Citation
The Apopka chief

Material Information

Title:
The Apopka chief
Uniform Title:
Apopka chief (Apopka, Fla. 1988)
West Orange news
Place of Publication:
Apopka, FL
Publisher:
John E. Ricketson
Creation Date:
January 7, 2005
Publication Date:
Copyright Date:
2005
Frequency:
Weekly
regular
Language:
English
Physical Description:
v. : ill. ; cm.

Subjects

Subjects / Keywords:
Newspapers -- Apopka (Fla.) ( lcsh )
Newspapers -- Orange County (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
Spatial Coverage:
United States -- Florida -- Orange -- Apopka
Coordinates:
28.685808 x -81.509717

Notes

Additional Physical Form:
Also available on microfilm from the University of Florida.
Numbering Peculiarities:
Issues for <Jun. 7, 1950-Dec. 26, 1956> also have numbering of: West Orange news.
General Note:
Description based on: Vol.1,no. 12 (Jun. 7, 1950).
General Note:
Issues for <1998>-published
Funding:
Funded in part by the University of Florida, the Library Services and Technology Assistance granting program of Florida, the State Library and Archives of Florida, and other institutions and individuals.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
Copyright Apopka Chief. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
001689212 ( ALEPH )
33886036 ( OCLC )
AJA1248 ( NOTIS )
sn 95047388 ( LCCN )

Related Items

Preceded by:
Orange County chief

UFDC Membership

Aggregations:
Florida Digital Newspaper Library

Downloads

This item is only available as the following downloads:


Full Text

PAGE 1

By John Peery Apopka Chief Staff By John Peery Apopka Chief Staff The Apopka ChiefVolume 96 Number 29Your trusted local news sourceFriday, July 20, 2018 / 50 cents The Apopka Chief LifestyleGod Bless AmericaSportsAn Apopka woman is named top citizen by the Orange County commissioner. See page 1B. A Wekiva High School graduate and baseball player is Seattles top draft pick. See page 1C. This week Section A Section B Section C Section DOpinion .................. 2A Pub. Notices 3,6,7,9A Lifestyle ................. 1B Worship ................. 2B Dining & Ent .......... 3B Kapers ................... 4B Bus. Rev. .... 3B,6B-8B Sports .................... 1C ....... 8C-10C Service Dir. .......... 10C Bus. Rev. ............... 1D Legal ads ......... 2D-8D By John Peery Apopka Chief Staff Apopka police seek higher merit-pay raises from cityDuring the City Council meeting, Sam Anderson, an Apopka police ofcer, shows the car door panel that was shot in 2014 as he interrupted a robbery while he stopped to get coffee. See P A Y P age 9AAn alligator swims in one of the canals along the Lake Apopka Wildlife Drive recently. The drive is open each Friday through Sunday and most federal holidays from sunrise to sunset. The entrance to the one-way, 11-mile drive is located at 2803 Lust Rd., Apopka. The drive is maintained by the St. Johns River Water Management District. A leisurely swim Mayor Bryan Nelson said the reworks will go up on Sept. 2. City Commissioner Alice Nolan speaks during the City Council meeting. City Administrator Edward Bass talks to the City Council about the budget. See FIREW ORKS P age 8ACity Council gives tentative OK to higher property taxes See TAXES P age 10A PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. 407-884-1846 COMPREHENSIVE ADULT DENTISTRYProviding Extraordinary Care for Extraordinary Patients Celebrating over 20 years of exceptional service to the Apopka area! Richard Petrilli, DMD, PA

PAGE 2

Quotable More than one member of the City Council also expressed that if the merit increase is kept at three percent, it is expected only for this budget year it is not meant to continue for years into the future. The Apopka Chief on budget merit raises This past Sunday, I had the honor and pleasure of participating as a judge in the annual Scholarship Sunday oratorical contest at the New Hope Mis sionary Baptist Church in Apopka. The South Apopka Ministerial Alliance has the annual oratorical contest, coined Scholarship Sun day, as one of its targeted initiatives. This program nity to participating speak ers who receive a monetary award for researching the theme presented to them. Several years ago, following the conclusion of National Association of Colored People (NAACP) program, the South Apopka Ministerial Alliance orator ical contest was born. This event presents an excel lent opportunity for young people of churches that are members of the Alliance to showcase their talents while improving on their public-speaking skills and where they learn to step out of their comfort zones. Member churches select a student from their congre gation to represent them, and they show their sup port by attending the event (a factor used in selecting a winner for the contest). The theme for this years event was How can I create a safe environment for our schools? Par ticipants for the program discussed ways to create a safer school environment, including, but not lim ited to: compassion; good role models; activities to strengthen trust between students and teachers; unity; ways to report suspicious activities that protect both the reporter and person being reported; and parental involvement. For the awarding of the oratorical contest winners, Pastor Hezekiah Bradford, It only takes a few minutes for the inside of a car to get dangerously hot, and the near recordhigh temperatures in many regions of the country this summer pose a greater risk for heatstroke tragedies. Since 1998, 764 children have died from heatstroke in hot cars ac cording to the National Administration (NHTSA). Despite warnings from safety organizations, each year children continue to die from this needless trag edy. People often think that something like this could never happen to them, said Amy Stracke, safety advocacy for AAA The Auto Club Group and executive director of the Safety Foundation. How ever, the majority of heat stroke deaths are accidents, where a parent or caregiver forgets the child is in the back seat. AAA and its Auto Foundation encourage anyone with small children to develop a regular, consistent reminder system for getting their children out of the car. In cases where chil dren are left unintentional ly, something usually hap pens such as a change in routine that takes the drivers attention away from backseat passengers, especially when a child has fallen asleep. Child heatstroke deaths in vehicles are 100 percent preventable, and we want to make sure no parent or caregiver ever has to experience such un thinkable heartbreak, said Matt Nasworthy, Florida public affairs director for AAAThe Auto Club Group. We urge parents to think about their rou tines and what steps they can take to prevent a child from being left in the car AAA and its Auto Foundation suggest the fol lowing safety tips to help keep children safe: Make it a Habit Before locking your vehicle, check the front and back seat. Set an Alarm Consider programming an alarm on your phone that will go off to remind you to check your vehicle. Caregiver Assistance If you normally drop your child off at a babysitter or daycare, ask the caregiver to call you if your child doesnt show up as expected. Add a ReminderPut your purse/wallet or cell phone in the back seat. This way you are reminded to look in the back seat up en masse on Wednesday, July 18, to protest a proposal in next years city budget that calls for city of Apopka employees to have a maximum of a three-percent merit raise. They wanted that pushed to six percent. Of course, with merit pay raises, not everyone gets the maxi mum, whatever that number is. Some may get that top number, but employees get something between zero and the top number, which is the way it should be. Not every employee deserves the maximum merit raise, but most would likely The proposed budget assumes a three-percent merit raise for all employees for the upcoming 20182019 city of Apopka budget, and Edward Bass, city administrator, said that for each percentage-point increase in merit raises above three percent it would cost the city $250,000, meaning that an additional three percent increase in merit raises could add up to $750,000 in costs for the city. However, Bass said even if the City Council decided to award up to six-percent merit increases, the city would likely budget for an av the City Council will need to come up with an additional $500,000 in revenue to meet the request of the just asking for the six-percent merit pay hikes for themselves, City Council members seemed reluctant to include just the law enforcement wanted to keep the potential raises the same for all employees, while acknowledging the dangerous jobs More than one member of the City Council also expressed that if the merit increase is kept at three percent, it is expected only for this budget year it is not meant to con tinue for years into the future. While we agree with the police retirement packages, we also know package. Sometimes, six percent is the right number, but other times, three percent is what is needed, and there are times when no raises are offered because its just not possible from a revenue standpoint. We would love to see everyone in the city receive even bigger rais es, but its just not always possible. Hopefully, Bass and the other ka will be able to whittle down ex penses so that the desires of the po police department is important for Apopka and we understand the need to have quality, experienced We would hope that the of this one year, they may not get the maximum six-percent merit raise. If they do, great, but if it doesnt work out, then a one-year blip in the overall scheme of things will not make that much of a difference. Many people in other jobs admittedly not as dangerous as police work would love to have an increase in pay, but the revenue numbers dont justify that. Bottom line is that we hope hard work, but we also hope they understand that, sometimes reality becomes the deciding factor. Our position The Apopka Chief The Apopka Chief A weekly newspaper founded in 1923July 20, 2018, Page 2A Opinion JULY 20 With the vast majority of the Hate Trumpers marching in the streets obviously being below the age of 50, this is certainly the gang that couldnt think straight. Certainly by the time they had reached 20 years old in the late 1980s, they had missed the devastation of the Jimmy The Wimp mortgage interest rates had soared to more than 20 percent, oil prices had doubled, and most people spent much time in long lines at the gas stations across America for highpriced fuel. The Wimps 20-per cent approval rating in August 1977 was the lowest ever recorded. We were blessed that when Ronald Reagan was picked as the GOP presidential candidate in the 1980 election, the Demoni acs nominated The Wimp again and Reagan took the electoral votes 489 to 43 more than 10 to 1. versing all The Wimps destruction, President Reagan defeated his second term opponent Walter Mondale by even a larger margin of electoral votes 525 to 13. I hope the Demoniacs make Hillary their candi date again, and we get both the popular and electoral college majorities, send ing the Hill out of town for good. It is obvious that the Dems are setting them selves up for a Carter Catastrophe in the coming mid-terms and presidential vote in 2020 and beyond. A recent article by Creator Syndicates Stephen Moore said it all in the headline: The state of the American worker never better Moore wrote: Ev eryone knows the joyous statistic, of the lowest unemployment rate in two decades, the lowest black and Hispanic unemploy ment rate in at least three decades, a record number of Americans today who lion bonuses paid out to middle-income Americans this year And, in job creation, close to 800,000 jobs have sprung up in construction, manufacturing, and mining under Trumps administra tion. These jobs are ex tremely good news because as blue-collar middle class, appearing for decades. Having been born ear ly in the Great Depression of the 1930s, I remember the long lines of the unem ployed, and the many small businesses that closed their doors. Fortunately, my See CORBEIL Page 6A Publisher John Ricketson General Manager Neoma Knox Editor John Peery Reporters Richard Corbeil Teresa Sargeant Neal Fisher Photographer Tammy Keaton Marketing Director Jackie Trefcer Advertising Anita Walker Dyer Wendy Richardson Apopka Event of the WeekThe Dept. of Motor Vehicles (FLOW) Mobile Van will be at the North Orange Branch Library, 1211 E. Semoran Blvd., Apopka, Tuesday, July 24, from 10 a.m.2 p.m. This unit provides a convenient method to renew a driver license, obtain a replacement driver license, etc. No County Commissioner District 2 Rod Love The Apopka Chief is published every Friday and entered as Periodicals, post1879. The Apopka Chief newspaper is published by Foliage Enterprises, Inc., every Friday at 400 N. Park Avenue, Apopka, Fla., 32712-3417. An annual subscription is $25 in Orange County and $30 outside Orange County, Phone 407-886-2777. Postmaster: Send address changes to The Apopka Chief, PO Box 880, Apopka, Fla., 32704-0880. Budgetary restraints problem for amount of merit increase When president pulls off such miracles, obviously God loves himOratorical participants win awards Hot car heatstroke has killed 764 See LOVE Page 6A See H EA T S T ROK E Page 6A Send Letters to the Editor: www.T heApopkaChief.com Mema Says Old is when you stop lying about your age and start bragging about it. Jesus then cometh, and taketh bread, and time that Jesus shewed himself to his disciples, after 14. This Week In Word

PAGE 3

The Apopka Chief, July 20, 2018, Page 3A Crews are scheduled the nights of today, Friday, July 20, and Satur day, July 21, to work to permanently close the State Road 46 intersection at County Road 46A. Nightly lane closures are scheduled from 8 p.m.-6 a.m. to allow crews to move the trafSR 46 to a new connector road. This portions of the Wekiva Parkway (SR 429). The intersection and signal relocation on July 21 will coincide with closing portions of CR 46A. Access main. for this operation. The six miles of elevated expressway will extend along the SR 46 corridor from the SR 429 interchange east of Camp Challenge Road to near Longwood-Markham Road. The project includes a non-tolled, local service Wekiva River, and several wildlife Rock Springs Run State Reserve, and Lower Wekiva River Preserve. A multi-use trail with scenic this section. Work will include contions of CR 46A and SR 46 to maintain private property access. Work www.wekivaparkway.com. Follow for real-time updates. way will complete Central Floridas of Transportation and the Central Florida Expressway Authority have opened 13 miles of the eventual 25mile toll road. Work on Wekiva Parkway will close area roadsJuly 20, 2018 Publish: The Apopka Chief 160898 PUBLIC HEARING NOTICE CHANGE OF ZONING AMENDMENT CITY OF APOPKA NOTICE is hereby given that Thomas Sullivan, c/o Gray Robinson, P.A has made an application, in accordance with Florida Statutes 163.3187c) and the Apopka Code of Ordinances, Part III, Land Development Code, Article XII, Section 12.04.00, to the City of Apopka City Council for a CHANGE OF ZONING FOR 19.67 +/ACRES FROM R-1A TO PLANNED UNIT DEVELOPMENT DISTRICT This application relates to the following described property located at 2400 Schopke Road. Apopka City Council Community Development Department Notice is given that a public hearing will be held by the City of Apopka City Council at its regularly scheduled meetings in the City Council Chambers of the Apopka City Hall, 120 E. Main Street, Apopka, Florida on Wednesday, August 1, 2018, beginning at 1:30 p.m., or as soon thereafter as possible. Affected parties and the public may appear at the above listed hearings to speak. The proposed Rezoning can be inspected at the Apopka Community Development Department located at Apopka City Hall on weekdays between the hours of 8:00 a.m. and 4:30 p.m. City Hall address shown below. Please be advised that, under State law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act ADA, persons with disabilities needing assistance to participate in any of Main Street, Apopka FL 32703, Telephone: 407-703-1704, no less than 48 hours prior to the proceeding. ORDINANCE NO. 2660 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, CHANGING THE ZONING FROM R-1A SINGLE FAMILY RESIDENTIAL) TO CITYPUD PLANNED UNIT DEVELOPMENT) FOR CERTAIN REAL PROPERTY GENERALLY LOCATED WEST OF SCHOPKE LESTER ROAD AND SOUTH OF SHOPKE ROAD, COMPRISING 19.67 ACRES MORE OR LESS, AND OWNED BY JEL LAND DEVELOPMENT LLC ; PROVIDING FOR DIRECTIONS TO THE COMMUNITY DEVELOPMENT DIRECTOR, SEVERABILITY, CONFLICTS, AND AN EFFECTIVE DATE. Parcel I.D.: 06-21-28-7172-19-030 Contains: 19.67 +/Acres July 20, 2018 Publish: The Apopka Chief 160897 PUBLIC HEARING NOTICE CHANGE OF ZONING NOTICE is hereby given that DEWBERRY, C/O SARAH MAIER has made an application, in accordance with Florida Statutes 163.3187c) and the Apopka Code of Ordinances, Part III, Land Development Code, Article XII, Section 12.04.00, to the City of Apopka City Council, and Apopka Planning Commission for a change in Zoning from R-1AA Residential Single Family District to R-1 Residential Single Family District. This application relates to the following described property located at 1455 W. Lester Road. Apopka City Council Community Development Department Notice is given that a public hearing will be held by the City of Apopka City Council at its regularly scheduled meetings in the City Council Chambers of the Apopka City Hall, 120 E. Main Street, Apopka, Florida on Wednesday, August 1, 2018, beginning at 1:30 p.m., or as soon thereafter as possible. Affected parties and the public may appear at the above listed hearings to speak. The proposed Future Land Use and Zoning can be inspected at the Apopka Community Development Department located at Apopka City Hall on weekdays between the hours of 8:00 a.m. and 4:30 p.m. City Hall address shown below. Please be advised that, under State law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act ADA, persons with disabilities needing assistance to participate at 120 East Main Street, Apopka FL 32703, Telephone: 407-703-1704, no less than 48 hours prior to the proceeding. ORDINANCE 2654 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, CHANGING THE ZONING FROM R-1AA RESIDENTIAL SINGLE FAMILY DISTRICT TO R-1 RESIDENTIAL SINGLE FAMILY DISTRICT FOR CERTAIN REAL PROPERTY GENERALLY LOCATED SOUTH OF WEST PONKAN ROAD AND WEST OF HOME AGAIN ROAD, COMPRISING 5.75 ACRES MORE OR LESS, AND OWNED BY JTD LAND AT ROGERS ROAD LLC PROVIDING FOR DIRECTIONS TO THE COMMUNITY DEVELOPMENT DIRECTOR, SEVERABILITY, CONFLICTS, AND AN EFFECTIVE DATE. Parcel I.D.: 29-20-28-0000-00-005 Contains: 5.75 +/Acres The hiring of an attorney is an important decision that should not be based solely upon advertisements. Before you decide, ask me to send you free written information about our qualifications and experience. BANKRUPTCY IS ALL I DOROBERT H. PFLUEGER, P.A.377 Maitland Ave. #1002 Altamonte Springs Everyone deserves a fresh start. Let our experience work for you.If you are considering bankruptcy, call today for your FREE CONSULTATION Over 35 Years Experience407-339-2022 SKYSCRAPER 3D 2018) PG-13 10:20 PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. 3D MOVIES WEKIVA SPRINGS RD, APOPKA Fri., July 20, 2018 thru Sun., July 22, 2018 MAMMA MIA! HERE WE GO AGAIN PG-13 10:10A*; 1:00; 4:10; 7:20; 10:00 THE EQUALIZER 2 R 12:30; 3:30; 6:40; 9:50 HOTEL TRANSYLVANIA 3: SUMMER VACATION PG) 10:40A*; 1:20; 4:20; 7:00; 9:30 SKYSCRAPER 2018 PG-13) 10:10A*; 1:30; 4:30; 7:40 ANT-MAN AND THE WASP PG-13 10:20A*; 1:10; 4:00; 7:10; 10:10 THE FIRST PURGE R 1:40; 4:40; 7:50; 10:25 JURASSIC WORLD: FALLEN KINGDOM PG-13 10:30A*; 12:40; 3:40; 6:50; 9:50 INCREDIBLES 2 PG 10:00A*; 12:50; 3:50; 7:30; 10:30*SUNDAY ONLY VFW POST 10147 519 S. Central Ave., Apopka Would like to invite you to our breakfast held every third Saturday of the month. ALL FOR $ 6.00 We will be serving: Scrambled Eggs Sausage Links Pancakes Biscuits and Gravy Water Time: 8 am 10 am Every third Saturday of the month. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. VFW POST 10147 THIS SATURDAY, JULY 21 We will be serving: July 21 breakfast, sponsored by THIS SATURDAY PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible.

PAGE 4

The Apopka Chief, July 20, 2018, Page 4A By John Peery Apopka Chief Staff The improvement and/or extension of Rogers Road was among the items discussed by city staff Wednesday, July 18, at the Development Review Committee (DRC) meeting. DRC is made up of representatives from the various city of Apopka departments. During the discussion on phase 2 of the Carriage Hill subdivision, which is located at the north end of Rogers Road, which runs north from Lester Road, Apopka Deputy Police Chief Randy Fernandez brought up the idea of improving the road. s really a sub-standard road, Fernandez said. Later clarifying his statement, Fernandez said, not calling it unsafe. I want to make sure thats not the message. Yet, what we are doing is putting more and more subdivisions on this road. We need to think about upgrading this road to the rest of the standards around. It looks like were approving more subdivisions in the back and not doing anything with the road. I dont think we need to get into that habit. Fire Chief Chuck Carnesale said the ISO or departments throughout the nation and has consistently ranked the Apopka Fire Department at an ISO 1, the highest, has dinged the department for its response times to that area because of the roadways. Currently, Rogers Road dead ends about halfway between Lester Road and Ponkan Road. like it cut through to Ponkan myself, Carnesale said. ith all the stations we have, thats the one area (ISO has mentioned). Station 5 could get gers) if that road was cut through. ISO brought the issue up, Carnesale said, prior City staff may soon look at ways to improve or extend Rogers Road as more houses are built in that area.City staff talks about road work See S TAFF Page 5 A Everybody has an opinion. Why not share yours? The Apopka Chief 400 N. Park Ave., Apopka 32712 Send, bring or email your signed letters to the Editor at Submit your letter online at www.theapopkachief.com Email: news@theapopkachief.com For more info, call: 407-886-2777 Fax: 407-889-4121 The patient and any other person responsible for payment has a right to refuse to pay, cancel payment or be reimbursed for payment for any other service, examination or treatment which is performed as a result of and within 72 hours of responding to the advertisement for the free, discounted fee or reduced fee service, examination or treatment. Our Price PetMed Our Price ** PetMed Size 6 Months 6 Months 12 Months 12 months5 10 88.78 99.99 173.84 (148.84) 194.96 10 20 90.04 104.99 176.96 (151.96) 204.96 20 40 96.34 107.94 188.48 (163.48) 210.96 40 60 98.56 109.64 190.76 (165.76) 214.96 60 120 101.38 112.96 196.40 (171.40) 218.96Manufacturer Guaranteed2807 Rock Springs Rd., Apopka, FL 32712 Pet Care Center OF APOPKA Pet Care Center OF APOPKA River Oaks Animal Hospital 407-884-8924 East Lake Animal Clinic, Sorrento PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. If you bought at Pet Med, you paid too much! Vaccination Packages FREE New Client Exam www.centralfloridavets.com One Day of BoardingFREE *Prices include $15 or $25 **Manufacturer Mail-In Rebate PLUS $15 Heartworm test if needed for 12 months While supplies Last, price correct at time of press. Prices in parenthesis include a limited number of $50 rebates. Exp 7/31/18. Central Floridas Finest Pet Resort Dare-to-Compare Prices! PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Perrys Decorative GlassJUNE & JULY ONLY352-751-0883www.EntryPointbyPerrys.com*Not good with sales, promos or closeouts already marked down. Not good on prior purchases. Lic# SCC131151683SLIDING SHOWER DOORS SWING SHOWER DOORS$ 100$ 50$ 50 10% OFF MIRROR MATEOFF any installed sliding door OFF any carved design swing shower door over 25 sf OFF any clear swing shower door over 15 sfChange out those old sliding glass doors with new French doors with blinds! COMPLETE DOOR REPLACEMENTS NOW AVAILABLE! Are your Entry Doors wearing out? FREE In-House Estimates FRONT ENTRY DOOR w/ 1 SIDELIGHT or 2 SIDELIGHTS NEW DOORS WITH YOUR CHOICE OF or FULL GLASS After Mirror Wrap Before Mirror Wrap 22x64 $599 Reg $799 22x36 $399 Reg $499 22x64 $749 Reg $899 22x64 $749 Reg $1049 22x64 $599 Reg $799 10 Avail. 10 Avail. 10 Avail. 20 Avail. Royal Palm Nickel Prices Good For In Stock Only Till Gone Many More Designs To Pick From New Load of Closeout Glass Just Arrived While They Last Stratford-Platinum Only Aragon-ORB Bell Flower Dance Gear is located inside KidzDance in Victoria Plaza, 1007 W. US 441, Apopka407-889-9898 10% OFFPROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. BOGO WEEKMonday, July 16th Tuesday, July 24thOPEN HOUSE GREAT DEALS & SURPRISESStop in or call for details!Dance Gear CAPEZIO ~ BLOCH ~ LEOS ~ HARMONIE ~ JO + JAX ~ HEART + SOUL ~ HONEYCUT SASSI DESIGNS ~ SUGAR + BRUNO ~ SO DANCA ~ REVOLUTION ~ AND MORE!~ T R E N D Y T R E N D Z ~ ~ B O D Y W R A P P E R S ~ PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. STUDY SERVICE 10:00 AM 11:30 AM Community Church 407-218-5155 STUDY SERVICE Community Church 407-218-5155 STUDY SERVICE 10:00 AM 11:30 AM Community Church 407-218-5155 Tell them you saw it in The Apopka Chief s how I treat all my customers. And you can be sure Ill always do my best to meet your needs. Like a good neighbor, State farm is there. CALL ME TODAY. State Farm Mutual Automobile Insurance Company State Farm Indemnity Company, Bloomington, IL Shren Yeager, Agent 49A East 3rd Street Apopka, FL 32703 Bus: 407-880-3167 www.theyeagerbomb.com Hablamos Espaol 1301900 Honesty. Respect. Professionalism. Courtesy. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible.

