$?0./ *")@D#9$',$*'@@#98#$").$;#E$8")+9

PAGE 10

! !"#!$!%&'(!"$!))! "! #$"!%&'()'"!*)+*!,&+'*-."!/&0.!123!453!6-7+&8+''+!9-'!:;58!)8!<-=(+5';8"!>+9!/+5'+.3!?&5@)@;5'A!BC)0*5+8"!6)8*-!>;DD)8E+5"!F+8+G!?B;(("!4-5(C-!/;!H;90-8*G!8)8+!E5-8*BC)0*5+8G!')I!E5+-(=E5-8*=BC)0*5+83!6;;J)'!K-J)0.!K&8+5-0!L;J+"!MD;DN-3!! O !"#$%&'&()$*"+#,-$$$%./.01$2-$3456-$7)/#$38 Do you need to receive or send a FAX?is located in the same building asThe Apopka Chief & The Planter newspapers.If so, you can use our fax: 407-889-4121There is a small fee for this service.Apopka O! ce Supply400 N. Park Ave., Apopka, FL 32712 407-889-4455 Honor Your Loved Ones Call 407-886-2777 !"#"$%&'$"(%)$'*"$+),"!"#$%#&'()(*+,(-.#&/0&.&102034%0$5()(20&46./#4&5 *77$#.&10()(*+,(207.#85 9$01/8#1.$(:086#10!"##$%&'$"##$(&)'$'*+",'$-**./0!"#$%&$$"'()## '85;<;=>?.@44A143\HDUVLQ%XVLQHVV‡/LFHQVHG,QVXUHG&$& &*&(&&&& Add Your Church To Our List. Call (407) 886-2777 Newspaper readers are ACTIVE CONSUMERS! !!!!!"#$!"#$!%&'(!)*+!,-./001/,,2,"%&'(&)*+!)345#4(67!89':79!4;!<=5'5!,-./002/>??2"'',-.)/!&0!1&2!)343@&!)55=AB(C!4;!D4E!,-./002/>0-2!FG=!89':79!*&:@9&A!H44E5!,-./..,/-...34%(*'(!!)343@&!I6:5#!J&3#65#!,-./002/>2>0!I6:5#!)G#6479!*65564G&:C!!J&3#65#!89':79!,-./12K/?K10!I6:5#!J&3#65#!89':79!4;!!*4'G#!L4:&!K?>/K0?/>>>>!I6:5#!J&3#65#!89':79!4;!!"&G(&GE4!"3:6GM5!,-./.00/20-N!I6:5#!J&3#65#!"4::=G#4!K?>/K0K/>>,N!I6:5#!J&3#65#!89':79!4;!!!"O==#O&#=:!,-./02>/K01K!I6:5#!J&3#65#!89':79!4;!P&GM=:6G=!K?>/K0K/.1>-!I6:5#!J&3#65#!89':79!!4;!Q=((O44E!,-./001/-?-1!I4:=5#!)R=G'=!J&3#65#!!!89':79!,-./002/,K.,!I4'G#&6G!4;!S6;=!!J&3#65#!89':79!4;!)343@&T!UG7$!,-./0N,/0K>>!D453=(!8=G#=:=E!89':79!0--/1>,/20?-!V43=!J&3#65#!89':79!,-./002/210-!V4#!W4E!89':79!D4E5:4E5<49GXC&944$74A!S47@9&:#!J&3#65#!89':79!,-./>1?/NNKK!*784:A67@!W4&E!!J&3#65#!89':79!A774:A67@:4&EX(6R=$74A!Y4:#956E=!J&3#65#!89':79!,-./00,/,,,K!P9=!89':79!&#!F&@!S=R=(!,-./2?2/N?>K!!!%(=&5&G#!Z6=O!J&3#65#!!!89':79!,-./002/2.N.!W6R=:56E=!J&3#65#!89':79!,-./>1?/K0?-!"3:6GM5!84AA'G6#C!!J&3#65#!89':79!,-./001/>>,Shren Yeager 49A East 3rd Street, Apopka 407-880-3167 Like a good neighbor, State Farm is there. ¨ Apopka Auto UpholsteryBC(DA(B/@(:/800/E(*747F.GH0@#&%(*%6.&10(I#514"&/(*"/4JK&(H"5#&055(B;(?0.85,@.8$0&0()(L."$(M#/N'08.$%E(OP&085 LOOMISCREMATIONS $795 407-880-1007FUNERAL HOMES When you advertise in this section, you get the best of both worlds: low-cost ads AND targeted advertising!Maximize your marketing dollars by FOCUSING your advertising campaign on a concentrated market!!"#$!S'@=[5!I'((!D453=(!!J&3#65#!89':79!K?>/.K?/1N11!P:6G6#C!J&3#65#!89':79!,-./002/>122!H=@6O&!"3:6GM5!J&3#65#!89':79!,-./002/.02,3*.),!J=&:!S&@=!J6B(=!89&3=(!,-./?2K/K1KN3*.)*+4)!5+*,6+,!UL*W!K>N/1,0/K>1074(8&)*+!"#$!I:&G765!4;!)55656!,-./002/,2->!"#$!*&:C[5!\%:4#=7#:=55]!!^@:&6G6&G!‡!,-./002/,0-K7849*'-4(*+!$%*'+&%4)!)57=G564G!89':79T!8+8!,-./00-/1???!789*'(*46! 89:65#!8=G#=:=E! !89:65#6&G!89':79!K>N/KKN/--K2!<4':G=C!89:65#6&G!89':79!,-./00,/.>>K!W4'GE!S&@=!89:65#6&G!!89':79!K?>/.K?/SFZ+789*'(*46!5+*,6+,!89:65#6&G!"76=G7=!89':79!,-./K01/,>--78:9+8!&0!789*'(!)343@&!89':79!4;!89:65#!,-./001/>2K2!89':79!4;!89:65#!!4;!%(CA4'#9!,-./002/N,22!89':79!4;!89:65#!!4;!H=5#!F:&GM=!,-./2?2/>..-!P:6/86#C!89':79!4;!89:65#!,-./1>-/N.?.!N-#9!"#:==#!89':79!4;!89:65#!,-./00,/,0K?78:9+8!&0!1&2!89':79!4;!D4E!4;!Q=((O44E!,-./002/K-.,!D:&7=!"#:==#!89':79!4;!D4E!,-./>10/1N00!V=&(6GM!H&#=:5!89':79!!4;!D4E!,-./002/K.0-!%&:@!)R=G'=!H4:5963!8=G#=:!,-./002/>212!"4::=G#4!89':79!4;!D4E!K?>/.K?/,>,?78:9+8!&0!;,':'!789*'(!&0!<4((,9!=4/!54*6('!)343@&!H&:E!,-./00-/10.. $%*'+&%4)!89':79!4;!#9=!V4(C!"36:6#!,-./002/N.,->4*(8!462!?&92!H4:E!4;!S6;=!,-./002/.,>.>:))!1&'%,)!*6((=G6'A!4;!D(4:C!,-./0N,/--,N!Y=O!84R=G&G#!!%=:;=7#6GM!*6G65#:6=5!!,-./00-/0010@&)*6,'' !"#$!*&##9=O!V4(6G=55!,-./001/>>.,A62,%,62,6(!P:'=!P=A3(=!4;!D4E!,-./00-/0N0NA6(,92,6&-*64(*&64)!!Y=O!Z6564G!!84AA'G6#C!89':79!,-./002/K2N1!Y4:#9O=5#!84AA'G6#C!!89':79!,-./?.0/>-00!FG=!)774:E!89:65#6&G!!I=((4O5963!89':79!,-./?>K/K-->;,B*'8!84GM:=M@G!J=#9!)A!,-./02>/K?-?!84GM:=M@G!4;!W=;4:A!!<'E&65A!,-./2,?/-,,,<:(8,946!"#$!%&'(!S'#9=:&G!,-./001/>2K,#,(8&2*'(!I6:5#!^G6#=E!*=#94E65#!,-./002/K,>N!J=&:!S&@=!^G6#=E!*=#94E65#!,-./02>/N?KN!Q=((O44E!^G6#=E!*=#94E65#!,-./001/,,>2#&94C*46!!W4((6GM!V6((5!!*4:&R6&G!89':79!,-./KK>/0K0-D4E49,6,!8&(R&:C!89':79!4;!!#9=!Y&_&:=G=!,-./001/>N,0!)343@&!"3:6GM96((!89':79!4;!!#9=!Y&_&:=G=!,-./00,/0K>>D&6F=,6&-*64(*&64)!)G46G#=E!H4:E!I&A6(C!!H4:5963!8=G#=:!,-./002/,101!8=G#=:!4;!I&6#9!89':79!!;4:!)((!%=43(=!,-./,2,/1K.?!89':79!4G!#9=!+EM=!,-./021/NNKK !84A3&55!84AA'G6#C!!!89':79!,-./00-/2NN-!L&C53:6GM!84AA'G6#C!!89':79!,-./0N,/,112!+R=:(&5#6GM!84R=G&G#!!89:65#6&G!8=G#=:!,-./00,/0?10!I&6#9O4:@5!89':79!K->/>1K/NK1N!I:==E4A!I=((4O5963!,-./>11/2KNN!I:==E4A!*6G65#:6=5!,-./002/2--2!D:&7=!D453=(!89':79!K>N/,K0/,??,!D:&7=!%46G#=!89':79!,-./001/KK0K!V&33C!V6((!*6G65#:6=5!,-./001/-?0K!V4(C!P&B=:G&7(=!89':79!,-./1>0/02N.!V45&GG&!P4!P9=!V6M9=5#!!*6G65#:6=5!,-./,1N/,>22!UG536:=!,-./,N?/2>N0!P9=!86#C!4;!L=5#6GC!,-./>10/?..-!Y=O!S6;=!%:&65=!!H4:5963!8=G#=:!,-./00-/K,>N!Y=O!J=M6GG6GM!!H4:5963!8=G#=:!!K?>/,??/1N.K!Y=O!S6;=!H4:E!4;!I&6#9!K>N/,2-/0>-?!F:(&GE4!89':79!4;!!89:65#!,-./0>K/.K.-!!!!!%96(=A4G!*6G65#:6=5!,-./.N0/.N.1!W=`467=!6G!#9=!S4:E!!*6G65#:6=5!,-./0N,/.2,K!"=:R&G#5!4;!D4E!*6G65#:6=5!,-./0N,/0>??!"4::=G#4!89:65#6&G!8=G#=:!K?>/.K?/,,,.!"36:6#!4;!S6;=!!89:65#6&G!89':79!,-./002/,?.-!P&GM=:6G=!!84AA'G6#C!89':79!K?>/K0K/,N.K!P9=!"9&B&79!89':79!,-./,,?/N>K-!P:'=!H4:E5!4;!D4E!!P&B=:G&7(=!4;!*==#6GM!,-./>>./00>1!Z67#4:C!89':79!H4:(E!!F'#:=&79!8=G#=:!,-./001/.>00!"#$%&$'()'*(+$,-./-$01($/0**(2$3&$%&$40%(+$5-0**$-6%3*($7-(%5(*8(5+$042$'10&+$042$5((9$%&$#0/(+$042$7614$#1)%$7-(.1$,./9(2$,0&5:$7-(4$,.**$"$-(01$#1)%$-(08(4+$042$,.**$#)1;.8($7-(.1$5.4+$042$,.**$-(0*$7-(.1$*042<=$>$?-1)4./*(5$@ABCMaximize your marketing dollars by FOCUSING your advertising campaign on a concentrated market! Do you need to receive or send a FAX?If so, you can use our fax: 407-889-4121*In the same building asThe Apopka Chief!" !"#$79):1#; "#$%&'('$)&. *There is a small fee for this service.Apopka O! ce Supply 400 N. Park Ave., Apopka, FL 32712 407-889-4455G,6(,+&'(4)!89':79!6G!#9=!"4G!,-./>,2/---N!I&6#9!I=((4O5963!89':79!,-./.,N/K.?-!V4'5=!4;!D4E!%&:@!)R=G'=!!H4:5963!8=G#=:!,-./002/>212!%:6G7=!4;!%=&7=!!%=G#=745#&(!*65564G&:C!!89':79T!UG7$!,-./001/1>21!!!P9=!%=G#=745#&(5!,-./001/K0->!H&C!4;!D:&7=!*6G65#:6=5!,-./>1>/1110G9,'./(,9*46!I6:5#!%:=5BC#=:6&G!!4;!)343@&!,-./002/?1,K!"#$!)GE:=O5!%:=5BC#=:6&G!!!89':79!,-./>1K/20->H,0&9-,2!78:9+8!*6!"-,9*+4!W4((6GM!V6((5!!84AA'G6#C!89':79!,-./002/.22,5,C,6(8F24/!"2C,6(*'('!)343@&!"=R=G#9/E&C!!)ER=G#65#!,-./001/>0N>!I(4:6E&!S6R6GM!"L)!89':79!,-./>0,/.,.>!!I4:=5#!S&@=!,-./021/-20-!I:&G74/V&6#6&G!,-./>12/,K20!D=G=565!"3&G659!?-1/>2,/,0.K!!*&:&G &!!"=R=G#9/E&C!)ER=G#65#!,-./>1-/N0--!!*4'G#!F(6R=!,-./002/-,K-!F:(&GE4!I6(636G4!"=R=G#9/E&C!)ER=G#65#!,-./>1>/1>N-!F:(&GE4!Z6=#6&A=5=!"=R=G#9/E&C!)ER=G#65#!,-./KK1/,1.,!%6G=!V6((5!,-./>1N/,0N2!%(CA4'#9/"4::=G#4!,-./00,/-?1?I,-%)&!3J.)*+&! P=A3(4!)5&AB(=&!JaB(67& !S&@=!V4O=((!J:&G79!!89&3=(!,-./0N,/,,2?K6*(/!^G6#C!89':79!4;!!89:65#6&G6#C!,-./>1?/1N0ND67$7-)5($,-)$,0.7$)4$7-($E)12$F-0**$1(4(,$7-(.1$571(4;7-:$G-(&$5-0**$%)647$6'$,.7-$,.4;5$*.9($(0;*(5+$G-(&$5-0**$164$042$4)7$3($,(01&+$G-(&$5-0**$,0*9$042$4)7$#0.47<$"50.0-$CHAIBJ.52)%$.5$7-($'1.4/.'0*$ 7-.4;:$G-(1(#)1($;(7$,.52)%<$ K42$.4$0**$&)61$;(77.4;+$;(7$ 642(157042.4;<$L1)8(135$CA@First Amendment to the Constitution of the United StatesCongress cannot make a law that favors the establishment of one particular religion; that prohibits the free exercise of religion; or that restricts freedom of speech or of the press, or the right of the people to gather and engage in peaceful demonstration and to petition the government for redress of their grievances. www.TheApopkaChief.com | news@theapopkachief.com | 407-886-2777$VDJURXS *+,-&+./,& WUHPHQGRXV EX\LQJSRZHU !"#$%#&%'(()*+&+,#%#&$-.#*+/%#*%&+,$+&%'(()*+&0)'*&1*##-)2&+)&3)*%,/(4 232 W. Michael Gladden Blvd. Apopka, Florida 32703 Attend your place of worship this week" MARVIN C. ZANDERS FUNERAL HOME Hwy. 436/441 407-886-3388 Hwy 56789:;&<=<>8&;?@AB&5 #-C#%-$0%D&EF&$424@&)/!I4.,964+),!78:9+8>?-N!)343@&!J(RE$8&((!;4:!A4:=!6G;4b LMNFOPQFQRS @&'4664!3*.),!5+8&&) 84((=M=!S=R=( 5%9*6T!5,-,'(,9 #4/!SL!F!;:)/!SUV!PMSQ P'6#64Gb! !"#$$%&'&()'*+,$' #$-$.,$/0'1#$$%&'2.,$3 H=!E4!G4#!79&:M=!#'6#64G$ !V45&GG&6G#9=96M9=5#$ 94A5#=&E$74A 74))!LMNFLOSFLPRR!0&9!*60& $69&))!I&24/ ,QWKHVDPHZD\ OHW\RXUOLJKWVKLQH EHIRUHRWKHUVWKDW WKH\PD\VHH\RXU JRRGGHHGVDQG JORULI\\RXU)DWKHULQ +,./,01 -.//@0P(;QRS !"##$%#&&'(#$')*+#,The Christian Household "Submit to one another out of reverence for Christ."Ephesians 5:21 NIV! !"##$+#.&#$)#/*0-T he New Testament provides a number of codes or instructions for how Christian households should function. Martin Luther coined the term "Haustafeln" (literally, "house table"), a summary or table of the specific actions which each member of the household should carry out, and he included this list in his small catechism. Ephesians 5:22-6:9 is perhaps the most complete list of duties, spelling out the way that husbands and wives should treat each other, as well as parents and children and masters and slaves. To modern ears, much of this advice may seem not only archaic, but perhaps even immoral, given that slavery is almost universally condemned and we don't usually expect wives to be "subject to their husbands." But understood in their historical context, these instructions were revolutionary, telling husbands to love their wives as they do their own bodies (Ephesians 5:28), and telling masters to treat their slaves well and to stop threatening them (Ephesians 6:9). The master-slave instructions are applicable today to the employer-employee relationship. Children are instructed to obey their parents, but parents, and particularly fathers (the traditional disciplinarians) are told to not provoke their children, and to raise them "in the discipline and instruction of the Lord" (Ephesians 6:4). A shorter summary of these household codes can be found in Colossians 3:18-4:1. Study these passages and consider honestly whether you are following these instructions. Christopher Simon The Christian Household !""#$%&'(#$!)&'*+,-(!&."#,%!""#$%'*+,-(!."#,%/0"#1$%$2&"*-&"+!$+,&"3$2*(-) !"#$%&'#() #!*+#,'$'%'$$%)'#!+ "! $P"!Q+009;;*"!*)+*!,C&5'*-."!/&0.!1R3!45'3!?-E+5!9-'!:;58!)8!SC)=B-E;"!T00)8;)'3!?C+!9-'!-!J+J:+5!;U!(C+!?;B)+(.!;U!H-*);0;E)B!,+BC=8)B)-8'3!?&5@)@;5'A!C&':-8*"!V;8=-0*G!BC)0*5+8"!/+88)U+5"!?(+U-8)+G!'):0)8E'"!<-&0!S;;N"!V-8)+0!S;;NG!;8+!E5-8*BC)0*3!6;;J)'!K-J)0.!K&8+5-0!L;J+"!MD;DN-3 O See page 3B -*,).!+%/0!.!1%2!&&'3 45 "!#W"!MD;DN-"!*)+*!X+*8+'*-."! /&0.!1Y3!453!Z+00-J.!9-'!:;58!)8!<+88)8E(;8!F-D"![)5E)8)-3!L+!J;@+*!(;!S+8(5-0!K0;5)*-!)8!\WYW3!?&5@)@;5'A!*-&EC(+5'"!4;8()!6-**"!S;88)+!H;*E+5'"!]B;++G!(9;!E5-8*BC)0*5+8G!(C5++!E5+-(=E5-8*=BC)0*5+83!6;;J)'!K-J)0.!K&8+5-0!L;J+"!MD;DN-3 O & 2UODQGR 'D\WRQD !"#$%&'()*/DNHODQG7LWXVYLOOH !"#$%&#'()*)+&,-('"#&(%DWWV)XQHUDO+RPH0RQXPHQWV!"#$%&''"$(&)*+%'$,+-(%,-%./+%'#-+$&*%)#0,-+001 T4"8(,80%#/(#5(*$P.?5(U44%(./(!.//5(M"&08.$((V430 (DV\&UHGLW(DV\7HUPV3D\PHQW3ODQV $IIRUGDEOHIRU$Q\)DPLO\V%XGJHW!"#$%&'()* +&%"&,*%&* -.//FF *+,-"./0012+"34+5",6768,9*"213* *:;&<)=;$">?@(A"(>B" <<<=!"#%&'&()*"+#,=>'?