PAGE 5

The Apopka Chief, July 20, 2018, Page 5A to the most recent housing that is planned along Rogers Road. If that was cut through, Station 5 could be there in two minutes, Carnesale said about his new station along Jason Dwelley Parkway. If Rogers Road was cut through straight north to Ponkan Road, it would come out on to Ponkan a little west of Jason Dwelley Parkway where Wolf Lake Middle School sits. David Moon, the citys senior planning manager, said the extension of Rogers Road needs to be in the long-term plans. Even if the extension was in the citys ly take an imminent domain proceeding because the property owners to the north havent expressed any desire to sell their properties, Moon said. Other items Among the other items that came before DRC, but received little discussion were the proposed IHOP restaurant and AutoZone store that are planned along U.S. Highway 441 just east of where Lake Doe Boulevard dead ends into U.S. 441. The only discussion was brought up by buildwho asked if the 73 parking spots were enough for the IHOP restaurant. The Community Dehim it was. Another item that was talked about was a subdivision planned for the southwest corner of the intersec tion of Binion Road and Lust Road. Moon said the concept plan submitted by develop ers showed 102 50-ft. wide lots on the 31-acre parcel, but that the Community Development staff wasnt in favor of that size lots because Avian Pointe, a development that is nearly complete working its way through the citys approval process, has 75-foot wide lots on the north side of Lust Road. Four polling places have changed in Northwest Orange County for the upcoming 2018 elections, and the Orange gan mailing new voter information cards Monday, July 16, to Orange County voters whose polling places have changed for the 2018 elections. The Apopka-area changes are among several around Orange County. e encourage everyone to check their registration information and update their voter record before election day, if needed, said Bill Cowles, Orange County Supervisor of Elections. This will save the voter time on election day and will ensure they receive important elec tion mailings. All voters affected by the below polling place changes will receive a new votat orangcountyvotes.com. Voters can reStaff: Fire chief said extending Rogers Road would help improve AFDs response times Continued from page 4A Four local polling places changed See POLL S P age 7A Someday Starts Today in Apopka Our medical specialties include: Cardiology | Gastroenterology | Pulmonology | Spine Health Sports Medicine and Rehab | Urology | Women's Imaging | Digestive Health Florida Hospital Apopka Medical Oce Building 2100 Ocoee-Apopka Road, Apopka, FL 32703To schedule an appointment call (-DOCSSomedayStartsToday.com 18-APK-03868 Apopka New MOB Service Ad Apopka Chief & Planter June 2018 Issue R1.indd 1 6/13/18 1:17 PM PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Well, if not the end of the world, definitely the end of our democracy our country as we know it. Like Town Cryers of old, right! Take, for instance, his left, were shouts of reason. My take on it all is that Impeachment! This is their years that journalists are swer has always been Not so. as do the stats regarding ists went to Hillary Clinton... ior as an excuse for your called bad behavior is to Clinton) thought it was a The Audacity of a Dope. e should not slip into collective amnesia over the Obama adgest threat, not Al Qaeda, saying, for 20-years? of the winners and losers in he got what he wanted and we got nothing. Clearly tion when Russia annexed Impeach Obama, do you? Their that, as mentioned in my beall he has accomplished so take an honest look in the Comments Welcomebarefootwahine1@yahoo.com Patti Bankson The End of the WorldThe Way I See It Patti Bankson PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. FOR A FEE ADVERTISED MINIMUM FEE ONLOR FOR FREE SERVICE: THE PATIENT AND ANY OTHER PERSON RESPONSIBLE FOR PAYMENT HAS THE RIGHT TO PAY, CANCEL PAYMENT, OR BE REIMBURSED FOR PAYMENT FOR ANY OTHER SERVICE, EXAMINATION, OR TREATMENT THAT IS PERFORMED AS A RESULT OF AND WITHIN 72 HOURS OF RESPONDING TO THE ADVERTISEMENT FOR THE FREE, DISCOUNTED FEE, OR REDUCED FEE SERVICE, EXAMINATION OR TREATMENT. ONLY VALID WHEN INSURANCE COVERAGE IS NOT APPLICABLE. FOR A FEE ADVERTISED MINIMUM FEE ONLOR FOR FREE SERVICE: THE PATIENT AND ANY OTHER PERSON RESPONSIBLE FOR PAYMENT HAS THE RIGHT TO PAY, CANCEL PAYMENT, OR BE REIMBURSED FOR PAYMENT FOR ANY OTHER SERVICE, EXAMINATION, OR TREATMENT THAT IS PERFORMED AS A RESULT OF AND WITHIN 72 HOURS OF RESPONDING TO THE ADVERTISEMENT FOR THE FREE, DISCOUNTED FEE, OR REDUCED FEE SERVICE, EXAMINATION OR TREATMENT. ONLY VALID WHEN INSURANCE COVERAGE IS NOT APPLICABLE. Creating Beautiful Smiles Since 2007 Con dence StartsWITH A SMILE FREE CONSULTATIONIncludes X-rays & Full Exam (D0330 D0340, D0150) Cannot be combined with any other offer, insurance, or discounts. Must present coupon at time of initial consultation Premier 407-703-2744 www.TheModernSmile.com515 N. Park Ave., Suite 107, Apopka, FL 32712SE HABLA ESPAOL Creating Beautiful Smiles Since 2007 Con dence StartsWITH A SMILE FREE CONSULTATIONIncludes X-rays & Full Exam (D0330 D0340, D0150) Cannot be combined with any other offer, insurance, or discounts. Must present coupon at time of initial consultation 407-703-2744 www.TheModernSmile.com515 N. Park Ave., Suite 107, Apopka, FL 32712 GIVE YOUR CHILD A BEAUTIFUL SMILE THAT WILL BENEFIT THEM FOR A LIFETIME. GIVE YOUR CHILD A BEAUTIFUL SMILE THAT WILL BENEFIT THEM FOR A LIFETIME. Premier SE HABLA ESPAOL PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Frame and Lens PurchaseNot combinable with insurance or other discounts. With coupon. Expires 7/31/18. Reimbursement of your eye exam up to $59.00 Value.* With the purchase of frame and lenses. Cannot be combined with insurance or other discounts. With coupon. Expires 7/31/18. $50 OFF 407-880-0335 407-880-0335 Personalized Service from our Family to Yours. Personalized Service from our Family to Yours.EYE EXAM FREE Frame and Lens PurchaseNot combinable with insurance or other discounts. With coupon. Expires 7/31/18. Reimbursement of your eye exam up to $59.00 Value.* With the purchase of frame and lenses. Cannot be combined with insurance or other discounts. With coupon. Expires 7/31/18. $50 OFF EYE EXAM FREE

PAGE 6

before leaving the vehicle. Dont Leave Them Alone, Not Even for a Minute Never leave chil dren unattended in a ve hicle, even if the windows are open or the air condi tioning is running. Vehicles Arent Play Areas Dont let children play in an unattended ve hicle. Put Keys Out of Sight Always lock your vehicle even in driveways and garages and keep keys out of childrens reach. Call for Help If you see a child or pet alone in the car, call 911 immediately and follow the instructions of emergency personnel. The Apopka Chief, July 20, 2018, Page 6A ALL ABOUT APOPK A (USPS 545-440) The Apopka Chief is published every Friday and entered as Periodicals, postage paid at Apopka 1879. The Apopka Chief newspaper is published by Foliage Enterprises, Inc., every Friday at 400 North master: Send address changes to The Apopka Chief, The Apopka Chief is a consistent award-winning community weekly newspaper and a member of the Florida Press Association. The and 1988, the only three-time winner. Letters to the editor are welcome, but must be signed and include a daytime telephone number, address,, or ters. www.theapopkachief.com, news@theapopkachief.com City of Apopka Telephone Numbers Orange County Telephone Numbers Other Area Numbers of Note City Hall ............................ .................. City Administrator ............ City Clerk .......................... Community Devel. ............ Code Enforcement ............ Finance Dept. .................... Fire (non-emerg.) .............. Parks and Rec. Dept. ......... Police Chief ....................... Police (non-emerg.) ........... Job Line ............................. Solid Waste Collect. .......... Street Maintenance ............ Utility Billing .................... ..................... 911 150 feet above sea level. Its population is about 48,000 and its total area is more www.apopka.net Animal Services .......... Auto/Boat Tags ........... Building Dept. ............. County Chairman ........ County Commission .... County Attorney .......... Clerk of the Court ....... Elections Supervisor ... Fire/Rescue ................. Garbage Collecting ..... Health Dept. ................ Hunting/Fishing Lic. ... Parks and Rec. Dept. ... Property Appraiser ...... Sheriff Administrative Non-Emerg. Complaint Utilities ........................ All other departments .. ............... 911 U.S. Senators Bill Nelson (Dem.) ........... Marco Rubio (Rep.) ......... U.S. Representative Val Demings (Dist. 10) .... State Representatives Kamia Brown (Dist. 45) ... State Senators Randolph Bracy (Dist. 11) 407-656-6716 Orange County Commissioner Rod Love .......................... Orange County Public Schools Pupil assignment .............. Bus routes ......................... Superintendent ................. School Board .................... Miscellaneous The Apopka Chief ............. Museum of the Apopkans Chamber of Commerce ..... 407-886-1441 The Apopka Chief Established 1923 fathers corner drugstore managed to survive until Pearl Harbor, and then World War II turned the economy around. President Trumps campaign promises of turning the Obama economic mess around has had no effect on the leftists who contin ue in their Hate Trump madness despite mountains of success doing this on his watch in only 18 months. According to Moore, The latest Bureau of Labor statistics show six a shortage of workers to the country, employers are signing promised bonuses and truck drivers. Finally, stated Moore, the real unem ployment rate, the socalled U-6 rate, which includes discouraged workers who have dropped out of the work force and part-time work, has fallen to eight percent, down from a high of 16 percent In his two-terms as president, Barack Obama almost doubled the nation al debt from the $10 tril lion from prior decades, to years. I believe that what has saved us is the elec tion of President Trump out of 17 Republicans who insanity of a political party to nominate a person as ethics and morality as Hill ary. Moore suggests ad ditional reforms and ideas that would help workers grow the economy even faster, ) Reinstate the ments of 1996, which helped pull Americans out of welfare dependency and into the workforce. eral minimum wage at $5 an hour to $7 an hour to encourage young workers to get experience. prenticeship program that would give young Americans a college degree ly learning a useful trade. Trump has proposed such changes. 4) Make the Trump tax cuts permanent, especially the immediate expensing provision that encourages business capital spending. 5) Allow employers to get out of Obamacare if they provide lower cost health insurance coverage to their workers. Obam acare has corresponded health insurance premium costs with escalations ex These higher insurance costs to employers are crowding out pay raises for workers and thus reducing work incentives. As Moore suggests, rumps soaring economy and employment can be sent higher. His war on unfair and ridiculous one-way (against us) rates will be the elevators into further our neighbors. The great American work ethic has not been lost, but it has been eroded by years of dumb govern ment policies that Trump and Congress should cor rect. Behold that which I have seen; it is good and comely for one to eat and good of all his labour that he taketh under the sun all the days of his life; this is the gift of God. Ecclesias tes 5:18. Corbeil: Leftists still hate Trump Continued from page 2A sented the annual scholar ships. Attendees who came out for the event supported contest were no strangers nity and included Ms. Joy Strivens, attorney Greg Jackson, and myself. The speakers for this years event were Amiya Hunsinger (Discovery Life Church, Apopka, Pastor Kevyn Bryant), Sonia Maldonado (New Hope Missionary Baptist Church, Apopka, Rev. Dr. H. L. Dericho), and Destiny Taylor (St. Luke Full Gospel Bradford Jr.). Ms. Taylor was declared the winner for this years oratorical contest on Scholarship Sunday. All three speakers ing their presentations. In light of this won derful event, and on a simi lar note, I would like to mention a few events that be hosting in the next few weeks. Neighborhood Commu nity Meeting at the Silver Star Recreation Center. At this meeting, I, along with Safe Neighborhood lead ers, discussed how Orange Countys Safe Neighbor hoods Program works, and listened to each of the three Safe Neighborhoods spokesperson present a seven-minute presentation hoods activities, goals and accomplishments. The Safe Neighborhoods Program Orange Countys older and transitioning communi ties; assists residents and community stakeholders in reclaiming communities before crime and deteriora tion create blighted condi with the Orange County County Government, the private sector, community stakeholders, and others to collaboratively preserve hoods. This was an excel lent opportunity to work together to discuss ways to improve our communi ties. For more information about the Safe Neighbor hoods Program, residents can contact Ms. Allison M. Early next month, along with Apopka Mayor Bryan Nelson and Apopka Commissioner Alexander Smith, I will be hosting a Town Hall Forum that will focus on Engaging Men, Advancing Women. The forum will take place on Wednesday, August 8 Apopka Community Cen ter/VFW, 519 S. Central Ave, Apopka. This event will have two keynote speakers, six panelists, a moderator, and an educa tor/community leader. We will discuss improving communities, in regard to the negative effects that living without active moth ers and fathers has on chil dren. Research indicates that children who grow up in homes without active mothers and fathers are most likely to be aggres sive. This forum is free and open to the public. For more information, residents can refer to the or contact Ms. Shirley Sharpe-Terrell from my My hope for this weeks events and for the upcoming events is to educate the community on how we can build relation ships, reduce crime, and ensure the safety of resi dents. Love: A Town Hall Forum will be hosted August 8 Heatstroke: Never leave them alone in the vehicle Continued from page 2A Continued from page 2A Rev. Richard E. King, and Shirley Sharpe-Terrell July 20, 2018 Publish: The Apopka Chief 160899 PUBLIC HEARING NOTICE SMALL SCALE FUTURE LAND USE AMENDMENT AND CHANGE OF ZONING NOTICE is hereby given that 3255 CLARCONA ROAD LLC has made an application, in accordance with Florida Statutes 163.3187c) and the Apopka Code of Ordinances, Part III, Land Development Code, Article XII, Section 12.04.00, to the City of Apopka City Council, and Apopka Planning Commission for a change in the Future Land Use Designation for approximately 4.75 +/acres from Agriculture to Industrial and a change in Zoning from Agriculture to I-1 Restricted Industrial District. This application relates to the following described property located east of Clarcona Road and north of Stone Road. Apopka City Council Community Development Department Notice is given that a public hearing will be held by the City of Apopka City Council at its regularly scheduled meetings in the City Council Chambers of the Apopka City Hall, 120 E. Main Street, Apopka, Florida on Wednesday, August 1, 2018, beginning at 1:30 p.m., or as soon thereafter as possible. Affected parties and the public may appear at the above listed hearings to speak. The proposed Future Land Use and Zoning can be inspected at the Apopka Community Development Department located at Apopka City Hall on weekdays between the hours of 8:00 a.m. and 4:30 p.m. City Hall address shown below. Please be advised that, under State law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act ADA, persons with disabilities needing assistance to participate at 120 East Main Street, Apopka FL 32703, Telephone: 407-703-1704, no less than 48 hours prior to the proceeding. ORDINANCE NO. 2661 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, AMENDING THE FUTURE LAND USE ELEMENT OF THE APOPKA COMPREHENSIVE PLAN OF THE CITY OF APOPKA; CHANGING THE FUTURE LAND USE DESIGNATION FROM AGRICULTURE 1 DU/ 5 AC) TO INDUSTRIAL MAX F.A.R. 0.60) FOR CERTAIN REAL PROPERTY LOCATED EAST OF CLARCONA ROAD AND NORTH OF STONE ROAD, COMPRISING 4.75 ACRES MORE OR LESS, AND OWNED BY 3255 CLARCONA ROAD LLC ; PROVIDING FOR SEVERABILITY; AND PROVIDING FOR AN EFFECTIVE DATE.Parcel I.D.: 27-21-28-0000-00-045 Contains: 4.75 +/Acres ORDINANCE NO. 2662 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, CHANGING THE ZONING FROM AGRICULTURE TO I-1 RESTRICTED INDUSTRIAL DISTRICT) FOR CERTAIN REAL PROPERTY GENERALLY LOCATED EAST OF CLARCONA ROAD AND NORTH OF STONE ROAD, COMPRISING 4.75 ACRES MORE OR LESS, AND OWNED BY 3255 CLARCONA ROAD LLC ; PROVIDING FOR DIRECTIONS TO THE COMMUNITY DEVELOPMENT DIRECTOR, SEVERABILITY, CONFLICTS, AND AN EFFECTIVE DATE. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible.