PAGE 11

Honor Your Loved Ones Call 407-886-2777 !"#$%&'&()$*"+#,-$$$%./.01$2-$3456-$7)/#$28 9:+1.);+#0<$ !"#$%&'($)*+$ ,-$."/*01."*2(3)45("/2 =)>+?@$7'A#;$B'.;$&;'/;)>$+CD?.E#0$)D1+F+1+#0$,';$#F#;@'C#$+C$1"#$,)>+?@!"#$!%#&'(#!)*!+#$!,)-.!/01'1+!2%,/3!14!)*5*$'167!8!6$9!0')7'8:!*)'!*8:1-1$4!16!;0)0<8!91+#!4(#))-587$=!(#1-='$6>!?8:51-.!@)9$'!,)&'!14!)**$'$=!)6!*)&'!/&6=8.4!16!;&7&4+! )'!A(+)B$'C!*'):!DEFG5FH!8>:>!"#$!16+$'8(+1I$!4$4541)64!8'$!+1+-$=C!,$'$!J4!A&'!?8:1-.C!"#$!?8:1-.!K1*$!K16$C!%#'14+186!@8'5$6+167C!86=!%#8--$67$4!?8(167!?8:1-1$4!")=8.C! 86=!91--!16(-&=$!8(+1I1+1$4!*)'!$I$'.)6$!16!+#$!*8:1-.>!?8+#$'!L)#6!@8--8'=C!0'1$4+!16!(#8'7$!8+!%,/C!91--!*85(1-1+8+$!8-)67!91+#!7&$4+!0'$4$6+$'4!M'>!N16$++$!O>!A-4$6C!OI$'.)6$P4!%)&65 4$-167!%$6+$'C!J6(>C!86=!M$BB1$!"&'6$'C!$Q$(&+1I$!=1'$(+)'!)*!M$BB1$!"&'6$'P4!%86($'!%8'$!R!S$4)&'($!%$6+$'>!T%#&'(#!)*!+#$!,)-.!/01'1+!14!$Q(1+$=!+)!0'$4$6+! +#14!)00)'+&61+.!+)!:$$+!)+#$'!*8:1-1$4!*'):!;0)0<8!+#8+!4#8'$!()::)6!7)8-4CU!8!(#&'(#!40)<$49):86!481=>!?8:1-.!@)9$'!,)&'!91--!:$$+!16!+#$!@8'14#!,8--!)6!+#$!(8:0&4!)*!%,/!-)5 (8+$=!8+!+#$!()'6$'!)*!/1Q+#!/+'$$+!86=!,17#-86=!;I$56&$>!;=I86($=!'$714+'8+1)6!14!'$()::$6=$=>!?)'!:)'$!16*)':8+1)6C!I141+!,)-.5/01'1+;0)0<8>():!)'!?8($5B)) !@#1--14!W#$8+-$.!O-$:$6+8'.!/(#))-!91--!#)4+!8!N'1--!R!%#1--!)6!/8+&'=8.C!;&7&4+!FFC!*'):!6))6!+)!X!SPRQWKHVFKRROVHOG0DU 5 I16!%>!Y86=$'4!;I$>C!;0)0<8>!"#$!0&B-1(!14!16I1+$=!+)!+#$!*'$$!$I$6+C!B&+!$40$(18--.!9$-():$!8'$!(&''$6+!W#$8+-$.!4+&=$6+4C!+#$1'!*8:15-1$4C!86=!W#$8+-$.!8-&:61>!W#$8+-$.!@'16(108-!K8+'1(18!@165=$'!481=!+#$!$I$6+!14!08'+!)*!8!-)67$'5+$':!0-86!+)!#$-0!B&1-=!4&(($44!8+!+#$!4(#))-> !TW$P--!-$+!+#$:!<6)9!9$!8'$!#$'$!86=!+#14!14!9#8+!9$P'$!8B)&+>!"#8+P4!9#.!9$P'$!#8I167!+#14!N'1--!R!%#1--CU!@16=$'!481=>!TJ+P4!8!6)54+'167458++8(#$=!$I$6+>!J+P4!Z&4+!():$!$8+!91+#!&4C!:$$+!+#$!4+8**!86=!:$$+!+#$!0$)0-$!9#)!8'$!+$8(#167!.)&'!<1=4!$I$'.!=8.>!K$+P4!:$$+!+#$!*8:1-1$4!9#)!+#$!<1=4!7)!#):$!+)!$I$'.!=8.C!86=!-$+P4!Z&4+!0-8.!4):$!78:$4>U!"'.167!+)!B&1-=!'$-8+1)64#104!16!+#$!()::&61+.!(86!B$!8!=8&6+167!+84!TW$P--!#8I$!4):$!-&6(#!86=!0-8.!4):$!*8:1-.!78:$4CU!@16=$'!481=>!!T%):0$+1+1)6!B'$$=4!$Q($--$6($C!4)!9$!(86!7$+!+)!<6)9!$8(#!)+#$'>!W$!7$+!+)!<6)9!$8(#!)+#$'!9$--!16!+#)4$!*&6!78:$4!+#8+!=)6P+!'$[&1'$!86.!():0-$Q!+#16<167!B$.)6=!0-8.167!+#$!78:$>U 7.:?+D$+0$+CF+1#E$1'$G;+??$)CE$*"+??$#F#C1 9;?)CE'$B#)?1"$+0$0#);D"+C/$,';$'?E#01$;#0+E#C1 !!"#$%#&$'(%)*+&' "!#$"!%&'()! *)!+)&'"!*,)*!-.'*/0"!1.20!345!675!-,2)7!8/9!:&7'!,'!;<)=7&2)>"!?)'@>.(A05!675!-,2)7!8/9!/!2&'B>,C)!7)9@,*)'>!&D!EF&FA/5!-.7=,=&79G!:7&><@)7"!E*/C"!%&'()!*)!+)&'H!9,9>)79"!-<,72)0!I)J&7)"!I)D.',/A!-F7,'B9"!K/0)!I&8)22"!L.(A)0)!+/A)9"!M<,&"!6/7,)!->&')"!EF&FA/5!L/2*@8,'!K/,7(<,2*!K.')7/2!N&C)"!EF&F@A/5 O ,"$-+,%+.%/-'0&' "!#P"! Q.9>,9"!*,)*!-.'*/0"!1.20!335!675!;/7=)7!8/9!:&7'!,'!+&8)22"!M<,&!/'*!C&=)*!>&!EF&FA/!,'!R4S#!8<)7)!<)!8&7A)*!/9!/!C)(<7))!B7/'*(<,2*7)'5! O 1"',"$%&2&'(%3"(, "! #3"!-&77)'>&"!*,)*!-/>.7*/0"!1.20!3#5!675!L&0*!8/9!:&7'!,'!-&77)'>&5!-.7=,=&79G!8,D)"!1.*,>@B7/'*@(<,2*7)'5!+&&C,9!K/C,20!K.')7/2!N&C)"!EF&FA/5 %4'()5-+%5.%6#*++*6) "!PU"! EF&FA/"!*,)*!-/>.7*/0"!1.20!RV5!695!%<,22,F9!8/9!:&7'!,'!W)8!X&7A"!W)8!X&7A5!+&&C,9!K/C,20!K.')7/2!N&C)"!EF&FA/5 O &+&$-%,")5&'%1"'& "! V4"!EF&FA/"!*,)*!-/>.7*/0"!1.20!3R5!6795!Y&7)!8/9!:&7'!,'!EF&F@A/5!-.7=,=&79G!<.9:/'*"!6/7AH!9&'"!I)=2,'!Y2&0*H!C&><)7"!;/7&@20'!I&9>)7H!B7/'*C&><)7"!E'')22!6))A9H!9,9>)7"!E'')!+&'BH!+&&C,9!K/C,20!K.')7/2!N&C)"!EF&FA/5 G)>#$9CH$I)D)1+'C$8+:?#$JD"''?$A+??$:#$%./.01$KLM !"#$!\)'+#41=$!]805+14+!%#&'(#!^8(8+1)6!]1B-$!/(#))-!N8:$!A6_!91--!+8<$!0-8($!/&6=8.5"#&'4=8.C!;&7&4+!G5DC!8+!+#$!(#&'(#C!::HOFK5RDG$SRS 5 <8>!"#$!\)'+#41=$!]80+14+!%#&'(#!;0)0<8!14!40)64)'5167!+#$!$I$6+>!TN8:$!A6_!14!8!9$$!`1=4!91--!B$716!$8(#!=8.!8+!+#$!0$0!'8--.>!!?'):!+#$!0$0!'8--.C!NLGVZLOOJDWKHUDWWKHHOG #)&4$C!9#$'$!+#$.!91--!B$!$[&100$=!+)!=17!=$$0!16+)!N)=P4!W)'=>!`1=4!91--!-$8'6!+#8+!N)=!#84!71I$6!+#$:!$I5$'.+#167!+#$.!6$$=!+#')&7#!#14!=1I16$!0)9$'>!O8(#!=8.C!<1=4!91--!:8<$!('8*+4C!0-8.!78:$4C!$6Z).!468(<4C!4167!4)674C!86=!-$8'6!8B)&+!:14541)64>!S$714+'8+1)6!14!;&7&4+!G!8+!aEFG!0>:>!S8--.!B$7164!QLJKWO\DWSPDQG(-)4$4!8+!D!0>:>!?)'!:)'$!16*)':8+1)6C!()6+8(+!S86=.!@)9$--!8+! !A'-86=)!,$8-+#!14!4$8'(#167!*)'!+#$!)-=$4+!%$6+'8-!?-)'1=8!'$41=$6+!9#)!984!B)'6!8+!A'867$!N$6$'8-!,)401+8->!?)&6=5$=!16!FDFbC!A'867$!N$65$'8-!984!+#$!)'17168-!#)4015+8-!16!9#8+!14!6)9!A'-86=)!,$8-+#P4!()::&61+.5B84$=!6$+9)'!]8B1$4!B)'6!8+!A'5867$!N$6$'8-!9)&-=!6)9!UDQJHLQDJHIURPWRFHH>!T;4!08'+!)*!)&'!($6+$65QLDOFHOHEUDWLRQZKLFKRI 5 (18--.!-8&6(#$4!\)I$:B$'!ZHZDQWWRQGDQGWDON91+#!+#$!)-=$4+!16=1I1=&8-! 9#)4$!-1*$!B$786!8+!A'867$!N$6$'8-!,)401+8-CU!481=!`8'$6!L$64$6C!I1($!0'$415=$6+!)*!+#$!A'-86=)!,$8-+#!?)&6=8+1)6!86=!(#81':86!)*!+#$!A'-86=)!,$8-+#!($65+$6618-!()::1++$$>!TW$!B$5-1$I$!+#8+!0$'4)6!91--!B$!8B-$!+)!4#8'$!91+#!&4!4+)'1$4!+)!#$-0!&4!B$++$'!&6=$'4+86=!9#8+!-1*$!984!-1<$!16!%$65+'8-!?-)'1=8!=&'167!+#8+!+1:$!0$'1)=>U!!"#$!68:$C!A'867$!N$6$'8-C!984!16!$Q14+$6($!XQWLO,WZDVWKHQFKDQJHGWR2UDQJH0HPR 5 '18-!,)401+8-!4))6!8*+$'!+#$!4+8'+!)*!8!cF5:1--1)6!$Q086541)6!0')Z$(+!+#8+!984!=$=15(8+$=!84!8!98'!:$:)'18-!+)! 16=1I1=&8-4!9#)!4$'I$=!16!W)'-=!W8'!JJ>!"#$!A'-86=)!5HJLRQDO0HGLFDO&HQWHU:)61<$'!984!16+')=&($=!16!ZLWKWKHFRQVROLGDWLRQRI2UDQJH0HPRULDO+RV 5 01+8-!86=!,)-1=8.!,)401+8-C!8!*8(1-1+.!-)(8+$=!8!()&0-$!)*!B-)(<4!898.>!J6!FDbDC!8!0)'+1)6!)*!,)-1=8.!,)401+8-!984!'$:)=$-$=!86=!86!8=5Z)16167!B&1-=167!984!()654+'&(+$=!+)!('$8+$!9#8+!14!6)9!;'6)-=!@8-:$'!,)4501+8-!*)'!%#1-='$6>!J6=1I1=5&8-4!9#)!9$'$!B)'6!8+!A'5867$!N$6$'8-!,)401+8-C!)'!9#)!+#16)'-86=)#$8-+#> ():V)'867$7$6$'8-B8B1$4>!@8'+1(108+1)6!14!)0$6!+)!'$451=$6+4!9#)!(&''$6+-.!-1I$!16!A'-86=)!,$8-+#P4!1::$5=18+$!4$I$65()&6+.!4$'I1($!8'$8C!9#1(#!16(-&=$4!A'5867$C!/$:16)-$C!A4($)-8C!K8<$C!@)-!"#$!=$8=5-16$!*)'!$6+'.!14!FFEGD!0>:>C!0RQGD\2FWREHU7KH)-=$4+!0$'4)6!91--!B$!4$-$(+5$=!B84$=!)6!.$8'C!:)6+#C!86=!=8+$>!A6($!4$-$(+$=C!+#$!16=1I1=&8-!91--!B$!16+$'5I1$9$=!*)'!I1=$)!4$7:$6+4!+#8+!91--!B$!4#8'$=!91+#!+#$!()::&61+.!+#')&7#!A'-865=)!,$8-+#P4!?8($B))*8($B))<>():V)'5-86=)#$8-+#> !"#"$%&'(&)*+,&!"#$%&'()*'+),-.-/0)1'%+2)) !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! )345367 !89:;1)<=,>;?@)?A*;1= 1<,?@=)AB)CA?;?@),D=?ED=?* 1;*F)AB),!A!G, !"#$%&'()'*+,+-.'/(0+1'2*32' !"#$%&'()*++,% '*3)'435+'31'3667(832(91:' (1'3889,5318+';(2*'<79,(53'=232>2+)'?@ABA?CDE8F'315'2*+'G696 H3'%95+' 9I'",5(1318+):'J3,2'$$$:'K315'L+0+7964+12'%95+:'G,2(87+'M$$:'= +82(91' ?NBOPBOO:'29'2*+'%(2.'9I'G696H3'%(2.'%9>18(7:'315'G696H3'J731 1(1/' %944())(91'I9,'31' -./01./02&23&24/&-56-0&73602/&78-00/1&9062& 1/5/837./02&:3060;&-01&.-<2/=&78-0 B'#*()'3667(832(91',+732+)'29'2*+' I9779;(1/'5+)8,(-+5'6,96+,2.Q' !-.-/0&12%3&1."4526!-.-/0&7604424#&1.882$$2.41.88"42%3&9:;:6.-8:4%&9:-%0<%8:4%= 1.4%024$>&+)?=)+&@AB&!5<:$C.%25:&2$:4&%D0%&%D:&12%3&.E& !"#"$%&'(%))*)+&,#--*..*#) &F266& D.6G&0&-"H625&D:0<24#&%.&5.4$2G:<&04&08:4G8:4%&%.&I9&"?-?4 & .<&0$&$..4&%D:<:0E%:<&0$&-.$$2H6:=PKQRMNQ&CIRS1N&2$:4&%D0%&0&-"H625&D:0<24#&E.<&%D:&08:4G8:4 %& %.&I9&"?-? (&!C9&.4& B12)1.2%34&C1"51-;1D&6E4&896:4&;1+*))*)+&%5&F=99&"?-? &.<&0$&$..4& %D:<:0E%:<&0$&-.$$2H6:=&&!EE:5%:G&-0<%2:$&04G&%D:&-"H625&803&0--:0<&0%&%D:&0H.;:&62$%: G& D:0<24#$&%.&$-:0/=&RD:&-<.-.$:G&7K9&L0$%:<&7604&504&H:&24$-:5%: G& 0%&%D:&!-.-/0&1.88"42%3&9:;:6.-8:4%&9:-0<%8:4%&6.50%:G&0%&!.-/0& 12%3&M066&.4&F::/G03$&H:%F::4&%D:&D."<$&.E&,>**&0=8=&04G&T>'*&-= 8=& 12%3&M066&0GG<:$$&$D.F4&H:6.F=&76:0$:&H:&0G;2$:G&%D0%(&"4G:<&O %0%:& 60F(&2E&3."&G:52G:&%.&0--:06&0&G:52$2.4&80G:&F2%D&<:$-:5%&%.&%D2 $& 80%%:<(&3."&F266&4::G&0&<:5.&T*?B?*'B+?*T(&4.& 6:$$&%D04& T,&D."<$&-<2.<&%.&%D:&-<.5::G24#= GHIJK!K,L&KG?&8MF6 !K&GHIJK!K,L&GN&/OL&,J/P&GN&!'G'Q!4&NRGHJI!4&!SLKIJKT&GHIJK! K,L&88E84& BOJ,O&!SLKIC&/OL&!IG'/LI&U!VJ!K&'GJK/L&'R!KKLI&WKJ/&ILVLRG' SLK/&X'WIY& S!C/LH&'R!KZ&NGH&,LH/!JK&HL!R&'HG'LH/P&RG,!/LI&KGH/O&GN&RWC/& HG!I&!KI& L!C/&GN&CH&78E4&,GS'HJCJKT&68F?86&!,HLC&SGHL&GH&RLCC[&GBKLI&\P& !'G'Q!& ,RL!H&R!QL&JKVLC/SLK/C4&RR,[&'HGVJIJKT&NGH&IJHL,/JGKC&/G&/OL& ,GSSWKJ/P& ILVLRG'SLK/&IJHL,/GH4&CLVLH!\JRJ/P4&,GKNRJ,/C4&!KI&!K&LNNL,/JVL&I!/L?& HBI)!AJ*) 3537K L3M)JN)1+OPQ0$),R+NS),-.-/0%OR%P+&)T.") P.)0)2"OUQ0%&%OV)#Q+0/20&P) A?)J,*8>E,FS),8@8J*)33N)*%W+()X)0W)Y)35)0W) AO+)J0P"QU0T) .2)+R+QT)W.OP'N!"#$%&&#'"#(")*%+,-6FUDPEOHG(JJV6DXVDJH/LQNV 3DQFDNHV%LVFXLWVDQG*UDY\ 2UDQJH-XLFH&RHH:DWHU,::)BA>)Z 4N55 [ ,8@8J*)33 "#14! B'$8<*84+! 40)64)'$=!B. Funerals don't have to be Expensive to be Respectful.(407) 880-1007 LOOMIS FAMILY FUNERAL HOMES Providing every family with the care and respect they deserve Visit Us Online: www.thapopkachief.comEmail: news@ theapopkachief.com !"#$!%&'!(#)$!#$!*&$+!,-!./01!2#!34$5!&$6!7$46!8&)9:)!4$!;#%:<<-!=>4#-!&$6!?&'':6!&%&@!#$!*A<@!BB-!BC.D!4$!7A'24'-!E;+!!!F:!%&'!2>:!#<6:'2!#G!G#A)!H>4<6):$-!#$:!'4'2:)-!I4HJ@-!2%#!()#2>:)'! ;&))@!&$6!*:))@!K6:H:&':6L+!MG2:)!&!G:%!@:&)'!4$!;#%:<:@!N#9:6!2#!O:%&)J-!=F!%>:):!>:!5):%!A?+!MG2:)!5)&6A&24$5!>45>!'H>##:!N&))4:6!2>:!<#9:!#G!>4'!<4G:-!76$&+!!!!F:!4'!'A)949:6!(@!>4'!%4G:!#G!PQ!@:&)'-!>4'!2>)::!H>4<6):$-!R#$$4:-!":$4':-!3:2>!&$6!0!5)&$6H>4<6):$S!R&H>:<-!8#6@!&$6!8&N:)#$+!!MG2:)!N#94$5!2#!M?#?J&!4$!./PD!>:!%#)J:6!&'!&!N:H>&$4H!A$24:$!>:!&$6!76$&!2)&9:<:6!2#!$:&)<@!:9:)@!'2&2:!4$!#$:!#G!2>:4)!N&$@!N#2#)!>#N:'!%42>!2>:4)!2)&9:<4$5!H#N?&$4#$'-!2>:!=)&$5:!8#A$2@!TH>##&2!76$&!>&6!%#)J:6!%42>!G#)!N&$@!@:&)'+!!F:!%&'!&$!&H249:!N:N(:)!4$!2>:!U#6:.%7?%>@;<6ABA% &'%978%C"($%"$%!7$:7()%>D-%>.%R+'9+$T%0("B%>;@==6B%[%;@==6B%9+?#%U:(+7,%?"%0",,"9%7?%Z3T'9""3\Y(''$9""3%F'B'?'()%+$%N6"6I7-%54A N((7$T'B'$?8%'$?(:8?'3%?"%U7,39+$%57+(2#\ +,3%5:$'(7,%&"B'-%N6"6I7A% %999AC7,39+$07+(2#+,376"6I7A2"B Continued from page 2B

PAGE 12

!"#$%&'&()$*"+#,-$$%./.01$2-$3456-$7)/#$89 !"#$%&!'())*&(+!(,!-.(./#!0#&!+#$%1!2(!23%!4%#+5&!6*&2!,()!#7#1%$*7!%87%99%+7%!,()!23%!&.)*+:!&%$%&2%)!#2!"(3+&!;(./*+&!<+*=%)&*2>!*+!?#92*$()%@!'1A!B(!C%!&%9%72%1!,()!23%!4%#+5&!6*&2@!#!&2D1%+2!$D&2!3#=%!#!:)#1%!.(*+2!#=%)E#:%!(,!FAG!()!3*:3%)!(+!#! HAI!&7#9%!*+!#!.)(:)#$!(,!#2!9%#&2!JH!7)%1*2&@!0*23!#2!9%#&2!JK!:)#1%1!7)%1*2&A!'())*&(+!*&!23%!&(+!(,!"*$!#+1!L#9%)*%!'())*&(+!(,!-.(./#@!#+1!3%!:)#1D#2%1!,)($!M%/*=#!;*:3!N73((9A!;%!*&!$#O()*+:!*+!#+!#)2&!#+1!&7*%+7%!.)%E$#O()!#+1!%8.%72&!2(!:)#1D#2%!*+!'#>!KIKJA :';;+0'<$=)(#0$>#)!*+&.*)%1!.)(:)#$&@!0*99!&3#)%@!(+!N#2D)1#>@!-D:D&2!JR@!#2!H!.A$A@!3*:3E9*:32&!(,!3%)!)%7%+2!2)*.!2(!S&)#%9!*+!23%!;(9>!6#+1A!TS+!23%!U((2&2%.&!(,!"%E&D&!*+!M()1!#+1!N(+:V!0*99!C%!.)%&%+2%1!#2!23%!U9()*1#!6*=*+:!W3D)73@!XII!Y1:%E3*99!Z9#7%@!-.(./#@!9(7#2E%1!(+!23%!7#$.D&!(,!U9()*E1#!6*=*+:![%2*)%$%+2!W($E$D+*2>A!L(7#9*&2&!4#=*1!Z%2%)E&(+!#+1!4#=*1!\(+Q#9%Q@!03(!*&!#9&(!#!7%99*&2@!0*99!&*+:!&(+:&!)%9#2%1!2(!"%&D&5!9*,%!(+!Y#)23A!P23%)!$D&*E7*#+&!03(!0*99!.%),()$!#)%!'#>1#!\#)7*#@!=(7#9*&2!#+1! .*#+*&2@!"(>7%!;(#2&(+@!.*E#+*&2@!#+1!?(++*%!;#++#3@!():#+*&2A!B3%!.DC9*7!*&!7()1*#9E9>!*+=*2%1!2(!#22%+1!23*&!,)%%!.)(:)#$A Bonnie Hannah will present programs highlighting her trip to Israel. *".;A"$B+CC$")D#$=.0+A)C$&;'/;)=$+<0&+;#E$FG$)$1;+& !"#$!%&%'#($)*+,($-./0$1*..$ /(#$2+/'$'#323.%0.#$#2#$4.%((#($ 5+'$6"#$7'+4'%8 9:'+;#36$<*4"6$6+$=*4"6>?The Apopka Chief, The Planter & AOS (Apopka Of ce Supply) would like to thank the generous Apopka area for continuing to donate the gift of sight for so MANY. 407-886-2777 OLD GLASSES & HEARING AIDS WANTED TavaresLions ClubIf you have old glasses or hearing aids you no longer need, please leave them at!"#"$%&'IFH()""*+&!"#The Apopka Chief!"#$7C)<1#;!]%0&.#.%)&HII!]A!Z#)/!-=%A@!-.(./#K8H 352-343-0180 @#1$.0$1#CC$HIJK$F.0+<#00$01';GL!"##$The Apopka Chief "%&$ '()"*$+,-.$/%)$/0$/12$3"2*)-,%4$'()5,"#,'-'6$ 7"'<#M$84NO66PO3NNNQ$$R)SM$84NO66TO8535 7$ 83",#9$"&':-.)"(/(*"5.,)065/3;$ /2$<,',-$ BBBU1"#)&'&()A"+#,UA'=$ !"#$"%&%'($)*$+'$+,,)&'#-$%.$+'$%/0)&,+',$1#2%.%)'$,"+,$.")341$'),$5#$5+.#1$.)4#4-$30)'$+16#&,%.#/#',.7$8#*)&#$-)3$1#2%1#9$+.:$/#$,)$.#'1$-)3$*&##$;&%,,#'$%'*)&/+,%)'$+5)3,$)3&$<3+4%*%2+,%)'.$+'1$#=0#&%#'2#7 !"#$%&'()*+,-+"..+,+/0 %0!1%(+23+ '4.&151%6+'3"30DLWODQG$YH $OWDPRQWH6SULQJV!"#$%&'#()#*#$"#*(+(,$#*-(*.+$./(0#.(&1$(#23#$4#'5#(6&$7(,&$(%&1/ ,7+89:+;<=+>9?@AB=86+>;HH+G9B;8+79<+89:<+4%11+)0#-&.("(,0# ‡6$9(<285+20( ‡6723)RUHFORVXUH ‡:,3(287XQVHFXUHGGHEW ‡6723FROOHFWLRQWKUHDWV ‡5((67$%/,6+\RXUFUHGLW Over 35 Years Experience Call 407-886-2777 and speak with one of our representatives today! The Apopka Chief =.)$>#"%-)2www.theapopkachief.com Be a part of our Business Profile program. Your business will benefit from advertising with Tell Your Story 400 N. Park Ave., Apopka 32712 !"#$%&'(()'&*$+,--.#$/($0',1* '1$234#$56$'0$7"/($1#)(232#&8 +,--.#$9'.,7/'1 Find GREAT deals & coupons in the circulars in The Apopka ChiefTODAY Ace Hardware !LDIs"EALLSs#63 *#0ENNEY !""#$$%&!'(%)*+,-.*)%-(./!"#$%&"'(%)%!"$*+,"-(% .'/0(++1/$"2+%3/4%&"$%5'4+67.#00*+.-!&1+*)-2*($-!&%&!(2).!3-(4 .566%789%5%:;8<=%>?@ABC@A>DEF !"#$%&'#()$*! !"#+$!,-./)'-! !"#$! !%&'()!"#$%&$'()(*+,,-(.%&+/$' !"#$%&'"&('%)'*+ ',%$-"./-$%$-'0%1".(2%KDYHWROHIRUEDQNUXSWF\7KHVWDIIDW !"#$ /DZ2IFHRI5REHUW+3XHJHU3$ NQRZV 3)2%.)2',#$3)2#%$-3$%OLIHFDQEHXQSUHGLFWDEOH 4%25*",6'%63)%7'3)% 3%2,3#$56%2,"&%5)%5)+FRPH0HGLFDOELOOVFDQJRIDUEH\RQGZKDW\RXU5)#.,3)6'%15((%&30%3)2%'(575)3$'%0".,%#3*5)/#8%-REVFDQEHORVWDQG\RXPD\EHIDFLQJWKHSRVVLELOLW\RIORVLQJ\RXU-"7'8%9-3$'*',%$-'%UHDVRQEDQNUXSWF\LVSDUWRIWKHOHJDOV\VWHPEHFDXVHSHRSOHQHHGD130%$"%#$3,$%"*',8%:-'%VWLJPDUHJDUGLQJEDQNUXSWF\KDVIDGHG,WLVQRZYLHZHGDVDIUHVKVWDUW(YHU\ERG\GH#',*'#%3%2"+"*',8 &KDSWHU%DQN UXSWF\LVDERXWVWDUWLQJRYHUDQGJHWWLQJDIUHVKVWDUW"3)8%:-','%5#%3%("$%RIEX]]RQWKHVWUHHWVDERXW/RDQ0RGLFD$5")%$-,"./-%/"*',)+PHQWEDFNHG0RUWJDJH0RGLFDWLRQ3URJUDPVNQRZQDV+$03DQG+$537KHSUREOHPLVWKHODZVDUHVRFRQIXVLQJDQGWKHSDSHUZRUNVRRYHUZKHOPLQJWKDWPRVWSHRSOHJHWIUXV$,3$'2%3)2%/5*'%.&%$,05)/%WRZRUNWKURXJKWKHV\VWHPWRPRGLI\WKHLUPRUW/3/'#8% 7KH/DZ2IFH RI5REHUW+3XHJHU3$ %-3#%-'(&'2%73)0% &'"&('%)3*5/3$'%$-'%#0#+WHPDQGKDVEHHQYHU\VXFFHVVIXOREWDLQLQJH[FHOOHQWORDQPRGLFDWLRQUHVXOWVPDNLQJLWSRVVLEOHIRUWKHPWRDIIRUGWRNHHSWKHLUKRPH $IWHUKHOSLQJFOLHQWV #$30%5)%$-'5,%-"7'#%3)2% GLVFKDUJLQJPLOOLRQVRIGROODUVLQGHEWWKHWHDP3$% 7KH/DZ2IFHRI 5REHUW+3XHJHU3$ KDVWKHEDFN /,".)2%)''2'2%$"%'=+&(35)%0".,%"&$5")#%3)2%VXJJHVWVWKHEHVWVROX$5")%$"%0".,%&,'#')$%#5$+XDWLRQ%DQNUXSWF\ODZLVYHU\FRPSOH[VR\RXQHHGDEDQNUXSWF\ODZ0',%$-3$%2'3(#%15$-%$-'#'%LVVXHVRQDGDLO\EDVLV 7KHVWDIIDW !"#$ /DZ2IFHRI5REHUW+3XHJHU3$ %5#%3(+ 130#%#$,5*5)/%$"%&,"*52'%WKHKLJKHVWOHYHORIFOLHQWVHUYLFHDYDLODEOH 5REHUW+3XHJHU $ 5#%3)%3$$",)'0%15$-%3%,'+FRUGRIVXFFHVVDQG-3#%'3,)'2%$-'%,'#&'6$%RIKLVFROOHDJXHV5REHUW3XHJHUVDJJUHVVLYHUHSUHVHQWDWLRQH[WHQVLYHH[SHULHQFHDQG-5#%'=6'((')$%,'&,'#')+ WDWLRQRIGHEWRUVLQ)3)653(%25#$,'##%-3*'%'3,)'2%-57%$-3$%,'&.$3+$5")8% ?'63.#'% !"# % %&'$ 2IFHRI5REHUW+3XHJHU3$ %-3)2('#% RQO\EDQNUXSWF\FDVHVKLVFOLHQWVKDYHWKHSHDFHRIPLQGWKDWWKHLUFDVHVDUHEHLQJKDQGOHGE\RQHRIWKHPRVWH[SHULHQFHGEDQNUXSW60%(310',#%3,".)28%;5#%IHHVDUHUHDVRQDEOHDQGZLOORIWHQZRUNZLWKKLVFOLHQWVWRHVWDEOLVKDH[LEOHSD\PHQWSODQ '217'(/$<*HW WKHIUHVKVWDUW\RXGHVHUYHE\FDOOLQJ !"# % /DZ2IFHRI5REHUW+3XHJHU3$ %$"+ GD\DWWR#6-'2.('%0".,%6")#.($3+$5")8% 0HQWLRQWKLVVWRU\ DQGWKH\OOZDLYHWKHFRQVXOWDWLRQIHH $GYHUWLVHPHQW 5REHUW3XHJHUKDVVSHFLDOL]HGLQEDQNUXSWF\ODZIRURYHU\HDUV0HQWLRQWKLVVWRU\DQGWKH\ZLOO1%*&#$2+/'$3+,(/.6%6*+,$5##> ,!-./01234&5(&!66&78&9':& YLY[^P]Y!4YNY[LYN! -!U[YN;!NB-[BA!6YB!P<[!Y_ZY[SY]WY!MP[`!UP[!^P< !"#$%&#'()% *"%+",-.% /#0'1)00)0