PAGE 7

The Apopka Chief, July 20, 2018, Page 7A view and update their information at any time on the Orange County Supervisor of Elections website or angecountyvotes.com or call the ofchanged in Northwest Orange County are: Precinct 229 will move to Apopka Estate. side Baptist Church. Jones Avenue from St Patrick Catholic Church. Polling place changes affect the following precincts around the county: Seventh Day Adventist Church. Oasis Community Church. Church of Orlando. Avenue from Pershing Avenue Christian Church. ican Social Club. Davidson. Stoneybrook Boulevard from StoneyCenter. Center. Conference United Church of Christ Department of Environmen sin Management Action Plan bate for all Orange County Commission candidates seek ing to represent District 2. lic. mal candidate discussions set ty District 2 commissioner will be faced with the daunt ing task of guiding the pro cess of complying with the that will be implemented and reduce nitrogen reaching the for residents who have sep the potential for higher prop to comply with BMAP man Continued from page 5A Polls: Several places around county have changedregulations are: tions for both residents and businesses. Cleansing nitrogen from storm water run off. Mandates to replace con ventional septic systems with sewers or advanced nitrogen reducing systems. and transmission infrastruc facilities. cost of compliance is estimat and homeowner costs is un sewer bills increased.Orange County Commission candidates will debate issues on July 26 July 20, 2018 Publish: The Apopka Chief 160901 PUBLIC HEARING NOTICE CHANGE OF ZONING AMENDMENT CITY OF APOPKA NOTICE is hereby given that Randy Holihan, Brandon Partners has made an application, in accordance with Florida Statutes 163.3187c) and the Apopka Code of Ordinances, Part III, Land Development Code, Article XII, Section 12.04.00, to the City of Apopka City Council, and Apopka Planning Commission for a rezoning of property This application relates to the following described property: Apopka City Council Community Development Department Notice is given that the City of Apopka City Council will hold a public hearing to consider Ordinance NO. 2666 at its regularly scheduled meeting in the City Council Chambers of the Apopka City Hall, 120 E. Main Street, Apopka, Florida on Wednesday, August 1, 2018, beginning at 1:30 p.m. or as soon thereafter as possible. Affected parties and the public may appear at the above listed hearings to speak. The proposed Master Plan can be inspected at the Apopka Community Development Department located at Apopka City Hall on weekdays between the hours of 8:00 a.m. and 4:30 p.m. City Hall address shown below. Please be advised that, under State law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act ADA, persons with disabilities needing assistance to participate in any of Main Street, Apopka FL 32703, Telephone: 407-703-1704, no less than 48 hours prior to the proceeding. ORDINANCE NO. 2666 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, CHANGING THE ZONING FROM COUNTYA-1 PD/ZIP) TO CITYKELLY PARK INTERCHANGE MIXED-USE KPI-MU, AND ASSIGNING A KELLY PARK CROSSING INTERCHANGE AND VILLAGE CENTER OVERLAY DISTRICTS, FOR CERTAIN REAL PROPERTY GENERALLY LOCATED EAST OF STATE ROAD 429 ON THE SOUTHWEST CORNER OF THE INTERSECTION OF WEST KELLY PARK ROAD AND PLYMOUTH-SORRENTO ROAD, COMPRISING 18.13 ACRES MORE OR LESS, AND OWNED BY JD AND KATHLEEN L HORNE TRUST ; PROVIDING FOR DIRECTIONS TO THE COMMUNITY DEVELOPMENT DIRECTOR, SEVERABILITY,CONFLICTS,AND AN EFFECTIVE DATE.Parcel I.D: 13-20-27-0000-00-008 Contains: 18.13 +/Acres July 20, 2018 Publish: The Apopka Chief 160900 PUBLIC HEARING NOTICE CHANGE OF ZONING NOTICE is hereby given that SUNTRUST BANK has made an application, in accordance with Florida Statutes 163.3187c) and the Apopka Code of Ordinances, Part III, Land Development Code, Article XII, Section 12.04.00, to the City of Apopka City Council, and Apopka Planning Commission for a change in Zoning from C-2 General Commercial District) to C-1 Retail Commercial District. This application relates to the following described property located south of East Semoran Boulevard and east of Sheeler Avenue. Apopka City Council Community Development Department Notice is given that a public hearing will be held by the City of Apopka City Council at its regularly scheduled meetings in the City Council Chambers of the Apopka City Hall, 120 E. Main Street, Apopka, Florida on Wednesday, August 1, 2018, beginning at 1:30 p.m., or as soon thereafter as possible. Affected parties and the public may appear at the above listed hearings to speak. The proposed Zoning can be inspected at the Apopka Community Development Department located at Apopka City Hall on weekdays between the hours of 8:00 a.m. and 4:30 p.m. City Hall address shown below. Please be advised that, under State law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act ADA, persons with disabilities needing assistance to participate in any of Main Street, Apopka FL 32703, Telephone: 407-703-1704, no less than 48 hours prior to the proceeding. ORDINANCE NO. 2663 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, CHANGING THE ZONING FROM C-2 GENERAL COMMERCIAL DISTRICT) TO C-1 COMMERCIAL RETAIL DISTRICT) FOR CERTAIN REAL PROPERTY GENERALLY LOCATED SOUTH OF EAST SEMORAN BOULEVARD AND EAST OF SHEELER AVENUE, COMPRISING 0.49 ACRES MORE OR LESS, AND OWNED BY SUNTRUST BANK ; PROVIDING FOR DIRECTIONS TO THE COMMUNITY DEVELOPMENT DIRECTOR, SEVERABILITY, CONFLICTS, AND AN EFFECTIVE DATE.Parcel I.D.: 11-21-28-0750-00-070 Contains: 0.49 +/Acres PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER: is proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. GOLF CLUB Golf Special www.ZellwoodGolf.comCall 407-886-3303 today for your Tee Time! Valid for up to 4 players. Not valid with any other offer. Must present coupon at check-in. Expires 7/31/18. $ 25 18 HOLES THREE-MONTH TRIAL MEMBERSHIP Plus TaxINCLUDES: Green Fees & Cart Fees. One Sleeve of Golf Balls. Unlimited Golf Cart Fees & Range Balls Included Single $650 tax included Family $976 tax included PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER: is proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. See Dealer For Details. Pictures for illustration purposes only. Expires 7/31/2018plus $1,000CUSTOMER CASHfor 72 MONTHS0% APR 2018 FORD EDGE ESCAPE & EXPLORER Web site: www.theapopkachief.com email: news@ theapopkachief.com Phone: 407-886-2777 Fax: 407-889-4121 400 N. Park Ave., Apopka

PAGE 8

The Apopka Chief, July 20, 2018, Page 8A (ATF), which began an investigation because the explosives were left unattend ed. Amphitheater canopy For various reasons, the replacement of the canopy over the Apopka amphitheater has been a slow process, but it appears that the next several weeks. The City Council unanimously awarded a contract to replace the fabric canopy that was destroyed last September by Hurricane Irmas high winds. While that is good news for the city, the better news is that Apopkas por tion of the replacement cost is expected to be no more than $16,249.22 and could be even less. The citys portion could be partially reimbursed by state funds, but that has not been desaid. The total cost of replac ing the canopy is $349,165, but most of that expense will be borne by insurance proceeds of $284,168.10. Another $48,747.68 will be paid for by the Federal Emergency Management Agency (FEMA) via reim bursement for storm damages incurred by the city. Big Span Structures of Crystal River won the bid over Close Construction of Okeechobee. Big Span has done hundreds of projects around the world, including cover ings for sports stadiums, as well as Volcano Bay at Universal Orlando. Edward Bass, city administrator, said he hopes to have Big Span Structures begin the work soon and it is expected to take 12-13 weeks to complete. Splash pad fees The long-awaited splash pad at Kit Land Nelson Park is under construction and the City Council approved a fee structure for those who want to utilize the facility when it opens later this year. After surveying other area cities that have splash pads, the city staff deter mined that the daily fee should be $2 per person with a $20 seasonal pass per person for city residents only. Both fees are for all ages. The splash pad may be rented for a two-hour party for $150 for city residents and $250 for those living outside the city limits of Apopka. The fee includes two attendants for parties, which will be held after the park closes to the public for the day. City documents say the fees will help cover some of the expenses for upkeep and maintenance of the splash pad. Alonzo Williams Park Thanks to a state grant of $750,000, the city plans to build a new community center at Alonzo Williams Park, 515 S. Hawthorne Ave., Apopka. However, when the city solicited bids to construct the new facil ity, the bids came in sever al hundred thousand dollars over the grant amount. The bids ranged from more than $1.1 million to nearly $1.4 million. The design and engineering services for the community center have been provided by CH2M Hill, which estimated the cost of construction to be $740,00, but based on the bids, was too low. As a result, the city has re-hired CH2M Hill to provide an updated cost estimate for community center at a cost of $34,970. The cost of the new designs would be funded through savings in the citys recreation budget, according to city documents. Development plans Several projects came before City Council for apdevelopment plan and three others seeking approval for a preliminary development plan. Among the items that development plan is a proposed Dollar General store at the northwest corner of the intersection of Park Avenue and Michael Gladden Boulevard (Ninth Street). However, the approval of the Dollar General was delayed for at least two weeks as the City Council voted to table the matter until the August 1 meeting because of concerns over Commissioner Kyle study by Dollar General, for the intersection where the store will sit at Park Avenue and Michael Gladden Boulevard should be enough to take another look at approving the project. City staff said they will tant to take a look at the in the study. The 7,600-square foot retail store began its trek through the citys approval process beginning in March 2017. If eventually approved, both Michael Gladden Boulevard and Park Avenue will have entrances for the stores parking lot that would have 25 parking spaces. development plans were three housing projects for 262 single-family homes in three proposed develop ments in various areas of the city. Preliminary develop ment plans were approved for three projects, including Greystone skilled nursing facility at Alston Bay Boulevard and Ocoee-Apopka Road near the new Florida Hospital Apopka campus. The other two projects are housing developments. One is a 52-lot single-fam ily home project near the Wekiva Parkway inter change at Kelly Park Road and the other is a 92-townhome development locat ed on the north side of Old Dixie Highway near where Bradshaw Road dead ends into Old Dixie Highway. There were three zoning change approvals, one of which is for the proper ty that is expected to one day be home to a Publix supermarket. The proper ty, owned by the J.D. and Fireworks: City Council awards bid to replace amphitheater canopy Continued from page 1A City Commissioner Kyle Becker speaks during the meeting on Wednesday, July 18. See FIRE W OR KS Page 10A Home Delivery for Only $25* a Year!* New or Renewal(Orange County) $30 Out of CountyName_________________________________________________ Address_______________________________City_____________ State___________Zip________Phone Number________________ Amt. Enclosed $_____________Clip this coupon and bring it in or mail it to: The Apopka Chief The Apopka Chief CARDS Dont miss another issue. Subscribe Today! Visit www.TheApopkaChief.com to Subscribe, Renew or Pay Online! Create a Keepsake! Funeral and cemetery services at one location. Stop by for a tour of our newly designed funeral home lo cated in Apopka.A FREE FUNERAL PLANNING GUIDE is available upon request or online at www.highlandfh.com. HIGHLAND FUNERAL HOME 3x5 High.Were.Open Funeral Home NOW OPEN PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Im here to help life go right, by saving you time and money when you combine your home and auto insurance. CALL ME TODAY. State Farm Mutual Automobile Insurance Company State Farm Indemnity Company State Farm Fire and Casualty Company State Farm General Insurance Company Bloomington, IL Shren Yeager, Agent 49A East 3rd Street Apopka, FL 32703 Bus: 407-880-3167 www.theyeagerbomb.com Hablamos Espaol 1601486 See why millions trust us for Home & Auto. Im here to help life go right, by saving you time and money when you combine your home and auto insurance. CALL ME TODAY.State Farm Mutual Automobile Insurance Company State Farm Indemnity Company State Farm Fire and Casualty Company State Farm General Insurance Company Bloomington, IL Shren Yeager, Agent 49A East 3rd Street Apopka, FL 32703 Bus: 407-880-3167 www.theyeagerbomb.com Hablamos Espaol 1601486 See why millions trust us for Home & Auto. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. 316 S. Central Ave., Apopka Recovery from auto related injury. A few seconds in an auto accident can turn into years of suffering. Se Habla Espaol Status is in consideration from practice procedures over the past years of providing safe, quality, and affordable health care services to patients by consistently incorporating the most current and best clinical evidence into their treatment plans. Dr. Mark Boylan, Chiropractic Physician Dr. Boylan has earned Tier 1 participation in the OptumHealth/United HealthCare Tier 1 Advantage Program. earned Tier 1 316 S. Central Ave., ApopkaRecovery from auto related injury.Status is in consideration from practice procedures over the past years of providing safe, quality, and affordable health care services to patients by consistently incorporating the most current and best clinical evidence into their treatment plans. A few seconds in an auto accident can turn into years of suffering.se habla espaol Dr. Mark Boylan, Chiropractic Physician Dr. Boylan has earned Tier 1 participation in the OptumHealth/United HealthCare Tier 1 Advantage Program. PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign Below Date Approval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. We Are Moving...Sooner Than Later... Deco Gallery Innovative Ideas for the Home & Garden2640 W. OBT in Apopka PREMOVING SALE!Starting July 21stEVERYTHING 50% OFF N. Park Ave. Orange Blossom Trail 429 Binion Rd. 407-410-0888 Monday thru Saturday 9AM 5PM Sunday 12 PM 5PMJust West of Home Depot

PAGE 9

The Apopka Chief, July 20, 2018, Page 9A an advantage for Apopka. e have no collective bargaining and no union. Thats a huge savings for the cityAnderson said, adding that a limit of three percent for merit raises will affect the quality of police work. It will all but destroy our efforts to recruit and retrain quality law enforcewill suffer Harmon, said that continu ing to utilize red-light cam eras would be a good way to fund the merit pay increases, but also said that the cameras add safety to the city campaign earli er this year, Mayor Nelson ran on a platform of getting rid of the red-light cameras when the contract expires telling you s because of safetyHarmon said. eve solved several accidents that we wouldnt have been able to do otherwise because of the cam eras. Ive covered two fatal accidents that were caught by cameras. We wouldnt have had that otherwise. If you dont think s a safety issue and you vote to get rid of them and your family member or someone you know gets hurt or killed at an intersection that used to have a red-light camera, if you feel good about that, thats OK, but I think they actually are a safety thing, not just a money thing. The city has averaged about $800,000 in net revenue annually from the red-light cameras, but will have only about a quarter of that money available for contract for the cameras is Former Orange Counwhose son Robert is an spoke in favor of the higher merit-pay increase. This is not where you smart means you take care you take care of your people, your people will take care of you. the City Council, City Adsaid that for each percent age-point increase in the merit pay for all city employees, it would cost Apopka $250,000. An additional three percent would mean $750,000 more would be needed in the budget, but wouldnt need that much more revenue because the average merit-pay increase cent, meaning the budget would need another $500,000 to meet the reRoberson, the citys new looking for ways to get the budget in balance. Were looking at every line. Were continuing to look for ways to provide savings. Immediately after the discussion about the mer it-pay increases for city staff, the City Council voted to approve the proposed property tax rate by a halfmill, which would increase the tax rate to 4.2876 mills, which would mean an increase of $50 a year per erty value. (A full story about the property tax rate is elsewhere in this edition.) a.m. to noon for constituent outreach. 6275 for an appointment. Those needing immediate assistance may visit or contact the Eustis Pay: Former Orange County sheriff speaks in favor of higher raises Continued from page 1A Former Orange County Sheriff Kevin Beary speaks to the City Council at its meeting held on Wednesday, July 18.State reps staff will have Apopka office hoursJuly 20, 2018 Publish: The Apopka Chief 160903 PUBLIC HEARING NOTICE CHANGE OF ZONING AMENDMENT CITY OF APOPKA NOTICE is hereby given that Robert Vesely has made an application, in accordance with Florida Statutes 163.3187c) and the Apopka Code of Ordinances, Part III, Land Development Code, Article XII, Section 12.04.00, to the City of Apopka City Council, and Apopka Planning Commission for AN AMENDMENT TO THE PUD ZONING ORDINANCE NO. 2345 This application relates to the following described property: Apopka City Council Community Development Department Notice is given that a public hearing for the amendment to Ordinance 2345 will be held by the City of Apopka City Council at its regularly scheduled meetings in the City Council Chambers of the Apopka City Hall, 120 E. Main Street, Apopka, Florida on Wednesday, August 1, 2018, beginning at 1:30 p.m. or as soon thereafter as possible. Affected parties and the public may appear at the above listed hearings to speak. The proposed PUD Zoning Ordinance can be inspected at the Apopka Community Development Department, located at Apopka City Hall on weekdays between the hours of 8:00 a.m. and 4:30 p.m. City Hall address shown below. Please be advised that, under State law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act ADA, persons with disabilities needing assistance to participate at 120 East Main Street, Apopka FL 32703, Telephone: 407-703-1704, no less than 48 hours prior to the proceeding.ORDINANCE NO. 2668 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, AMENDING ORDINANCE 2345, WHICH AMENDS THE ADOPTED KOA CAMPGROUND PLANNED UNIT DEVELOPMENT PUD) MASTER PLANFOR CERTAIN REAL PROPERTY LOCATED AT 3800 WEST ORANGE BLOSSOM TRAIL, COMPRISING 10.2 ACRES MORE OR LESS; OWNED BY ORANGE BLOSSOM APOPKA RV RESORT INC; PROVIDING FOR DIRECTIONS TO THE COMMUNITY DEVELOPMENT DIRECTOR, SEVERABILITY, CONFLICTS, AND AN EFFECTIVE DATE. Parcel I.D: 36-20-27-0000-00-020 Contains: 10.2 +/AcresJuly 20, 2018 Publish: The Apopka Chief 160902 PUBLIC HEARING NOTICE CHANGE OF ZONING AMENDMENT AND MASTER PLAN CITY OF APOPKA NOTICE is hereby given that Pulte Home Corporation has made an application, in accordance with Florida Statutes 163.3187c) and the Apopka Code of Ordinances, Part III, Land Development Code, Article XII, Section 12.04.00, to the City of Apopka City Council, and Apopka Planning Commission for a rezoning of property and Master Plan This application relates to the following described property: Apopka City Council Community Development Department Notice is given that the City of Apopka City Council will hold a public hearing to consider Ordinance No. 2667 and its associated Master Plan at its regularly scheduled meeting in the City Council Chambers of the Apopka City Hall, 120 E. Main Street, Apopka, Florida on Wednesday, August 1, 2018, beginning at 1:30 p.m. or as soon thereafter as possible. Affected parties and the public may appear at the above listed hearings to speak. The proposed PUD Master Plan can be inspected at the Apopka Community Development Department located at Apopka City Hall on weekdays between the hours of 8:00 a.m. and 4:30 p.m. City Hall address shown below. Please be advised that, under State law, if you decide to appeal a decision made with respect to this matter, you will need a record of the proceedings and may need to ensure that a verbatim record is made, which record includes the testimony and evidence upon which the appeal is to be based. In accordance with the Americans with Disabilities Act ADA, persons with disabilities needing assistance to participate in any of Main Street, Apopka FL 32703, Telephone: 407-703-1704, no less than 48 hours prior to the proceeding. ORDINANCE NO. 2667 AN ORDINANCE OF THE CITY OF APOPKA, FLORIDA, CHANGING THE ZONING FROM RESIDENTIAL SINGLE-FAMILY DISTRICT R-1AA) TO PLANNED UNIT DEVELOPMENT PUD, FOR CERTAIN REAL PROPERTY GENERALLY LOCATED ON THE EAST SIDE OF ROGERS ROAD, APPROXIMATELY ONE-HALF MILE NORTH OF THE INTERSECTION OF ROGERS ROAD AND LESTER ROAD, COMPRISING 61.1 ACRES MORE OR LESS, AND OWNED BY MIKHAIL WAFAA, ABDELSAYED GEORGE, ABDELSAYED LUCY, AND ABDELSAYED WAFEEK ; PROVIDING FOR DIRECTIONS TO THE COMMUNITY DEVELOPMENT DIRECTOR, SEVERABILITY,CONFLICTS,AND AN EFFECTIVE DATE. Parcel I.D: 29-20-28-0000-00-003 Contains: 61.1 +/Acres Find GREAT deals & coupons in the circulars in The Apopka Chief this FRIDAY! Chief Find GREAT deals & coupons in the circulars in The Apopka Chief Find GREAT deals & coupons in the circulars in The Apopka Chief JAMES MALTBY Owner Licensed & Insured 321-689-5866 MALTBYSTree Service & Landscaping Maintenance PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Tell them you saw it in The Apopka Chief

PAGE 10

The Apopka Chief, July 20, 2018, Page 10A city is proposing for the upcoming budget. (A full storequest is elsewhere in this edition.) Because of state laws, the City Council can easily reduce that proposed half-mill increase, but if they had set no increase or a lower one, it is much tougher to raise it once the proposed millage rate is passed. At a budget workshop on July 5, City Commissioner Kyle Becker suggested the half-mill rate after Mayor Bryan Nelson proposed a quarter-mill increase. Becker echoed that same thought at the July 18 City Council meeting. set that we need to take it down, he said, adding that he wants the city to fund an economic development position so that more businesses are brought into town. fully support a halfmill (tax increase), Becker said. Currently, the General Fund portion of the proposed budget that will take effect on October 1 is $46,406,650, which is 3.28 percent lower than the cur rent budget of $47,978,759. Although the proposed property tax increase was given approval, City Administrator Edward Bass said he and Jamie Rober director, are still looking for ways to get the budget tinuing to look for ways to provide savings. Among the items in the budget are four new employees as two new people public safety dispatch center and two others will be hired for the building department. A plans examiner and a permit clerk will help in the building department to keep up with booming growth in Apopka, Bass said. He added that funding for those positions will be offset in part by fees charged to developers for those services. sary votes for the proper ty tax and budget will take place on September 5 at 5:15 p.m. at City Hall. Kathleen L. Horne Trust, is at the southwest corner of the intersection of Kelly Park Road and Plymouth-Sorrento Road within view of the Wekiva Parkway interchange. The zoning change would be from county agriculture to Kelly Park Interchange MixUse, which is a special zoning for that immediate area around the interchange. The 18-acre parcel is expected to house a Publix supermarket of 46,031 square feet along with other smaller businesses. Earlier this year, Publix told city staff that it could be three years or so before the store is built. Bid winners Two contracts were awarded by the City Council at its Wednesday, July 18, meeting. improvements for the inter section of Martin Street and Vick Road. mitted the lowest bid for the re-construction of the intersection adjacent to Apopka High School. Barracuda Building bid of $223,265 was more than $75,000 lower than the next-lowest bid. There day, July 10. The second-lowest bid was $302,965 submitted by Florida Safety Contractors, Inc. of Thonotosassa. The project includes re-construction of approximately 670 linear feet of Vick and Martin roadways, along with driveways, sidewalk, and drainage structures. be installed at the intersec tion, but that is not part of this project. The second contract approved by the City Council was for the installation of the potable water main extension on Stutzman Court. The bid was won by Stage II Door, Inc., for $163,840 to install approximately 3,000 linear feet of six-inch potable water pipe. The city will pay for the project through water impact fees and then will be reimbursed for the cost through a legislative appropriation from the state government. Other items The City Council also gave the OK to purchase a new standby generator for a water plant, awarded a concepted a state grant to improve an athletic complex. The generator will replace a 34-year-old one at the Mount Plymouth Lakes Water Treatment Plant that was installed by Orange County Utilities, which built the plant that Apopka purchased several years ago. The new standby generator will cost $99,222. The extension of the Moore Stephens Lovelace, P.A., is for one year. The city hired the Orlando ofcial audits. The original contract was for three years with two one-year options. of the two options. The cost for the audit on September 30 will be $51,000. The state grant for recreation is for $50,000 and will be spent on improve ments to the Apopka Athletic Complex on Wells Street near the Apopka Ninth Grade Center. The bulk of the grant $30,000 will be spent on equipment for the playground, while $10,000 will go to additional surface materials for the playground. The remaining $10,000 will be spent to renovate, replace, or add restrooms, baseball dugouts, drinking fountain, picnic facilities, and a bike rack. The grant is from the Florida Recreation Development Assistance Program. The city applied for the grant in October 2016. As part of its ongoing efforts to improve pedestrian safety in Apopka, the Apopka Police Department will be conducting a three-day pedestrian safety enforcement operation that will focus on motorists who fail to yield the right-of-way to pedestrians. The three-day operation will take place on July 31-August 2 at several crosswalks within Apopka. be conducting the enforcement operation at heavily cers dressed in plain clothes will be crossing the street monitor the crosswalk for motorists and pedestrians who fail to yield the rightof-way or who take unsafe and unlawful actions. Drivers and pedestrians stopped during this safety operation will be issued warnings or citations. The Apopka Police Department is committed to preventing these tragic deaths and is leading the effort with proactive enforcement and education programs, said Deputy Chief Randy Fernandez. The department is conducting this public awareness and enforcement program to educate and encourage members of the community to develop and maintain safe practices while driving, walking, and cycling throughout Apopka. Crosswalk enforcement actions are an effective way to communicate pedestrian right-of-way laws to both drivers and pedestrians.The police department conducts enforcement actions in response to community requests and to educate the general public on the rules at marked and unmarked crossings. Those who choose to ignore the law and the message, however, will be deterred from future violations through enforcement. As is the case is easy to avoid a ticket. In this case, simply yield the right-of-way to pedestrians who are in a crosswalk. Continued from page 1A Taxes: Next tax vote will be Sept. 5 Fireworks: Auditors contract renewed for year Continued from page 8A Apopka police will focus on safety for pedestrians July 31 through August 2 PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. NOW ENROLLING FOR THE 2018-2019 SCHOOL YEAR! VPK (limited spots available) Before & After School Care SCHOOLS WE SERVICE: 441 S Highland Ave. Apopka, Florida 32703 | 407-886-0015 OFFERING Hours of Operation: 6 a.m. 6 p.m. (Activities, Teacher Directed) Like us on Facebook Get important news when it happens News that can affect you and your familyYour Trusted News Source The Apopka Chief www.TheApopkaChief.comSubscribe, Renew or Pay Online! Get Your E-edition Now! Home Delivery for Only $25* a Year!* New or Renewal(Orange County) $30 Out of County Name_____________________________________________________________ Address_______________________________________City__________________ State_______ Zip________________Phone Number_______________________ Amt. Enclosed_______________ Clip this coupon and bring it in or mail it to: The Apopka Chief CARDS PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Richard Petrilli, DMD, PA COMPREHENSIVE ADULT DENTISTRYProviding Extraordinary Care for Extraordinary Patients 407-884-1846 Celebrating over 20 years of exceptional service to the Apopka Area! 407-884-1846 Richard Petrilli, DMD, PA COMPREHENSIVE ADULT DENTISTRY Providing Extraordinary Care for Extraordinary Patients Celebrating over 20 years of exceptional service to the Apopka Area! Lyne Sy Tangco, D.D.S.Complete Family Dentistry New Patients WelcomeLanguages Spoken: Creole and TagalogMon., Tues., and Thurs. 8:00 a.m. to 5:00 p.m. Wednesday and Friday 8:00 a.m. to 2:00 p.m.1706 E. Semoran Blvd, Suite 106, Apopka 407-886-8817 Apopka Dental Art, P.A. Keep SmilingSpecial Introductory Offer $49 Most Insurance Acceptedincludes full exam Fmx, Panoramic & Consultation apopkadentalart.comuninsured patients only PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. CARDS CARDS CARDS CARDS PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. When Quality Service Matters D O BROTHERSLandscaping & Maintenance Corp.26 years of service with Full Service Landscape and Maintenance C o n t r o l S U M M E R g r o w t h You pay: Fair PricesWe pay: Close Attention to Detail!You call: Don at 407-369-0431 We give: References and free estimates. Licensed & Insured