PAGE 13

!"#$%&'&()$*"+#,-$$%./.01$2-$3456-$7)/#$89 %&'&()$7':+;#$<#&)=1>#?1$)1$7:#)0)?1$@+#A$9)&1+01$*".=;" %&'&()$B+/"$C;"'':$D)?E$>#>D#=0$&)=1+;+&)1#$)1$;)>& !"#$#%&$#%'($#%)&*+%,(%-&*%&./%+&0#%)1,"% 2&3#%4-(-3&%5&,6$&7%8&+%91+,$1:,! !"#$%&'('#"%)"*+, -".%/"0%120*-23* !"#$%&'! $('&)*!+,!"#+-$%$,.!/)&0,1!HIFLHQWDQGHFRQRPL/0)!,0(2#0)!.0'!'&#-$/&!WRPRUHWKDQUHVLGHQWVDFURVV2U0,.&!0,%!304&!/+2,($&'!ZKRKDYHFRPHWRNQRZWKHEHQHWVRIXVLQJQDWXUDOJDVWRSRZHUDS")$0,/&'!$,!0,%!0#+2,%!WKHLUKRPHV!50(2#0)!.0'!$'!0!JUHDWDOWHUQDWLYHWRHOHFWULFLW\,WVHQYLURQPHQWDOO\IULHQGO\HIFLHQWDIIRUGDEOHDQGFRQYHQLHQWIRUWKRVHZKRVWLOO60,(!(+!/++4!0,%!&,7+8!DKRWVKRZHUZKHQWKHSRZHUJRHVRXW:KHWKHUXVLQJWKHVHUYLFHWRSRZHUWKHLUJDVUDQJHVJULOOVZDWHUKHDWHUVRU.&,�(+#'1!,0(2#0)!.0'!FXVWRPHUVHQMR\ORZHUHQHUJ\ELOOV:KLOHWKHVHEHQHWVPD\EHZHOONQRZQWRQDWXUDOJDVFXVWRPHUVVRPHPD\QRWEHDZDUHRIKRZHDV\LWFDQEHWRSD\WKHLUELOOZLWKWKH !"#$%&'('#"% )"*+-".%/"0%120*-23* :LWKVHYHUDOTXLFNDQGHDV\SD\PHQWPHWKRGVWRFKRRVHIURPWKH'LVWULFWPDNHVSD\LQJ\RXUPRQWKO\ELOOVDVHDV\DQGZRUU\IUHHDVSRV VLEOH2QOLQHSD\PHQWVWKURXJKWKH'LVWULFWZHEVLWHRUPRELOHDSSPDNHLWHDV\WRSD\\RXUELOORQWKHJRZKHUHYHUZKHQHYHUIUHHRIFKDUJH2WKHUIUHHRIFKDUJHRSWLRQVLQFOXGHXVLQJWKH'LVWULFWVDXWRPDWHGSKRQHVHUYLFHVHQGLQJLQ\RXUSD\PHQWE\PDLORUVWRSSLQJE\\RXUQHLJKERUKRRG'LVWULFWRIFHRUGURSER[DQGSD\LQJLQSHUVRQ3D\PHQWVRYHUWKHSKRQHZLWKDFXVWRPHUVHUYLFHUHS#&'&,(0($-&!0))+6!*+#!0!SHUVRQDOWRXFKDQGUHDOWLPHSURFHVVLQJRI\RXUSD\PHQWIRUDQRPLQDOIHH:KLOHWKH'LVWULFWRIIHUVPDQ\RSWLRQVWRSD\ \RXUELOOWKHHDVLHVWDQGPRVWFRQYHQLHQWPHWKRGLVDXWRPDWLFELOOSD\%2:%?(+%0=2*38%*(%5"*+-".%6"0@%9+--?>%"0%*820%(::$-%20%(5.?%"A"2."7.$%:(-%"%.2B2*$C%*2B$D% &CA$-*20$B$5* 2&3#%4-(-3&%5&,6$&7%8&+%91+,$1:,%;'-7(*##+%<%=#-,#'>#$%?@AB When extreme weather hits, natural gas generators power homes automatically and are installed outside your home. They eliminate the need to buy and store fuel, turn on within seconds of a power outage, and shut off once the electricity returns. 1320 Winter Garden-Vineland Road Winter Garden, FL 34787-4341 0Hrrs&AXrr Safe & Reliable Natural Gas Service www.langd.org :PVSDPNNVOJUZCBOL XJUIVOMJNJUFESFBDI 5*3&%0'#&*/(+645 "/"$$06/5/6.#&3 8FIBWFBMMPGUIFTFSWJDFTZPVFYQFDU GSPNZPVSCBOLJODMVEJOHPOMJOF CBOLJOHBOENPCJMFEFQPTJUXJUIPOF JNQPSUBOUEJFSFODF 8JUIVTrJUTQFSTPOBM XXXGOCNEDPN]n BUSINESS PROFILE 407-788-1923 !"##$%&''($)*+#",-./$01234$%516784$9:+$+;24$-1<84$*1=584$>;??@4$A1784$!BB2$C$!1DB4$167$01671618E !;55$+12$%./'?015(@A' 2$363A'0$"$'9>=A' B.61".A'C3<1.6.A' ;.-"&4.6.A'D%/-".' !"#$%&'%()% *+,$-((#The Apopka Chief.(&/%0/&'1$2%3$4'%5(&/,$02CTM#XG#RQRMC(.r21$QZ#RQRMC(. r(CZr'OCKN0GYU"6JG#RQRMC%JKGHEQOr#FU"6JG#RQRMC%JKGHEQO444607$89(9#+:7"$;6,(<5&-',/"-$%1(2+=%+1 F#1$+>&'=1)?1$?#A0$ A"#?$+1$")&&#?0 G#A0$1")1$;)?$),,#;1 $H'.$)?E$H'.=$,)>+:H ‡,Q'HSWK%XVLQHVV(FRQRPLF1HZV ‡6RFLDO3ROLWLFDO&KDQJHV‡3DUN5HFUHDWLRQDO1HZV ‡6FKRRO
PAGE 14