PAGE 11

!"#$%"&'()*++++++++++++,-./01#2$0(*&++++++++++++++++,!"#$%&'&()$*"+#, !"#$%&'(%&')*(%+,-.%)/ -+,#./01# 23*!456$7 itchen apers!"#$%&'()*$$ +,-(.(/01$./%2/"3$ 2//+$01()*$34,$ ",.(5,1$/)$5&*,$678!"!#$%&!'(!)%*((+!,$-.!/-++!'$&0!1+$%0!(2!)$'3.45$67!"3839'!:7!;.(!$?K4JC:4L::L?! ??? !"!<3+'-460$.!.032-(2!;(.!"1(1&$!A-8*!)%*((+!%+$9909!(;!=L:C4MC!/-++!G0!*0+5!)$'3.5$67!@3+6!J=7!$'!'*0!N0++/((5!B(<<32-4'6!B02'0.7!E=M>!O2-(2!)'?7!N0++/((5?!F*0!.032-(2!/-++!G0!*0+5!;.(!10.!10.9(2?!,3259!9*(3+5!G0! 902'!'(!)*$.(2!I.0H(7!=J!D?!)3<<-'!)'?7!"1(1&$7!EJK=J?!,(.!<(.0!-2;(.<$'-(27!%$++!I.0H(!$'!:>K4QQL4JQKC7!(.!D$620!B$.'0.!$'!ECJ4ECK4M=>E!(.!ECJ4C=M4K:MC? ??? !"2!"1(1&$!R0.-S(2!9'(.0!-9!5(2$'-28!31!'(!JJ>!G$%&1$%&9!'(!9'3502'9!-2!'*0!%(<<32-'6!$9!1$.'!(;! $!2$'-(2$+!G$%&1$%&!8-H04$/$6?!!!T2!)325$67!@3+6!JJ7!'*0!FBB!9'(.0!$'!J=>K!U?!)0<(.$2!#+H5?7!"1(14 &$7!$2!$3'*(.-S05!R0.-4S(2!/-.0+099!.0'$-+0.7!/-++!1$99!(3'!G$%&1$%&9!G04'/002!=4:!1?>>!1$.4 '-%-1$'-28!FBB!$25!D-.04 +099!N(20!9'(.09!'*$'!/-++!5(4 2$'0!=QK7>>>!G$%&1$%&9!;3++!(;!9%*((+!9311+-09!'(!%*-+5.02!'*.(38*!FBBV9!$223$+!)%*((+!W(%&9!#$%&1$%&!X-H0$/$6?!!!Y(%$+!;$<-+-09!<$6!G.-28!'*0-.!%*-+5.02!'(!'*0!9'(.0!'(!1-%&!31!$!G$%&1$%&!OOHGZLWKSHQFLOVSDSHUD102%-+!G(Z7!$25!<(.0?!!!#$%&1$%&9!/-++!G0!DYDLODEOHRQDUVWFRPHUVWVHUYHGEDVLV 7)8($/'$.8"''1$,)+9:$;<1/+=0#)9$9#<>+'>$)>?$@)8(&)8($A+B#)C)0$);'>A$#B#>/. !"#$%&%'(#)(&*%(+, "1(1&$!B*-0;!)'$;;!!!T.$280!B(32'6!2$<05!$2!"1(1&$!.09-4502'!(20!(;!9-Z!B-'-S029!(;! '*0![0$.!;(.!*0.!0Z'029-H0!%(<<32-'6!90.H-%0!'*$'!-2%+3509!$!/00&+6!;.00!'3'(.-28!1.(8.$=Q!T.4$280!B(32'6!B(<<32-'6!B(2;0.02%0!-2!'*0!W02$-949$2%0!)02-(.!B02'0.!-2!T.4+$25(!(2!)$'3.5$67!@3+6!=:?!)*0!-9!$!9-28+0!<('*0.!(;!'*.00!9(29?!!^_'!<0$29!'*$'!10(1+0!$.0!2('-%-28!'*0!/(.&!'*$'!_! $!60$.97!\(..-9!90.H05!$9!$2!0Z0%3'-H0!G($.5!<0<4G0.!;(.!'*0!"<0.-%$2!B$24%0.!)(%-0'64W0+$6!;(.!Y-;0! "1(1&$? !! )*0!-9!$!.0%-1-4 02'!(;!'*0!b""BI!T.$280!B(32'6!G.$2%*!)0.H-%0!'(!'*0!B(<<32-'6!"/$.5?!)*0!-9!$+9(!$!%$<1$-82!<$2$840.7!<(9'!.0%02'+6!;(.!B(<4<-99-(20.!"+0Z$250.!A?!)<-'*7!/*(!/(2!$!90$'!(2!'*0!"1(1&$!B-'6!B(32%-+!0$.+-0.!'*-9!60$.?!!!!"'!'*0!%(2;0.02%0!+32%*0(2!/*02!Y(H0!%(<4<02'05!(2!\(..-9V!%(<4<32-'6!90.H-%07!*0!UVWDVNHGWKHDXGLHQFHLI'*06!.0<0$9#8#+B#.$*+/+D#>$',$E#)9$)C)9?$,'9$8';;<>+/0$.#9B+8# Pictured above are, (l-r), Alexander Smith, City of Apopka Commissioner; Monique Morris, recipient of the Citizen of the Year Award; and Rod Love, County Commissioner, District 2. Pictured back row left corner is Jonathan Elicier, selected to be an Alpha Leader of the Wolf Pack Welcomes summer orientations group at Newberry College. See AWARD Page 5B Apopka residents Rebecca Pennell as Kate Monster and Alec Lacher as Rod will perform in the musical, "Avenue Q," high-school version at Dr. Phillips High School July 20-21 and August 17-18 at 7 p.m. each day. Tickets are $10. Between the performances at DPHS, the Dr. Phillips Visual and Performing Arts Theatre Magnet, Troupe 4276 will travel to the American High School Theatre Festival in Edinburgh, Scotland. The group will travel to London, England, then to Edinburgh, July 28-August 10. 95/5'&)1$3/$5,"2/"%$()$%01(.&Ruby Nunez completed a week at Electronic Arts (EA) Tiburon, Maitland's STEAM video gaming sum-mer camp. She was one of 10 female high school stu-dents that attended the summer camp. The stu-dents were mentored by software engineers, given exclusive access to EA pro-prietary technology and tools, operated 3D anima-tion software, visited a re-cording studio, participat-ed in play-testing sessions and more. They learned about the gaming culture and career opportunities. Ruby plans on taking more tech courses at Apopka High School and Florida Virtual School. :9$;0%%,"$<&%5$./%5-,3,+ !@(2$'*$2!U+-%-0.!(;!"1(1&$!*$9!G002!90+0%'05!'(!90.H0!$9!$2!"+1*$!Y0$50.!;(.!'*0!J>=Q!D(+;!I$%&!D0+%(<0!93<<0.!(.-02'$'-(29!$25!A(/+!U;;0%'!$'!b0/G0..6!B(++080!e)?B?f?!D(+;!I$%&!D0+%(<0! *0+1!90'!'*0!9'$80!;(.!$%$50<-%!.0$5-2099!$25!93%%099;3+!%(<<32-'6!-2'08.$'-(2!'(!b0/G0..6!B(++080?!A(/+!U;;0%'!-9!'*0!VHFRQGVWHSLQDUVW\HDU9'3502'V9!'.$29-'-(2?!"+1*$!Y0$50.9!/0.0!90+0%'05!;.(/)/+'>$A9'<& D0&-/$!)1.-289!)'$'0! I$.&7!+(%$'05!-2!"1(1&$7!-9!*$H-28!a-9%(H0.6!A(3.!-2!'*0!I$.&!)325$6!$;'0.2((2!-2!'*0!1$.&V9!_2'0.1.0'-H0!I$H-+-(2!$'!J!1?:4QQ:4J>>L? F);+1+#.$+>B+/#?$/'$G"#)/1#0$H9+11$I$*"+11 G#(+C)$2&9+>A.$&9'A9);.$)9#$.8"#?<1#? !I*-++-9!D*0$'+06!U+40<02'$.6!)%*((+!/-++!*(9'!$!X.-++!j!B*-++!(2!)$'3.5$67!"3839'!==7!;.(
PAGE 12