!"#$%&'&()$*"+#,-$%./.01$2-$3456$7)/#$89 !"#$#!"%&'$()*+)!,-!.(,/+!/%-/01!2/!,-!%!#3+'4,-5!&+%61!7+)8+!,/!9,/5!/5+!:3*+6!;,-<(,/-=!$+6#9=!#)!*%)6,)%,-+4!$0!0#()!?%3-1!@5,-!)+<,>+!,-!>)#8,4+4!$0!A+#)*,%!"%)>+)!,3! !"#$%&'!()'!(*++$, -RDQ+RIIPDQV&UDE4XLFKHLV *)+%/!?#)!6(3<5+#3!#)!4,33+)1!@5,-!,-!-5%)+4!9,/5!(-!$0!B,)-/!C)+-$0/+),%3!&KXUFKRI3XQWD*RUGDLQ -'.#&)/'(0' 1/#2/%,' @5%3D!0#(=!?#6D-1 7KLVUHFLSHIRU/RXLVH8VWOHUV&RUQ &DVVHUROHIURPWKHFRRNERRNSXWWR JHWKHUE\1RUWKVLGH%DSWLVW&KXUFKLV9#34+)?(6!%34!+%-0=!/##11HZ9LVLRQV 3//4$%5')6/'3"(78 GRHVLWDJDLQZLWK$QQD.HQQHG\V(JJ SODQW&DVVHUROH7KDQN\RXVRPXFK%URFFROLDQG&DXOLRZHU6DODGIURP1HZ9LVLRQV 3//4$%5')6/'3"(78 !,-! -5%)+4!$0!#()!4+%)!?),+34!?#)!-#!&%30!0+%)-=!E+#&%!F3#G1!2/!,-!9#34+)?(660!<),->=!-9++/=!%34!/%3*01!H+6,<,#(-I0UV+REJRRGV$QJHO%LVFXLWVDUH 6/#2/%"9: !@5,-!)+<,>+!,-!?)#&!#()!?),+34-! ,3!C6%,3-=!A+#)*,%=!,3! !"#$%&'!()'!(*++$, 1HZ9LVLRQ&RPPXQLW\&KXUFK-5%)+-!4+6,<,#(-!)+<,>+-!,3!/5+,)! 3//4; $%5')6/'3"(78,' 7KLVRQHLVIRU-RDQ%\HUV 3HDQXW%XWWHU3LH7U\LW((8?((8,!B#)!%!6%)*+!*%/5+),3*=!/)0!/5,-!4+6,'<,#(-!>(3<5!)+<,>+=!B)%3<,-!J%),#3!K+'<+>/,#3!C(3<5=!?)#&! >6#+"/&)(%'@/; 7/$A)&, *(25*,$+$53(56 !"#"$!%&#'()*( (+,-.+$/012$3114$35610-7+8$1/$ 9:5-;8<$)+10=-5$ !"#$%&'!()'!(*++$ >$.1?;48$@52A?0=+0<$8+581;+4$58$4+8-0+4$B-7@$85:7<$.+..+0<$+7,C917571+8<$.++:+4$5;4$8:-,+4$/10$30+;,@$/0-+8D500178<$8:-,+4#+::$.+..+0<$8:-,+4$-;71$0-;=8";-1;<$8:-,+4#?77+06HDVRQLQJV!J%D+!L!6%)*+!>%//,+-=!#8%6!,3!-5%>+1!C6%<+!+%<5!>%//0!#3!%!6%)*+!-.(%)+!#?!%6(&,3(&!?#,61!:44!%!6%0+)!#?!24%5#!>#' /%/#!-/),>-!M<(/!?#)!B)+3<5!?),+-N1!7+%'VRQ2QWRSRIWKLVSODFHDOD\HURI -6,<+4!<%))#/-1!7+%-#31!:44!#3+!),3*!#?!$+66!>+>>+)!%34!#3+!-6,<+!#?!#3,#31!7+%'-#3!%34!/#>!9,/5!*+3+)#(-!>%/!#?!$(//+)1!B#64!?#,6!(>!%34!-+%6!/,*5/60=!&%D,3*!-,G!-+>%)%/+!-+)8,3*-1!;%D+!?#)!O!5#()!%/!PQR!/#!STT!4+*)++-1!7+)8+!9,/5!*%)6,$,?.$25E1;;5-8+WDEOHVSRRQVRXURXQFHSDFNDJH6ZLVVFKHHVH4-,+4FGH$,?.$8:-,+4$=0++;$1;-1;>$+==8<$A+57+;FG>$,?.$2-:IF$,?.$J10$210+K$,05A2+57F$LM-;,@$.-+$,0?870L[PD\RRXUHJJVDQGPLONXQWLO$6+34+41!7/,)!,3!<)%$&+%/=!<5++-+!%34!#3,#3-1!C#()!,3/#!>,+!<)(-/1!;%D+!%/!SRT!4+*)++-!?#)!UT!/#!UR!&,3(/+-1!7+)8+-!-,G!/#!+,*5/1 /28,6(867/(56 &251&$66(52/( (+,-.+$/012$N107@8-4+$#5.7-87$ D@?0,@$,11IA11I F$FOM1?;,+$,5;$,0+52+4$,10;F$FOM1?;,+$,5;$B@1:+$I+0;+:$,10;<$405-;+4F$PM1?;,+$,1;75-;+0$81?0$,0+52>$+==8F$A1Q$R-//E$,10;A0+54$2-QF$87-,I$A?77+0$ J+6/!$(//+)1!J,G!9,/5!#/5+)!,3*)+' 4,+3/-1!C#()!,3/#!$%D,3*!>%3!%34!$%D+!%/!SRT!4+*)++-!?#)!UR!&,3(/+-!#)!(3/,6!6,*5/60!$)#93!#3!/#>1 $11$.(11('<6 (**3/$17&$66(52/( (+,-.+$/012$ 1HZ9LVLRQ&RPPXQLW\&KXUFKV 2..3$%4')5.'2"(67' ,11IA11I F$2+4-?2$+==.:5;7HGS$,?.$=057+4$,@++8+FG>$,?.$2-:IFG>$87-,I$A?77+0$10$250=50-;+>$8:-,+8$71587$J,0?2A8K6DOWWRWDVWH9+..+0$71$7587+!C++6!+**>6%3/!%34!<(/!,3/#!$6#6%3/=!%44!/#%-/+4!$)+%4'<)(&$-=!&,6D=!$(//+)=!-%6/!%34!>+>>+)1! J,G!%66!/#*+/5+)1!C(/!,3!<%--+)#6+!4,-5!%34!->),3D6+!*)%/+4!<5++-+!#8+)!/#>1!;%D+!%/!SRT!4+*)++-!(3/,6!<5++-+!&+6/-!%34!$+*,3-!/#!$($$6+1 1(20$.12;6%52&&2/,$1' &$8/,)/2:(56$/$' (+,-.+$/012$ 1HZ9LVLRQ&RPPXQLW\&KXUFKV 2..3$%4')5.'2"(67' ,11IA11I EXQFKFDXOLRZHUF$A?;,@$A01,,1:-T$870-.8$,0-8.$A5,1;FG>$,?.$2+4-?2$8-U+$0+4$1;-1;FG>$,?.$=1:4+;$05-8-;8H)+--,3*VF$,?.$25E1;;5-8+FG>$,?.$8?=50F$75A:+8.11;$,-4+0$6-;+=50!;)+%D!%34!<(/!$)#<<#6,!%34!<%(6,'RZHULQWRELWHVL]HGSLHFHV%URFFR 6,!-/+&-!&%0!$+!(-+4!,?!>++6+4!/#!-#?/!<+3/+)1!M",3/V!6%)*+!>,+<+-!%)+!+%-0!/#!-/),>1N!;)+%D!$%<#3!,3/#!-&%66!>,+<+-1!76,<+!/5+!#3,#3!,3/#!),3*-1!J,G!%66!/5+!,3'*)+4,+3/-!/#*+/5+)1'UHVVLQJ&RPELQHPD\RQQDLVH-(*%)!%34!8,3+*%)W!>#()!#8+)!/5+!-%6'%4!%34!&,G!9+661!K+?),*+)%/+!,3!%,)'/,*5/!FRQWDLQHU&KLOODWOHDVWIRXUKRXUVWLS <#3/%,3+)!/#!->)+%4!4)+--,3*!+8+360!/5)#(*5#(/1 056/&+2%*22'6 $1*(/%,6&8,76 (+,-.+$/012$3114$35610-7+8$1/$ 9:5-;8<$)+10=-5$ !"#$%&'!()'!(*++$ F$,5I+$E+587>$75A:+8.11;8$:?I+B502$B57+0FXSVSODLQRXUF$7+58.11;$8145F$75A:+8.11;$A5I-;=$.1B4+0S$75A:+8.11;8$8?=50F$7+58.11;$85:7F$,?.$8@107+;-;=>$,?.8$A?77+02-:I!H,--#68+!0+%-/!,3!6(D+9%)&!M3#/!KRWZDWHU6LIWRXUDQGDOORWKHUGU\LQJUHGLHQWVWRJHWKHULQDERZO&XWLQ-5#)/+3,3*1!:44!$(//+)&,6D=!/5+3!4,-'VROYHG\HDVW6WLUXQWLODOORXULVPRLVW HQHG.QHDGRQRXUHGERDUGIRUDPLQ (/+1!K#66!#(/!%34!<(/!9,/5!$,-<(,/!<(//+)1!;%D+!%/!UTT!4+*)++-!?#)!%$#(/!OP!&,3'(/+-1 -2$1%<(563($187%877(53,( 1HZ9LVLRQ&RPPXQLW\&KXUFKV 2..3$%4')5.'2"(67' ,11IA11I S$1?;,+8$,0+52$,@++8+<$81/7+;+4F$,?.$.1B4+0+4$8?=50 FGH$,?.$.+5;?7$A?77+0>$75A:+8.11;8$,1,15$J1.7-1;5:KF$7+58.11;$65;-::5P$1?;,+8$B@-..+4$71..-;=F$=05@52$,05,I+0$10$A5I+4$LM-;,@$.-+$,0?870L[UVWYHLQJUHGLHQWVXQWLOXII\:44!/#>>,3*!%34!&,G!9+661!7>)+%4!,3/#!SLHVKHOO&KLOOZHOO &$52/$867,1%2*$16 )5,(1'6+,33(&$13,( (+,-.+$/012$%.1.I5$D-7-U+;$91:-,+$ $OXPQL$VVRFLDWLRQV 85#+$%4'9*+'2$%.&)':((7;((7 F$,?.$:-=@7$A01B;$8?=50FGS$7+58.11;$85:7FGS$,?.$2+:7+4$A?77+0H$+==8<$A+57+;$B+::F$,?.$B@-7+$,10;$8E0?.F$,?.$.+,5;$@5:6+8F$7+58.11;$65;-::5!J,G!,3!#)4+)!*,8+31!C#()!,3/#!(3'$%D+4!4++>!>,+!-5+661!;%D+!%/!SRT!4+'*)++-!?#)!#3+!5#()!#)!(3/,6!-+/!,3!<+3/+)!%34!D3,?+!$6%4+!<#&+-!#(/!<6+%31!@5+!<#3/),$(/#)!-%0-=!XB##6>)##?!%34!4+6,'<,#(-1Y 056.$7+(5,1(+(50$1V .$7+(5,1(6+(5,'$1 )5$1&,60$5,21 5(&(37,21381&+ (+,-.+$/012$ :5#+".&)(%'<.6.$=)& <$ $PHULFDV2OGHVW-XQLRU/HDJXH D11IA11I$-;$90-;7<$5$D11IA11I$AE$ 7KH-XQLRU/HDJXHRI&KDUOHVWRQ V;,C F$W?507$,5;$/01U+;$105;=+$X?-,+H$W?5078$-,+$B57+0F$OM1?;,+$,5;$/01U+;$:+21;$X?-,+$10$X?-,+$1/$FP$:+21;8>$JN1C$TK$,5;8$J5$N1C$T$,5;$Y$TO$1?;,+8K$.-;+5..:+$X?-,+S$W?5078$,50A1;57+4$B57+0$10$=-;M=+0$5:+>$,?.8$8?=50<$4-881:6+4$-;$>$,?.8$B57+0$J-/$4+8-0+4K$ J,G!-/##()!5%6?!/5+!.(%3/,/0!#8+)!6%)*+!6(&>!#?!,<+!,3!>(3<5!$#96!%34!%44!P!.(%)/-!<%)$#3%/+4!9%'/+)!#)!*,3*+)!%6+1![-+!#/5+)!5%6?!#?!-/#-!/5+!>(3<5!X%6,8+1YN!:44!/5+!-(*%)!#360!,?!&#)+!-9++/+3,3*!,-!4+-,)+41!M2?!/#!$+!(-+4!%-!%!$%-+!?#)!>(3<5!X9,/5!->,)',/-=Y!#&,/!-(*%)!%34!-($-/,/(/+!%6<#5#6,,3+%>>6+!\(,<+!]!%$#(/!U!.(%)/-1N!OTT!-+)8,3*-2&366&+22/,6287)25680&*(<$ 5(680(6$8*8677UDIF SDWWHUQVDUHFKDQJLQJ6WRUP\ZHDWKHU,12+8$5;4$=1+8Z$#+$,50+/?:$B-7@$E1?0$?2A0+::58C$ :34!%69%0-!9%/<5!#(/!?#)! /5#-+!>+4+-/),%3-1! '2177(;7:+,/( HK2^2EA1&KLOGUHQPXVWEHYH\HDUVROGRQRUEH0(+/'#>D%!SPQOP=!UTQ'QTS'OQ`U1 $ 2QDQ\ *,8+3!9++D+34=!0#(!<%3!-++! 25;E<$25;E$ /52-:-+8 -;$577+;45;,+ !%/!/5+!$+%(/,?(6! <#&>6+G!-+//,3*!>%)/,<,>%/,3*!,3!8%),#(-!RUJDQL]HGVSRUWSURJUDPV$PHQLWLHVDW/5+!<#&>6+G!,3<6(4+V!7#<<+)!B,+64-=!7#?/'$%66!B,+64-=!;%-+$%66!B,+64-=!J(6/,'C()>#-+!)LHOGV6DQG9ROOH\EDOO&RXUWV2XWGRRU%DVNHWEDOO&RXUWV7HQQLV&RXUWV:DONLQJ7UDLO$PSKLWKHDWHU3OD\JURXQG&RQFHV-,#3!7/%34-1FFM2-:+$B-:4:-/+$40-6+$J,12.:+7+$B-7@$4-0+,7-1;5:$8-=;8K$J1.+;+4$-;$>[FTK$1;$\5I+$%.1.I5$8@10+8<$ $0 $ +3/+),3*!?)#&! a(-/!K#%4!#??!;,3,#3!K#%4=!%$#(/!%!&,6+!VRXWKRI&DPS:HZDLQWKH3O\PRXWK%)+%=!?#)!#3+'9%0!4),8+=!OT!&,6+-!>+)!5#()=!9,/5!>#--,$6+!9,646,?+!->#//,3*!-/#>-1! ]"$ 127)(('7+(*$72567KHGULYH25E$A+$,:18+4Z !2?!0#(!%)+!-/#>>,3*=!4),8+! 9,66!/%D+!&#)+!/5%3!O!5#()1!H),8+!)(3-!$0!<%3%6-!(-+4!,3!&(+34+3/!#3!/5%/!/0>+!#?!-0-/+&1!@5+!4),8+!,-!#>+3!#3!B),'4%0-=!7%/()4%0-!%34!7(34%0-!%34!?+4+)%6!5#6,4%0-!%34!,-!<#3/)#66+4!$0!/5+!<#(3/01!2SHQGXULQJGD\OLJKWKRXUVRQO\RQHKRXU%?/+)!-(3),-+!%34!#3+!5#()!$+?#)+!-(3-+/N1!2IFLDOVXQULVHDQGVXQVHWKRXUVFDQEH?#(34!#36,3+1!!@5+!)#%4!,-!<6#-+4!#3!#/5+)!4%0-!4(+!/#!#3*#,3*!)+-/#)%/,#3!9#)D1!@5+!/)%,6!,-!OO!&,6+-!6#3*1! 6LQFHLWVRSHQLQJ 7@+$705-:$@58$@54$210+$7@5;$F[[<[[[^$YLVLWRUV)((',1*7+($//,*$72560$<&$86(&/26,1*2)7+(75$,/ $ :(.,:$635,1*667$7(3$5. $ ,-!%! Q=TTT'%<)+!B6#),4%!7/%/+!C%)D!,3!:>#>D%=!B6#),4%1!2/!,-!6#<%/+4!PT!&,3(/+-!3#)/5!#?!2UODQGRRII,QWHUVWDWHDWH[LWQHDU:6/%/+!7>),3*-!%34!a#3*9##41!@5+!>%)D!%6-#!<#3/%,3-!/5+!5+%4!9%/+)!#?!/5+!Z+D,8%!K,8+)1!:44)+--V!O`TT!Z+D,9%!&LUFOH$SRSNDRSHQIURPDP>1&1!B#)!,3?#)&%/,#3=!<%66!UTQ'``U'USOO11 )5,'$<$8*867 %$&.726&+22/6$/(67$;+2/,'$<$8*867$8*867 ?#)!<6#/5,3*=! ?##/9+%)!%34!<+)/%,3!%<<+--#),+-!-+66,3*!?#)!dLT!#)!6+--!>+)!,/+&=!%34!<+)/%,3!-<5##6!-(>>6,+-!-+66,3*!?#)!dOR!#)!6+--!>+)!,/+&1!)RUFRPSOHWHLQIRUPDWLRQJRWRZZZRUL4%)+8+3(+1<#& 6$785'$<$8*867 25$1*(&2817<+($/7+$1')$0V\_$*`9" VSRQVRUHGE\ERWK2UDQJH &RXQW\0D\RU7HUHVD-DFREVDQGWKHJRYHUQPHQWRIWKH&RPPRQZHDWKRI3XHUWR5LFR6DWXUGD\$XJXVWDPSPDWWKH2UDQJH&RXQW\&RQYHQWLRQ&HQWHU1RUWK+DOO8QLYHUVDO%OYG2UODQGR)RULQIRFRQWDFWZZZRFQHWPDULD 681'$<$8*867 021'$<$8*867 =XPED6HQLRUV)LWQHVV&ODVV 021 '$<6DQG)5,'$<6DPDW)UDQ&DUOWRQ&HQWHU1)RUHVW$YHQXH&DOOUTQ'QTS'OLUP!?#)!,3?#)&%/,#31!#+=-;;-;=$(5,+B5:I-;=$901=052a$ RVTT! SPSPDWWKH2UDQJH&RXQW\3DUNV0DJQROLD3DUN%LQLRQ5G:>#>D%1!@5+!>)#*)%&!,-!?#)!>+#>6+!%*+!OP!%34!#64+)=!%34!,-!?)++1!C)+')+*,-/)%/,#3!,-!)+.(,)+4!$0!<%66,3*!UTQ'``L'UPSO1!B#)!>%)D!,3?#)&%/,#3=!8,-,/!9991#)%3*+<#(3'/0>%)D-13+/"6+0+57+08$%;1;E21?8$2++78$&1;M45E8$57$OaH[$.C2C<$ (SLVFRSDO&KXUFKRI /5+!"#60!7>,),/=!LTO!71!",*56%34!:8+3(+1!2?!0#(!5%8+!%!>)#$6+&!9,/5!?##4!]!#8+)+%/',3*=!%3#)+G,%=!$(6,&,%!]!/5+)+!,-!%!-#6(/,#3!IRU\RX)RUPRUHLQIRUPDWLRQYLVLW2$RUJ#)!<%66!a%()%!UTQ'U`U'QQSL!#)!A,3*+)!UTQ'`SP'RQQP17RDVWPDVWHUV (YHU\0RQGD\SP '!`VST!>1&1=!,3!/5+!J(-+(&!#?!:>#>D%3-=!(WK6W$SRSND)/)RUPRUH,3?#)&%/,#3=! JN?2A+0$,@5;=+4K !<%66!UTQ' RUYLVLWZZZ$SRSNDWRDVWPDV/+)-1#)*17RDVWPDVWHUV 310+87$\5I+$D@?0,@ 5RRP+DUOH\/HVWHU/DQH$SRSND)ORULGD7LPHSP2SHQWRHYH)0#3+!,3/+)+-/+41!B#)!,3?#)&%/,#3=!<%66!UTQ'&OXE1XPEHU'LVWULFW$UHD'2UDWRUVRI([FHOOHQFH 78(6'$<$8*867 :DONDQG7DON DPDPDW 0DJQROLD3DUN&DOOIRU&#)+!,3?#)&%/,#313/$17&/,1,&DW8)0LG)ORULGD5H8+50,@$D+;7+0 =!PQPR!;,3,#3!K41=!:>#>D%=! HYHU\7XHVGD\DPSPZLWKURWDW,3*!J%-/+)!A%)4+3+)!<6,3,<,%3-!/#!+8%6(%/+!0#()!>6%3/!->+<,&+3-1!B#)!,3?#)&%/,#3=!<%66!RUYLVLWRUDQJHLIDVXHGXUHVBKRUW%07$D:588a DPDWWKH)UDQ&DUOWRQ &HQWHU1)RUHVW$YH$SRSND)RU&#)+!,3?#)&%/,#3=!<%66!%34!6+%8+!&+--%*+!?#)!E%3<0!J),3*-!K41=!:>#>D%1!@#!)+-+)8+!->%<+!?#)!6(3<5+#3=!<%66!$0!/5+!B),4%0!$+?#)+=!#)!?#)!,3?#)&%/,#3=!<%66!A)+*!7>()6#)#-/%/+!<%3<+)!,-!5+64!%/!WKH$SRSND$UHD&KDPEHURI&RPPHUFH$(,64,3*=!O`T!Z1!J%,3!7/1=!:>#>D%=!%/!!LVST!>1&1=!%34!,-!#>+3!?#)!%30#3+!95#!,-!,3'/+)+-/+4!,3!/5+!-($\+)#-/%/+!<%3<+)1!,/!,-!?)++1!B#)!&#)+!,3?#)&%/,#3=!<%66!UTQ'SUO'O`PL :('1(6'$<$8*867 $OWDPRQWH6SULQJV$SRSND9):3RVW !&++/-!+8+)0!Z+43+-4%0!&#)3,3*! DW6&HQWUDO$YHQXH$SRSNDIURP`VST'OT!%1&1!E+9!&+&$+)-!%)+!%69%0-!9+6<#&+1! &DOORUHPDLO ,3?#e8?9>#-/OTOUQ1<#&=XPED6HQLRUV)LWQHVV&ODVV :('1(6'$<6DWDPDW)UDQ&DUOWRQ&HQWHU1)RUHVW$YHQXH&DOOIRULQIRUPDWLRQ&ODVVHVDOVRKHOGRQ0RQGD\VDQG)ULGD\VDWDPD-7E$1/$%.1.I5$](D$J]+6+:1.2+;7$(+M6-+B$D122-77++K !&++/-!+8+)0!Z+43+-' GD\DWDPDPDW&LW\+DOO(J%,3!7/)++/=!:>#>D%1! $ 7236&KDSWHU7 %D+! ??! 9 #(34-! 6 HQVLEO\7236DQRQSURWRUJDQL]D /,#3=!9,66!5+6>!0#(!)+%<5!%!9+,*5/!*#%6!9,/5!-(>>#)/!?)#&!?),+3460=!<%),3*!&+&$+)-=!HGXFDWLRQDQGUHZDUGV(DFK:HGQHVGD\%1&1]!9+,*5',3!$+*,3-!%/!`VUR!]!&++/,3*!HQGVDW&RPHWR%HDU/DNHK#%4=!:>#>D%=!/#!&++/!9,/5!#/5+)-!95#!5%8+!%!6,D+'&,34+4!*#%6!/#!6#-+!9+,*5/1!1RSURGXFWVQRVSHFLFGLHWWRIROORZQRPHGV&DOOIRUPRUHLQIRU&%/,#31D5048$b$#0-4=+a DPIRU6(1,256 &RPHDQGMRLQWKHIXQRUEULQJLQVRPHIULHQGVDQGVWDUW\RXURZQ&DOOOLSO!?#)!,3?#)&%/,#31!D05/78$b$D@577+0$5;4$#1504$)52+8<$DP $ IRU6(1,2567KLVLVDQLQIRUPDO *%/5+),3*!#?!-+3,#)!%4(6/-!95#!+3\#0!>6%0',3*!$#%)4!*%&+-=!<%)4-!#)!<)+%/,3*!>)#\'HFWV&DOOIRULQIRUPDWLRQ7LQ\7DOHV5K\PH7LPHIRU>)#G,&%/+60! OR!&,31!+8+)0!Z+41!B#)!,3?%3/-!$,)/5!/#!O`!PRQWKV2&/61RUWK2UDQJH%UDQFKr7RGGOHU7LPH !:/!OTVUR!%1&1=!+8+)0!Z+41=! (VSHFLDOO\IRUFKLOGUHQDJHVWR/5-!%34!6%-/-!%>>)#G,&%/+60!PT!&,3'XWHV2&/61RUWK2UDQJH%UDQFKr6WRU\ERRN)XQIRU>)#G,&%/+60!ST!&,3'XWHV2&/61RUWK2UDQJH%UDQFKr C 7+856'$<$8*867 c5:I-;=$D:?Aa 6(1,256DP&LW\RI $SRSND:LOOPHHWDW0DJQROLD3DUN&DOOUTQ'``L'UPSO!?#)!,3?#)&%/,#31 D@5-0$*Q+0,-8+$D:588$/10$8+;-108 DP)UDQ&DUOWRQ&HQWHU1)RUHVW$YHQXH$SRSND&DOO !!!!!!!!!!!! 527$5< $\?;,@+1;$&++7-;=< !OPVTT! E##31! &++7-;=8$50+$57$;+B$:1,57-1;$1/$ 3:10-45$!18.-75:$-;$7@+$#1504$(112$57$>F[[$",1++M%.1.I5$(154<$%.1.I5$ !B#)!,3?#)&%/,#3!<%66!UTQ'UOR'LR``1 &1710,E,:+$N-=@7a !LVTT!>1&1!'!OTVTT!>1&1! DW3RUNLHV%%4(0DLQ6W$SRSND(YHU\7KXUVGD\QLJKWZLOOIHDWXUHGUDZLQJVSUL]HVWURSKLHVDQGMXVWSODLQVKRZ,3*!#??1!B#)!,3?#)&%/,#3=!<%66!UTQ'``T'SSRO 83&20,1*(9(176 $8*86735,0$5<(/(&7,21 ( %)60! 8#/,3*!4%/+-!%)+!?)#&!B),4%0=!:(*(-/!OQ=!PTO`!/5)#(*5!7(34%0=!:(*(-/!PL=!PTO`=!?)#&!OT!%1&1!/#!L!>1&1!+%<5!4%01!23!:>#>D%=!+%)60!8#/,3*!$##/5-!9,66!$+!%/!/5+!:>#>D%!&RPPXQLW\&HQWHU9):3RVW6&HQWUDO$YHQXH6XSHUYLVRURI(OHFWLRQVDGGUHVVDQGSKRQHQXPEHU:.DOH\6W2UODQGR)/72:1+$//)250,/,7$5<9(76 7+>' /+&$+)!`=!?)#&!OT!%1&1'P!>1&1=!%/!/5+!:>#>'ND&RPPXQLW\&HQWHU9):3RVW6&HQWUDO$YHQXH7KHPHHWLQJLVIRU8+/+)%3-=!8+/+)%3!->#(-+-=!9,4#9-=!%34!<5,64)+3!/#!%//+34=!%-D!.(+-/,#3-=!%34!6+%)3!%$#(/!/5+!^+/+)%3-!:4&,3,-/)%/,#31!J%D+!)+-+)8%/,#3-V!:33,+!:)/,-!%/!UTQ'LUL'RTSQ1 21*2,1*(9(176 $$ !!! $ !!! $ $ !!! $ $ !!! $ !! $ !! !!!! !! !!! !!! $$$$$ !!! $$ !! $ $ !! $ !!! $ !! $ !! !! $$ $$ $ $$$ !! $$ !!! $ $$ !! $$$ $ D-7E$D1?;,-:$ QRUPDOO\PHHWVWKHUVW Z+43+-4%0!%/!OVST!>1&1=!%34! 7@-04$ :HGQHVGD\DWSP 1 $ LQWKH&LW\&RXQ FLO&KDPEHUV&LW\+DOO(0DLQ6W:>#>D%1 $ :66!&++/,3*-!#>+3!/#!/5+!>($6,<1! 6XEMHFWWRFKDQJHZLWKQRWLFH 1!B#)!,3?#1=! FDOO&LW\&OHUN $%=+;45$5;4$ 2-;?7+8$1/$2++7-;=$,5;$A+$/1?;4$1;M:-;+C$";,+$.187+4<$,@+,I$/10$5;E$0+6-MVLRQVE\7XHVGD\DWSPEHIRUHWKH2++7-;=C$9):3267:,//%(6(59,1*%5($.)$67 $ /5+!-+<#34!7%/()4%0!,3!:(' *(-/!4(+!/#!/5+!3+<+--,/0!#?!-+//,3*!(>!/5+!8#/,3*!>)+<,3),'&%)0!+6+#3-#)+4!$0!:CH!%34! 0F'RQDOGVORFDWHGDW(0DLQ6W%52:1%$*/81&+7KLUG6DWXUGD\1/$+5,@$&1;7@$57$ (SLVFRSDO&KXUFKRI /5+!"#60!7>,),/!%/!/5+!<#)3+)!#?!",*56%34!%34!L/5!7/1=!:>#>D%=!?)#&!OT!%&1'O!>1&1!:66!%)+!9+6<#&+!/#!<#&+!%34!$+!?+4!9,/5!/5#-+!95#!9#(64!6,D+!/#!-5%)+!,3!%!$)#93!EDJOXQFK,QDGGLWLRQPHQVVRFNVLSRSVVWXIIHGDQLPDOVDQGFKLOGUHQVERRNV%*!#/5+)!/5,3*-!9,66!$+!#??+)+41!B#)!,3'?#)&%/,#3=!<%66!UTQ'QTS'UPPS! &2))((:,7+$&23 !,-!-<5+4(6+4!7%/' XUGD\IURPWLPHWRWLPHDW0F'RQDOGVRQ(0DLQ6WUHHW $ J++/!9,/5!:>#>D%! 3ROLFH&KLHI0LFKDHO0F.LQOH\DQGRWKHURIFHUV !/#!4,-<(--!&%//+)-!#?!<#3<+)3!/#! 0#(=!%34!+3\#0!%!<#>!#?!<#??++1! $ 7KH$OWDPRQWH6SULQJV$SRSND9):3RVWLVORFDWHGDW6&HQ705:$%6+;?+<$%.1.I5C$ @5+!>#-/!,-!#>+3! Z+43+-4%0!%34!7%/()4%0!J#)3,3*-!?)#&!7,0(&+$1*( !`VST!/#!OTVTT!%1&1!M#/5+)! 5#()-!$0!%>>#,3/&+3/!#360N1 $ :66!&+&$+)-! %34!?%&,6,+-!%)+!()*+4!/#!%//+341!@5#-+!95#!5%8+!-+)8+4!,3!%30!$)%3<5!#?!/5+!&,6,'WDU\GXULQJDQ\ZDURUFRQLFWDQGZKR&%0!$+!,3/+)+-/+4!,3!$+<#&,3*!%!&+&$+)=!DUHDOVRXUJHGWRDWWHQG&DOO`PLL=!#)!+&%,6!,3?#e8?9>#-/OTOUQ1<#&!! $ !! Nc"D$33%$%:?2;-$d$ J#3/560!&++/,3*-! M(-(%660!/5+!U/5!J#34%0!+8+3,3*!,3!%!/5!4(),3*!/5+!-<5##6!0+%)N!%)+!#>+3!/#!%30#3+1!c#(!4#!3#/!5%8+!/#!5%8+!$++3!%!&+&$+)!#?!BB:=!3#)!,-!,/!3+<+--%)0!/#!5%8+!%!<5,64!,3!%3!BB:!<5%>/+)1! %::$7@57$-8$0+M W?-0+4$-8$5$4+8-0+$71$@+:.$7@+8+$E1?;=$.+1.:+<$A17@$/10$33%$5;4$SM!C$ B#)!,3?#)' &%/,#3=!<#3/%!?#)!%3!5#()!#)!/9#!9#(64!$+!*)+%/1!$GPLQLVWUDWLYHSRUWLRQLVPRYLQJWRRIFHQH[WGRRULQDFRXSOHRIZHHNV&DOO-RDQQDWRUFHOO $ !!!!!!! $ !!!!! !! $ !! $ !!! 0XVHXPRI$SRSNDQV(WK6WUHHW"#()-!#>+3V!@(+-4%0!/5)#(*5!B),4%0=!OVOR!SPWRSP$GPLVVLRQLVIUHH&RQWDLQVGLVSOD\VDQGLQIRUPDWLRQDERXW$SRSNDV5,-/#)0=! 5;4$@58$@-8710E$A11I8$/10$85:+C B#)!&#)+!,3?#)&%/,#3=!<%66!UTQ'QTS'OQTQ1 !! J#3/560!&++/,3*-!#?!:>#>D%!",-/#),<%6!7#<,+/0!%)+!3#)&%660!5+64!#3!%!7(34%0!%?/+)3##317KH$SRSND(ONV/RGJH PHHWVUVW DQGWKLUG7XHVGD\VRIPRQWK:2U%3*+1!B#)!&#)+!,3?#)&%/,#3=!<%66!UTQ'``L' OLTT!#)!+&%,6!%>#>D%+6D-e%#61<#&1!!!*):&$SRSND:RPDQV&OXE '!/#!&++/! /5+!S)4!@(+-4%0!#?!+%<5!/5=!$+*,33,3*!,3!7+>/+&$+)1$31:-5=+$)504+;$D:?A$ PHHWVWKHUVW 7KXUVGD\RIHDFKPRQWKDWDPDWWKH0XVHXPRI$SRSNDQV(WK6W:>#>D%=!7+>/+&$+)!/5)#(*5!_(3+1%.1.I5$)504+;$D:?A$ PHHWVWKHUVW @(+-4%0!+%<5!/5!%/!B,)-/![3,/+4!J+/5'RGLVW&KXUFK63DUN$YH6HSWHP$+)!/5)#(*5!J%01!!B#)!,3?#)&%/,#3=!<%66!.DWK\ &?8-,$57$&5=;1:-5$0+,104+0$,:588+8$ $+' *,3!#3!J#34%0-!?)#&!SVST'UVOR!>1&1!%34!,3/+)&+4,%/+!<6%--+-!%)+!5+64!#3!Z+43+-'4%0-!OOVOR!%1&1'3##3!%34!PVST!>1&1'SVOR!SPDW6%LQLRQ5G+Z\:>#>D%1!@5+!<6%--+-!%)+!#>+3!/#!%66!%*+-1!@5+!<#-/!,-!dP!>+)!>+)-#3!>+)!<6%--1!2?!0#(!%)+!%!3#8,<+=!#)!%)+!,3/+)+-/+4!,3!6+%)3,3*! /#!>6%0!/5+!)+<#)4+)=!<%66!UTQ'``L'UPSO1!D-7E$1/$%.1.I5$9:5;;-;=$b$f1;-;=$M$(-(%660!/5+!-+<#34!@(+-4%0!#?!/5+!/51 $ TaH[$.C2C &LW\&RXQFLO&KDPEHUV&LW\ +DOO(0DLQ6W$SRSND$OOPHHW,3*-!#>+3!/#!/5+!>($6,<1!7($\+,/%6!:>#>D%!4+-,*3+4!/#!5+6>!/5#-+!9,/5!<5)#3,)+-'-()+=!%)/5),/,-=!4,%$+/+-=!<%3<+)!%34!&#)+1!&DOOWROHDUQPRUHDERXW?)++!<5)#3,#>D%1#)*=!<6,>#)/(3,/,+-!%8%,6'DEOHDWWKH5HVWRUHV&DOO !! #)!UTQ'``T'```O!/#!-,*3!(>!?#)!,3?#)&%/,#312SHQ+HDUW.LWFKHQ @5+!A#64+3! #>D%1!B#)!&#)+!,3?#)&%/,#3=!<%66! rrrrrrrrrr r2&/62UDQJH&RXQW\3XEOLF/LEUDU\1RUWK2UDQJH%UDQFK$GGUHVV(7+&#)%3!;#(6+8%)4=!:>#>D%!USL!M7+&#')%3N!%34!@5#&>-#3!K#%41!9991#<6-1,3?#1!@#!)+-+)8+!%!->%<+=!<%66!UTQ'`SR'QSPS1rr$SRSND$UHD&KDPEHURI&RPPHUFH(0DLQ6W$SRSND)RUPRUHLQIR<%66!UTQ'``L'OUUO &20081,7<(9(176 D%\*N]%($VN3" 2(+'6(>>*%$)?'.1.%)&@'/*%3'+#$&.+&@' DQGQRQSURWRUJDQL]DWLRQV 6HQGLQIRID[RUHPDLO 548g7@+5.1.I5,@-+/C,12C 6XEVFULEHWR7KH$SRSND&KLHI *M*4-7-1;$10$!12+$]+:-6+0E &DOORU ^,-,/!/5+!Z+$!-,/+V !9991/5+%>#>D%<5,+?1<#& V;$D1?;7Ea$hH[$B-7@$*M+4-7-1;<$ 10$h>T$/10$X?87$.1875:$4+:-6+0EC "?7M1/MD1?;7Ea$hHT$B-7@$*M*4-7-1;C 10$hH[$/10$.1875:$4+:-6+0EC CCC (9(176 ++ $c**i\_$$ ++ '9D"&VN)$$ ++ $"N)"VN) ++ (9(176 !"#"$% 7)+:$.&$1)01;$<'='$<)>=.:/#:0$?+1"$%@/#A$9+0B.+10$':$/):A+B$=:#)C itchen apersby ancy

PAGE 15

!"#$%&'&()$*"+#,-$$%./.01$2-$3456-$7)/#$89 9'.,7/'1($7'$7"#$%&'(()'&*$+,--.#$3&#$0',1*$'1$234#$:6$'0$7"/($1#)(232#&8