!"#$%&'&()$*"+#,-$$./01$23-$2345-$6)7#$28 !"#$%&'()*+$#,-. "#$%!&'()*+,%-! $.#!(%!/"'#-!"#! "'0!1%(+*2%3! $/-&0+01&,/#-23 ,+4 '+*#4!50*-.67+! -.2%!"/! &'()*$.2*"#8 !"#"$%&'$"(%)$'*"$+),"!"#$%#&'()(*+,(-.#&/0&.&102034%0$5()(20&46./#4&5 *77$#.&10()(*+,(207.#85 9$01/8#1.$(:086#10!"##$%&'$"##$(&)'$'*+",'$-**./0!"#$%&$$"'()## '85;<;=>?.@44A143\HDUVLQ%XVLQHVV‡/LFHQVHG,QVXUHG&$& &*&(&&&& Add Your Church To Our List. Call (407) 886-2777 Newspaper readers are ACTIVE CONSUMERS! !!!!!"#$!"#$!%&'(!)*+!,-./001/,,2,"%&'(&)*+!)345#4(67!89':79!4;!<=5'5!,-./002/>??2"'',-.)/!&0!1&2!)343@&!)55=AB(C!4;!D4E!,-./002/>0-2!FG=!89':79!*&:@9&A!H44E5!,-./..,/-...34%(*'(!!)343@&!I6:5#!J&3#65#!,-./002/>2>0!I6:5#!)G#6479!*65564G&:C!!J&3#65#!89':79!,-./12K/?K10!I6:5#!J&3#65#!89':79!4;!!*4'G#!L4:&!K?>/K0?/>>>>!I6:5#!J&3#65#!89':79!4;!!"&G(&GE4!"3:6GM5!,-./.00/20-N!I6:5#!J&3#65#!"4::=G#4!K?>/K0K/>>,N!I6:5#!J&3#65#!89':79!4;!!!"O==#O&#=:!,-./02>/K01K!I6:5#!J&3#65#!89':79!4;!P&GM=:6G=!K?>/K0K/.1>-!I6:5#!J&3#65#!89':79!!4;!Q=((O44E!,-./001/-?-1!I4:=5#!)R=G'=!J&3#65#!!!89':79!,-./002/,K.,!I4'G#&6G!4;!S6;=!!J&3#65#!89':79!4;!)343@&T!UG7$!,-./0N,/0K>>!D453=(!8=G#=:=E!89':79!0--/1>,/20?-!V43=!J&3#65#!89':79!,-./002/210-!V4#!W4E!89':79!D4E5:4E5<49GXC&944$74A!S47@9&:#!J&3#65#!89':79!,-./>1?/NNKK!*784:A67@!W4&E!!J&3#65#!89':79!A774:A67@:4&EX(6R=$74A!Y4:#956E=!J&3#65#!89':79!,-./00,/,,,K!P9=!89':79!&#!F&@!S=R=(!,-./2?2/N?>K!!!%(=&5&G#!Z6=O!J&3#65#!!!89':79!,-./002/2.N.!W6R=:56E=!J&3#65#!89':79!,-./>1?/K0?-!"3:6GM5!84AA'G6#C!!J&3#65#!89':79!,-./001/>>,Shren Yeager 49A East 3rd Street, Apopka 407-880-3167 Like a good neighbor, State Farm is there. ¨ Apopka Auto UpholsteryBC(DA(B/@(:/800/E(*747F.GH0@#&%(*%6.&10(I#514"&/(*"/4JK&(H"5#&055(B;(?0.85,@.8$0&0()(L."$(M#/N'08.$%E(OP&085 LOOMISCREMATIONS $795 407-880-1007FUNERAL HOMES When you advertise in this section, you get the best of both worlds: low-cost ads AND targeted advertising!Maximize your marketing dollars by FOCUSING your advertising campaign on a concentrated market!!"#$!S'@=[5!I'((!D453=(!!J&3#65#!89':79!K?>/.K?/1N11!P:6G6#C!J&3#65#!89':79!,-./002/>122!H=@6O&!"3:6GM5!J&3#65#!89':79!,-./002/.02,3*.),!J=&:!S&@=!J6B(=!89&3=(!,-./?2K/K1KN3*.)*+4)!5+*,6+,!UL*W!K>N/1,0/K>1074(8&)*+!"#$!I:&G765!4;!)55656!,-./002/,2->!"#$!*&:C[5!\%:4#=7#:=55]!!^@:&6G6&G!‡!,-./002/,0-K7849*'-4(*+!$%*'+&%4)!)57=G564G!89':79T!8+8!,-./00-/1???!789*'(*46! 89:65#!8=G#=:=E! !89:65#6&G!89':79!K>N/KKN/--K2!<4':G=C!89:65#6&G!89':79!,-./00,/.>>K!W4'GE!S&@=!89:65#6&G!!89':79!K?>/.K?/SFZ+789*'(*46!5+*,6+,!89:65#6&G!"76=G7=!89':79!,-./K01/,>--78:9+8!&0!789*'(!)343@&!89':79!4;!89:65#!,-./001/>2K2!89':79!4;!89:65#!!4;!%(CA4'#9!,-./002/N,22!89':79!4;!89:65#!!4;!H=5#!F:&GM=!,-./2?2/>..-!P:6/86#C!89':79!4;!89:65#!,-./1>-/N.?.!N-#9!"#:==#!89':79!4;!89:65#!,-./00,/,0K?78:9+8!&0!1&2!89':79!4;!D4E!4;!Q=((O44E!,-./002/K-.,!D:&7=!"#:==#!89':79!4;!D4E!,-./>10/1N00!V=&(6GM!H&#=:5!89':79!!4;!D4E!,-./002/K.0-!%&:@!)R=G'=!H4:5963!8=G#=:!,-./002/>212!"4::=G#4!89':79!4;!D4E!K?>/.K?/,>,?78:9+8!&0!;,':'!789*'(!&0!<4((,9!=4/!54*6('!)343@&!H&:E!,-./00-/10.. $%*'+&%4)!89':79!4;!#9=!V4(C!"36:6#!,-./002/N.,->4*(8!462!?&92!H4:E!4;!S6;=!,-./002/.,>.>:))!1&'%,)!*6((=G6'A!4;!D(4:C!,-./0N,/--,N!Y=O!84R=G&G#!!%=:;=7#6GM!*6G65#:6=5!!,-./00-/0010@&)*6,'' !"#$!*&##9=O!V4(6G=55!,-./001/>>.,A62,%,62,6(!P:'=!P=A3(=!4;!D4E!,-./00-/0N0NA6(,92,6&-*64(*&64)!!Y=O!Z6564G!!84AA'G6#C!89':79!,-./002/K2N1!Y4:#9O=5#!84AA'G6#C!!89':79!,-./?.0/>-00!FG=!)774:E!89:65#6&G!!I=((4O5963!89':79!,-./?>K/K-->;,B*'8!84GM:=M@G!J=#9!)A!,-./02>/K?-?!84GM:=M@G!4;!W=;4:A!!<'E&65A!,-./2,?/-,,,<:(8,946!"#$!%&'(!S'#9=:&G!,-./001/>2K,#,(8&2*'(!I6:5#!^G6#=E!*=#94E65#!,-./002/K,>N!J=&:!S&@=!^G6#=E!*=#94E65#!,-./02>/N?KN!Q=((O44E!^G6#=E!*=#94E65#!,-./001/,,>2#&94C*46!!W4((6GM!V6((5!!*4:&R6&G!89':79!,-./KK>/0K0-D4E49,6,!8&(R&:C!89':79!4;!!#9=!Y&_&:=G=!,-./001/>N,0!)343@&!"3:6GM96((!89':79!4;!!#9=!Y&_&:=G=!,-./00,/0K>>D&6F=,6&-*64(*&64)!)G46G#=E!H4:E!I&A6(C!!H4:5963!8=G#=:!,-./002/,101!8=G#=:!4;!I&6#9!89':79!!;4:!)((!%=43(=!,-./,2,/1K.?!89':79!4G!#9=!+EM=!,-./021/NNKK !84A3&55!84AA'G6#C!!!89':79!,-./00-/2NN-!L&C53:6GM!84AA'G6#C!!89':79!,-./0N,/,112!+R=:(&5#6GM!84R=G&G#!!89:65#6&G!8=G#=:!,-./00,/0?10!I&6#9O4:@5!89':79!K->/>1K/NK1N!I:==E4A!I=((4O5963!,-./>11/2KNN!I:==E4A!*6G65#:6=5!,-./002/2--2!D:&7=!D453=(!89':79!K>N/,K0/,??,!D:&7=!%46G#=!89':79!,-./001/KK0K!V&33C!V6((!*6G65#:6=5!,-./001/-?0K!V4(C!P&B=:G&7(=!89':79!,-./1>0/02N.!V45&GG&!P4!P9=!V6M9=5#!!*6G65#:6=5!,-./,1N/,>22!UG536:=!,-./,N?/2>N0!P9=!86#C!4;!L=5#6GC!,-./>10/?..-!Y=O!S6;=!%:&65=!!H4:5963!8=G#=:!,-./00-/K,>N!Y=O!J=M6GG6GM!!H4:5963!8=G#=:!!K?>/,??/1N.K!Y=O!S6;=!H4:E!4;!I&6#9!K>N/,2-/0>-?!F:(&GE4!89':79!4;!!89:65#!,-./0>K/.K.-!!!!!%96(=A4G!*6G65#:6=5!,-./.N0/.N.1!W=`467=!6G!#9=!S4:E!!*6G65#:6=5!,-./0N,/.2,K!"=:R&G#5!4;!D4E!*6G65#:6=5!,-./0N,/0>??!"4::=G#4!89:65#6&G!8=G#=:!K?>/.K?/,,,.!"36:6#!4;!S6;=!!89:65#6&G!89':79!,-./002/,?.-!P&GM=:6G=!!84AA'G6#C!89':79!K?>/K0K/,N.K!P9=!"9&B&79!89':79!,-./,,?/N>K-!P:'=!H4:E5!4;!D4E!!P&B=:G&7(=!4;!*==#6GM!,-./>>./00>1!Z67#4:C!89':79!H4:(E!!F'#:=&79!8=G#=:!,-./001/.>00!"#$%&$'()'*(+$,-./-$01($/0**(2$3&$%&$40%(+$5-0**$-6%3*($7-(%5(*8(5+$042$'10&+$042$5((9$%&$#0/(+$042$7614$#1)%$7-(.1$,./9(2$,0&5:$7-(4$,.**$"$-(01$#1)%$-(08(4+$042$,.**$#)1;.8($7-(.1$5.4+$042$,.**$-(0*$7-(.1$*042<=$>$?-1)4./*(5$@ABCMaximize your marketing dollars by FOCUSING your advertising campaign on a concentrated market! Do you need to receive or send a FAX?If so, you can use our fax: 407-889-4121*In the same building asThe Apopka Chief!" !"#$60)9:#; "#$%&'('$)&. *There is a small fee for this service.Apopka O! ce Supply 400 N. Park Ave., Apopka, FL 32712 407-889-4455G,6(,+&'(4)!89':79!6G!#9=!"4G!,-./>,2/---N!I&6#9!I=((4O5963!89':79!,-./.,N/K.?-!V4'5=!4;!D4E!%&:@!)R=G'=!!H4:5963!8=G#=:!,-./002/>212!%:6G7=!4;!%=&7=!!%=G#=745#&(!*65564G&:C!!89':79T!UG7$!,-./001/1>21!!!P9=!%=G#=745#&(5!,-./001/K0->!H&C!4;!D:&7=!*6G65#:6=5!,-./>1>/1110G9,'./(,9*46!I6:5#!%:=5BC#=:6&G!!4;!)343@&!,-./002/?1,K!"#$!)GE:=O5!%:=5BC#=:6&G!!!89':79!,-./>1K/20->H,0&9-,2!78:9+8!*6!"-,9*+4!W4((6GM!V6((5!!84AA'G6#C!89':79!,-./002/.22,5,C,6(8F24/!"2C,6(*'('!)343@&!"=R=G#9/E&C!!)ER=G#65#!,-./001/>0N>!I(4:6E&!S6R6GM!"L)!89':79!,-./>0,/.,.>!!I4:=5#!S&@=!,-./021/-20-!I:&G74/V&6#6&G!,-./>12/,K20!D=G=565!"3&G659!?-1/>2,/,0.K!!*&:&G &!!"=R=G#9/E&C!)ER=G#65#!,-./>1-/N0--!!*4'G#!F(6R=!,-./002/-,K-!F:(&GE4!I6(636G4!"=R=G#9/E&C!)ER=G#65#!,-./>1>/1>N-!F:(&GE4!Z6=#6&A=5=!"=R=G#9/E&C!)ER=G#65#!,-./KK1/,1.,!%6G=!V6((5!,-./>1N/,0N2!%(CA4'#9/"4::=G#4!,-./00,/-?1?I,-%)&!3J.)*+&! P=A3(4!)5&AB(=&!JaB(67& !S&@=!V4O=((!J:&G79!!89&3=(!,-./0N,/,,2?K6*(/!^G6#C!89':79!4;!!89:65#6&G6#C!,-./>1?/1N0ND67$7-)5($,-)$,0.7$)4$7-($E)12$F-0**$1(4(,$7-(.1$571(4;7-:$G-(&$5-0**$%)647$6'$,.7-$,.4;5$*.9($(0;*(5+$G-(&$5-0**$164$042$4)7$3($,(01&+$G-(&$5-0**$,0*9$042$4)7$#0.47<$"50.0-$CHAIBJ.52)%$.5$7-($'1.4/.'0*$ 7-.4;:$G-(1(#)1($;(7$,.52)%<$ K42$.4$0**$&)61$;(77.4;+$;(7$ 642(157042.4;<$L1)8(135$CA@First Amendment to the Constitution of the United StatesCongress cannot make a law that favors the establishment of one particular religion; that prohibits the free exercise of religion; or that restricts freedom of speech or of the press, or the right of the people to gather and engage in peaceful demonstration and to petition the government for redress of their grievances. www.TheApopkaChief.com | news@theapopkachief.com | 407-886-2777$VDJURXS *+,-&+./,& WUHPHQGRXV EX\LQJSRZHU !"#$%#&%'(()*+&+,#%#&$-.#*+/%#*%&+,$+&%'(()*+&0)'*&1*##-)2&+)&3)*%,/(4 232 W. Michael Gladden Blvd. Apopka, Florida 32703 Attend your place of worship this week" MARVIN C. ZANDERS FUNERAL HOME Hwy. 436/441 407-886-3388 Hwy 56789:;&<=<>8&;?@AB&5 #-C#%-$0%D&EF&$424@&)/!I4.,964+),!78:9+8>?-N!)343@&!J(RE$8&((!;4:!A4:=!6G;4b LMNFOPQFQRS @&'4664!3*.),!5+8&&) 84((=M=!S=R=( 5%9*6T!5,-,'(,9 #4/!SL!F!;:)/!SUV!PMSQ P'6#64Gb! !"#$$%&'&()'*+,$' #$-$.,$/0'1#$$%&'2.,$3 H=!E4!G4#!79&:M=!#'6#64G$ !V45&GG&6G#9=96M9=5#$ 94A5#=&E$74A 74))!LMNFLOSFLPRR!0&9!*60& $69&))!I&24/ ,QWKHVDPHZD\ OHW\RXUOLJKWVKLQH EHIRUHRWKHUVWKDW WKH\PD\VHH\RXU JRRGGHHGVDQG JORULI\\RXU)DWKHULQ +,./,01 -.//@0P(;QRS !"##$%#&&'(#$')*+#,Self-Justification "You are the ones who justify yourselves in the eyes of others, but God knows your hearts. What people value highly is detestable in God's sight."Luke 6:15 NIV! !"##$+#.&#$)#/*0-H ow much of our daily speech is devoted to justifying ourselves to others, explaining why we did something or trying to correct possible misunderstandings? We really should stop justifying ourselves. If others think poorly of us, so be it. Self-justification is an ego trip and is almost always an attempt to salvage our pride or manipulate others into thinking well of us. Others are usually not thinking enough about us for there to be a need to justify ourselves; they are busy thinking of themselves! Keep things simple, and let your yes be yes and your no be no. Perhaps the best example of this was how Jesus responded to Pilate's questions, when he knew that his very life was at stake. (Matthew 27:11-14) He wasn't quick to justify Himself and appeared to not even defend himself. Others may tear you down and go to great lengths to damage your reputation or assassinate your character, but trust that God knows the truth, and you won't need to justify your motives to Him. He knows the truth and sees your heart more clearly than even you do. Christopher Simon Self-Justification !""#$%&'(#$!)&'*+,-(!&."#,%!""#$%'*+,-(!."#,%/0"#1$%$2&"*-&"+!$+,&"3$2*(-) <'$1'/$")=#$ >"/;>"$9#?@$ 1'/$?'/0A$0+(#$ /@$:'$&/B0+>+C#D$www.theapopkachief.com*(++! The Apopka Chief! (," -./011203///4" 5(6"-./01170-8384"9)"$:(;+" #$%&<,=$('9'>(?=;$5@?9: !"#$%&'#() See page 5B )56789):6;<8=)>6;? 9! :;9!<&"&=.9!-*%-!50*-.6!>')6!?8!@08!A.0-!1.+!("0#!*#!A.'$,').8!B'0C*C"0+3!1*/%9!D.2+6E!$,*)-0%#9!F%*#-.!G.)).,.#9!H*$2"0*.9!I"#.)-E!+*()*#4+9!J(%*2.9!F'$6E!KL!40.#-$,*)-0%#!.#-!40%.2M40.#-$,*)-0%#8!F""N*+!5.N*)6!5'#%0.)!O"N%9!<&"&=.8 H9=G!V=(36GM!V':#5! "=A6G&:T!(=E!BC!+R&G!"A6#9T!O6((!B=!9=(E!&#!I6:5#!^G6#=E!*=#94E65#!89':79!4;!)343@&T!4G!"&#':E&CT!<'(C!>NT!;:4A!N-!&$A$/NbK-!3$A$T!&#!>-N!"$!%&:@!)R=/G'=$ U;!C4'!O4'(E!(6@=!#4! 9=(3!54A=4G=!5#=3!4'#!4;!#9=!7C7(=!4;!34R=:#C!4:!94A=(=55G=55T!74A=!&GE! (=&:G!#9=!3:6G763(=5!#9&#!O6((!=c'63!C4'!#4!E4!#965!O4:@!4;!74A3&5564G&#=!A6G65#:C!O6#94'#!9':#6GM!#945=!C4'!5==@!#4!9=(3$! )343@&[5!;&6#9!74A/ A'G6#C!65!94(E6GM!#965!5=A/6G&:!;:==!4;!79&:M=!#4!7:=/&#=!&G!'GE=:5#&GE6GM!4;!#9=!B=5#!O&C!#4!9=(3!54A=4G=!6G!G==E$!84;;==!&GE!5G&7@5!&:=!3:4R6E=E$ P4!56MG!'3T!3(=&5=!'5=! #9=!(6G@b!9##35bdd&343@&!O9=G9=(36GM9':#5T=R=G#B:6#=$ 74A$!U;!C4'!9&R=!c'=5#64G5T! 3(=&5=!74G#&7#!=R&G$5A6#9XFUQFRUJ7KHVHPLQDULVB&5=E!4G!#9=!B44@!eH9=G!V=(36GM!V':#5!\V4O!#4!)(/(=R6&#=!%4R=:#C!O6#94'#!V':#6GM!#9=!%44:!&GE!f4':/5=(;]g!BC!"#=R=!84:B=##!&GE!J:6&G!I6@@=:#$! 6HPLQDUWHDFKHVKRZWRKHOSWKHSRRU >@AA@67)B;CD8) B6;E89 9!:;9!<&"&=.9!-*%-!50*-.69! >')6!KP8!@08!Q.0#%+!1.+!("0#!*#!A.+,*#42"#9!I8G8!B'0C*C"0+3!1*/%9!R%006!S))%#E!$,*)-0%#9!<#-0%19!T.$,%)!B.-)%N*0%9!T%(%=.,E!+*+2%09!@.06!S)*U.(%2,!Q.0#%+8!5*C%!40.#-$,*)-0%#8!F""N*+!5.N*)6!5'#%0.)!O"N%9!<&"&=.8 56E8F)A3)97@F: 9!L?9! <&"&=.9!-*%-!A%-#%+-.69!>')6!V8!B,%!1.+!("0#!*#!@%-*#.9!W%1!X"0=8!B,%!,.-!N.#6!+'0C*C"0+8!F""N*+!5.N*)6!5'#%0.)!O"N%9!<&"&=.8! Y

PAGE 13

!"#$%&'&()$*"+#,-$$./01$23-$2345-$6)7#$89 $5.99KING BUFFETBest Bu et and Best Deals in ApopkaVoted one of the Best of Apopka 20172157 East Semoran Blvd., Apopka!"!#$%&'()*$%+'%,*+-#)*$%.-(/01 $2.00(23%45678%29%026785:;1%!<=6>8?;% @>AA?3%B73C%;92B%=D5E1%/2>F29% D?G>7D?81%(23%45678%B73C%59:%23C?D% 2AA?D1%!&789&:;<=!&'#&,'("43)10&?@2(.4$1& A.BB$+&*"+,&1#'*&263A0&?CD0&EFGHFHIPER ADULT LUNCH BUFFETBBB1N79OPE>AA?31=2M Call for Takeout: 407-292-2248TornatoresItalian.com 3818 Edgewater Dr. | Orlando, FL 32804 Top Neighborhood Restaurant of 2017 !"#$%#$&%'()*$+,&%-.% /0-%12#)&&,923%45678%B73C%59:%23C?D%=2>F29%2D%;F?=7561% M>;3%FD?;?93%=2>F291%!Ux"‡x‡{xn 7XHV6DWSP6XQSP‡0RQ&ORVHGOne offer per coupon. Not to be combined with other offers, coupons or discounts. Not valid for catering and banquet parties. Exp. 7/31/18. Experience Authentic Italian Food Today! Pizza Special Weekly Lunch Specials $5.95Specials starting atDine in only. No sharing. One offer per coupon. Not to be combined with other offers, coupons or discounts. Must present coupon. Exp. 7/31/18.second pizza 50% OFF of equal or lesser value Dine-In or Take-out Get an Additional 10% OFFTues. thru Sat. 11am 3pm !"#$%&"'(%')*++,'-%./(*0%.1 —”•ƒ—…‡•ƒ”‡ƒ†‡ˆ”‡•Š†ƒ‹Ž›Š‡Š‘—•‡•ƒŽƒ††”‡••‹‰‹•ƒ†‡ˆ”‘•…”ƒ–…ŠŽ›–Š‡‹‡•–‹‰”‡†‹‡–•ƒ”‡—•‡† !"#$%&'&()*'+,"-&)".,($"/)"0&1,02&'&3()42*%& 5$$6)7&/)'*802)&1'%&,04&49::$4)7&0$&;)< !"#"$%&#%'$ !!!"#$%%&'()*+$,()"#(()%'*)%+,-'$).%'$ ././01"02&-(3$,0456780 ’‘’ƒutyruvryyyvzrzr :3%DOO%OYG6DQIRUG)/ !"#$#%&''(%)*%'+$%,-**)'. C a ff Ž P o s itano !"#$%#&'()*+,-.+(,/&(,01& 0+)+.%2&*1&1("#&+)-$+,-.+(,3 !"##$%&' !()*$%&' !$$+"$%, + Follow us on -./012304-44 25..'6789:;<'!=>?' @A9AB;&'+)'52/.5 Or visit our other locations at: &BTU$PMPOJBMp$SPTTSPBET Artegon 4%.&"/&5%06&1("&'#%-.%&1("#& :RUOGV*UHDWHVW(YHQWZK 7"22/&8-.%#/&-.&1("#&60-'%& (#&("#/9 3LOHKLJKZKRXU )-#:%.&;<#%/5&6#(2"'%9 !!"#$%&$'()(*$+,)-$.!/$'01(*$2"2! 34,45)6$78$!9:"! ;,<=*<$,>$'+$.!/$?$@0=($;A0B$CAD-&X.ŒZ}X}utXKŒvPo}}udŒ]o 34,45)6$78$!9:29 /všZ‰}‰l}uu}vWo is coupon valid at Apopka locations only. Limit one per customer, per visit. Not valid with any other o ers. Expires 7/31/18$2 OFFSub, chips and Medium drink :;#$<"#$!"#$"%#&' ()$*)+,','/=>$'=$<"+;$ &)7#$,'?$)$ -.&"/'01+1+-' &2*&.1&+(&3@)(#$;/?#$<'$ A#=<+'=$<"#;#$)>;B *3% J"6$,'.1$& >.A1 K Q%;>E;%5D?%296:% F5D3%2A%3C?7D%;32D:1%*%F2DP3729%2A%:2>D%F>D=C5;?%79%RSKL%53%566%-1,1% J"6$% ,'.1$&>.A1 K& 62=53729;% O2?;%32%3C?% J"6$,'.1$& >.A1 K& T>E67=%,5A?3:% U2>9853729Q%32%E?%>;?8%32%FD2478?%67A?;5479O%?G>7FM?93%32%A7D;3%D?P;F298?D;1% ,79=?%3C?%U2>9P 853729%;35D3?8Q%73%C5;%OD593?8%24?D%VJJ%M766729%32%FD2478?%?G>7FM?93Q%3D57979OQ%598%;>FF2D3%32%C2M?32B9%C?D2?;1%*66%E?=5>;?%53% J"6$,'.1$& >.A1 K L & 3C?:%E?67?4?%3C53% M5N79O%OD?53%;>E;%7;%923%?92>OCW%:2>%C54?%32%82%O228Q%3221 XD2B79O%>F%79%5% A5M76:%3C53%B5;%E23C%?93D?FD?9?>D756%598%E>763%29%M2D?%3C59%RSS%\HDUVRIUHJKWLQJKHU735O?Q%73%;??M;% J"6$% ,'.1$&>.A1 K IRXQGHUV B?D?%8?;379?8%32%;35D3%J"6$,'.1$&>.A1 K 1%'A% =2>D;?%3C?:%3D7?8%23C?D%3C79O;%5629O%3C?%B5:%32%3C?7D%*M?D7=59%8D?5M%Y%URFNQUROOUHDOHVWDWH598%?4?9%/CD7;3M5;%3D??%A5DM79OQ%E>3%?4?D:P3C79O%3C?:%?.A1 K 1 Z73C%M2D?%3C59% KQKSS% J"6$,'.1$&>.A1 K % D?;35>D593;Q%3C?:%5D?%FRQYLQFHGWKH\UHGRLQJ5%A?B%3C79O;%D7OC31%T?2PF6?%=2M?%E5=N%BC?9%WKH\UHWUHDWHGZHOODQGA?8%?4?9%E?33?D1%+>D9;%2>3Q%F?2F6?%5E;26>3?6:%.'"!%3C?%;5M?%3C79O;%J"6$,'.1$&>.A1 K & 82?;%Y%3C?%E?;3%M?53;Q%=C??;?;Q%598%32FF79O;%J"6$,'.1$&>.A1 K %=59% QG T?2F6?%=2M?%E5=N% 5O579%598%5O579%E?P=5>;?Q%>967N?%23C?D%;>E%F65=?;Q% J"6$,'.1$& >.A1 K %;3?5M;%3C?7D% M?53;%598%=C??;?;Q%D?POHDVLQJDUXVKRIDYRUV3C?9%;3>AA;%5%;?D479O%WKDWVZD\RYHUFRGHRQ29?%2A%3C?7D%325;3?8%FD7PYDWHUHFLSHVXEUROOV,WV5%B79979O%=2ME7953729%3C53%;537;A7?;%D54?92>;%5FF?373?;%598%3C?%456>?%=29;=72>;%567N?1 *3% J"6$,'.1$& >.A1 K Q%:2>%B766%A798% M59:%45D7?37?;%2A%C23Q%=268Q%598%;F?=7563:%;>E;%;?D4?8%29%:2>D%=C27=?%2A%BC73?%2D%BC?53%;>E%D266;1%'9?%2A%3C?%M2;3%F2F>65D%;F?=7563:%;>E;%7;%3C?%022N%[%.588?D K % ,>E%B73C%;M2N?8%3>DN?:%ED?5;3Q%"7DO7975%C29?:%C5MQ%598%M?63?8%&29P3?D?:%\5=NQ%;?D4?8%]U>6P6:%794264?8^%6258?8%=2MPF6?3?%B73C%M5:2Q%M>;P 35D8Q%6?33>=?Q%32M532Q%29729Q%598%5%8766%;F?5D%29%3C?%;78?1% *%9?B%A542D73?%7;%3C?% 3DVWUDPL5HXEHQ,WV3C?%#?>E?9Q%D?794?93?8Q%;35=N?8%C7OC%B73C%-,)*%/C27=?%F5;3D5M7%598%M?63?8%,B7;;Q%F57D?8%B73C%3C?7D%;B??3%598%359O:%;65BQ%+C2>;598%_;6598Q%598%M5:21%@>3%KXUU\EHFDXVHLWVRQO\IRUDOLPLWHGWLPH.LGV=2ME2;%5D?%56;2%54576P5E6?%A2D%3C?%67336?%29?;1 J"6$,'.1$&>.A1 K % 7;%923%`>;3%5E2>3%;>E;1%+C?:%56;2%;?D4?%A59P35;37=%;5658;Q%79=6>879O%3C?%_356759%B73C%XD766?8%/C7=N?9%,5658 70 1%+C?% =C2FF?8%;5658%7;%5%E6?98%2A%;565M7Q%OD766?8%=C7=N?9%ED?5;3Q%D2PM579?Q%32M532Q%E?66%F?FPF?DQ%=>=>ME?DQ%M2aa5PD?665Q%F?FF?D29=797Q%598%8D?;;79O1%*6;2%545765E6?%7;% J"6$,'.1$&>.A1 K % 5B5D8%B79979O%/C7671 *66% J"6$,'.1$& >.A1 K %A?53>D?%3C?%/2P =5P/265%UD??;3:6?%M5P =C79?%3C53%5662B;%:2>%32%G>?9=C%:2>D%3C7D;3%B73C%KRSb%ED598;%AD2M%3C?%A2>93579%2A%3C?%A>3>D?1 J"6$,'.1$&>.A1 K % 56;2%2AA?D;%=53?D79O%;?DP47=?;1%.?3%3C?7D%=D?B%A??8%:2>D;%B73C%F6533?D;%2A%=268%;>E;Q%;5658;Q%598%8?;;?D3;1%*;N%3C?%=5;C7?D%A2D%5%=53?D79O%M?9>%3285:1 *;%3C?:%;5:%79%3C?% UHVWDWLRQ/(76($7 $2>%B766%A798%3B2% =294?97?936:%62=53?8%J"6$,'.1$&>.A1 K %79% *F2FN51%+C?:%5D?%62P=53?8%53%JJSc%!1%,353?%#258%dJeQ%,>73?%KSKJQ%f=2D9?D%2A%dJe%598%0>93%/6>E%@2>6?45D8gQ%dSHPJJKPHLRH1%*98%3C?:%5D?%56;2%62=53?8%53%KeSL%Z1%'D59O?%@62;;2M%+D576%79%3C?%02M?%)?F23%T65a5Q%dSHPdedPJeRd1%$2>%=59%56;2%=C?=N%3C?M%2>3%53%BBB1A7D?C2>;?;>E;1=2M1 ;4M$6+"1$5$#+ !"#"$%$&'%$()%*"+'&),#'%-,.# / %0)12$'3%"4%56)672%2$%889:%;<%-$2$'%=)23%>8?@% -,"$'%A9A8@%B1)+4'+%)C%>8?%243%D,4$%E0,.%F),0'G2+3H@%243%2$%A?9I%J<%K+24L'%F0)##)M%N+2"0%"4%$&'%D)M'%O'6)$%P02Q2< R),+%6,+1&2#'%2$%*"+'&),#'%-,.# /%% &'06#%#2G'%0"G'# Does your group or organization have a cookbook or some favorite recipes they'd like to share? Or Mail to:!The Apopka Chief! and The PlanterRECIPES, 400 N. Park Ave., Apopka, FL 32712 MMM... Chili! :HGORYHWRKHDUIURP\RX !"#"$%&'''($)*+,-,.+/)"*0(/-1 "#$ Dining !"#!$#%&"'!"#()*&+!

PAGE 14

!"#$%&'&()$*"+#,-$$./01$23-$2345-$6)7#$89 !"#$%!&''()!&'!#*+'!,'-$.'%!IURPDIRUPHUUVW/*01!23!4.2.(*)!0UV%HWW\/DQGZLIHRIWKHODWH0D\RU-RKQ/DQGDQGDOVR3,25!6,%7!8*,/!1HOVRQZKRLVWKHPRWKHURIRXUFXUUHQWPD\RU%U\DQ1HOVRQ%RWKRIWKHVHDF 9 FRPSOLVKHGODGLHVEHORQJHGWRWKH$SRS 9 ND:RPDQV&OXEDWWKHWLPH :KDWV &RRNLQ"ZDVZULWWHQ 7 -DQHOO0D[ZHOOVKDUHVKHUGHOLFLRXV&DVKHZ&KLFNHQLQ1RUWKVLGH%DSWLVW&KXUFKVFRRNERRN6KHDGGVKHUWLPHVDYLQJWLSVIRURXUFRQYHQLHQFH%HWW\/DQGV6HDIRRG6RXIHIURP7KH$SRSND:RPDQV&OXE :KDWV &RRNLQ" XVHVDSRXQGRIVHDIRRGRI \RXUFKRLFHDQGLVEDNHGDVDFXVWDUGLQDZDWHUEDWKLQWKHRYHQ,WORRNVOXV 9 FLRXV! )URP)LHOGWR)HDVWDQGWKH%UXVFKL IDPLO\V'')DUPV83LFNLQ3DOP&LW\ZHKDYHSHVWRVWXIIHGHJJSODQW7DQLD%UXVFKLSODQVKHUPHDOVDURXQGZKDWVIUHVKIURPWKHLUHOGVDQGVKHPDNHVWKLVGLVKHDUO\LQWKHVHDVRQZKHQWKH\RXQJHJJSODQWVDUHVXSSOHDQGVZHHW+HUIDPLO\FRQVLGHUVWKLVIRUNWHQGHUHJJSODQWFRPIRUWIRRGDQGZLWKDVDODGLWVGLQQHU1RUWKVLGH%DSWLVW&KXUFKKDVVKDUHGZLWKXV%URFFROL&DVVHUROHIURP'LDQH%XQQHOO7KLVGLVKXVHVIUR]HQEURFFROLDQGPDNHVDORYHO\VLGHIRU\RXUVXSSHU)RUDWDVW\VLGHGLVKWU\UHDGHU1DQF\7KRPDV,WDOLDQ6TXDVK7KLVLVDVLPSOHGLVKWKDWXVHVIUHVKYHJHWDEOHV,%*$6!5#(<(43!#4!'%#?*!>&(<*!)(''#,%*$!>(%&!;:18;!%,5<*:'-##4'!0#$4'%,$0&$IWHUERXLOORQFXEHVDUHGLVVROYHGDGGRWKHUVDXFHLQJUHGLHQWV%ULQJWRDERLODQGDGGFROGZDWHUZLWKFRUQVWDUFK/HWWKLFNHQ3ODFHGHHSIULHGFKLFNHQRQSODWHSRXUVRPHVDXFHRYHULWDQGWRSZLWKFKRSSHGJUHHQRQLRQVDQGFD 9 VKHZV6HUYHRYHUFRRNHGULFH6HUYHVIRXU3HUVRQDOQRWHV ,QGWKDW,FDQEUHDN XSWKHERXLOORQFXEHVEHIRUHDGGLQJWKHPWRWKHZDWHUWRVDYHRQWLPH$OVR,RPLWWKHVDOWLQWKHVDXFHDQGXVHDWDEOHVSRRQRUWZRRIDGGLWLRQDOVR\VDXFHVRWKHVDXFHLVDGDUNHUFRORUP\SUHIHUHQFH7KLVUHFLSHLVHDV\WRGRX 9 EOHRUWULSOHRUIRUVHUYLQJODUJHUFURZGV$QRWKHUWLPHVDYLQJWLSLI\RXDUHFRRN 9 LQJDODUJHUDPRXQWRIFKLFNHQ\RXFDQPDNHWKHFKLFNHQWKHGD\EHIRUHDQGVWRUHLWLQWKHUHIULJHUDWRURYHUQLJKW1H[WGD\VSUHDGWKHFKLFNHQRXWRQDFRRNLHVKHHWDQGEDNHLQWKHRYHQDWGH 9 JUHHVVWLUULQJRFFDVLRQDOO\MXVWORQJHQRXJKWRJHWLWKRWDQGFULVSLWXS %(77'-,-*$' 18;!K(),<(,!#4(#46!0&#--*)7!B(4(!-*--*$'6!$*)6!=*<<#>!,4)!#$:,43*6!0/%!/-I!#/40*'!C'B,<!'L/,'&6!'<(0*)!,5#/%!189!(40&1!H/00&(4(6!'<(0*)!,5#/%!189!(40&6DOWWRWDVWHM*--*$!%#!%,'%*1!%,5<*'-##4!B(40*)!3,$<(0WDEOHVSRRQGULHG,WDOLDQVHDVRQLQJ;!%*,'-##4'!#$3,4(0!4#:',<%!'*,'#4:(436SULQNOHRIUHGSHSSHU;!%,5<*'-##4'!$*)!>(4*!?(4*3,$1!&*,-(43!%,5<*'-##4!5**A!'%#02!C%&*!%&(02!2(4)D18;!0/-!?*3*%,5<*!'%#02!C%&*!<(L/()!2(4)D 6DXWpLQH[WUDYLUJLQROLYHRLOXQWLOEURZQHGDERXWPLQXWHVRQLRQSHSSHUVDQGPXVKURRPV$GGVTXDVKDQG]XFFKLQLVDXWpXQWLOVRPHZKDWOLPSWXUQLQJZLWKVSDWXODRIWHQVRDOOZLOOJHWH[SRVHGWRKHDW$GGWKHJDUOLFDQGDOOWKHGU\VHDVRQLQJV$GGFXSOLTXLGYHJHWDEOHVWRFNWDEOHVSRRQVUHGZLQHYLQHJDURQHRXQFHFDQGLFHGWRPD 9 WRHV*HWWKHYHJHWDEOHVJRLQJZHOODQGDGGWKHEHHIVWRFNWRWKHKRWWRPDWRJUD 9 Y\VRLWZLOOPHOWDQGPL[LQZHOO&RRNIRUDERXWPLQXWHVDQGVHUYHKRW 0$(&/$<7216&+2&2/$7(&+,3 &+(:(<&22.,(6 @*0(-*!A$#B!"*>!K('(#4!.#BB/4(%=! &KXUFKV "$$ !',$!"%(4/ FXSVRXU;!%*,'-##4'!5,2(43!'#),;!0/-'!5/%%*$6!'#A%*4*)FXSVUPO\SDFNHGEURZQVXJDU18;!0/-!>&(%*!'/3,$;!-,02,3*'!(4'%,4%!?,4(<<,!-/))(43!C7N9!#/40*'D9!*33';!%*,'-##4'!?,4(<<,!*G%$,0%9!0/-'!'*B(:'>**%!0�#<,%*!0&(-';!0/-'!0&#--*)!>,<4/%'!C#-%(#4,,$B!>,%*$18;!0/-!0#0#,;87!0/-!'&#$%*4(431:18;!0/-'!'/3,$;!*33'FXSVVLIWHGRXU1!%*,'-##4!5,2(43!'#),18;!%*,'-##4!',<%789!0/-!'#/$!B(<2!#$!5/%%*$B(<21!%*,'-##4!?,4(<<,!*G%$,0%0L[ZDWHULQWRFRFRDVORZO\OHWVWDQGPLQXWHV&UHDPWKHVKRUWHQLQJ$GGVXJDUJUDGXDOO\FUHDPLQJZHOO$GGHJJVRQHDWDWLPH%HDWZHOO$OWHUQDWH 9 O\DGGVLIWHGGU\LQJUHGLHQWVDQGVRXUPLONEHDWLQJDIWHUHDFKDGGLWLRQ$GGWKHFRFRDDQGYDQLOODH[WUDFW7XUQLQWRWZRJUHDVHGDQGRXUHGSDQVLQFKOD\HU%DNHLQGHJUHH)DKUHQKHLWRYHQIRUWRPLQXWHV !):;1$)<=$=#0+>+'/:$>'?,'@;$,''=$+:$"+7"0+7";#=$+<$;"+:$A##(B:$C)&#@: itchen apersby ancy !"#$%&%$"'!!($%!)*%+!,%$)--.,/%UHVXPHV$XJXVW7UDIFSDWWHUQVDUHFKDQJLQJ6WRUP\ZHDWKHUFRPHVDQGJRHV !"#$%&'%()$'%*+,$-.*$/-0$ *,-)1$21#1)*03%")4$56789$9:;9$<=>?:$5@>A>7B4&KLOGUHQPXVWEHYH\HDUVROGRQRUEHIRUH6HSWHPEHUWRVWDUWNLQGHUJDUWHQ7RHQWHUUVWJUDGHDFKLOGPXVWEHVL[\HDUVROGRQRUEHIRUH6HSWHPEHUDQGPXVWKDYHVXFFHVVIXOO\FRPSOHWHGNLQGHUJDUWHQ)ORULGD6WDWXWH,PPXQL]DWLRQVPXVWEHFXUUHQW&LW\RI$SRSNDV1RUWKZHVW5HFUHDWLRQ&RPSOH[ CDEF$G%)-"$5'1&&1($ H%0I'%(J$!2-2I%$CKDEKJ$LFDMDFCMEDNL4 % 6"$%"($O3P1"$'11I1"#J$(-.$+%"$)11$PDQ\PDQ\IDPLOLHV $ LQDWWHQGDQFH $%*$ *,1$Q1%.*3/.&$+-R2&1S$)1**3"O$2%0*3+32%*M3"O$3"$P%03-.)$-0O%"3T1#$)2-0*$20-O0%R)J$!R1"3*31)$%*$*,1$+-R2&1S$3"+&.#1U$V-++10$W31&#)J$V-/*Q%&&$W31&#)J$X%)1Q%&&$W31&#)J$Y.&*3MH.02-)1$W31&#)J$V%"#$A-&&1(Q%&&$Z-.0*)J$6.*#--0$X%)I1*Q%&&$Z-.0*)J$91"M"3)$Z-.0*)J$<%&I3"O$90%3&J$!R2,3*,1%*10J$H&%(O0-."#J$Z-"+1))3-"$V*%"#)4PLOHZLOGOLIHGULYHFRPSOHWHZLWKGLUHFWLRQDOVLJQVRSHQHGLQRQ/DNH$SRSNDVKRUHV Q( % 1"*103"O$/0-R$ ?.)*$@-%#$-//$X3"3-"$@-%#J$%Q-.*$%$R3&1$)-.*,$-/$Z%R2$<1'%$3"$*,1$H&(R-.*,$%01%J$/-0$-"1M'%($#03P1J$EF$R3&1)$210$,-.0J$'3*,$2-))3Q&1$'3&#&3/1$)2-**3"O$)*-2)4$ 0!% 127)(('7+(*$72567KHGULYHPD\EHFORVHG $>/$(-.$%01$)*-223"OJ$#03P1$ '3&&$*%I1$R-01$*,%"$E$,-.04$503P1$0.")$Q($+%"%&)$.)1#$3"$R.+IM/%0R3"O$#%()4$9,1$-"1M'%($#03P1$1S3*)$-"$G-"1)$@-%#$3"$[1&&'--#4$\-.$'3&&$)11$%$/01),'%*10$R%0),$)()*1R$%"#$'3&#&3/1$#121"#1"*$-"$*,%*$*(21$-/$)()*1R4$9,1$#03P1$3)$-21"$-"$W03M#%()J$V%*.0#%()$%"#$V."#%()$%"#$/1#10%&$,-&3#%()$%"#$3)$+-"*0-&&1#$Q($*,1$+-."*(4$621"$#.03"O$#%(&3O,*$,-.0)$-"&($]-"1$,-.0$%/*10$)."03)1$%"#$-"1$,-.0$Q1/-01$).")1*^4$2IFLDOVXQULVHDQGVXQVHWKRXUVFDQEH/-."#$-"&3"14$$9,1$0-%#$3)$+&-)1#$-"$-*,10$#%()$#.1$*-$-"O-3"O$01)*-0%*3-"$'-0I4$9,1$*0%3&$3)$EE$R3&1)$&-"O4$ 6LQFHLWVRSHQLQJ WKHWUDLOKDVKDGPRUHWKDQYLVLWRUV)((',1*7+($//,*$72560$<&$86(&/26,1*2)7+(75$,/ % :(.,:$635,1*667$7(3$5. % 3)$%$ DJFFFM%+01$W&-03#%$V*%*1$H%0I$3"$!2-2I%J$W&-03#%4$>*$3)$&-+%*1#$KF$R3".*1)$"-0*,$-/$60&%"#-J$-//$>"*10)*%*1$L$%*$1S3*$_LJ$"1%0$!&*%R-"*1$V203"O)$%"#$?-"O'--#4$9,1$2%0I$%&)-$+-"*%3")$*,1$,1%#$'%*10$-/$*,1$<1I3P%$@3P104$!##01))U$ENFF$<1I3'%$Z30+&1J$!2-2I%$CKDEKJ$-21"$/0-R$_$%4R4M`$24R4$W-0$3"/-0R%*3-"J$+%&&$LFDMNNLMLCEE444 )5,'$<-8/< 6$785'$<-8/< &RRNLHVDQG0LONZLWKD&RS6WRU\WLPH7RR 1P10($*,30#$V%*.0#%($-/$*,1$ R-"*,$%*$7-0*,$60%"O1$X0%"+,$?3Q0%0(J$EKEE$:4$V1R-0%"$X&P#4J$!2-2I%J$ 1232 $9,3)$1P1"*$3)$)2-")-01#$Q($!H5$%"#$ Y+5-"%)$&-+%*1#$%*$KCC$:4$Y%3"$V*4%52:1%$*/81&+7KLUG6DWXUGD\ RIHDFK0RQWKDW :23)+-2%&$Z,.0+,$-/$ *,1$=-&($V2303*$%*$*,1$+-0"10$-/$=3O,&%"#$%"#$a*,$V*4J$!2-2I%J$/0-R$EF$%R4ME$24R4$!&&$%01$'1&+-R1$*-$+-R1$%"#$Q1$/1#$'3*,$*,-)1$',-$'-.&#$&3I1$*-$),%01$3"$%$Q0-'"$EDJOXQFK,QDGGLWLRQPHQVVRFNVLSRSVVWXIIHGDQLPDOVDQGFKLOGUHQVQ--I)$%R-"O$-*,10$*,3"O)$'3&&$Q1$-//101#4$W-0$3"/-0R%*3-"J$+%&&$LFDMDFCMLKKC 681'$<-8/< 021'$<-8/< =XPED6HQLRUV)LWQHVV&ODVV $Y67M 5!\V$%"#$W@>5!\V$_UFF$%4R4J$%*$W0%"$Z%0&*-"$Z1"*10J$EE$7$W-01)*$!P1".14$Z%&&$LFDMDFCMEaLK$/-0$3"/-0R%*3-"4$%HJLQQLQJ5DFHZDONLQJ3URJUDP `UFF$ 24R4$M$`U``$24R4J$%*$*,1$60%"O1$Z-."*($H%0I)8$Y%O"-&3%$H%0IJ$K_K_$X3"3-"$@#4J$!2-2I%4$9,1$20-O0%R$3)$/-0$21-2&1$%O1$EK$%"#$- J$%"#$3)$/0114$H01M01O3)*0%*3-"$3)$01b.301#$Q($+%&&3"O$LFDMNNaMLKCE4$W-0$2%0I$3"/-0R%*3-"J$P3)3*$'''4-0%"O1+-."M*(2%0I)4"1*2YHUHDWHUV$QRQ\PRXVPHHWV0RQGD\VDWSP :23)+-2%&$Z,.0+,$-/$ *,1$=-&($V2303*J$aFE$V4$=3O,&%"#$!P1".14$>/$(-.$,%P1$%$20-Q&1R$'3*,$/--#$c$-P101%*M3"OJ$%"-01S3%J$Q.&3R3%$c$*,101$3)$%$)-&.*3-"$/-0$(-.4$W-0$R-01$3"/-0R%*3-"J$P3)3*$6!4-0O$-0$+%&&$?%.0%$LFDMLNLMDDCa$-0$B3"O10$LFDMNCKM`DDK47RDVWPDVWHUV $:P10($Y-"#%(J$DUFF$24R4$ M$NUCF$24R4J$3"$*,1$Y.)1.R$-/$!2-2I%")J$EKK$:$`*,$V*J$!2-2I%J$W?$CKDFC4$W-0$R-01$3"/-0R%*3-"J$ 1XPEHUFKDQJHG $+%&&$LFDM Da`MKaK_$-0$P3)3*$'''4!2-2I%*-%)*R%)M*10)4-0O47RDVWPDVWHUV $ )RUHVW/DNH&KXUFK $ @--R$_J$`E`$=%0&1($?1)*10$?%"1J$!2-2I%J$W&-03#%$CKDFC4$93R1U$D$24R4J$621"$*-$1P1M0(-"1$3"*101)*1#4$W-0$3"/-0R%*3-"J$+%&&$LFDMDaEMK_LC4$Z&.Q$7.RQ10U$LN__``aJ$53)*03+*$NLJ$!01%$5LK4$60%*-0)$-/$:S+1&&1"+14$ 78(6'$<-8/< $ :DONDQG7DON $NUFF$%4R4$M$_UFF$%4R4J$ %*$Y%O"-&3%$H%0I4$Z%&&$LFDMNNaMLKCE$/-0$R-01$3"/-0R%*3-"43/$17&/,1,&DW8)0LG)ORULGD5HVHDUFK&HQWHU J$KDK`$X3"3-"$@#4J$!2-2I%J$ 1P10($9.1)#%(J$_$%4R4MEK$24R4$'3*,$0-*%*M3"O$Y%)*10$B%0#1"10$+&3"3+3%")$*-$1P%&.M%*1$(-.0$2&%"*$)21+3R1")4$W-0$3"/-0R%*3-"J$FDOORUYLVLWRUDQJHLIDVX1#.d01)e,-0*d$UW&ODVV $_UFF$%4R4J$%*$*,1$W0%"$Z%0&*-"$ Z1"*10J$EE$74$W-01)*$!P14J$!2-2I%4$W-0$R-01$3"/-0R%*3-"J$+%&&$%"#$&1%P1$R1))%O1$/-0$7%"+($Y+5-"%&#$%*$LFDMDFCMEaCE4$$'(37027259(+,&/(6)/2:02%,/(9$1 % IRUUHQHZLQJGULYHUVOLFHQV HV7XHVGD\-XO\IURPDPSPDWWKH1RUWK2UDQJH/LEUDU\(6HPRUDQ%OYG$SRSND6(&21'78(6'$<2)(9(5<0217+ U$ 9,1$!R103+%"$Z%"+10$V-+31*($O0-.2$#3)M+.))3-"$-"$20-)*%*1$+%"+10$3)$,1&#$%*$*,1$!2-2I%$!01%$Z,%RQ10$-/$Z-RR10+1$Q.3"OJ$ENF$<4$Y%3"$V*4J$!2-2I%J$%*$$aUCF$24R4J$%"#$3)$-21"$/-0$%"(-"1$',-$3)$3"*101)*1#$3"$*,1$).Qf1+*$-0$',-$,%)$Q11"$#3%O"-)1#$'3*,$20-)*%*1$+%"+104$3*$3)$/0114$W-0$R-01$3"/-0R%*3-"J$+%&&$LFDMCLEMENKa :('1(6'$<-8/< $ $OWDPRQWH6SULQJV$SRSND9):3RVW $R11*)$1P10($<1#"1)#%($R-0"3"O$ %*$`E_$V4$Z1"*0%&$!P1".1J$!2-2I%J$/0-R$NUCFMEF$%4R4$71'$R1RQ10)$%01$%&'%()$'1&+-R14$Z%&&$LFDMNN_MNKaaJ$-0$1R%3&$3"/-gP/'2-)*EFELD4+-R=XPED6HQLRUV)LWQHVV&ODVV $ <:57:V5!