PAGE 16

!"#$%&'&()$*"+#,-$$%./.01$2-$3456-$7)/#$68 $5.99KING BUFFETBest Bu et and Best Deals in ApopkaVoted one of the Best of Apopka 20172157 East Semoran Blvd., Apopka!"!#$%&'()*$%+'%,*+-#)*$%.-(/01 $2.00(23%45678%29%026785:;1%!<=6>8?;% @>AA?3%B73C%;92B%=D5E1%/2>F29% D?G>7D?81%(23%45678%B73C%59:%23C?D% 2AA?D1%!&789&:;<=!&'#&,'("43)10&?@2(.4$1& A.BB$+&*"+,&1#'*&263A0&?CD0&EFGHFHEPER ADULT LUNCH BUFFETBBB1M79NOE>AA?31=2L Does your group or organization have a cookbook or some favorite recipes they'd like to share? Or Mail to:!The Apopka Chief! and The PlanterRECIPES, 400 N. Park Ave., Apopka, FL 32712 MMM... Chili! :HGORYHWRKHDUIURP\RX !"#"$%&'''($)*+,-,.+/)"*0(/-1 !!"#$%&$'()(*$+,)-$.!/$'01(*$2"2! 34,45)6$78$!9:"! ;,<=*<$,>$'+$.!/$?$@0=($;A0B$CAD-&X.ŒZ}X}utXKŒvPo}}udŒ]o 34,45)6$78$!9:29 /všZ‰}‰l}uu}vWo is coupon valid at Apopka locations only. Limit one per customer, per visit. Not valid with any other o ers. Expires 8/31/18$2 OFFSub, chips and Medium drink 90#$1"#$!"#$"%#&' ()$*)+,','.:;$':$1"+0$ &)/#$,'<$)$ -.&"/'01+1+-' &2*&.1&+(&3=)(#$0.<#$1'$ >#:1+':$1"#0#$);0? Call for Takeout: 407-292-2248TornatoresItalian.com 3818 Edgewater Dr. | Orlando, FL 32804 Top Neighborhood Restaurant of 2017 !"#$%#$&%'()*$+,&%-.% /0-%12#)&&,923%45678%B73C%59:%23C?D%=2>F29%2D%;F?=7561% L>;3%FD?;?93%=2>F291%!D593;%B73CO79%5%;C2D3%8D7479N%87;O359=?Q%73%=59%E?%4?D:%C5D8%32%;3598%2>3%AD2L%3C?%=D2B81% '9?%4?56%F5DL7N75O 95%L?63;%7932%5923C?D1%'9?%F653?%2A%65;5N95%7;%4?D:%L>=C%67M?%3C?%29?%E?A2D?%73%598%3C?%29?%32%=2L?%5A3?D%73Q%A2D%3C53%L533?D1%*98%3C?%?98O6?;;%FD2=?;;729;%2A%566%3C79N;%P356759%N?3%3?872>;%3CD2>NC%24?DO?D?1% P9%2D8?D%32%ED?5M% 5B5:%AD2L%3C?%F5=MQ%59%P356759%D?;35>D593%C5;%32%2AA?D%;2L?3C79N%9?B%598%87AA?D?93Q%2D%73%C5;%32%82%3C?%=65;;7=;%;2%B?66%3C53%3C?:%;??L%9?B%598%AD?;C1% 9LQFHQWV,WDOLDQ I$1+3.63#+ %C5;%829?% R>;3%3C53S% 7KHDYRUVEURXJKW 2>3%79%3C?%87;C?;%;?D4?8%53% 9LQFHQWV,WDOLDQ I$1+3.63#+ %5D?%2>3%2A% 3C7;%B2D681%02L?L58?%;5>=?;Q%L?53E566;Q%N9O2==C7Q%F7TT5%82>NCQ%8D?;;79N;Q%598%8?;;?D3;%DUHIXOORIDYRUWKDWRQO\=2L?;%AD2L%5>3C?937=O73:%598%3D58737291%+C?%C2L?L58?%A228%598%;5>=?;%;?D4?8%5D?%;?=O298%32%929?1% P356759%=>7;79?%?9O 3C>;75;3;%=59%?9R2:%VRPHRIWKHQHVW,WDOLDQA228%598%8?67=5=7?;%D7NC3%C?D?Q%=62;?%32%C2L?1%*;%3C?%D?;35>D593%2B9?D;Q%"79=?93%598%U2;?FC79?%)ROJRUHVSKLORVRSK\LV5;%?5;:%5;%73%7;%;3D57NC3OA2DB5D8V%W-;?%3C?%E?;3%79ND?87?93;%5;%;7LF6:%5;%F2;;7E6?%598%;?D4?%3C?L%B73C%A59A5D?%598% F6?5;>D?1X +C?%=5D?A>66:%=D5A3O ?8%L?9>%2A% 9LQFHQWV % ;C2B=5;?;%L59:%2A%3C?%;7N953>D?%87;C?;%3C53%C54?%E>763%5%L>6373>8?%2A%A59;%3CD2>NC2>3%/?93D56%Y62D7851%P3%2AA?D;%;>=C%A5O42D73?;%5;%=C7=M?9%L5DO;565%598%=C7=M?9%F7=53O35Q%;CD7LF%;=5LF7Q%=56O5L5D7Q%;?5A228%=2LE2Q%598%?NNF6593%F5DL7N75O95%5629N%B73C%3C?7D%8?O67=72>;%F5;35%87;C?;Q%C2L?L58?%;7N953>D?%F7TT5;Q%598%;5658;1%P356O7592%;>E;Q%;5658;%598%5937F5;32%D2>98%2>3%5%A5E>62>;Q%A5;3%6>9=C%L?9>1%*98Q%B73C%5%45D7O?3:%2A%FD7=?%F2793;Q%3C?%;?6?=3729;%5662B%A2D%5%87979N%?8N?31% PA%:2>%5D?%79%5%C>DO D:%2D%B593%32%?9R2:%5%B298?DA>6%P356759%L?56%2D%F7TT5%79%3C?%=2LA2D3%2A%:2>D%2B9%C2L?Q%=566%5C?58%598%F65=?%:2>D%2D8?D1%$2>D%L?56%B766%E?%F5=M5N?8%598%D?58:%A2D%F7=MO>F1%*98Q%7A%:2>%624?%FKLFNHQZLQJVGRQWF5;;%3C?;?%>F1%YD?;CQ%F6>LFQ%9?4?D%AD2T?9%B79N;%5D?%56;2%5%A542DO73?%2A%3C?%N>?;3;%53% :"#% FHQWV,WDOLDQ5HVWDX63#+ 1 Y2D%"79=?93Q%7;%C5;% 56B5:;%E??9%5E2>3%3C?%A2281%*98Q%53% 9LQFHQWV =+3("3#&I$1+3.63#+ Q%3C53% 7;%3C?%A2=>;1%/D?5379N%5%F65=?%BC?D?%F?2F6?%=59%?6%P356759%=>7;79?%598%?9R2:%3C?L;?64?;%B73C%AD7?98;Q%A5L76:Q%598%E>;79?;;%5;O;2=753?;%C5;%56B5:;%E??9%C7;%F5;;7291%*98Q% 5;%5%A5L76:Q% 9LQFHQWV % A2=>;?;%29%3C?%3C79N%3C53%C5;%56B5:;%E??9%L2;3%7LF2D3593%32%3C?LQ%BC7=C%7;%L5M79N%?5=C%598%?4?D:%N>?;3%A??6%3C53%3C?:%5D?%F5D3%2A% :"#% FHQWV %A5L76:%?4?D:%37L?% 3C?:%879?%B73C%3C?L1 9LQFHQWV,WDOLDQ I$1+3.63#+ VPHQX C5;%5%45D7?3:%2A%F5;35;Q%5>3C?937=%P356759%L579%L?56;Q%598%8?67=72>;%F7TT5%598%;598B7=C?;%L58?%B73C%B?66O;2>D=?8Q%G>5673:%79ND?87?93;1%!4O?D:%87;C%C5;%;2L?3C79N%32%L5M?%73%87AA?D?93Q%2AOA?D79N%N2>DL?3;%598%A59;%59%>9D74566?8%?F6?8%B73C%5%D>;37=Q%5>3C?937=%P356759%5LE7?9=?1%!5=C%D?=7F?%FRPHVIURP9LQFHQWVB298?DA>6%?3C?937=%5D2OL5;%79%3C?%M73=C?9%598% 3C?%C2L?L58?%D?=7F?;%=2LF76?8%AD2L%C7;%37L?%79%P356:1 9LQFHQWV,WDOLDQ I$1+3.63#+& 7;%5%B5DL% 598%=2LA2D35E6?%D?;35>OD593%3C53%7;%3C?%F?DA?=3%F65=?%A2D%:2>D%87979N%F6?5;>D?%2D%;F?=756%2=O=5;7291% 9LQFHQWV %C5;% E??9%;>==?;;A>66:%ED79NO79N%A5L76:%598%AD7?98;%5%35;3?%2A%P356:%A2D%24?D%JZ%:?5D;S 9LQFHQWV,WDOLDQ I$1+3.63#+ %7;%=294?O 97?936:%62=53?8%53%[\KZ%(2D3C%'D59N?%@62;;2L%+D576%79%&31%)2D51%]65=?%:2>D%=5DD:O2>3%2D8?D%E:%=56679N%J[^O_J[OZ[_H1%"7;73% 9LQFHQWV,WDOLDQ I$1+3.63#+& +>?;85:% 3CD2>NC%,53>D85:Q%AD2L%KK%51L1%32%\VJ`%F1L1Q%598%,>985:Q%AD2L%KK%51L1%32%HVK[%F1L1% :"#% FHQWV,WDOLDQ5HVWDX63#+ %7;%=62;?8%&2985:1% ;4J$6+"1$5$#+ !"#$%&'(&#&)*+#,&)+("'-#"'.-&/.*&#-%.-+&01.&$.2+(&/..)&#-)&)*'-34&5.6#"+)&78("&,'-8"+(&/*.,&9:.:3#&.-&;;<=&>'-6+-"?(&!"#$'#-&@+("#8*#-"&.//+*(&1.,+A,#)+&!"#$'#-&)'(1+(&"1#"&#*+&#$0#%(&)+$'6'.8(&#"&#&2+*%&#//.*)#B$+&:*'6+4 (QMR\WKHH[SHULHQFHRIKRPHPDGHDYRUV ./&!"#$%&#"&>'-6+-"?(&!"#$'#-&@+("#8*#-" !"#$%#&'()*+,-.+(,/&(,01& 0+)+.%2&*1&1("#&+)-$+,-.+(,3 !"##$%&' !()*$%&' !$$+"$%, + Follow us on -./012304-44 25..'6789:;<'!=>?' @A9AB;&'+)'52/.5 Or visit our other locations at: &BTU$PMPOJBMp$SPTTSPBET Artegon 4%.&"/&5%06&1("&'#%-.%&1("#& :RUOGV*UHDWHVW(YHQWZK 7"22/&8-.%#/&-.&1("#&60-'%& (#&("#/9 3LOHKLJKZKRXU )-#:%.&;<#%/5&6#(2"'%9 5914 North Orange Blossom Trail .PVOU%PSBt 7XHV6DWSP6XQSP‡0RQ&ORVHGOne offer per coupon. Not to be combined with other offers, coupons or discounts. Not valid for catering and banquet parties. Exp. 8/31/18. Experience Authentic Italian Food Today! Pizza Special Weekly Lunch Specials $5.95Specials starting atDine in only. No sharing. One offer per coupon. Not to be combined with other offers, coupons or discounts. Must present coupon. Exp. 8/31/18.second pizza 50% OFF of equal or lesser value Dine-In or Take-out Get an Additional 10% OFFTues. thru Sat. 11am 3pm !"#$%&"'(%')*++,'-%./(*0%.1 —”•ƒ—…‡•ƒ”‡ƒ†‡ˆ”‡•Š†ƒ‹Ž›Š‡Š‘—•‡•ƒŽƒ††”‡••‹‰‹•ƒ†‡ˆ”‘•…”ƒ–…ŠŽ›–Š‡‹‡•–‹‰”‡†‹‡–•ƒ”‡—•‡† !"#$%&'&()*'+,"-&)".,($"/)"0&1,02&'&3()42*%& 5$$6)7&/)'*802)&1'%&,04&49::$4)7&0$&;)< !"#"$%&#%'$ !!!"#$%%&'()*+$,()"#(()%'*)%+,-'$).%'$ ././01"02&-(3$,0456780 ’‘’ƒutyruvryyyvzrzr :3%DOO%OYG6DQIRUG)/ !"#$#%&''(%)*%'+$%,-**)'. C a ff Ž P o s itano Dining !"# $#%&"' "#()*&+

PAGE 17

!"#$%&'&()$*"+#, !"#"$%&'(&)*+,(&-.#/&+0 !""#$%"#&$'()#*+,# -./$0("#*$#$%"#$'-#'1# $%"#-*2"#*3'0$#4.(&$# !$(.5"6#*#)'0$%#3*&" 7 3*88#$"*9#1('9#:-'7 5*#$%*$#$(*;"8",#$'# <''-"(&$'=+6#>?@?6# $'#-8*)#.+#*#+*$.'+*8# 3*&"3*88#$'0(+*9"+$# $%"("?#<''-"(&$'=+# .&#%'9"#$'#$%"#>* 7 $.'+*8#A*&"3*88#B*88# '1#4*9"?#C%"#$"*9# -"(/"+$#'1#$%"#$"*9&# .+#$%"#$'0(+*9"+$#$%*$# =*&#-8*)",#D08)#EE7 EF? -&'./0 !"#$%&'#()*+%, !"#"$%&'()*+&,-%++&& &&&&&&&& .(*&/*0)*/&#+&'##"*0/1 -#23&4)*56&#+&70*%8/&9% 1 -)#3%5&.#:03%8*3-/&(*56& *;*0<&/:88*0&%-&-(*&'## 1 "*0/-#23&70*%8/&=%0$&)3& 9*2&>#0$&%0*&"0#8#-*6&%/& -(*&?0#23&@*2*5&#+&<#:-(& A%/*A%55&BCD&<*%0/&%36&:3 1 6*0EF&'(#/*3&%/&%&"%0-&#+&-(*& 1 8*3-&(*56&G:5<&DD1DHI&-(*& 1 "*0)*3?*6&A<&!"#"$%J/&4)0/-& -(*&/-%-*F&& & !;*0<&!A*55I&K0%36#3& ,#2*0/I&K0%<5#3&K:-5*0I& L%/-#3&M#0$8%3I&L5)&.(:0 1 8#36I&G%?$&7:A#)/I&G%?$ 1 /#3&.:03*0I&G:5)%3&N#3O% 1 5*OI&9#%(&P%0-8%3I&Q2*3& 70%;*/&%36&R#A<&S? 1 '5%8#3&6)63J-&-0%;*5&-#& -(*&-#:03%8*3-&2()?(&)/& /:"*0;)/*6&A<&-(*&!8*0) 1 1 6*"%0-8*3-F 1 "%//F & T>#:&?%3&5)-*0%55<&/%;*&(:360*6/&#+&6#55%0/&2()5*&-%$ 1 1 1 +#06%A5<&2%-?(&%55&<#:0&K5:*&7%0-*0&-*%8/&)3&%?-)#3&%36& 1 1 -)/*8*3-/&/(#:56&(%;*&-(*)0&"%<8*3-&%36&%0-2#0$&-#&-(*& Players and coaches from First Strike, an Apopka youth baseball team, have their picture taken at Cooperstown Dreams Park in Cooperstown, N.Y., the site of the National Baseball Hall of Fame. See TEAM Page 6C Coach Lenin Vazquez (third from left) and members of the Wekiva High School wrestling team particpated in the Appalachian State Wrestling School this summer at the university in Boone, N.C. Teams from across the country were involved in the school, including state champions from Florida, Georgia, South Carolina, North Carolina, and Tennessee. The top Wekiva performers were, Vic Altimirano, runner-up; Brien Palmer, fourth place; and Wil Accius, fth place. Other Wekiva wrestlers attending were, Shane O'Leary, Hassan Chandler, Kanard Ramatour, and Mo Weisenfeld. !"#$%&'()"*+,")*'-./0"+"'$1'23'4&).,$1& 0)1#$)/$%&'&()$2+3" Practice for high school football teams around the state began Monday, July 30, with both the Wekiva Mustangs and the Apopka Blue Darters taking part. The rst ve days of practice for the 2018 season are dubbed contact-free, but beginning with the sixth practice, on Monday, August 6, for the Mustangs and Darters, contact is allowed. Both teams will play preseason games on August 17 and will start the regular season on August 24.

PAGE 18

!"#$%&'&()$*"+#,-$%./.01$2-$3456-$7)/#$3* 407-889-5222 !"#$%$&# "''(%)$*++,

PAGE 20

!"#$%&'&()$*"+#,-$%./.01$2-$3456-$7)/#$8* 9):1#:0$&:#&):#$,':$,''1;)<<$0#)0'=$)0$&:)>1+>#$;#/+=0 Jackson Darlington hands the ball off to Jecoryan Davis-Hamilton as offensive line man Cody Miller looks down the eld. Offensive line coach Bill Caughell watches as players go through their drills on the rst day of practice for the 2018 season. Jackson Darlington throws the ball under the watchful eye of his coach and father, Rick Darlington. Running back Cornelius Williams prepares to catch a pass on Monday, July 30, the rst day of football practice ahead of the 2018 regular season. Wide receiver Fred Young keeps his eyes on the ball as he prepares to catch a pass. Head coach Rick Darlington points during practice on Monday, July 30. Defensive line coach Matt Anderson pays attention to technique played by a lineman. A defensive back goes up for an interception during drills for the defensive backs. Defensive coordinator Tom Paolucci talks to the line backers during practice. Jalen Carter stops to take a drink of water during practice on Monday, July 30. Defensive backs coach Mike Granato makes his point on Monday, July 30, the rst day of prac tice. !"#$$%&'("()% *+%,('-%.//0+

PAGE 21

!"#$%&'()*+%,-./+01.%233/4+55%4'1)0.%67+8/)8'% Despite the daily afternoon thundertorms, the morning football practice beginning this week was very hot and required numerous water breaks. A teammate catches a pass in the wing thrown by WHS quarterback Sean Robles on July 31. A player for Wekiva prepares to receive a ball as he begins to sprint downeld Tuesday. On Tuesday, July 31, players at Wekiva High School practice for the upcoming football season. WHS head coach Rich Bedesem oversees practice on Tuesday morning, July 3. Wekiva assistant coach Reggie Lee uses a pole with a ball attached to the end to simulate a snap while working with the defensive line. On Tuesday, July 31, Wekiva players were put through agility drills as teams begin the rst week of practice. 9:'%;636(+%<:)'2=%;-1-./%>=%!"#$=%?+1'%@< !"#$#%&'(&& )*++(&,-*$#. Wekiva High School's offensive line lunges at blocking dummies during Tuesday morning's practice. Assistant coach Mac MacCarty monitors Wekiva players from the edge of the eld as practice progresses.