\V$%*$NUFF$%4R4$%*$W0%"$Z%0&M*-"$Z1"*10J$EE$7$W-01)*$!P1".14$Z%&&$LFDMDFCMEaLK$/-0$3"/-0R%*3-"4$Z&%))1)$%&)-$,1&#$-"$Y-"#%()$%"#$W03#%()$%*$_UFF$%4R4&LW\RI$SRSND'5&'HYHORSPHQW5HYLHZ&RPPLWWHH $R11*)$1P10($<1#"1)M #%($%*$_$%4R4MEF$%4R4$%*$Z3*($=%&&J$EKF$:4$Y%3"$V*011*J$!2-2I%4$ % 7236&KDSWHU7 %I1$ //$ # -."#)$ $ HQVLEO\7236DQRQSURWRUJDQL]D *3-"J$'3&&$,1&2$(-.$01%+,$%$'13O,*$O-%&$'3*,$).22-0*$/0-R$/031"#&(J$+%03"O$R1RMQ10)J$1#.+%*3-"J$%"#$01'%0#)4$:%+,$<1#"1)#%($%4R4c$'13O,M3"$Q1O3")$%*$NUL`$c$R11*3"O$1"#)$%*$EFUCF4$Z-R1$*-$_aC`$X1%0$?%I1$@-%#J$!2-2I%J$*-$R11*$'3*,$-*,10)$',-$,%P1$%$&3I1MR3"#1#$O-%&$*-$ORVHZHLJKW1RSURGXFWVQRVSHFLFGLHW*-$/-&&-'J$"-$R1#)4$Z%&&$LFDMCEKMDEKC$/-0$R-01$3"/-0R%*3-"4&DUGV%ULGJH $_UCF$%4R4$/-0$V:7>6@V4$ Z-R1$%"#$f-3"$*,1$/."J$-0$Q03"O$3"$)-R1$/031"#)$%"#$)*%0*$(-.0$-'"4$Z%&&$LFDMDFCMEaCE$/-0$3"/-0R%*3-"4$&UDIWV&KDWWHUDQG%RDUG*DPHV_UCF$%4R4 % /-0$V:7>6@V4$9,3)$3)$%"$3"/-0M R%&$O%*,103"O$-/$)1"3-0$%#.&*)$',-$1"f-($2&%(3"O$Q-%0#$O%R1)J$+%0#)$-0$+01%*3"O$20-f1+*)4$Z%&&$LFDMDFCMEaCE$/-0$3"/-0R%M*3-"47LQ\7DOHV5K\PH7LPHIRU6@V$NUFF$%4R4$Z3*($ -/$!2-2I%4$<3&&$R11*$%*$Y%O"-&3%$H%0I4$Z%&&$LFDMNNaMLKCE$/-0$3"/-0R%*3-"4&KDLU([HUFLVH&ODVVIRUVHQLRUV J$_$ %4R4J$W0%"$Z%0&*-"$Z1"*10J$EE$7$W-01)*$!PM1".1J$!2-2I%4$Z%&&$LFDMDFCMEDNL4$$$$$$$$$$$$,!*5,6 /XQFKHRQ0HHWLQJ $EKUFF$ 7--"4$ 0HHWLQJVDUHDWQHZORFDWLRQRI )ORULGD+RVSLWDOLQWKH%RDUG5RRPDW2FRHH$SRSND5RDG$SRSND $W-0$3"/-0R%*3-"$+%&&$LFDMLE`M a`NN40RWRUF\FOH1LJKW $aUFF$24R4$M$EFUFF$ 24R4$%*$H-0I318)$XXiJ$K`a$:4$Y%3"$V*4J$!2-2I%4$:P10($9,.0)#%($"3O,*$'3&&$/1%*.01$#0%'3"O)J$203T1)J$*0-2,31)$%"#$f.)*$2&%3"$),-'3"O$-//4$W-0$3"/-0R%*3-"J$+%&&$LFDMNNFMCC`E4 83&20,1*(9(176 %$&.726&+22/6$/(67$;+2/,'$<$8*867$8*867 /-0$+&-*,3"OJ$ /--*'1%0$%"#$+10*%3"$%++1))-031)$)1&&3"O$/-0$jaF$-0$&1))$210$3*1RJ$%"#$+10*%3"$)+,--&$).22&31)$)1&&3"O$/-0$jE`$-0$&1))$210$3*1R4$)RUFRPSOHWHLQIRUPDWLRQJRWRZZZRUL#%01P1".14+-R25$1*(&2817<+($/7+$1')$0,/<(;32 $)2-")-01#$Q($Q-*,$60%"O1$ Z-."*($Y%(-0$9101)%$G%+-Q)$%"#$*,1$O-PM10"R1"*$-/$*,1$Z-RR-"'1%*,$-/$H.10*-$@3+-J$V%*.0#%(J$!.O.)*$LJ$_UCF$%4R4Ma$24R4$%*$*,1$60%"O1$Z-."*($Z-"P1"*3-"$Z1"*10J$7-0*,$=%&&J$_LFF$k"3P10)%&$X&P#4J$60&%"#-4$)RULQIRFRQWDFWZZZRFQHWPDULD35,0$5<(/(&7,21$8*867 $$9,1$&%)*$#%($*-$01O3)*10$*-$P-*1$-0$ FKDQJHSDUW\DIOLDWLRQLV-XO\:%0&($P-*3"O$#%*1)$%01$/0-R$W03#%(J$!.MO.)*$EDJ$KFEN$*,0-.O,$V."#%(J$!.O.)*$KaJ$KFENJ$/0-R$EF$%4R4$*-$a$24R4$1%+,$#%(4$>"$!2-2I%J$1%0&($P-*3"O$Q--*,)$'3&&$Q1$%*$*,1$!2-2I%$Z-RR."3*($Z1"*10dAW<$H-)*$EFELDJ$`E_$V$Z1"*0%&$!P1".14$V.210P3)-0$-/$:&1+*3-")$%##01))$%"#$2,-"1$".RQ10U$EE_$<4$l%&1($V*4J$60&%"#-J$W?$CKNFaJ$LFDMNCaMKFDF4 21*2,1*(9(176 %% $$$ % $$$ % $ % $$$ % $ % $$$ % $$ % $$ $$$$ $$ $ $$$ $ $$$ %%%%% $$$ %% $$ % $ % $$ % $$$ % $$ % $$ $ $$ %% $ %% $ % $ %%% $$ %% $$$ $ % $ %% $$ %%% $ % $ 9):3267:,//%(6(59,1*7,.58+5$*% *,1$*,30#$V%*.0#%($-/$*,1$ R-"*,$/0-R$NMEF$%4R4$%*$`E_$V4$Z1"*0%&$!P1".14&LW\&RXQFLO QRUPDOO\PHHWVWKHUVW <1#"1)#%($%*$EUCF$24R4J$%"#$ WKLUG :HGQHVGD\DWSP 4 % 3"$*,1$Z3*($Z-."M +3&$Z,%RQ10)J$Z3*($=%&&J$EKF$:4$Y%3"$V*4J$ !2-2I%4 % !&&$R11*3"O)$-21"$*-$*,1$2.Q&3+4$ 6XEMHFWWRFKDQJHZLWKQRWLFH 4$W-0$3"/-4J$ +%&&$Z3*($Z&10I$LFDMDFCMEDFL4 $JHQGD DQGPLQXWHVRIPHHWLQJFDQEHIRXQGRQOLQH2QFHSRVWHGFKHFNIRUDQ\UHYLVLRQVE\7XHVGD\DWSPEHIRUHWKHPHHWLQJ $ KH )2/,$*(6(5720$&/8% $ 399:;% WKHUVWDQGWKLUG7XHVGD\RIHDFKPRQWK J$Q1O3""3"O$%*$EEUL`M"--"J$%*$X11/$ m68$X0%#(8)$3"$9,1$X%+I$@--RJ$ELEF$@-+I$V203"O)$@#4J$!2-2I%4$9-$01)10P1$)2%+1$/-0$&."+,1-"J$+%&&$Q($*,1$W03#%($Q1/-01J$-0$/-0$3"/-0R%*3-"J$+%&&$B01O$V2.0&-+I$LFDMNNLMaLaL4$ &2))((:,7+$&23 $3)$)+,1#.&1#$V%*M .0#%(J$/0-R$*3R1$*-$*3R1$%*$Y+5-"%)$-"$KCC$:4$Y%3"$V*011*4 % Y11*$'3*,$!2-2I%$ H-&3+1$Z,31/$Y3+,%1&$Y+l3"&1($%"#$-*,10$RIFHUV $*-$#3)+.))$R%**10)$-/$+-"+10"$*-$ (-.J$%"#$1"f-($%$+-2$-/$+-//114$ % 7KH$OWDPRQWH6SULQJV$SRSND9):3RVWLVORFDWHGDW6&HQWUDO$YHQXH$SRSND 9,1$2-)*$3)$-21"$ <1#"1)#%($%"#$V%*.0#%($Y-0"3"O)$/0-R$7,0(&+$1*( $NUCF$*-$EFUFF$%4R4$]-*,10$ ,-.0)$Q($%22-3"*R1"*$-"&(^4 % !&&$R1RQ10)$ %"#$/%R3&31)$%01$.0O1#$*-$%**1"#4$9,-)1$',-$,%P1$)10P1#$3"$%"($Q0%"+,$-/$*,1$R3&3MWDU\GXULQJDQ\ZDURUFRQLFWDQGZKRR%($Q1$3"*101)*1#$3"$Q1+-R3"O$%$R1RQ10J$%01$%&)-$.0O1#$*-$%**1"#4$Z%&&$LFDMNN_MNKaaJ$-0$1R%3&$3"/-gP/'2-)*EFELD4+-R$$ % $$ 1:2&))$$OXPQL %<% Y-"*,&($R11*3"O)$ ].).%&&($*,1$L*,$Y-"#%($1P1"3"O$3"$%$R-"*,$#.03"O$*,1$)+,--&$(1%0^$%01$-21"$*-$%"(-"14$\-.$#-$"-*$,%P1$*-$,%P1$Q11"$%$R1RQ10$-/$WW!J$"-0$3)$3*$"1+1))%0($*-$,%P1$%$+,3&#$3"$%"$WW!$+,%2*104$ $OOWKDWLVUH TXLUHGLVDGHVLUHWRKHOSWKHVH\RXQJSHRSOHERWKIRU))$DQG+ W-0$3"/-0M R%*3-"J$+-"*%+*$"'-+//%%gOR%3&4+-R$= ROXQWHHUV1HHGHG 9,1$51QQ31$9.0"10$ Z%"+10$Z1"*10$"11#)$P-&."*110)$*-$,1&2$3"$WKHRIFH0RQGD\WKUX)ULGD\IURP=1&2$/-0$%"$,-.0$-0$*'-$'-.&#$Q1$O01%*4$$GPLQLVWUDWLYHSRUWLRQLVPRYLQJWRRIFH"1S*$#--0$3"$%$+-.2&1$-/$'11I)4$Z%&&$G-%""$%*$LFDMNNFMKEEE$-0$LFDM_KFMKNNK$+1&&4 % $$$$$$$ % $$$$$ $$ % $$ $ % $$$ 0XVHXPRI$SRSNDQV(WK$:>99:/% =-.0)$-21"U$9.1)#%($*,0-.O,$W03M #%(J$EUE`$24R4$*-$`$24R4$!#R3))3-"$3)$/0114$Z-"*%3")$#3)2&%()$%"#$3"/-0R%*3-"$%Q-.*$!2-2I%8)$,3)*-0(J$ DQGKDVKLVWRU\ERRNV IRUVDOH $W-0$R-01$3"/-0R%*3-"J$+%&&$LFDM DFCMEDFD4 $$Y-"*,&($R11*3"O)$-/$!2-2I%$ =3)*-03+%&$V-+31*($%01$"-0R%&&($,1&#$-"$%$V."#%($%/*10"--"47KH$SRSND(ONV/RGJH R11*)$ UVWDQGWKLUG7XHVGD\VRIPRQWK:60%"O14$W-0$R-01$3"/-0R%*3-"J$+%&&$LFDMNNaMEaFF$-0$1R%3&$%2-2I%1&I)g%-&4+-R4$$$*):&$SRSND:RPDQV&OXE M$*-$R11*$ *,1$C0#$9.1)#%($-/$1%+,$R-"*,J$Q1O3""3"O$3"$V12*1RQ104%)ROLDJH*DUGHQ&OXE PHHWVWKHUVW 9,.0)#%($-/$1%+,$R-"*,J$%*$_UCF$%4R4J$%*$*,1$Y.)1.R$-/$!2-2I%")J$EKK$:J4$`*,$V*4J$!2-2I%J$V12*1RQ10$*,0-.O,$G."14$SRSND*DUGHQ&OXE PHHWVWKHUVW 9.1)#%($1%+,$R-"*,$%*$W30)*$k"3*1#$Y1*,M-#3)*$Z,.0+,J$KFE$V4$H%0I$!P14J$V12*1RMQ10$*,0-.O,$Y%(4$$W-0$3"/-0R%*3-"J$+%&&$l%*,($LFDMNNaMa_DF4 $ 0XVLFDW0DJQROLDUHFRUGHUFODVVHVQ1O3"$-"$Y-"#%()$/0-R$CUCFMLUE`$24R4$%"#$3"*10R1#3%*1$+&%))1)$%01$,1&#$-"$<1#"1)#%()$EEUE`$%4R4M"--"$%"#$KUCF$24R4MCUE`$24R4$%*$K_K_$V4$X3"3-"$@#4$]='($LCD^J$!2-2I%4$9,1$+&%))1)$%01$-21"$*-$%&&$%O1)4$9,1$+-)*$3)$jK$210$210)-"$210$+&%))4$>/$(-.$%01$%$"-P3+1J$-0$%01$3"*101)*1#$3"$&1%0"3"O$*-$2&%($*,1$01+-0#10J$+%&&$LFDM NNaMLKCE4$&LW\RI$SRSND3ODQQLQJ=RQLQJ.).%&&($*,1$)1+-"#$9.1)#%($-/$*,1$R-"*,4 % SP $Z3*($Z-."+3&$Z,%RQ10)J$Z3*($ =%&&J$EKF$:4$Y%3"$V*4J$!2-2I%4$!&&$R11*M3"O)$-21"$*-$*,1$2.Q&3+4$V.Qf1+*$*-$+,%"O1$'3*,$"-*3+14$W-0$3"/-4J$+%&&$5%P3#$Y--"J$LFDMDFCMEDC_ 4$ %ULGJH*DPHVDQG&ODVVHV $:P10($ Y-"#%($%"#$W03#%($R-0"3"O$%*$_UE`$%4R4J$%*$*,1$?%I1$Z-."*($5.2&3+%*1$X03#O1$Z&.QJ$`EF$<4$l1($!P14J$:.)*3)4$W-0$R-01$3"/-0MR%*3-"J$+%&&$C`KMCE`M__CL$-0$P3)3*$&%I1#.M2&3+%*14+-R4$$$+RVSLWDO+HDOWK&RXUVH2IIHUHG U$9,1$ ?3P3"O$=1%&*,($H0-O0%R$%*$W&-03#%$=-)M23*%&$!2-2I%$#1)3O"1#$*-$,1&2$*,-)1$'3*,$+,0-"3+$#3)1%)1)$).+,$%)$,3O,$Q&--#$201)M).01J$%0*,03*3)J$#3%Q1*1)J$+%"+10$%"#$R-014$Z%&&$LFDMaK`MDFLN$*-$&1%0"$R-01$%Q-.*$/011$+,0-"3+$#3)1%)1$)1&/MR%"%O1R1"*$+-.0)1)4$$&RPSXWHU&ODVVHVLQERWK(QJOLVKDQG6SDQLVK $!P%3&%Q&1$#%3&($-0$'11I&($ %*$6Z?V$7-0*,$60%"O1$X0%"+,4h$Z&%))1)$%01U$Z-R2.*10$X%)3+)J$:S+1&J$<-0#$@1M).R1$<03*3"OJ$:R%3&$/-0$V1"3-0)J$:??>V$:"O&3),$?%QJ$<-0#J$6"&3"1$G-Q$V1%0+,1)J$H-'10$H-3"*J$>"*10"1*J$621"$?%QJ$=-'$*-$.)1$%$R-.)1$%"#$I1(Q-%0#J$1*+4$Z%&&$6Z?V$7-0*,$60%"O1$X0%"+,h$/-0$R-01$#1*%3&)4+DELWDW9ROXQWHHUV $B-$*-$'''4,%Q3*%*M )1R3"-&1%2-2I%4-0OJ$+&3+I$-"$P-&."*110)4$9,101$%01$%$".RQ10$-/$-22-0*."3*31)$%P%3&M%Q&1$%*$*,1$@1)*-01)4$Z%&&$$ $$ -0$LFDMNNFMNNNE$*-$)3O"$.2$/-0$3"/-0R%*3-"42SHQ+HDUW.LWFKHQ 9,1$B-"$ \1%0)$V1"3-0$Y3"3)*0($-/$V*4$H%.&$!Y:$Z,.0+,$'3&&$)2-")-0$%$)-.2$I3*+,1"J$-"$*,1$*,30#$Y-"#%($-/$1P10($R-"*,J$/0-R$"--"MLUFF$24R4J$%*$*,1$Z,.0+,$%*$EFEK$V4$H%0I$!P14J$!2-2I%4$W-0$R-01$3"/-0R%*3-"J$+%&&$LFDMNN_MLLaL4 hhhhhhhhhh h]6Z?V^$60%"O1$Z-."*($H.Q&3+$?3Q0%0($7-0*,$60%"O1$X0%"+,$!##01))U$EKEE$:4$V1R-0%"$X-.&1P%0#J$!2-2I%$LCa$]V1R-M0%"^$%"#$9,-R2)-"$@-%#4$'''4-+&)43"/-4$9-$01)10P1$%$)2%+1J$+%&&$LFDMNC`MDCKC4hh!2-2I%$!01%$Z,%RQ10$-/$Z-RR10+1J$ENF$:4$Y%3"$V*4J$!2-2I%4$W-0$R-01$3"/-J$+%&&$LFDMNNaMELLE &20081,7<(9(176 &$/(1'$5,1)2 !"#$%"&&'()*+$,-,(*./$0'(1$#2).,#./$ DQGQRQSURWRUJDQL]DWLRQV 6HQGLQIR ID[RUHPDLO DGV#WKHDSRSNDFKLHIFRP 6XEVFULEHWR7KH$SRSND&KLHI ((GLWLRQRU+RPH'HOLYHU\ Z%&&$LFDMNNaMKDDD$-0$ A3)3*$*,1$<1Q$)3*1U $'''4*,1%2-2I%+,31/4+-R ,Q&RXQW\ZLWK(HGLWLRQ RUIRUMXVWSRVWDOGHOLYHU\ 2XWRI&RXQW\ZLWK((GLWLRQ RUIRUSRVWDOGHOLYHU\ (9(176 ++ :((./< ++ 83&20,1* ++ 21*2,1* ++ (9(176 -8/<