PAGE 23

!"#$%&'&()$*"+#,-$%./.01$2-$3456-$7)/#$8* !"!#$%&'($)*'+,--.%&,(%/!!#%,$$!#0 1 !0%/.%-,*2!%#34/!*(%)5%6*)4'#!#$% ,-34#'%5*)4%$&!%5)3*%(+&))-(%,(% ,--%5)3*%(+&))-(%&,"!%,%0!!6%5))$ 1 /,--%$*,0'$')#%7&'+&%2)!(%/,+8% 4)*!%$&,#%9:%.!,*(;%<&!%2))01 #,$3*!0%*'",-*.%,#0%*!4'#'(+'#2% ,4)#2%$&!%5)3*%+),+&!(%,#0%$&!'*% ,-34#'%,#0%5,#(%,00(%,#%!-!4!#$% )5%=)"',-%+,4,*,0!*'!%$)%$&!%>*. 1 '#2%<)7!-%,$4)(6&!*!; % <&'(%.!,*?(%>*.'#2%<)7 1 !-%$,8!(%)#%(6!+',-%4!,#'#2%03!% $)%$&!%6,(('#2%)5%5)*4!*%@#'$!0% A!2,+.%B,#8%>CD%E,"!%F)7!*(% '#%G)"!4/!*%H:IJ;%F)7!*(%7,(% ,%0*'"'#2%5)*+!%/!&'#0%$&!%>*.'#2% <)7!-%!"!#$;%K#%&)#)*%)5%E,"!% F)7!*(?%'#0'(6!#(,/-!%+)#$*'/3 1 $')#(%$)%$&!%(3++!((%)5%$&!%>*. 1 '#2%<)7!-%,#0%&'(%,/'0'#2%6,((')#% ,#0%2!#!*)3(%(366)*$%5)*%&'2&% (+&))-%(6)*$(%'#%L!$*)%D*-,#0)M% $&!%!"!#$%&,(%/!!#%*!1#,4!0%'#% &'(%&)#)*; 1 +3-$%$)%$&'#8%,/)3$%6*!6,*'#2%5)*% ,#)$&!*%>*.'#2%<)7!-%!"!#$%,$% >&*'($#!*?(%7'$&)3$%E,"!%F)7!*(;% E,"!%F)7!*(%'(%$&!%6!*()#%7&)% !#+)3*,2!0%4!%$)%*!"'"!%$&!%>*. 1 '#2%<)7!-%!"!#$%3#0!*%$&!%<,-8'#?% D-0%N+&))-%/,##!*%'#%H:IO%,#0% &'(%3#/*'0-!0%6,((')#%5)*%&'2&% (+&))-%(6)*$(%'#%L!$*)%D*-,#0)M% !(6!+',--.%&'(%/!-)"!0%B'(&)6% L))*!%P)*#!$(M%/*)32&$%,%(6!+',-% !#!*2.%$)%$&!%4!$*)%D*-,#0)%&'2&% (+&))-%(6)*$(%(+!#!; % QE,"!%F)7!*(?%6,((')#%,#0% +)#$*'/3$')#(%$)%&'2&%(+&))-% (6)*$(%,*!%3#4,$+&!0%,#0%'#0'( 1 6!#(,/-!M%7!%&)6!%$&,$%$&'(%(4,--% 2!($3*!%7'--%*!4'#0%!"!*.)#!%)5% $&!%!R,46-!%E,"!%F)7!*(%(!$% '#%63*(3'#2%&'(%6,((')#(%,#0%&'(% +)44'$4!#$%$)%&!-6'#2%)$&!*(% ,+&'!"!%(3++!((S%,#0M%!(6!+',--.M% &'(%6,((')#%5)*%$&!%2))0%#,$3*!0% 53#%,#0%+,4,*,0!*'!%)5%$&!%>*. 1 '#2%<)7!-%!"!#$;T % @#'$!0%A!2,+.%B,#8%>CD% L'8!%N-!,5)*0%(,'0M%QC"!*.)#!% ,$%@#'$!0%A!2,+.%B,#8%'(%6*)30% $)%+,**.%)#%E,"!%F)7!*?(%-!2,+.% '#%$&!%>!#$*,-%U-)*'0,%+)443#' 1 $.%,#0%!(6!+',--.%E,"!?(%-)"!%)5% &'2&%(+&))-%(6)*$(;%K%-))8%5)* 1 7,*0%$)%,$$!#0'#2%$&'(%53#%!"!#$% ,(%7!%(366)*$%&'2&%(+&))-%(6)*$(% ,#0%E,"!;%E,"!%&,(%/!!#%,%4!# 1 $)*%,#0%5*'!#0%$)%4!%)"!*%H:%.!,*(% ,#0%&!%'(%0!!6-.%4'((!0;T% % V'--',4(M%+*!,$)*%,#0%&)($%)5% $&!%<,-8'#?%D-0%N+&))-%*,0')%6*) 1 2*,4%,#0%5)*4!*%W6)68,%B-3!% E,*$!*%$'2&$%!#0M%7'--%&!-6%$)%5,+'1 '$,$!%$&!%6*)2*,4?(%X3!($')#1,#01 ,#(7!*%6!*')0%,#0%7'--%'#$!*"'!7% !,+&%)5%$&!%+),+&!(%5)*%,%(6!+',-% *,0')%(&)7%$&,$%7'--%/!%/*),0+,($% )#%<&3*(0,.M%W323($%IJM%,$%J%6;4;% )#%UL%YZ;Y%<&!%[,4!%,#0%WL% JO:%<&!%[,4!; % <&!%6*)2*,4%7'--%,-()%/!%*!1 /*),0+,($%,$%\%6;4;%)#%UL%I:H;9% VUAW%,#0%WL%9O:%VUAW%)#% U*'0,.M%W323($%I\; % V'--',4(%!R6*!((!0%2*,$' 1 $30!%5)*%$&!%(366)*$%)5%$'$-!%(6)# 1 ()*%@#'$!0%A!2,+.%B,#8%,#0%&)($% (6)#()*%>&*'($#!*?(;%QK%7,#$%$)% $&,#8%@#'$!0%A!2,+.%B,#8%,#0% >CD%L'8!%N-!,5)*0%5)*%$&!'*%+)# 1 $'#3!0%(366)*$%)5%$&!%E,"!%F)7 1 !*(%>*.'#2%<)7!-%K#"'$,$')#,-%6*! 1 (!#$!0%/.%@#'$!0%A!2,+.%B,#8M% !(6!+',--.%'#%$&'(%(6!+',-%.!,*% 7&!*!%7!%&)#)*%5)*4!*%@#'$!0% A!2,+.%B,#8%>CD%E,"!%F)7!*(;% K%,-()%7,#$%$)%$&,#8%$&!%>&*'($ 1 #!*%5,4'-.%5)*%&)($'#2%$&!%>*. 1 '#2%<)7!-%,#0%>&*'($#!*?(%D6!* 1 ,$')#(%L,#,2!*%]'4%U-,#,2,#%5)*% &'(%(366)*$%)5%<,-8'#?%D-0%N+&))-% ,#0%&'2&%(+&))-%,$&-!$'+(%'#%>!# 1 $*,-%U-)*'0,;T % <&!%6*)2*,4%7'--%($,*$%,$%Z% 6;4;%7'$&%,#%'#5)*4,-%()+',-%&)3*% 7'$&%+),+&!(M%(6)#()*(M%,-34 1 #'M%,#0%)$&!*%23!($(M%5)--)7!0%/.% 6;4;%K44!0',$!-.%5)--)7'#2%0'# 1 #!*M%,$%,66*)R'4,$!-.%\%6;4;M%$&!% +),+&!(%7'--%4,8!%$&!'*%6*!(!# 1 $,$')#(M%*!+)*0!0%5)*%$&!%<,-8'#?% D-0%N+&))-%*,0')%6*)2*,4;%<&!% +),+&!(%7'--%/!%,",'-,/-!%5)*%$&!% )6!#%X3!($')#1,#01,#(7!*%(!( 1 (')#%7'$&%0'##!*%23!($(;%>),+& 1 !(%7'--%,-()%/!%,",'-,/-!%5)*%'#$!* 1 "'!7(%7'$&%4!0',%7&)%,$$!#0%$&!% !"!#$; Continued from page 1C !'9#:;$ !"#$"%&'()**')+,*-./'0-/12)#+3%+.3%+1(/"'1/11)#+'()24',#%,4/1 !"#$%&'#()*+%, W6)68,%>&'!5%N$,55 % % V&!#%[,2!%N$!--'#2%($!66!0% )#$)%$&!%/)7-'#2%-,#!(%5)*%$&!% 6)$!#$',-%)5%/!+)4'#2%,%6*)5!( 1 (')#,-%,#0%=)'#'#2%$&!%F*)5!((')# 1 ,-%B)7-!*(%W(()+',$')#%^+)#('0 1 !*!0%$&!%4,=)*%-!,23!%)5%/)7-'#2_ 7,(%)/"')3(;%G)7M%7'$&%$&!%+, 1 *!!*%4)"'#2%5*)4%.)3$&%,#0%&'2&% (+&))-%+)46!$'$')#%,(%,%4!4/!*% )5%$&!%W6)68,%B-3!%E,*$!*(?%0. 1 #,($.M%$&,$%)/"')3(%&,(%)#-.%'# 1 1 )#(&'6(%3#0!*%$&!%/!-$;%P)7!"!*M% /!5)*!%($!66'#2%)#$)%$&!%@#'"!* 1 ('$.%)5%G)*$&7!($!*#?(%+,463(%'#% A'4,M%D&')%,#0%!#$!*'#2%,%6*)5!( 1 ,#+&)*%)5%$&!%E,*$!*(?%H:IJ%UP 1 NWW%($,$!%+&,46')#(&'6%$!,4% /3('#!((%$)%$!#0%$); % P!-0%'#%$&!%E,--,(1U$;%V)*$&M% )#2*!((%^@NB>_M%$&!% ]3#')*%[)-0%>&,46')#(&'6(%'(% .)3$&%/)7-'#2?(%!X3'",-!#$%)5%$&!% N36!*%B)7-;%<&!%@NB>%'(%$&!%#, 1 $')#,-%2)"!*#'#2%/)0.%)5%/)71 '#2%,(%*!+)2#'`!0%/.%$&!%@#'$!0% N$,$!(%D-.46'+%>)44'$$!!;% % W#)$&!*%3#7,"!*'#2M%($!,0 1 5,($%!55)*$%/.%N$!--'#2%$*,#(-,$ 1 !0%$)%+,6$3*'#2%^$'!0%5)*_%(!"!#$&% 6-,+!%,(%7!--%,(%#)$+&'#2%Q$&!% -,($%,+&'!"!4!#$%7&'+&%63$(%!" 1 !*.$&'#2%'#%6-,+!%,(%K%&!,0%)55% $)%+)46!$!%,$%$&!%+)--!2!%-!" 1 !-%,#0%,(%,%6*)5!((')#,-MT%N$!-1 $&*)32&)3$%$&!%!"!#$M%K%7,(%/)71 '#2%4.%/!($;%B3$%!(6!+',--.%03* 1 '#2%$&!%(!+)#0%&,-5%)5%$&!%!"!#$M% K%7,(%/)7-'#2%4.%/!($;%B)7-'#2% $&,$%7!--%)"!*%$&!%+)3*(!%)5%(3+&% ,%(3($,'#!0%,4)3#$%)5%2,4!(%,#0% 0'55!*!#$%5)*4,$(%'(%$&!%8'#0%)5%*!1 ,((3*,#+!%!"!*.%/)7-!*%'(%-))8'#2% 5)*%7&!#%!#0'#2%)#!%,#0%4)"'#2% $)%,#)$&!*%6)*$')#%)5%,%+,*!!*;T% % W%$)$,-%)5%IMOY9%/)7-!*(% +)46!$!0%'#%$&!%3#0!*1H:%,2!%0' 1 "'(')#%7'$&%N$!--'#2; % <&!%!"!#$%+)#('($(%)5%$7)% 2!#!*,-%+)46)#!#$(a*)3#0(M%I:1 6'#%,#0%,%0)3/-!1!-'4'#,$')#%,(% 7!--%,(%&!,01$)%&!,0%$)3*#,4!#$; /-)+8(%)5%I:16'#%'#%$&!%3#0!*1H:% ,2!%0'"'(')#;%W%$)$,-%)5%5)3*% 5)3*%/-)+8(;%<)$,-(%5*)4%$&!%6*! 1 "')3(%/-)+8%,*!%+,**'!0%$)%$&!% #!R$; ^)*%IZ%2,4!(1W0",#+!*(%b)3#0_M% #34/!*%)5%2,4!(%4,8'#2%36%$&!% W#)$&!*%+3$%$))8%6-,+!%,5$!*%$&!% W0",#+!*(%b)3#0_M%$)%ZO;%<&!#% /)7-!*(%6-,+'#2%36%$)%IZ$&%03* 1 '#2%$&!%-,($%/-)+8%^)*%HZ%2,4!(_% ,0",#+!0%$)%$&!%0)3/-!1!-'4'#, 1 $')#M%&!,01$)1&!,0%$)3*#,4!#$;% <&!%)3$+)4!(%)5%$&!%$)3*#,4!#$% ,*!%0!$!*4'#!0%/.%4)($%6'#(% 8#)+8!0%0)7#%)"!*%$&!%+)3*(!%)5% $7)%2,4!(; % QV'$&%!"!*.$&'#2%,+&'!"!0M% ,3$&)*'$.%7!*!%,-*!,0.%$&!*!MT% N$!--'#2%(,'0;%QP)7!"!*M%$&,$%-'$ 1 $-!%!R$*,%()4!$&'#2%+)4'#2%7'$&% 1 $')#%,#0%,3$&)*'$.%'#%$&!%/'22!($% )5%!"!#$(%,(%7!--%,(%$&!%-,($%2)1 ,*)3#0%'(%'44!,(3*,/-!%7&!#% 4)"'#2%$)%$&!%#!R$%-!"!-%)5%+)4 1 6!$'$')#;%G)$%)#-.%'44!,(3*,/-!% 5)*%4!%+)#$'#3'#2%$)%,+&'!"!M%/3$% 4,./!%!"!#%4)*!%()%5)*%$&!%5,'$&% +),+&%^<.-!*%N)(/._%&,0%7&!#% 4,8'#2%$&!%*!+*3'$'#2%0!+'(')#;% >,--'#2%36%+),+&%,#0%,##)3#+'#2% 6-,+'#2%(!"!#$&%7,(%"!*.%(,$'(5. 1 '#2;%<&!%!4)$')#,-%6)('$'"!%7,(% )"!*,--%(,$'(5,+$')#%$&)32&;T%%%% % V&'-!%$&!%!#0%*!(3-$%7,(% $&!%(,4!%'46*!(('"!%)"!**'0'#2% 5)*+!M%$&!%4!,#(%7!*!%()4!7&,$% 1 #!#$a*)3#0%)5%$&!%!"!#$M%($!,0.% ,#0%($!,05,($%4!,#$%&)7%N$!--'#2% 4)"!0%'#$)%+&,46')#(&'6%+)# 1 $!#$')#;%@(3,--.M%$&!%#,4!%N$!-1 '#2%'(%,4)#2%$&!%$)6%)5%$&!%($,#0 1 '#2(%5*)4%$&!%/!2'##'#2;%% % N$!--'#2%&,0%43($!*!0%,#%," 1 !*,2!%)5%IYY;H9%6'#(%$)$,-%,#0% 2,4!(;%E!(6'$!%$&!%,"!*,2!%0*)6 1 6'#2%$)%IYZ;9:%,5$!*%!'2&$%2,4!(M% &!%*)(!%$)%I\J$&%6-,+!%'#%$&!% ($,#0'#2(%,(%$&!%!#03*,#+!%5,+ 1 $)*%8'+8!0%'#;%<&!#%,-4)($%&,-5% &!-0%7,(%YY$&%,#0%$&!%,"!*,2!% 7,(%H::;J9%,5$!*%IH%2,4!(;%<&!% 4)($%",-3,/-!%*'(!%+,4!%03*'#2% $&!%5)3*$&%/-)+8%^IZ%2,4!(_%,(% N$!--'#2%63$%&'4(!-5%(X3,*!-.%'#% $&!%4'R%5)*%,0",#+'#2%7'$&%,#%," 1 !*,2!%)5%HHO;%W$%$&,$%6)'#$%,(%7!--% ,"!*,2!%&,0%/!!#%366!0%$)%H:Z;9Z% ,#0%$&!%6-,+!%7,(%HY$&;%N$!--'#2?(% 1 !*,2!%)5%HHZ%7,(%+)46'-!0%,#0% '#%II$&%6-,+!%7,(%(X3,*!-.%6)(' 1 $')#!0%$)%+)#$'#3!%,0",#+'#2;% 1 6)#!#$a*)3#0%7!*!%I9$&%6-,+!%,#0% ,#%,"!*,2!%)5%H:\;%<&!%4,*2'#% /!$7!!#%N$!--'#2%,#0%IJ$&%6-,+!% % W%H1H%*!+)*0%7,(%+)46'-!0 1 /.%N$!--'#2%03*'#2%$&!%$)3*#, 1 4!#$;%c'+$)*'!(%+,4!%)"!*%]3($'#% D?N&,32&#!((.%^>,#$)#M%L'+&;_% ,#0%>)*$!`%N+&!#8%^F&)!#'RM% 1 &,4M%V,;_%!#0!0%$&!%*3#;%<&!% )$&!*%-)((%7,(%$)%B*.+!%D-'"!*% ^>3.,&)2,M%U,--(M%D&;_;%% % Q<)%/!%&)#!($M%K%7,(#?$%#!,* 1 -.%,(%+)#('($!#$%,(%'#%$&!%6,($%,#0% +,6,/-!%)5%/,(!0%)#%$&!%6,($%03* 1 Q<&!%(+)*!(%7!*!%)/"')3(-.%#)$% 36%$)%6,*M%/3$%K%7,(%0)'#2%($355%)3$% )5%+&,*,+$!*;%C"!*.%/-)+8%K%&,0% $&,$%)#!%/,0%2,4!%63$$'#2%4!%/! 1 &'#0%$&!%!'2&$%/,--%)*%,--)7!0%$&!% )$&!*(%$)%+,$+&%36;%V&!#%/)71 '#2%()%4,#.%2,4!(M%!"!#%$&!%/!($% /)7-!*(%&,"!%,%/,0%(+)*!%)*%$7);% % Q<&!%!R6!*'!#+!%)5%+)4 1 6!$'#2%'#%()%4,#.%/'2%4!!$(%,#0% #!!0'#2%$)%4,8!%/'2%$&*)7(%7,(% $&!%0'55!*!#+!%/!$7!!#%4!%+)4 1 '#2%/,+8%7'$&%,%&'2&%(+)*!%,#0% ()4!%)5%$&!%)$&!*(%#)$;%<&!*!% 7,(#?$%5*3($*,$')#%)*%07!--'#2%)#% $&!%/,0%2,4!;%K#($!,0M%K%$&)32&$% )5%$&!%/,0%2,4!%,(%$&!%!R+!6 1 $')#%6*)"'#2%$&!%#)*4;%G)*%7,(% $&!%$&)32&$%=3($%/)7-'#2%36%$)% 4.%6*!"')3(%6,*%03*'#2%$&!%#!R$% 2,4!;%<&!*!%7,(%*))4%,#0%,#% )66)*$3#'$.%$)%(+)*!%!"!#%&'2&!*% $&,#%$&!%#)*4%'5%*!"'!7'#2%7&,$% 7,(%0)#!%7*)#2%,#0%$&!#%,66-. 1 '#2%$&!%+)**!+$')#;%L,*8'#2%)#% ,$$,'#!0%!"!*.%$'4!%,(%$&!%'46!$3(% 5)*%!R!+3$'#2%$&!%$&)32&$%6*)+!((;% U'#0'#2%$&,$%5)*4%,(%X3'+8%,(%6)( 1 ('/-!%$,8!(%,7,.%$&!%,4)3#$%)5% $'4!%$)%07!--;T% % B.%4!,#(%)5%,%6!*5!+$%*!+)*0% ,#0%#'#$&%(!!0%03*'#2%$&!%$)3* 1 #,4!#$M%W#$&)#.%G!3!*%^A!7 1 '(/3*2M%F,;_%+-,'4!0%$&!%H:I\% +&,46')#(&'6;%L3--'#%5!--%'#%$&!% % A,($%.!,*M%7&,$%,66!,*!0%$)% /!%)#-.%$&!%5)*4,-'$.%)5%+)46-!$ 1 '#2%$&!%U'#,-%W0",#+!*(%b)3#0% ($,#0'#2%'#%$&!%7,.%)5%,0",#+'#2% $)%$&!%$)3*#,4!#$%,#0%+&,46')# 1 (&'6%+)#$!#$')#%7,(%0!*,'-!0%/.%,% -!2%'#=3*.;%W5$!*%$&!%'#=3*.M%N$!-1 '#2%0*)66!0%)3$%)5%$&!%$)61I:;%% % N$!--'#2%7'--%+)46!$!%,(%,% 1 !*%$&'(%4)#$&%,$%B),*07,-8%B)7-% ^-)+,$!0%'#%D*-,#0)%)#%>)-)#',-% E*'"!%/!$7!!#%[)-0!#*)0%,#0% E!,#%*),0(_%3#0!*%$&!%B)7-%U-)* 1 '0,%/,##!*;%D#+!%$3*#'#2%6*)5!( 1 (')#,-M%,%/)7-!*%2'"!(%36%!-'2'/'1 '$.%5)*%]3#')*%[)-0%,#0%+,#%)#-.% +)46!$!%'#%$&!%)"!*1H:%.!,*(a ,03-$%0'"'(')#;%% % Q<&!%/!($%7,(%4,0!%)5%$&'(% .!,*?(%$)3*#,4!#$MT%N$!--'#2% (,'0;%QE!(6'$!%()4!%($*!$+&!(%)5% $&!%6-,.%0'66'#2%'#%X3,-'$.M%$&!*!% 7,(#?$%,#.$&'#2%-!5$%)#%$&!%$,/-!% 7&!#%-))8'#2%,$%$&!%$)$,-'$.%)5%$&!% !"!#$;%P)7%4,#.%/)7-!*(%,+*)((% $&!%+)3#$*.%+,#%(,.M%K%7,(%,4)#2% $&!%(!"!#%/!($d%W2,'#M%6-,+'#2% (!"!#$&%'(%"!*.M%"!*.M%(,$'(5.'#2% ,#0%,-4)($%,(%+)46-!$!%,%7,.%$)% -!,"!%$&!%&'2&%(+&))-a.)3$&%-!"!-% ,(%6)(('/-!;% 1 #!((%&,(%/!!#%$,8!#%+,*!%)5M%4)" 1 '#2%)#$)%+)--!2!%,#0%6*)5!((')#,-% +)46!$'$')#%'(%/!'#2%-))8!0%5)* 1 7,*0%$);T %&'&()$<'9:#=$&:)>#0$0#?#@1"$+@$@)1+'@):$1'.=@)A#@1 Gage Stelling nished in seventh place in a national bowling tournament. He helped guide the Apopka Blue Darters boys bowling team. He's now in college. % Would You Like Extra Copies? You may purchase The Apopka Chief at the following locations in and around Apopka Office Location: 400 N. Park Avenue, Apopka Subscribe Online at www.TheApopkaChief.com

PAGE 25

The Apopka Chief August 3, 2018 The most impor tant mission of Navy Re gion Hawaii is coordinat ing the Navys local sup This support involves port and housekeeping servic es for 11 surface warships and 18 submarines home ported in Joint Base Pearl Harbor-Hickam (JBPHH) and over 60 Navy shore These services extend as well as many ships of friendly allied navies that rely on support when they such as the Rim of the Pa for more than 75 ships is coordinated by COMNA VREG in a team effort Naval Station Pearl Harbor and Hickam Air Force Base Joint Base Pearl Har bor-Hickam was creat the former Naval Sta tion Pearl Harbor joined Realignment and Closure Commission report to the president required the re location of installation management functions and the establishment of JBPHH with Navy as the lead agency in provid ing these functions to the Military service ployees and contractors work together to achieve common goals using simi The establishment of JBPHH brings togeth er the best practices of ciencies in providing en hanced support of opera an appreciation for the rich history of Hickam JBPHH supports its part mands and mission readi ness of the Navy and the The offerings of Hickams 15th Services Squadron and Navy Re gion Hawaiis Morale have transitioned and op ily Readiness Center and Navy Regions Military have united to become the Joint POW/MIA Ac counting Command Accounting Command recovery and laboratory operations to identify un accounted-for Americans The command is on the island of Oahu and was Employing more than 500 joint military and civilian ues its search for the more still unaccounted for from ferred to as the Central diverse forensic skeletal The command main tains three permanent de tachments to assist with logistics and in-country support during investiga tion and recovery opera The core of JPs day-to-day operations in volves researching case excavating sites and iden tifying Americans who were killed in action but This process involves close coordination with propriate Service Casu Life Sciences Equipment www.himilitary.com/ info Department POWs/ MIAs Accounting Agen cy (DPAA) Laboratory ry is the largest and most cation laboratory in the world and is staffed by second federal laboratory to pass the American So ciety of Crime Laborato ternational Standards Pro laboratory accredited by In the Field Recovery teams ology methods in the ex cavation as directed by the on-site anthropolo referred to as the recovery tion much like a detective Each mission is tain processes each recov ard recovery missions last on the location and recov Recovery sites can be as small as a few meters for individual burials to ar eas exceeding the size of the site or determine the perimeter has been de establishes a grid system and sections the site with section is then excavated Every inch of soil that comes out of the site is screened for any poten equipment or material ev the environment or soil is washed through wire mesh with high-pressure and the material is then brought back to the lab for In the Laboratory Upon arrival at the tifacts recovered from a site are signed over to an evidence coordinator and rensic anthropologists are responsible for the analy sis of human remains and The forensic anthropologist assigned the case in the laboratory is not the individual who completed This entire procedure is meaning the anthropol ogist does not know the suspected identity of the tails that are required to select the appropriate sci approximate area of the analysis is completed in order to prevent bias from skeletal remains are ex amined in order to pro duce a biological pro may also analyze trauma caused at or near the time of death and pathological conditions of bone such as arthritis or previously Scientists use a va riety of techniques to es of unaccounted-for indi ysis of skeletal remains and sampling mitochon personal effects and life agency medical examiner evaluates these overlap ping lines of evidence in an effort to identify the re Forensic Odontology extremely important to records are often the best way to identify remains as they have unique indi vidual characteristics and may contain surviving which is passed from men receive mitochondri the agencys forensic od ontologists will have an temortem (before death) X-rays to use for compari charts and treatment notes can be critical to the re DNA in about three-quarters of from bones and teeth are analyzed at the Armed they extract and ampli to determine the genetic This sequence is compared with sequenc es from family reference samples provided by liv ing individuals who are maternally related to ence samples are collect ed as needed by the cas of the same maternal line unique within the gener stand alone as evidence factors previously men of evidence must be ex amined at the lab and cor related with all historical dergo a thorough peer re view process that includes an external review by in www.dpaa.mil/Re sources/Fact-Sheets DNA to X-ray: Military has variety of tools to ID remains mains released by North sent to a military lab in ter a system that routine bers from decades-old pend on combining multi they can take time: Even even scraps of clothing can be traced to the ma Teeth can be matched Bones can be used to esti tinctive shape of a clavi cle bone can be matched to records of X-rays tak en decades ago to look for Tiny samples of bone the amount of bone in the Each sample is sand ed to remove surface con consistency of baby pow a substance that dissolves the bone and leaves the with genetic samples from living people who are re lated to the missing per The military has been family members since bers who were listed as missing at the end of the between the known rela belong to a particular lin By analyzing differ entists can look for mark ers passed down by gen lab once linked remains to a great-great-great-greatgrandniece who initially had no idea she was relat ed to the missing service the lab estimates how strongly it suggests the remains belong to a par the results back to Ha with the other lines of evi in a wheel to make the service members from the overall in that time peri The agency identi How long does it take? might be done in just three remains recovered from North Korea from 1990 remains turned over by North Korea have stirred Curran has no mem over Korea and captured decades working to give attended scores of meet ings for families of those missing in action in Ko force in the late 1990s in getting several of her fam ily members including cle and cousins to join ples to the military in an effort to identify her fa Will their long wait now come to an end? voice breaking with emo it can still hurt not to have Joint Base Pearl Harbor-Hickam (JBPHH) is a home for recovery lab At Joint Base Pearl Harbor-Hickam, Hawaii, July 20, 2018. Air Force Staff Sgt. Sedric Franklin, as signed to the Defense POW/MIA Accounting Agency, conducts an honorable carry for the re mains of an unidentied U.S. service member lost in the Korean War. Photo by: Petty Ofcer 1st Class Amara Timberlake

PAGE 26

The Apopka Chief, August 3, 2018 Page 2D IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-2164 IN RE: ESTATE OF MUOI VAN NGUYEN Deceased. NOTICE TO CREDITORS (Summary Administration) TO ALL PERSONS HAVING CLAIMS OR DEMANDS AGAINST THE ABOVE ESTATE: Name Address ALL INTERESTED PERAND DEMANDS NOT SO ING ANY OTHER APPLIAttorney East Robinson Street August 3 and 10, 2018 161014 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA007582-O DIV NO.: 37 MARRIOTT OWNERSHIP RESORTS, INC. Plaintiff, vs. BRIAN EUGENE ORWIG, et al., Defendants. NOTICE OF ACTION BY PUBLICATION AS TO COUNT III DANT WHOSE RESIDENCE IS TO: TRUDY S. WILLIAMS, DECEASED, THE ESTATE OF TRUDY S. WILLIAMS, DECEASED, AND ANY UNKNOWN SPOUSES, HEIRS, DEVISEES, GRANTEES, ASSIGNEES, LIENORS, CREDITORS, TRUSTEES OR OTHER CLAIMANTS BY AND THROUGH, UNDER OR AGAINST, SAID DEFENDANT, 4508 6TH PLACE NORTHEAST WASHINGTON, DC 20017 YOU ARE HEREBY NOTIFIED MARRIOTT OWNERSHIP COUNT III 4 Interests numbered for administrative purposes: C70134 & C70135 & C70136 & C70137 in the MVC Trust "Trust") evidenced for administrative, assessment and ownership purposes by 1000 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 1082-0300-00, a.k.a MVC Trust, Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida as such agreement may be amended and supplemented from time to time "Trust Agreement", a memorandum of which is recorded in Official Records Book 10015, page 4176, Public Records of Orange County, Florida "Trust Memorandum". The Interests shall have a Use Year Commencement Date of January 1, 2014 (subject to Section 3.5 of the Trust Agreement). thirty (30) days from herein If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact Court Administration at 425 North Orange Avenue, Suite 2130, Orlando, Florida 32801, telephone (407) 8362303 within two (2) working days of your receipt of this document. If hearing or voice impaired, call 1-800955-8771. THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Publish: The Apopka Chief August 3 and 10, 2018 161015 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA007582-O DIV NO.: 37 MARRIOTT OWNERSHIP RESORTS, INC. Plaintiff, vs. BRIAN EUGENE ORWIG, et al., Defendants. NOTICE OF ACTION BY PUBLICATION AS TO COUNT(s) IV DANT WHOSE RESIDENCE IS TO: SONJA P. DEBREW, DECEASED, THE ESTATE OF SONJA P. DEBREW, DECEASED AND ANY UNKNOWN SPOUSES, HEIRS, DEVISEES, GRANTEES, ASSIGNEES, LIENORS, CREDITORS, TRUSTEES OR OTHER CLAIMANTS BY AND THROUGH, UNDER OR AGAINST, SAID DEFENDANT 2709 KEITH STREET TEMPLE HILLS, MD 20748 YOU ARE HEREBY NOTIFIED MARRIOTT OWNERSHIP COUNT IV 6 Interests (numbered for administrative purposes: P58144 & P58145 & P58146 & P58147 & P58148 & P58149 ) in the MVC Trust "Trust" evidenced for administrative, assessment and ownership purposes by 1500 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 1082-0300-00, a.k.a MVC Trust, Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida as such agreement may be amended and supplemented from time to time "Trust Agreement", a memorandum of which is recorded in Official Records Book 10015, page 4176, Public Records of Orange County, Florida "Trust Memorandum". The Interests shall have a Use Year Commencement Date of February 1, 2017 (subject to Section 3.5 of the Trust Agreement). thirty (30) days from herein If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact Court Administration at 425 North Orange Avenue, Suite 2130, Orlando, Florida 32801, telephone (407) 8362303 within two (2) working days of your receipt of this document. If hearing or voice impaired, call 1-800955-8771. THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Publish: The Apopka Chief August 3 and 10, 2018 161016 IN THE CIRCUIT COURT OF THE 9th JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA002707-O M&T BANK, Plaintiff, vs. ANGEL PRUSINOWSKI, INDIVIDUALLY AND AS TRUSTEE OF THE JONATHAN P. FRANCUM AND ANGEL PRUSINOWSKI REVOCABLE TRUST DATED MAY 7, 2010, JONATHAN P FRANCUM, INDIVIDUALLY AND AS TRUSTEE OF THE JONATHAN P. FRANCUM AND ANGEL PRUSINOWSKI REVOCABLE TRUST DATED MAY 7, 2010, ARBOR RIDGE HOMEOWNERS' ASSOCIATION OF APOPKA, INC., ARBOR RIDGE COMMUNITY ASSOCIATION, INC., Defendants. NOTICE OF FORECLOSURE SALE NOTICE IS HEREBY GIVORANGE LOT 377 OF ARBOR RIDGE PHASE 3, ACCORDING TO THE PLAT THEREOF AS RECORDED IN PLAT BOOK 68, PAGES 146 THROUGH 149, OF THE PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact Property of: Florida Association of Legal Support Specialists, Inc. the ADA Coordinator, Human Resources, Orange County Courthouse, 425 N. Orange Avenue, Suite 510, Orlando, Florida, (407) 836-2303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. ANY PERSON CLAIMING AN OTHER THAN THE PROPTHE CLERK SHALL RECEIVE TITLE THAT SHALL BE ASPublish: The Apopka Chief August 3 and 10, 2018 161017 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2017-CA007603 -O FEDERAL NATIONAL MORTGAGE ASSOCIATION ("FANNIE MAE", A CORPORATION ORGANIZED AND EXISTING UNDER THE LAWS OF THE UNITED STATES OF AMERICA, Plaintiff, vs. ROBYN A. OIGARDEN; UNKNOWN SPOUSE OF ROBYN A. OIGARDEN; FLORIDA HOUSING FINANCE CORPORATION; UNKNOWN TENANT(S) IN POSSESSION #1 and #2, and ALL OTHER UNKNOWN PARTIES, et.al., Defendant(s). NOTICE OF FORECLOSURE SALE NOTICE IS HEREBY GIVEN ORGANIZED AND EXISTING LOT 6, BLOCK G, ASBURY PARK. 3126/1659, ACCORDING TO PLAT THEREOF RECORDED IN PLAT BOOK W, PAGE 6, PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA. Publish: The Apopka Chief August 3 and 10, 2018 161018 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002178-O IN RE: ESTATE OF SHERRY BENNETT PYLE deceased NOTICE TO CREDITORS SHERRY BENNETT PYLE ALL OTHER CREDITORS HAVING CLAIMS OR DEMANDS AGAINST DECETHEIR CLAIMS WITH THE Petitioner Publish: The Apopka Chief August 3 and 10, 2018 161019 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA5156-O DIVISION NUMBER : 35 IN RE: FORFEITURE OF $25,700.00 IN U.S. CURRENCY NOTICE OF ACTION TO: JUAN SUAREZ PUPO that REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. DATED August 3, 10, 17 and 24, 2018 160996 IN THE CIRCUIT COURT OF THE 9TH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA. CASE No.: 2018-CA004757-O DEUTSCHE BANK NATIONAL TRUST COMPANY, AS TRUSTEE FOR ARGENT SECURITIES INC., ASSETBACKED PASS-THROUGH CERTIFICATES, SERIES 2004-W10, Plaintiff, vs. GLENN WELZ A/K/A GLENN DAVID WELZ; LEITHA WELZ; WATERMILL HOMEOWNERS' ASSOCIATION, INC.; FLORIDA HOUSING FINANCE CORPORATION; UNKNOWN TENANT #1; UNKNOWN TENANT #2; Defendants. AMENDED NOTICE OF ACTION TO: GLENN WELZ A/K/A GLENN DAVID WELZ LEITHA WELZ LOT 411, WATERMILL, SECTION FOUR, ACCORDING TO THE PLAT THEREOF, AS RECORDED IN PLAT BOOK 17, PAGE 97 AND 98 OF THE PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA 4425 Lipton Ct., Orlando, FL 32817 Reguests for Accommodations by Persons with Disabilities. If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. You should contact Court Administration at 425 North Orange Avenue, Suite 2130, Orlando, Florida 32801, telephone 407 836-2303 at least 7 days before your scheduled court appearance, or immediately upon receiving before the scheduled appearance is less than 7 days and if you are hearing or voice impaired, call 711. August 3 and 10, 2018 160998 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002219-O IN RE: ESTATE OF BONNIE L. CHANDLER Deceased. NOTICE TO CREDITORS P R the P R A ON WITHIN THREE MONTHS WITHIN THE TIME PERINOTWITHSTANDING THE Personal Representative: SHARI J. RAHMLOW Attorney for Personal Representative John J. Crone III, Esq. N o August 3 and 10, 2018 160999 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001854-O Division IN RE: ESTATE OF JOSEPH P. COTRONEO, JR. Deceased. NOTICE TO CREDITORS A WITHIN WITHIN THE TIME PERINOTWITHSTANDING THE TIME PERIODS SET Attorney M August 3 and 10, 2018 161036 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002390-O IN RE: ESTATE OF WILLIAM RAYMOND RYAN, JR., Deceased. NOTICE TO CREDITORS WITHIN THE TIME PERINOTWITHSTANDING THE Publish: The Apopka Chief August 3 and 10, 2018 161026 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001959-O IN RE: ESTATE OF GERTRUDE H. WINTON, Deceased. NOTICE TO CREDITORS WITHIN THE TIME PERINOTWITHSTANDING THE TIME PERIODS SET August 3 and 10, 2018 161032 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION FILE NO. 2018-CP-002368-O IN RE: ESTATE OF ELIZABETH F. WOOD, Deceased. NOTICE TO CREDITORS TO ALL PERSONS HAVING CLAIMS OR DEMANDS AGAINST THE ABOVE ESTATE: ALL INTERESTED PERSONS ARE NOTIFIED THAT: THE this Court WITHIN THREE ALL CLAIMS AND DEMANDS NOT SO FILED WILL BE FOREVER BARRED. August 3 and 10, 2018 161033 IN THE CIRCUIT COURT, NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018CP2348A IN RE: ESTATE OF BERT E. MERCIER, Decedent. NOTICE TO CREDITORS E D D E N ON OR D eD E C ourt WITHIN THE TIME PERINOTWITHSTANDING THE N Petitioner: N August 3 and 10, 2018 161007 TRL TOWING 605 FERGUSON DR., ORLANDO, FL 32805 407-207-4790 FAX 407-578-3052 NOTICE OF PUBLIC SALE: TRL TOWING TRL TOWING August 3, 2018 161042 TRL TOWING 605 FERGUSON DR., ORLANDO, FL 32805 407-207-4790 FAX 407-578-3052 NOTICE OF PUBLIC SALE: TRL TOWING TRL TOWING August 3, 2018 161043 PUBLIC NOTICESThe Apopka Chief Ph: 407-886-2777 Fax: 407-889-4121LEGALS CAN BE FOUND ON PAGES2D 6Donline at theapopkachief.com

PAGE 27

The Apopka Chief, August 3, 2018 Page 3D The Apopka Chief IN THE CIRCUIT COURT OF THE 9TH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA Case No.: 2018-DR-717-O Division: ___ Yessenia Lopez, Petitioner and Fernando Rosario Diaz, Respondent. AMENDED NOTICE OF ACTION FOR DISSOLUTION OF MARRIAGE If you fail to do so, a default may be entered against you for the relief demanded in the petition. Copies of all court documents in this case, including orders, are available at the Clerk of the Circuit view these documents upon request. You must keep the Clerk of O nation of Current Mailing and E-Mail Address, Florida Supreme Court Approved Family Law Form 12.915.) Future papers in this lawsuit will be mailed or e-mailed to the addresses on record at WARNING: Rule 12.285, Florida Family Law Rules of Procedure, requires certain automatic disclosure of documents and information. Failure to comply can result in sanctions, including dismissal or striking of pleadings. August 3, 10, 17 and 24, 2018 161000 NOTICE OF PUBLIC SALE P ACE TRANSPORTATIONS SYSTEMS LLC DBA Ace Wrecker 5601 South Orange Blossom Trail Orlando, FL 32839 05 FORD ID# 1FAHP28135G194762 01 HONDA ID# 1HGES26761L073729 05 HONDA ID# 1HGCM66595A054830 09 HONDA ID# JH2RD06019K701755 94 HONDA ID# 1HGEJ1125RL027734 04 KIA ID# KNAGD126145304065 99 MITSUBISHI ID# 4A3AX35G8XE079905 01 NISSAN ID# JN1CA31D01T811409 04 PONTIAC ID# 2G2WP522941144436 03 TOYOTA ID# 4T1BE32K43U710344 15 YIBEN ID# LYDY31BBXF1502403 August 3, 2018 161001 NOTICE OF SALE PURSUANT TO F.S. 713.78 FOR SALE VICE, YEAR MAKE VIN NUMBER August 3, 2018 161002 NOTICE OF SALE PURSUANT TO F.S. 713.78 FOR SALE VICE, YEAR MAKE VIN NUMBER August 3, 2018 161003 NOTICE OF PUBLIC SALE Towtruck Co., 2004 FORD 1FAFP33PX4W146561 2000 CHRYSLER 2C3HE66G6YH184593 August 3, 2018 161004 NOTICE OF PUBLIC SALE Towtruck Co., 2018 NISSAN 1N4AL3AP3JC176670 August 3, 2018 161005 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES Heathwick Medical Clinic August 3, 2018 161006 NOTICE OF PUBLIC SALE BARTLETT TOWING 1HGEM22522L075915 2002 HONDA CIVIC LX WBA3A5C55EF604692 2014 BMW328I August 3, 2018 161009 NOTICE OF PUBLIC SALE BARTLETT TOWING 5Y4AH06Y46A062005 2006 YAMAHA YFM400FW 2G1FP22K5X2108891 1999 CHEVROLET CAMARO August 3, 2018 161010 340 FAIRLANE AVENUE ORLANDO, FL 32809 TEL: (407)-851-3953 NOTICE OF PUBLIC SALE YEAR MAKE VEHICLE ID. NUMBER August 3, 2018 161011 340 FAIRLANE AVENUE ORLANDO, FL 32809 TEL: (407)-851-3953 NOTICE OF PUBLIC SALE YEAR MAKE VEHICLE ID. NUMBER August 3, 2018 161012 NOTICE OF PUBLIC SALE CASSELBERRY TOWING INC. WVWVD63B41E310800 2001 VOLKSWAGEN August 3, 2018 161013 NOTICE OF PUBLIC SALE OHN2016 CHEVROLET 2015 HONDA 2002 SATURN 2014 TOYOTA 2009 ACURA 2014 TOYOTA August 3, 2018 161027 NOTICE OF PUBLIC SALE WRECKER SERVICE, INC., YEAR MAKE VIN# August 3, 2018 161028 POWER TOWING SERVICES, INC. 440 METCALF AVE ORLANDO, FL 32811 TEL: 407-948-2338 TEL: 407-948-2283 FAX: 407-948-9498 NOTICE OF SALE OF MOTOR VEHICLE PURSUANT TO F.S. 713.78 (5) DATE OF SALE: 2003 ACURA TL BLACK 4D 2006 VOLK Touareg GRAY 4D SUV V8 August 3, 2018 161029 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES Hagerty JROTC Booster Club August 3, 2018 161025 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002314-O Division 1 IN RE: ESTATE OF FREDRICK BERNARD MURPHY Deceased. NOTICE TO CREDITORS ORANGE Publish: The Apopka Chief August 3 and 10, 2018 161037 IN THE CIRCUIT COURT OF THE 9TH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA Case No. 2018-CA007213-O STEVE OBRIEN, Plaintiff, vs. THE UNKNOWN SPOUSE, HEIRS, DEVISEES, GRANTEES, ASSIGNEES, LIENORS, CREDITORS, TRUSTEES, AND ALL OTHER PARTIES CLAIMING AN INTEREST BY, THROUGH, UNDER, OR AGAINST KATHERINE S. COLEMAN A/K/A KATHERINE SHERMAN COLEMAN; et al Defendants. NOTICE OF ACTION TO: BEGIN 165 FEET EAST OF THE NW CORNER OF THE SW 1/4 OF THE SW 1/4 OF THE SW 1/4, RUN SOUTH 335 FEET, EAST 169 FEET, NORTH 335 FEET, WEST 169 FEET TO BEGINNING, GAINES SUBDIVISION, AS RECORDED IN PLAT BOOK C, PAGE 65, PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA. the Property) Parcel Number: 16-20-27-2912-00-049 Pursuant to the Fair Debt Collection Practices Act, it is required that we state the following to you: THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. If you are a person with a disability who needs any accommodation in order to participate in a court proceeding or event, you are entitled, at no cost to you, to the provision of certain assistance. Please contact: ADA Coordinator, Human Resources, Orange County Courthouse, 425 N. Orange Avenue, Suite 510, Orlando, Florida, 407) 836-2303, fax: 407-836-2204; at least 7 days before your scheduled court appearance, or immediately upon receiving notification if the time before the scheduled court appearance is less than 7 days. If you are hearing or voice impaired, call 711 to reach the Telecommunications Relay Service. August 3 and 10, 2018 161038 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES La Voz August 3, 2018 161021 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES TRAVELJOLLY Prime August 3, 2018 161022 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES TJ Prime August 3, 2018 161023 NOTICE OF PUBLIC SALE BARTLETT TOWING 1GKDM19W8YB526917 2000 GMC SAFARI JN8AZ08T17W526822 2007 NISSAN MURANO SE/SL/S August 3, 2018 161024 NOTICE OF PUBLIC SALE Towtruck Co., 2000 HONDA 1HGCG1652YA062914 August 3, 2018 161030 NOTICE OF PUBLIC SALE Towtruck Co., 2015 INFINITI JN1CV6AP3FM501935 August 3, 2018 161031 NOTICE OF AGENCY ACTION TAKEN BY THE ST. JOHNS RIVER WATER MANAGEMENT DISTRICT Failure to uisite time frame shall constitute a waiver of the right to an administrative hearing. (Rule 28-106.111, F.A.C.). August 3, 2018 161008 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA4614-O DIVISION NUMBER : 34 IN RE: FORFEITURE OF $2,643.00 IN U.S. CURRENCY NOTICE OF ACTION TO: DOMINIC BOLDEN REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. July 13, 20, 27 and August 3, 2018 160826 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA3605-O DIVISION NUMBER : 33 IN RE: FORFEITURE OF $2,267.00 IN U.S. CURRENCY NOTICE OF ACTION TO: RENARDO C. JURINEACK REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. July 13, 20, 27 and August 3, 2018 160827 NOTICE OF PUBLIC SALE YEAR MAKE VIN# 2014 MAZDA JM1BM1L37E1211044 2015 NISSAN 1N4AL3APXFC275137 2015 CHRYSLER 1C3CCCAB0FN574717 2000 HONDA 1HGCG2250YA017952 2008 FORD 1FAHP35N38W183607 2006 MAZDA JM1BK12G261467572 2010 DODGE 1B3CC4FB5AN155041 August 3, 2018 161040 NOTICE OF PUBLIC SALE YEAR MAKE VIN# 1991 HONDA 1HGCB9868MA003671 1998 HONDA 1HGCG5647WA140812 2000 CHEVROLET 1GCCS1457YK229682 1995 TOYOTA 4T1SK12E0SU580732 1999 FORD 1FTYR10V0XPB68071 1984 PORSCHE WP0JB092XES860549 August 3, 2018 161041

PAGE 28

Get Your E-edition Now! Special rate! Phone: 407-886-2777 Call or Visit www.TheApopkaChief.com Read page by page. Anytime, anywhere & on any device. The Apopka Chief, August 3, 2018 Page 4D The Apopka Chief, February 16, 2018, Page 4D The Apopka Chief LEGAL ADVERTISING legal publication on pages 2D-6D IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2017-CA005773-O DIV NO.: 37 MARRIOTT OWNERSHIP RESORTS, INC. Plaintiff, vs. LYNDA J. EAST, et. al., Defendants. NOTICE OF SALE AS TO COUNT V TO: KELLI BUDD, NOT INDIVIDUALLY, BUT AS PERSONAL REPRESENTATIVE OF THE ESTATE OF STEPHEN E. BUDD C/O RICHARD A. DEWITT, ESQ., CROKER, HUCK, KASHER, DEWITT, ANDERSON & GONDERINGER, LLC 2120 SOUTH 72ND STREET, SUITE 1200 OMAHA, NE 68124 NOTICE IS HEREBY GIVEN COUNT V 14 Interests numbered for administrative purposes: H25624 & H25625 & H25626 & H25627 & H25628 & H25629 & H25630 & H25631 & H25632 & H25633 & H25634 & H25635 & H25636 & H25637 ) in the MVC Trust "Trust" evidenced for administrative, assessment and ownership purposes by 3500 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 1082-0300-00, a.k.a MVC Trust, Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida as such agreement may be amended and supplemented from time to time "Trust Agreement", a memorandum of which is recorded in Official Records Book 10015, page 4176, Public Records of Orange County, Florida "Trust Memorandum". The Interests shall have a Use Year Commencement Date of December 1, 2015 (subject to Section 3.5 of the Trust Agreement). 11:00am, If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact the ADA Coordinator, Human Resources, Orange County, Courthouse, 425 N. Orange Avenue, Suite #510, Orlando, Florida (407) 8362303, at least 7 days before your scheduled court appearance, or immediately upon the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. Publish: The Apopka Chief July 27 and August 3, 2018 160922 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2017-CA007872-O DIV NO.: 35 MARRIOTT OWNERSHIP RESORTS, INC. Plaintiff, vs. SAUL ODILON COSME PEREZ, et. al., Defendants. NOTICE OF SALE AS TO COUNT II TO: KELLI BUDD, NOT INDIVIDUALLY, BUT AS PERSONAL REPRESENTATIVE OF THE ESTATE OF STEPHEN E. BUDD C/O RICHARD A. DEWITT, ESQ., CROKER, HUCK, KASHER, DEWITT, ANDERSON & GONDERINGER, LLC 210 SOUTH 72ND STREET, SUITE 1200 OMAHA, NE 68124 NOTICE IS HEREBY GIVEN COUNT II 20 Interests numbered for administrative purposes: G53404 & G53405 & G53406 & G53407 & G53408 & G53409 & G53410 & G53411 & G53412 & G53413 & G53414 & G53415 & G53416 & G53417 & G53418 & G53419 & G53420 & G53421 & G53422 & G53423 in the MVC Trust "Trust") evidenced for administrative, assessment and ownership purposes by 5000 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 1082-0300-00, a.k.a MVC Trust, Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida as such agreement may be amended and supplemented from time to time "Trust Agreement", a memorandum of which is recorded in Official Records Book 10015, page 4176, Public Records of Orange County, Florida "Trust Memorandum". The Interests shall have a Use Year Commencement Date of December 1, 2014 (subject to Section 3.5 of the Trust Agreement). 11:00am, If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact the ADA Coordinator, Human Resources, Orange County, Courthouse, 425 N. Orange Avenue, Suite #510, Orlando, Florida (407) 8362303, at least 7 days before your scheduled court appearance, or immediately upon the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. Publish: The Apopka Chief July 27 and August 3, 2018 160923 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002079-O Division Probate IN RE: ESTATE OF JOSEPH J. PASSALACQUA a/k/a JOSEPH J. PACY Deceased. NOTICE TO CREDITORS N DeLoach, P.L. July 27 and August 3, 2018 160924 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001340-0 IN RE: ESTATE OF KENNETH J. PARTRIDGE a/k/a KENNETH JOHN PARTRIDGE Deceased. NOTICE TO CREDITORS 02777 Publish: The Apopka Chief July 27 and August 3, 2018 160945 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA5205-O DIVISION NUMBER : 40 IN RE: FORFEITURE OF $4,242.00 IN U.S. CURRENCY NOTICE OF ACTION TO: HENRY GONZALEZMATOS REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. July 27, August 3, 10 and 17, 2018 160946 IN THE COUNTY COURT, IN THE TENTH JUDICIAL CIRCUIT, IN AND FOR POLK COUNTY, FLORIDA CASE NO.: 53-2006SC005229-0000-00 HUDSON & KEYSE, LLC, as assignee of CHASE MANHATTAN BANK USA, N.A. PLAINTIFF, vs. STEVEN J. PENTON, an Individual, DEFENDANT(S) NOTICE OF SOLD AS IS AND WITH NO WARRANTY. SOLD SUBJECT TO ALL TAXES AND LIENS OF RECORD. PURCHASER TO PAY FOR BILL OF SALE. ACE WRECKER, 5601 SOUTH ORANGE BLOSSOM TRAIL. July 27, August 3, 10 and 17, 2018 160947 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA002845-O FEDERAL NATIONAL MORTGAGE ASSOCIATION ("FANNIE MAE", A CORPORATION ORGANIZED AND EXISTING UNDER THE LAWS OF THE UNITED STATES OF AMERICA, Plaintiff, vs. KAREN F. ALLEN; ALLEN TRUST, LLC; SUNTRUST BANK; ORANGE COUNTY, FLORIDA; BAY HILL PROPERTY OWNERS ASSOCIATION, INC;, UNKNOWN TENANT(S) IN POSSESSION #1 and #2, et.al. Defendant(s). NOTICE OF ACTION UNKNOWN TENANT(S) IN POSSESSION #2 LOT 26, BAY HILL SECTION 1-C, DR. PHILLIPS, ACCORDING TO THE PLAT THEREOF, AS RECORDED IN PLAT BOOK 2, PAGE 143, OF THE PUBLIC REC ORDS OF ORANGE COUNTY, FLORIDA. A/K/A: 6145 MASTERS BLVD, ORLANDO, FL 32819. July 27 and August 3, 2018 160956 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO. 2018-CA004651-O DIV NO.: 39 MARRIOTT RESORTS HOSPITALITY CORPORATION, a South Carolina Corporation, Management Agent on behalf of GRANDE VISTA OF ORLANDO CONDOMINIUM ASSOCIATION, corporation, and All Owners as Agent, Plaintiff, vs. MICHAEL R. BERRY, et al., Defendants. NOTICE OF ACTION BY PUBLICATION AS TO COUNT I TO: MICHELE S. BERRY 13819 JARVIS ROAD CYPRESS, TX 77429 YOU ARE HEREBY NOTIFIED COUNT I Unit Week 31 in Unit 3521, in GRANDE VISTA CONDOMINIUM, according to the Declaration of Condominium thereof, Rec ords Book 5114 at Page 1488 in the Public Rec ords of Orange County, Florida, and any amendments thereof. thirty of publication herein If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact the ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, (407) 836-2303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Publish: The Apopka Chief July 27 and August 3, 2018 160934 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE N O .: 2017-CA009926 IMRAN CHAUDHRY AND SOFIA NASEEM, Plaintiffs, vs. PEDRO BENEVIDES, UNKNOWN SPOUSE OF PEDRO BENEVIDES, LUIS HERNANDEZ, UNKNOWN SPOUSE OF LUIS HERNANDEZ, DEPARTMENT OF TREASURY INTERNAL REVENUE SERVICE, FLORIDA DEPARTMENT OF REVENUE, KINETIC LEASING INC., US ACQUISITION, LLC, SUNTRUST BANK, J&A LAND MANAGEMENT, LLC, ORANGE COUNTY CLERK OF COURT, AND EDUARDO DIAZ, Defendants. NOTICE OF ACTION EDUARDO DIAZ J & A LAND MANAGEMENT, LLC SOUTHWEST 1/4 OF TRACT 72, SECTION 24, TOWNSHIP 24 SOUTH, RANGE 28 EAST, MUNGER'S SUBDIVISION, AS RECORDED IN PLAT BOOK E, PAGE 22, PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA; ALSO DESCRIBED AS SOUTHWEST 1/4 OF LOT 72, SECTION 24 TOWNSHIP 24 SOUTH, RANGE 28 EAST, WILLIS R. MUNGERS LAND COMPANY SUBDIVISION, AS RECORDED IN PLAT BOOK E, PAGE 22, PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA, PROPERTY PARCEL ID NUMBER: 24-24-28-584400-723 NOTICE TO PERSONS WITH DISABILITIES July 27, August 3, 10 and 17, 2018 160964 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL DISTRICT IN AND FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001712-O IN RE: ESTATE OF WALTER J. BEATON Deceased. NOTICE TO CREDITORS Publish: The Apopka Chief July 27 and August 3, 2018 160935 NOTICE OF PUBLIC AUCTION Life Storage #849 Tuesday, August 14th, 2018 @ 10:00 Customer Name Inventory Nidza Rodriguez Novlette A Smith Leslie Coulter Devon C White Keith DeFreitas Charles Soriano James Hyacinthe Laura E Villaquiran Sebastian Hanna Ismael Otero Shantell Trotter Rodney E Hayes II July 27 and August 3, 2018 160936 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA4613-O DIVISION NUMBER : 40 IN RE: FORFEITURE OF $10,153.00 IN U.S. CURRENCY NOTICE OF ACTION TO: JACARIS ROZIER, DOMINIC F. BOLDEN, and JADARRIUS MARTIN REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. July 27, August 3, 10 and 17, 2018 160937 IN THE NINTH CIRCUIT COURT OF FLORIDA, ORANGE COUNTY PROBATE Case No. 2017-CP-001339-O IN RE: THE ESTATE OF THOMAS W. DYER, SR., Deceased. NOTICE TO CREDITORS PERSONAL REPRESENTATIVE: ATTORNEY FOR PERSONAL REPRESENTATIVE: Publish: The Apopka Chief July 27 and August 3, 2018 160939 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2017-CP-1756 Division Probate IN RE: ESTATE OF SHIRLEY JEAN KASTRINOS Deceased. NOTICE OF ACTION (formal notice by publication) July 27 and August 3, 2018 160957 NOTICE OF LIEN SALE Life Storage #037 August 14, 2018 9:00 11955 S. Orange Blossom Trail, Orlando, FL. 32837, 407-826-0024 FRANCINE RICHARDSON DENNIS LOPEZ CHANEYSIA NEAL July 27 and August 3, 2018 160960 NOTICE OF PUBLIC SALE Northwest Orlando Self Storage at 5330 N Pine Hills Road, Orlando, FL 32808 AUGUST 16, 2018 Unit #-Name-Description: #C025 #C101 #D057 #E019 Publish The Apopka Chief July 27 and August 3, 2018 160940

PAGE 29

The Apopka Chief, August 3, 2018 Page 5D NOTICE OF PUBLIC AUCTION In accordance with the provisions of State law, there being due and unpaid charges for which the undersigned is entitled to satisfy an owner goods hereinafter described and stored at the Life Storage # 077 location(s) listed below. And, due notice having been given, to the owner of said property and all parties known to claim an interest therein, notice for payment of such having expired, the goods will be sold at public auction at the below stated location(s) to the highest bidder or otherwise disposed of on Day/Date of Auction Tuesday August 14, 2018 Time: @ 1:30 PM 4066 Silver Star Rd Orlando, FL 32808 407-298-9451 EMILY SCHERER Boxes MATTHEW JACKSON Boxes INGRID ALLEN Household Goods/Furniture; Tv/Stereo Equipment; Clothes MARTHA HOWARD Household Goods/Furniture BOWONNA RODGERS Household Goods/Furniture JACQUELINE BRIGHT Bags CHARISMA CYPRIAN Household Goods/Furniture; Tv/Stereo Equipment; Kids bikes BAMBI LOKETO ENTERTAINMENT LLC Buisiness THOMAS SHELTON Household Goods/Furniture SERITA HALL Household Goods/Furniture CHARISMA CYPRIAN Household Goods/Furniture; Tv/Stereo Equipment; Kids bikes TAMEKA C HUDSON Household Goods/Furniture JANELLE RUIZ Household Goods/Furniture; Tools/Appliances ALVIESHIA SMITH Household Goods/Furniture; Boxes, Appliances CHRISTOPHER J MASOTTI Tools/Appliances ALEXANDRA GONZALEZ Household Goods/Furniture JOAN EDINBORO Household Goods/Furniture PASCALE HILAIRE Household Goods/Furniture PERCY RILEY Household Goods/Furniture BRENDA BRADSHAW Household Goods/Furniture CRAIG HARRIS Household Goods/Furniture CHASITY BUSH Household Goods/ Furniture WITLAN SAINT HILAIRE Boxes with Clothes GLADSTONE GRANT Household Goods/Furniture MAGALI GOMEZ Household Goods/Furniture; Tv/Stereo Equipment; Tools/Appliances; Landscaping/ Construction Equipment ISAAC CRAWFORD Household Goods/Furniture ORIELLE CORBETT Household Goods/Furniture Publish: The Apopka Chief July 27 and August 3, 2018 160965 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002065-O Division Probate IN RE: ESTATE OF CHRISTINE M. FINCH Deceased. NOTICE TO CREDITORS The administration of the estate of Christine M. Finch, deceased, who was found deceased on May 14, 2018, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Avenue, Suite 355, Orlando, Florida 32801. The names and addresses of the personal representative and the personal representative's attorney are set forth below. All creditors of the decedent and other persons having claims or demands against decedent's estate on whom a copy of this notice is required to with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIODS SET FORTH ABOVE, ANY CLAIM FILED TWO 2 YEARS OR MORE AFTER THE DECEDENT'S DATE OF DEATH IS BARRED. of this notice is July 27, 2018. Personal Representative: Sophie K. Finch 21747 44A Avenue Langley, British Columbia V3A 3E7 Attorney for Personal Representative: Courtney B. Abrahams Florida Bar No. 119046 DeLoach, P.L. 1206 East Ridgewood Street Orlando, FL 32803 Publish: The Apopka Chief July 27 and August 3, 2018 160966 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-000972-O Division_____ IN RE: ESTATE OF JOSE FRANCISCO RODRIGUEZ DEL VALLE, a/k/a JOSE F. RODRIGUEZ, a/k/a JOSE RODRIGUEZ Deceased. NOTICE TO CREDITORS The administration of the estate of Jose Francisco Rodriguez Del Valle a/k/a Jose F. Rodriguez a/k/a Jose Rodriguez, deceased, whose date of death was March 23, 2017; is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Ave., Suite 355, Orlando, FL 32801. The name and address of the personal representative and the personal representative's attorney is set forth below. All creditors of the decedent and other persons having claims or demands against decedent's estate, on whom a copy of this notice is required with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH ABOVE, ANY CLAIM FILED TWO (2) OR MORE YEARS AFTER THE DECEDENT'S DEATH IS BARRED. of this notice is: July 27, 2018. Felicita Morales Figueroa Personal Representative 132 Rose Hill Trail Sanford, Florida 32773 Katiria Rodriguez Toro Attorney for Personal Representative Florida Bar Number: 112148 301 N Pine Meadow Dr., Ste. D DeBary, Florida 32713 Telephone: (386) 259 3657 E-Mail: info@krtlaw.com Secondary E-Mail: info@ rodrigueztorolaw.com Publish: The Apopka Chief July 27 and August 3, 2018 160967 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001748-O Division IN RE: ESTATE OF LINDA LEE BUSSERT VENDERLY Deceased. NOTICE TO CREDITORS (Summary Administration) TO ALL PERSONS HAVING CLAIMS OR DEMANDS AGAINST THE ABOVE ESTATE: an Order of Summary Administration has been entered in the estate of Linda Lee Bussert Venderly, deceased, File Number 2018-CP-001748-O, by the Circuit Court for Orange County, Florida, Probate Division, the address of which is Clerk's OfCourthouse #355, P. O. Box 4994, Orlando, FL 32802-4994; that the decedent's date of death was April 23, 2018; that the total value of the estate is $ EXEMPT and that the names and addresses of those to whom it has been assigned by such order are: Name Address Suzanne Patricia Venderly Kapuschinsky 12942 Moss Park Ridge Drive Orlando, Florida 32832 Victoria Lee Venderly Vogel 366 Caring Place Loop, Clyde, NC 28721 Raymie Julian Venderly 2102 Koryak Court Apopka, Florida 32712 ALL INTERESTED PERSONS ARE NOTIFIED THAT: All creditors of the estate of the decedent and persons having claims or demands against the estate of the decedent other than those for whom provision for full payment was made in the Order of Summary Administration must WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702. ALL CLAIMS AND DEMANDS NOT SO FILED WILL BE FOREVER BARRED. NOTWITHSTANDING ANY OTHER APPLICABLE TIME PERIOD, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEDENT'S DATE OF DEATH IS BARRED. this Notice is July 27, 2018. Person Giving Notice: Richard Keith Vogel 366 Caring Place Loop Clyde, NC 28271 Attorney for Person Giving Notice William J. McLeod Attorney Florida Bar Number: 322024 McLEOD LAW FIRM 48 East Main Street (32703) Apopka, Florida 32704-0950 Telephone: (407) 886-3300 Fax: (407) 886-0087 E-Mail: Secondary E-Mail: Publish: The Apopka Chief July 27 and August 3, 2018 160968 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-000973-O IN RE: ESTATE OF JEFFREY MICHAEL ROSS Deceased. NOTICE TO CREDITORS (Summary Administration) TO ALL PERSONS HAVING CLAIMS OR DEMANDS AGAINST THE ABOVE ESTATE: You are hereby notified that an Order of Summary Administration has been entered in the estate of Jeffrey Michael Ross, deceased, File Number 2018-CP-000973-O, by the Circuit Court for Orange County, Florida, Probate Division, the address of which is: Clerk of the Circuit Court, Orange County Probate Division, P. O. Box 4994, Suite 355, 425 N. Orange Avenue, Orlando, FL 32802-4994; that the decedent's date of death was January 23, 2018; that the total value of the estate is cash in the amount of $2,834.29, and that the names and addresses of those to whom it has been assigned by such order are: Name Address Jeanette J. Ross 1201 Yates St., Orlando, FL, 32804 ALL INTERESTED PERSONS ARE NOTIFIED THAT: All creditors of the estate of the decedent and persons having claims or demands against the estate of the decedent other than those for whom provision for full payment was made in the Order of Summary Administration must WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702. ALL CLAIMS AND DEMANDS NOT SO FILED WILL BE FOREVER BARRED. NOTWITHSTANDING ANY OTHER APPLICABLE TIME PERIOD, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEDENT'S DATE OF DEATH IS BARRED. this Notice is July 27, 2018. Person Giving Notice: Jeanette J. Ross 1201 Yates St. Orlando, FL 32804 Attorney for Person Giving Notice William J. McLeod Attorney Florida Bar Number: 322024 McLEOD LAW FIRM 48 East Main Street (32703) Apopka, Florida 32704-0950 Telephone: (407) 886-3300 Fax: (407) 886-0087 E-Mail: Secondary E-Mail: Publish: The Apopka Chief July 27 and August 3, 2018 160969 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO. 2018-CA004066-O DIV NO.: 35 MARRIOTT RESORTS HOSPITALITY CORPORATION, a South Carolina Corporation, Management Agent on behalf of SABAL PALMS OF ORLANDO CONDOMINIUM ASSOCIATION, INC., a Floriand All Owners as Agent, Plaintiff, vs. THOMAS JENG, et. al., Defendants. NOTICE OF SALE AS TO COUNT II TO: BRENDA LOWRY CASE, INDEPENDENT EXECUTRIX OF THE ESTATE OF WILLIAM T. LOWRY C/O JOSEPH P. ANDERSON, JR. 2217 SECOND STREET SLIDELL, LA 70458 NOTICE IS HEREBY GIVEN that pursuant to the Final Judgment of Foreclosure entered on the July 18, 2018, in the cause pending in the Circuit Court, in and for Orange County, Florida, Civil Cause No. 2018-CA-004066-O, the sell, Orange County Clerk of the Court will sell the property situated in said County described as: COUNT II Unit Week 31 in Unit 4519, in SABAL PALMS CONDOMINIUM, according to the Declaration of Condominium thereof, Records Book 3851 at Page 4528 in the Public Records of Orange County, Florida, and any amendments thereof. at Public sale to the highest and best bidder for cash starting at the hour of 11:00 a.m. on the 18th day of September, 2018 online at www. myorangeclerk.realforeclose. com. Any person claiming an interest in the surplus from the sale, if any, other than the property owner as of the date claim within 60 days after the sale. Submitted for publication to The Apopka Chief on July 24, 2018. DATED this July 24, 2018. ROBERT W. DAVIS, JR. FLORIDA BAR NO. 084953 HOLLAND & KNIGHT LLP 200 S. Orange Avenue Suite 2600 Orlando, FL 32802 If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, t o the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County, Courthouse, at 425 North Orange Avenue, Suite #510, Orlando, Florida 32801; Telephone (407) 8362303, at least 7 days before your scheduled court appearance, or immediately cation if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. OUR FILE #110521.0237 MRHC # ORANGE Publish: The Apopka Chief July 27 and August 3, 2018 160970 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002020-O Division: Probate IN RE: ESTATE OF MARK ANTHONY PACE, Deceased. NOTICE TO CREDITORS The administration of the estate of MARK ANTHONY PACE, deceased, whose date of death was May 9, 2018, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Ave., Orlando, Florida 32801. The names and addresses of the personal representative and the personal representative's attorney are set forth below. All creditors of the decedent and other persons having claims or demands against decedent's estate, on whom a copy of this notice is required to with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIOD SET FORTH ABOVE, ANY CLAIM FILED TWO 2 YEARS OR MORE AFTER THE DECEDENT'S DATE OF DEATH IS BARRED. of this notice is: July 27, 2018. ANGELA COOK Personal Representative 2293 Purdy Rd Selmer, TN 38375 Michael A. Nardella, Esquire Florida Bar No. 051265 Anthony M. Nardella, Jr. Esquire Florida Bar No.: 341274 Nardella & Nardella, PLLC 250 E. Colonial Drive, Suite 102 Orlando, FL 32801 Telephone: 407-966-2680 Email: mnardella@ nardellalaw.com Email: anardella@ nardellalaw.com Secondary Email: msayne@nardellalaw.com Attorneys for Personal Representative Publish: The Apopka Chief July 27 and August 3, 2018 160955 IN THE CIRCUIT COURT IN AND FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION CASE NO. 48-2018-CP002228-O IN RE: Estate of PATRICIA ANN HOPPING f/k/a PATRICIA ANN WILSON, Deceased NOTICE TO CREDITORS (Summary Administration) TO ALL PERSONS HAVING CLAIMS OR DEMANDS AGAINST THE ABOVE ESORDER OF SUMMARY ADMINISTRATION has been entered in the estate of PATRICIA ANN HOPPING f/k/a PATRICIA ANN WILSON, deceased, File Number 48-2018-CP-002228O, dated July 14, 2018, by the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Avenue, Suite 340, Orlando, FL 32801, and that the total value of the estate is approximately $71,500.00, and that ,the names and addresses of the persons to whom it has been assigned by such order are: CHARLES WILSON, 5416 Long Street, Orlando, FL 32818 ALL INTERESTED PERSONS ARE NOTIFIED THAT: All creditors of the decedent and other persons having claims or demands against the decedent's estate on whom a copy of this notice is served within three months after the with this court WITHIN THE LATER OF THREE MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE OR THIRTY DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and persons having claims or demands against the claims with this court WITHIN THREE MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS AND DEMANDS NOT SO FILED WILL BE FOREVER BARRED. cation of this Notice is July 27, 2018. VICKI HAAF 4855 48th Street W, Apt. 712 Bradenton, FL 34210 Petitioner GEORGE C. KELLEY, ESQ. Florida Bar No. 098523 Attorney for Petitioner 368 E. Main Street P.O. Box 1132 Apopka, FL 32704-1132 Email: attorney@gckelleylaw.com Publish: The Apopka Chief July 27 and August 3, 2018 160982 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002052 Division 1 IN RE: ESTATE OF SUSAN JANE REDFORD Deceased. NOTICE TO CREDITORS The administration of the estate of Susan Jane Redford, deceased, whose date of death was May 7, 2018, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 North Orange Avenue, Orlando, FL 32801. The names and addresses of the personal representative and attorney are set forth below. All creditors of the decedent and other persons having claims or demands against copy of this notice is required claims with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against their claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIODS SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE DATE OF DEATH IS BARRED. of this notice is July 27, 2018. Personal Representative: Dalia Cantor 605 East Robinson Street Suite 450 Orlando, Florida 32801 Attorney for Personal Representative: FAMILY FIRST FIRM Geoffrey H. Hoatson Florida Bar Number: 59000 1212 Mount Vernon Street Orlando, Florida 32803 Telephone: (407) 574-8125 Fax: (407) 476-1101 E-Mail: Publish: The Apopka Chief July 27 and August 3, 2018 160938 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-1862 IN RE: ESTATE OF ANDREE L. IMPARATO, Deceased. NOTICE TO CREDITORS The administration of the estate of ANDREE L. IMPARATO, deceased, whose date of death was May 22, 2018, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Avenue, Orlando, Florida 32801 The names and addresses of the personal representative and the personal representative's attorney are set forth below. All creditors of the decedent and other persons having claims or demands against decedent's estate on whom a copy of this notice is required to with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIODS SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEDENT'S DATE OF DEATH IS BARRED. of this notice is July 27, 2018. Personal Representative: KAY LOTTMAN NEWLON 304 Log Run Court Ocoee, Florida 34761 Attorney for Personal Representative: Beth K. Roland Florida Bar Number: 103674 Family First Firm 1212 Mount Vernon Street Orlando, Florida 32803 Telephone: (407) 574-8125 Fax: (407) 476-1101 E-Mail: Publish: The Apopka Chief July 27 and August 3, 2018 160991 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-02220-O IN RE: ESTATE OF MARIE FERRANDA Deceased. NOTICE TO CREDITORS The administration of the estate of MARIE FERRANDA, a/k/a MARIE JOSEPHINE FERRANDA, deceased, whose date of death was May 29, 2018, File Number 2018-CP-02220-O, is pending in the Circuit Court for ORANGE County, Florida, Probate Division; the address of which is 425 North Orange Avenue, Orlando, FL 32801. The names and addresses of the personal representative and attorney are set forth below. All creditors of the decedent and other persons having claims or demands against copy of this notice has been with this court WITHIN THE LATER OF 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE TIME OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT SO FILED WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIOD SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEBARRED. tion of this notice is July 27, 2018. Co-Personal Representatives: MICHAEL FERRANDA 1512 Tatum Blvd., New Smyrna Beach, FL 32168 JAMES R. FERRANDA 21845 Brendenshire Lane, Eustis, FL 32736 Attorney for Co-Personal Representatives: JOSHUA C. WELLS Florida Bar No. 109785 Wright & Casey, P.A. 340 North Causeway New Smyrna Beach, FL 32169 386-428-3311 386-427-9516-facsimile Primary Email: jwells @surfcoastlaw.com Secondary Email: donna@surfcoastlaw.com Publish: The Apopka Chief July 27 and August 3, 2018 160980 NOTICE OF PUBLIC AUCTION In accordance with the provisions of State law, there being due and unpaid charges for which the undersigned is entitled to satisfy an owner goods hereinafter described and stored at the Life Storage #508 location(s) listed below. And, due notice having been given, to the owner of said property and all parties known to claim an interest therein, notice for payment of such having expired, the goods will be sold at public auction at the below stated location(s) to the highest bidder or otherwise disposed of on Tuesday August 14, 2018 at 12:00 2650 N Powers Dr., Orlando, FL 32818 407 293-6005 CUSTOMER NAME/ INVENTORY AIME, MELITA BIEN: Household Good/furniture RAYMOND, JOHN: Household Good/furniture WALKER, TENESHIA: Household Good/furniture/Tv Stereo equipment/Tools Appliances M CKINLEY, CHERYL: Household Good/furniture. WOODS, MAMIE: Storage Container. WILLIAMS, TAHIRAH: Household Good/furniture. MAHONE, TIFFANY: Household Good/furniture/TV ture, machines, equipment. BROWN, ROHAN: Household Good/furniture. PIERRE, MARIO: Household Goods/furniture. Publish: The Apopka Chief July 27 and August 3, 2018 160981 NOTICE OF PUBLIC AUCTION In accordance with the provisions of State law, there being due and unpaid charges for which the undersigned is entitled to satisfy an owner goods hereinafter described and stored at the Life Storage #507 location(s) listed below. And, due notice having been given, to the owner of said property and all parties known to claim an interest therein, notice for payment of such having expired, the goods will be sold at public auction at the below stated location(s) to the highest bidder or otherwise disposed of on Tuesday August 14, 2018 @ 11:00 11583 University Blvd. Orlando, FL 32817 (407) 207-0011 Amanda Durham Household Goods/ Furniture, TV/Stereo; Machines/Equipmnt Lisha Ceballo Household Goods/Furniture, Personal Stuff Georina Rodriguez Household Goods/Furniture Mark Right Household Goods/Furniture Christian Tejada Vehicle/Boat/Trailer Publish: The Apopka Chief July 27 and August 3, 2018 160977 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA4126-O DIVISION NUMBER : 34 IN RE: FORFEITURE OF $3,340.00 IN U.S. CURRENCY NOTICE OF ACTION TO: KENNETH L. BELL YOU ARE NOTIFIED that an action pursuant to the Florida Contraband Forfeiture Act following property in Orange County, FL: $3,340.00 in U.S. Currency seized on or about the 9th day of March, 2018, at or near 1724 N. Alafaya Trail, Orlando, Orange County, Florida. You are required to serve a copy of your written defenses, if any, to the Assistant General Counsel for West Colonial Drive, Orlando, Florida 32804, within 30 days original with the Clerk of this Court either before service on diately thereafter; otherwise a default will be entered against you for the relief demanded in the Petition for Final Judgment of Forfeiture. REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. DATED this 24 day of July, 2018. TIFFANY MOORE RUSSELL Clerk of the Court BY: Brian Williams, Deputy Clerk CIRCUIT COURT SEAL Civil Division 425 N. Orange Avenue Room 310 Orlando, Florida 32801 Publish: The Apopka Chief July 27, August 3, 10 and 17, 2018 160976 NOTICE OF LIEN SALE In accordance with the provisions of State law, there being due and unpaid charges for which the undersigned is entitled to satisfy an owner goods hereinafter described and stored at the Life Storage # 628 location(s) listed below. And, due notice having been given, to the owner of said property and all parties known to claim an interest therein, notice for payment of such having expired, the goods will be sold at public auction at the below stated location(s) to the highest bidder or otherwise disposed of on Tuesday, AUGUST 14, 2018 @ 10:30 AM. 4020 Curry Ford Rd, Orlando, FL 32806, Phone # 407 480-2932 Marcy M Lambert Hsld gds/Furn Delvis J Patino Hsld gds/Furn Kayla Morris Hsld gds/Furn Jacqueline Batista Hsld gds/Furn Irene M Kerr Hsld gds/Furn Publish: The Apopka Chief July 27 and August 3, 2018 160958 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Leh Hah Vah Pencils located at 14349 Island Cove Drive, in the County of Orange in the City of Orlando Florida 32824, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orlando, Florida, this 26th day of July, 2018. Dexter C McNeal Publish: The Apopka Chief August 3, 2018 160992 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Abdelgader Auto Service located at 1700 Woodbury Rd, Apt#802, in the County of Orange in the City of Orlando Florida 32828, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orlando, Florida, this 26th day of July, 2018. Mohamed Abdelgader Publish: The Apopka Chief August 3, 2018 160993 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Stork Lady Celebrations located at 3886 Calibre Bend Lane Apt 805, in the County of Orange in the City of Winter Park Florida 32792, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Winter Park, Florida, this 26th day of July, 2018. Stacy Luchs Publish: The Apopka Chief August 3, 2018 160994 NOTICE OF PUBLIC SALE All Florida Recovery Corp gives Notice of Foreclosure of Lien and intent to sell these vehicles on AUGUST 12, 2018 10:00:00 AM at 2512 Overland Rd, Apopka, FL 32703 pursuant to subsection 713.78 of the Florida Statutes. All Florida Recovery Corp reserves the right to accept or reject any and/or all bids. 1G1PC5SB4E7410745 2014 CHEVROLET CRUZE LT August 3, 2018 160997 J&B USED AUTO PARTS INC NOTICE OF PUBLIC SALE P ursuant to F.S. 713.78, the following vehicles will be sold at public auction on AUGUST 27th, 2018 at 8:00 am at J & B Used Auto Parts Inc., 17105 E. Colonial Dr. Orlando, Fl., 32820. Seller reserves the right to bid, to accept or reject any and all bids. Sold as is, no warranty, no title. Terms cash 2005 FORD 1FAFP26185G190314 2003 HONDA 1HGCM56643A121964 2012 MAZDA JM1BL1UF9C1522483 August 3, 2018 160995 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA2996-O DIVISION NUMBER : 35 IN RE: FORFEITURE OF $3,864.00 IN U.S. CURRENCY NOTICE OF ACTION TO: ERIK A. RODRIGUEZ YOU ARE NOTIFIED that an action pursuant to the Florida Contraband Forfeiture Act following property in Orange County, FL: $3,864.00 in U.S. Currency seized on or about the 6th day of February, 2018, at or near 12311 Lantana Park Lane, #112, Orlando, Orange County, Florida. You are required to serve a copy of your written defenses, if any, to the Assistant General Counsel for West Colonial Drive, Orlando, Florida 32804, within 30 days original with the Clerk of this Court either before service on diately thereafter; otherwise a default will be entered against you for the relief demanded in the Petition for Final Judgment of Forfeiture. REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. DATED this 10 day of July, 2018. TIFFANY MOORE RUSSELL Clerk of the Court BY: Sandra Jackson Deputy Clerk CIRCUIT COURT SEAL Civil Division 425 N. Orange Avenue Room 310 Orlando, Florida 32801 Publish: The Apopka Chief July 20, 27, August 3 and 10, 2018 160861 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-DR003918-O DIV: 38 IN RE: The Marriage of COURTNEY ALEXANDER COOMBS Petitioner/Husband, and LORI STAMPS-COOMBS, Respondent/Wife. NOTICE OF ACTION DISSOLUTION OF MARRIAGE TO: LORI STAMPS-COOMBS 711 SHERWOOD TERRACE DRIVE, APT #204 ORLANDO, FL 32818 YOU ARE HEREBY NOTIFIED that an action for dissolution of marriage has been are required to serve a copy of your written defenses, if any, WILLIAM A. SANTANA, ESQ., P.O. BOX 783694, WINTER GARDEN FL 34778 on or beoriginal with the Clerk of the Circuit Court, 425 N. Orange Avenue, Suite 320, Orlando, FL 32801, before service on mediately thereafter. If you fail to do so, a default may be entered against you for the relief demanded in the petition. The action is asking the court to decide how the following real or personal property should be divided: NONE. Copies of all documents in this case, including orders, are available at the Clerk of may review these documents upon request. You must keep the Clerk of your current address. (You dress, Florida Supeme Court Approved Family Law Form 12.915). Future papers in this lawsuit will be mailed to the address on record at the WARNING: Rule 12.285, Florida Family law Rules of Procedure, requires certain automatic disclosure of documents and information. Failure to comply can result in sanctions, including dismissal or striking of pleadings. TIFFANY MOORE RUSSELL CLERK OF CIRCUIT COURT By: Kierah Johnson, CIRCUIT COURT SEAL Deputy Clerk 425 North Orange Ave. Suite 320 Orlando, Florida 32801 Publish: The Apopka Chief July 20, 27, August 3 and 10, 2018 160862 The Apopka Chief