PAGE 15

!"#$%&'&()$*"+#,-$$./01$23-$2345-$6)7#$89 !"#$%&'(()'&*$+,--.#$/($0',1* '1$234#$56$'0$7"/($1#)(232#&8 +,--.#$9'.,7/'1 !"#$%&'($&)$&*$)"$#"+,$&%$-$ '"../%&)0$"1$'"/+)("/*$2("23($ #4"$-+($-3#-0*$ 4"35&%6$5""+*$1"+$"%($-%")4(+7 8%59 )"$4-:($)#"$6(%)3(.(%$*)"2$)"$ DVVLVWZLWKWKHFKDQJLQJRIDDW )&+($-)$;$"<'3"',$&%$)4($."+%&%6 $&*$*"$(%'"/+-6&%67!"#$%&'()*&+,-,./$0&(1&& 23(3%#&#$4& 0)55()$4,$6&+(77)$,-,/08&!"#$%&'$%((&')*%+',!"#$!%&%'#($)*+,($-./0$1*..$ /(#$2+/'$'#323.%0.#$#2#$4.%((#($ 5+'$6"#$7'+4'%8 9:'+;#36$<*4"6$6+$=*4"6>?The Apopka Chief, The Planter & AOS(Apopka Of ce Supply) would like to thank the generous Apopka area for continuing to donate the gift of sight forso MANY. 407-886-2777 OLD GLASSES & HEARING AIDS WANTED Tavares Lions ClubIf you have old glasses or hearing aids you no longer need, please leave them at.("(/%$0IFH1#((23$(5&The Apopka Chief!"#$60):;#<$=(#*2-2(+*>??$=7$@-+,$8:(79$82"2,-AB>7C352-343-0180 !"#$%&'()#%*+&',-*./)0'120'+3'4/$$5++60',$'5/&7'7+')/*7'-&'8/#"/&'+&'9:/*6#%0';:$%'<=0'>?<1@'A+)&'!B)-$'<=0''5-7.'N+)/'7.#&'2?'%/#)*'RI&LYLO6HUYLFH7KHIDPLO\ZLOOUHFHLYH"-*-7+)*'3)+N'QR??'BN'S'1R??'BN'+&'9.:)*6#%0';:$%'?<1'#7'%DOGZLQ)DLUFKLOG13DUN$YH$SRSND)OZLWKWKHIXQHUDOVHUYLFHWREHKHOG#7'<?0'>?<1'5-7.'T#*7+)'(#)%'+RZHOORIFLDWLQJ,QWHUPHQWZLOO3+$$+5'#7'D'%/#)*0'T#:$-&/'$-"/6'5-7.'E-$$#)6'#&6'A#)K#)#'6PLWKLQ$SRSND3DXOLQHFRQVLGHUHG%DUEDUDDV#'6#:G.7/)@''T#:$-&/'-*'#$*+'*:)"-"/6'K%'./)'3#-7.3:$'FRPSDQLRQ/XOXKHUGRJIRUWKHODVW\HDUVZLWKZKRPVKHIRXQGJUHDWMR\/XOXFDQWJXUHRXWZKHUHKHUSURWHFWRUIURPWKHVWRUPVKDVJRQH3DXOLQHVIULHQGVDUHWRRPDQ\WRFRXQW3DXOLQHKDGDVHUYDQWVKHDUWDQGDOZD\VSXWHY HU\RQHHOVHUVW6KHORYHGWKH/RUG3DXOLQHUHDGKHU%LEOHHYHU\GD\6KHZDVSDWLHQWDQGNLQGDOOWKH6#%*'+3'./)'$-3/@''J./'3+:&6'G)/#7'U+%'-&'7./'*-NB$/'$-"-&G'+3'$-3/@''J./'$+"/6'./)'/V7/&6/6'3#N-$%0'3)-/&6*0'DQGRZHUV6KHQHYHUPLVVHGD0LDPL'ROSKLQVRU2UODQGR0DJLFJDPH6KHHYHQZDVOXFN\HQRXJK7+'N//7'A+'W:7$#5@'J./'7.+:G.7'7.#7'5#*'G)#&6@'J./'5#*'#$*+'#',$+)-6#'J7#7/'3++7K#$$'3#&'#&6'.#6'N#&%'3)-/&6*'-&'9#$$#.#**//'3)+N'./)'7#-$G#7-&G'6#%*'5-7.'E-$$#)6'#&6'A#)K#)#@''8/#$7.%'#$$'+3'./)'$-3/0'./)'UVWKRVSLWDOVWD\ZDVLQKHUV+HUPLQGZDVDVVKDUSDVDWDFN6KHZHQWVQRUNHOLQJDWZKLWHZDWHUUDIWLQJDWDQGWR$ODVNDDW6KHZDVIDPRXVIRUKHU&KLFNHQQ'XPSOLQJVDQG&RFRQXWFDNH3DXOLQHUHFHQWO\FHOHEUDWHGKHUWKELUWKGD\ZLWKRIKHUFORVHVWIULHQGVDQGIDPLO\7KLVZDVDPDJQLFHQWGD\IRUKHU''X-*-7#7-+&'5-$$'K/'3)+N'CR??'#@N@'7+'<0'>?<1'#7'7./'Y++N-*',:&/)#$'8+N/'LQ$SRSND)ORULGDIROORZHGE\KHUIXQHUDOVHUYLFHDWDP,QOLHXRIRZHUVPHPRULDOFRQWULEXWLRQVN#%'K/'N#6/'7+'7./'W)$#&6+'A#.-#'J.)-&/'9)#&*B+)SWDWLRQ)XQGDW(DVW6HPRUDQ%OYG$SRSND,$+)-6#'2>=?2@''9.-*'3:&6'./$B*'7)#&*B+)7'W)$#&6+'DUHDFKLOGUHQWKDWQHHGPHGLFDOFDUHIURPWKH6KUL&/)*'7+'#&6'3)+N'7./'.+*B-7#$'-&'9#NB#@''' !"#$%&'()*%+, ./45!'2)!'*'3!-!./&0!'6)!12'3 Funerals don't have to be Expensive to be Respectful.(407) 880-1007 LOOMIS FAMILY FUNERAL HOMES Providing every family with the care and respect they deserve !"#$%&'$$'"(%()#) 0' $SRSNDGLHG6XQGD\-XO\<@'E)@'E+)+'5#*'K+)&'-&'J7/@'(/&/"-/"/0'E-**+:)-@'J:)"-"+)*R'ZLIH%HUQDGLQHFKLOGUHQ5LFN5KRQGDERWKRI:LQWHU3DUN5DQG\5RQ5RJHUDOORI$SRSND5HQHH+DOVWHDG2UPRQG%HDFK5DFKHOOH+RIIPDQ/RQJZRRG5RFN\%HHQH*XDWHPDOD0DUYLQ)W3LHUFHJUDQGFKLOGUHQJUHDWJUDQGFKLOGUHQWZRJUHDWJUHDWJUDQGFKLOGUHQ/RRPLV)DPLO\)XQHUDO+RPH$SRSND Z *"+$',-%.('/0 0'?<10'*:))+:&6/6'K%'3#N-$%@''J./'5#*'=C@''!&6)/#'5#*'$+"-&G'#&6'FDULQJDWUXHODG\ZKRHQU+%/6'*B/&6-&G'7-N/'5-7.'KHUFKLOGUHQDQGVSRLOLQJKHUJUDQGFKLOGUHQZLWKORQJKXJVDQGFKRFRODWHNLVVHV6KH-*'*:)"-"/6'K%'./)'3+:)'*+&*R'3DW(G'DQDQG.HYLQDQGRQHGDXJKWHU.DWKOHHQ3URFWRUDQGWKHLUVSRXVHVO&'#66-7-+&0'*./'$/#"/*'K/SKLQGHLJKWJUDQGFKLOGUHQ.HOVH\.LHUDQ6KDQHA)#&6+&0'J/#&0'A)/&&#&0' L/NB*/%'#&6'J./#@ 'J./'*B/&7'N+)/'7.#&'2?'%/#)*'+3'./)'B)+3/**-+&#$'FDUHHUKHOSLQJRWKHUVDVDQHGXFDWRUFRQVXPHUFUHGLW FRXQVHORUDQGD FRXQVHORUDWWKH1DY\5HOLHI6RFLHW\6KHZDVDOVRDQDFWLYHN/NK/)'+3'7./'&DWKROLF&KXUFK'9./'IXQHUDOVHUYLFH5-$$'K/G-&'#7'CR??'!E'+&',)-6#%' -XO\DW6W3DWULFNV&DWKROLF&KXUFKLQ0W'RUD)/ZLWKDJUDYHVLGHVHUYLFH-NN/6-#7/$%'3+$$+5-&G'#7'7./'9#%$+)'F/N/7/)%'-&'8+5/%S-&S7./S8-$$*0',Y@''O&'$-/:'+3'RZHUVSOHDVHVHQGGRQDWLRQVWRWKH$PHULFDQ&DQFHU6RFLHW\RUWKH$PHULFDQ5HG&URVV&RQGROHQFHVPD\EH$/37'#7'555@K/%/)*3:&/)#$SKRPHFRPDUUDQJHPHQWVLQWKHFDUHRI%H\HUV)XQHUDO8+N/'#&6'F)/N#7+)%0'Y//*SK:)G0',Y@ !"#$%&'(&$)%'(*(&+," Continued from page 2B=>+;/)<+#?@$ !"#$%&'()*%+,#%-."/% (/%0,#12"%,/3%+,#%455%62,"#%.73 D&+*)$E-2)&*)$F4/+'4$"1$ G-%6(+&%($#&33$4"35$&)*$D&1)4$H/%5-0$I:(%&%6$H&%6$"%$J/30$AK9$-)$L$27.7$M/*&'-3$6/(*)*$#&33$EHDYHPDQFRPERWKDW#&33$2(+1"+.$N-OO$*)03&%6$"1$*('/3-+$-%5$*-'+(5$*"%6*P$Q-++(%$Q&33&-.*9$,(0R"-+5S$E&33$E+-5*4-#9$)+/.2()S$G"55$T":())9$*-B"24"%(S$F4+&*$T":())9$R-**S$-%5$E"RJ"4%*"%9$2(+'/**&"%7$I: (+0"%($&*$&%:&)(5$)"$)4($'"% '(+)7$$$G4($'4/+'4$&*$3"'-)(5$-)$LCCU$H-53(+$V579$M)7$W"+-7$D"+$."+($&%1"+.-)&"%9$FDOO $G4($="+)4*&5($E-2 )&*)$F4/+'4$X-'-)&"%$E&R3($H'4""3$Y-.($Z%[$#&33$)-,($SODFH6XQGD\7KXUVGD\$XJXVWDWWKHFKXUFK>U\$Q7$Q(3'4$V"-59$82"2 ,-7$G4($="+)4*&5($E-2)&*)$F4/+'4$82"2,-$&*$*2"%*"+ &%6$)4($(:(%)7$]Y-.($Z%[$&*$-$#((,$"1$6(-+&%6$/2$1"+$)4($R&6$ 6-.(9^$-$'4/+'4$*2",(*.-%$*-&57$P_&5*$#&33$R(6&%$(-'4$5-0$-)$)4($2(2$+-3307$D+".$)4($2(2$+-3309$,&5*$#&33$6-)4 HUDWWKHHOGKRXVHZKHUH)4(0$#&33$R($(`/&22(5$)"$5&6$5((2$&%)"$Y"5<*$Q"+57$_&5*$#&33$3(-+%$)4-)$Y"5$4-*$6&:(%$)4(.$(:(+0)4&%6$)4(0$%((5$)4+"/64$4&*$5&:&%($2"#(+7$ $I-'4$5-09$,&5*$#&33$.-,($'+-1)*9$23-0$6-.(*9$(%N"0$*%-',*9$*&%6$*"%6*9$-%5$3(-+%$-R"/)$.&**&"%*7$V(6&*)+-)&"%$&*$8/6/*)$C$-)$LPUC$27.7$V-330$R(6&%*$%&64)30$-)$LP\?$27.7$-%5$'3"*(*$-)$K$27.7$D"+$."+($&%1"+.-)&"%9$'"%)-')$V-%50$@"#(33$-)$ A'<;"?+B#$9)&;+?;$*"/
PAGE 16

!"#$%&'%(#)''*+("*,(+&"-+)'*./"0+/"&,(+"1,+2345+6+&)1'34)+2345+7!"#$%&'($)*+,-./0+"//1$2*1#2$.*3$"/145*6$7#8492$/9$:;45*6<$=>8>2.$?<$%&'(<$*95$#952$/9$0>9-5*6<$=>8>2.$@<$%&'(A$$ B>;498$."42$2*1#2$.*3$ "/145*6$C#;4/5<$:1/;45*$1*D$54;#+.2$."*.$9/$2*1#2$.*3$/;$1/+*1$/C.4/9$.*3$E*12/$,9/D9$*2$542+;#.4/9*;6$2*1#2$2>;.*3F$D411$7#$+/1-1#+.#5$/9$C>;+"*2#2$/GH$I1/."498<$G//.D#*;<$*95$+#;.*49$*++#22/;4#2$2#11-498$G/;$JK&$/;$1#22$C#;$4.#LM$I#;.*49$2+"//1$2>C-C14#2$2#11498$G/;$J'@$/;$1#22$C#;$4.#LA$!"42$2*1#2$.*3$"/145*6$5/#2$9/.$*CC16$./H$ =96$4.#L$/G$+1/."498$2#11498$G/;$L/;#$."*9$JK&M$*96$2+"//1$2>CC16$4.#L$2#11498$G/;$L/;#$."*9$J'@M$7//,2$."*.$*;#$9/.$/."#;D42#$#3#LC.M$;#9.*12$/;$1#*2#2$/G$*96$#148471#$4.#L2M$;#C*4;2$/;$*1.#;*-.4/92$/G$*96$#148471#$4.#L2M$/;$2*1#2$/G$*96$#148471#$4.#L2$49$*$."#L#$C*;,<$#9-.#;.*49L#9.$+/LC1#3<$C>7-14+$1/58498$#2.*7142"L#9.<$/;$*4;C/;.A$ N#G#;#9+#H$0#+.4/9$ @O<$I"*C.#;$%&'(-''(<$P*D2$/G$:1/;45*A8#)''*+8399*0+:&,;( $ !"#$G/11/D498$42$*$142.$ /G$2+"//1$2>CC14#2$*95$."#4;$.*3*71#$2.*.>2$5>;498$."#$7*+,-./-2+"//1$.*3$"/1-45*6$C#;4/5A$Q/$.*3$42$5>#$/9$."#$2*1#$/;$C>;+"*2#$/G$*96$2+"//1$2>CC16$4.#L$D4."$*$2#11498$C;4+#$/G$J'@$/;$1#22$C#;$4.#LA$!"42$#3-#LC.4/9$5/#2$9/.$*CC16$./$2*1#2$/G$2+"//1$2>CC14#2$49$*$."#L#$C*;,<$#9.#;.*49L#9.$+/LC1#3<$C>714+$1/58498$#2.*7142"L#9.<$/;$*4;C/;.A$ R0+"//1$2>CC14#2S$*;#$ GHQHGDVSHQVSHQFLOV#;*2#;2<$+;*6/92<$9/.#-ERRNVQRWHERRNOOHUSD C#;<$1#8*1$C*52<$7495#;2<$1>9+"$7/3#2<$+/92.;>+.4/9$C*C#;<$L*;,#;2<$G/15#;2<$C/2.#;$7/*;5<$+/LC/24-.4/9$7//,2<$C/2.#;$C*C#;<$2+422/;2<$+#11/C"*9#$.*C#<$81>#<$C*2.#<$;>1#;2<$+/L-C>.#;$542,2<$C;/.;*+./;2<$+/LC*22#2<$*95$+*1+>1*-./;2A$<-";9*,(+'=+(#)''*+(399*0+.&,;(+&)"&+"1,+,-%,;9&> $ )495#;2M$+*1+>1*./;2M$ +#11/C"*9#$E.;*92C*;-#9.F$.*C#M$+/1/;#5$C#9-+412M$+/LC*22#2M$+/LC/-24.4/9$7//,2M$+/LC>.#;$542,2$E71*9,$IB2$/916FM$+/92.;>+.4/9$C*C#;M$+;*6-/92M$#;*2#;2M$G/15#;2M$81>#$E2.4+,$*95$14T>45FM$"48"-148".#;2M$1#8*1$C*52M$1>9+"$7/3#2M$L*;,#;2M$9/.#-ERRNOOHUSDSHUQRWH 7//,2M$C*2.#M$C#9+412<$49-+1>5498$L#+"*94+*1$*95$UHOOVSHQVLQFOXGLQJIHOW7*11C/49.<$G/>9.*49<$"48"-OLJKWHUVDQGUHOOVSRVWHU7/*;5M$C/2.#;$C*C#;M$C;/-.;*+./;M$;>1#;2$*95$2+42-2/;2A<-";9*,(+'=+(#)''*+(399*0+.&,;(+&)"&+"1,+&"-"?*,> $ )//,2$9/.$/."#;D42#$#3#LC.M$+/;;#+.4/9$WDSHXLGRUSHQVSULQW #;$C*C#;M$+/LC>.#;$C*C#;M$L*2,498$.*C#M$2.*C1#;2$*95$2.*C1#2A @*'&).A4+"A/+2##,(('%1.,(+ !"#$G/11/D498$42$*$142.$ /G$+1/."498$*95$*++#22/-;6$4.#L2$*95$."#4;$.*3*71#$2.*.>2$5>;498$."#$7*+,-./-2+"//1$2*1#2$.*3$"/14-5*6$C#;4/5A$Q/$.*3$42$5>#$/9$."#$2*1#$/;$C>;+"*2#$/G$*96$*;.4+1#$/G$+1/."498<$D*1-1#.<$/;$7*8<$49+1>5498$"*95-7*82<$7*+,C*+,2<$G*996$C*+,2<$*95$54*C#;$7*82<$7>.$#3+1>5498$7;4#G+*2#2<$2>4.+*2#2<$*95$/."#;$8*;-L#9.$7*82<$D4."$*$2#11498$C;4+#$/G$JK&$/;$1#22$C#;$4.#LA$E!"#$142.$42$9/.$*11-49-+1>24U#AF$ RI1/."498S$L#*92$*96$ *;.4+1#$/G$D#*;498$*CC*;#1<$49+1>5498$*11$G//.D#*;$E#3-FHSWVNLVVZLPQVUROO #;$71*5#2<$*95$2,*.#2F$49-.#95#5$./$7#$D/;9$/9$/;$*7/>.$."#$">L*9$7/56A$I1/."498$5/#2$9/.$49+1>5#$D*.+"#2<$D*.+"7*952<$V#D#1;6<$>L7;#11*2<$/;$"*95,#;+"4#G2A$ !"42$#3#LC.4/9$5/#2$ 9/.$*CC16$./$2*1#2$/G$+1/."-498<$D*11#.2<$/;$7*82$49$*$."#L#$C*;,<$#9.#;.*49L#9.$+/LC1#3<$C>714+$1/58498$#2.*7142"L#9.<$/;$*4;C/;.A$<-";9*,(+'=+,-,;9&+#*'&).A4+"A/+"##,(('%1.,(> $ =++#22/;4#2<$7*;;#..#2$*95$7/776$C492M$7#1.$7>+,1#2M$7/D$.4#2M$"*4;9#.2<$7/D2<$+14C2<$*95$"*4;7*952M$"*957*82M$9#+,D#*;M$C/96.*41$"/15-#;2M$2+*;U#2M$.4#2M$*95$ZDOOHWVDHURELFDQGW 9#22$+1/."498M$*C;/92$*95$+1/."498$2"4#152M$*."1#.4+$2>CC/;.#;2M$7*76$+1/."#2M$ 7*+,C*+,2$*95$7//,$7*82M$7*95*9*2M$7*2#7*11$+1#*.2M$7*."498$2>4.2<$+*C2<$*95$+/U#;->C2M$7#1.2M$7472M$74+6+1#$"#1L#.2$E6/>."FWWM$71/>2#2M$7//.2$E#3+#C.$2,4$RUVKLQJERRWVERZO 498$2"/#2$EC>;+"*2#5FM$7;*+#2$*95$2>CC/;.2$D/;9$./$+/;;#+.$/;$*11#U4*.#$*$C"624+*1$49+*C*+4.6$/;$49-V>;6WM$*95$7;*2M$+"/4;$*95$*1.*;$+1/."498WM$+1#*.#5$*95$2C4,#5$2"/#2M$+1#;4-+*1$U#2.L#9.2WM$+/*.2M$+/49$C>;2#2M$+/2.>L#2M$+/U#;*112M$54*C#;$7*82M$54*C#;2<$54*C#;$492#;.2$E*5>1.$*95$7*76<$+1/."$/;$542C/2*71#FM$5;#22-HVIDQQ\SDFNVVKLQJYHVWVQRQRWDWLRQIRU L*1$+1/."498$EC>;+"*2#5FM$81/U#2$E5;#22<$8*;5#9<$1#*."#;$*95$D/;,FM$8;*5->*.4/9$+*C2$*95$8/D92M$86L$2>4.2$*95$>94G/;L2M$"*.2$*95$+*C2M$"/24#;6$*95$C*9.6$"/2#$E49+1>5-498$2>CC/;.$"/24#;6FM$">9.-498$U#2.2M$V*+,#.2M$V#*92M$1*7$+/*.2M$1#884982<$.48".2<$*95$1#8$D*;L#;2M$1#/-.*;52M$1498#;4#M$L*;.4*1$*;.2$*..4;#M$/U#;2"/#2$*95$;>7-7#;$2"/#2M$C*9.2M$C>;2#2M$;*49+/*.2<$;*49$"*.2<$*95$C/9+"/2M$;#+#4U498$71*9-,#.2M$;#1484/>2$+1/."498WM$;/7#2M$2*G#.6$+1/."498M$2*G#.6$2"/#2M$2+/>.$>94-G/;L2M$2"*D12$*95$D;*C2M$2"4;.2M$2"/#$492#;.2$*95$492/1#2M$2"/#2$E49+1>5498$*."1#.4+FM$2"/>15#;$C*52$E#A8A<$5;#22#2$/;$V*+,#.2FM$2"/;.2$M$2,4$2>4.2$E29/DFM$2,4;.2M$21##CD#*;$E948".-8/D92$*95$C*V*L*2FM$214C-C#;2M$214C2M$2/+,2M$2>4.2<$ 21*+,2<$*95$V*+,#.2M$2>2-C#95#;2M$2D#*.7*952M$2D#*.#;2M$2D4L$2>4.2$*95$.;>9,2M$.4#2$E9#+,.4#2$*95$7/D$.4#2FM$.>3#5/2$EC>;-+"*2#5FM$>95#;+1/."#2M$>94G/;L2$ED/;,<$2+"//1<$*95$*."1#.4+$-$#3+1>5498$C*52FM$U#2.2A<-";9*,(+'=+&"-"?*,+#*'&).A4+"A/+"##,(('%1.,(> =++#22/;4#2$E"*95,#;+"4#G2M$V#D#1;6M$,#6$+*2#2M$D*.+"7*952$*95$D*.+"#2FM$*."1#.4+$81/U#2M$*."1#.4+$C*52M$7/D1498$2"/#2$E;#9.#5FM$7;4#G+*2-#2M$+"#+,7//,$+/U#;2$E2#C*;*.#$G;/L$D*11#.2FM$+"#2.$C;/.#+./;2M$+1/."<$1*+#<$,94..498$6*;92<$*95$/."#;$G*7;4+2M$+1/."498$;#-C*4;$4.#L2<$E#A8A<$.";#*5<7>../92<$.*C#2<$4;/9-/9$C*.+"#2<$/;$X4CC#;2FM$+/;-2*8#2$*95$7/>./994#;#2M$$+/2L#.4+$7*82M$+;47$71*9-,#.2M$54U498$2>4.2$ED#.$*95$5;6FM$5>GG#1$7*82M$#17/D$SDGVQVVKLQJERRWVZDGHUV‡)RRWEDOOSDGVG/;L*1$+1/."498$E;#9.#5FM$8*;L#9.$7*82M$81/U#2$E7*2#7*11<$7*..498<$74+6+1#<$8/1G<$"/+,#6<$;>77#;M$2>;-84+*1$*95$.#9942FM$8/881#2$E#3+#C.$C;#2+;4C.4/9WFM$"*;5$"*.2M$"#1L#.2<$#3+#C.$6/>."$74+6+1#WW$E7*2#-7*11<$G//.7*11<$"/+,#6<$L/-./;+6+1#$*95$2C/;.2FM$4+#$2,*.#2M$49-149#$2,*.#2M$,#6$+"*492M$,9##$C*52M$14G#$V*+,#.2$*95$U#2.2M$1>88*8#M$L*,#->C$7*82M$C*52$EG//.7*11<$"/+,#6<$2/++#;<$#17/D<$,9##<$*95$2"/>15#;FM$C*49.$/;$5>2.$L*2,2M$C*..#;92M$C;/.#+.4U#$L*2,2$E*."1#.4+FM$;#9.-#5$+1/."498$/;$G//.D#*;$E#A8A<$>94G/;L2<$G/;L*1$D#*;<$+/2.>L#2$*95$7/D1-498$2"/#2FM$;#C*4;$/G$D#*;-498$*CC*;#1M$;/11#;$71*5#2M$;/11#;$2,*.#2M$2*G#.6$81*22-#2$E#3+#C.$C;#2+;4C.4/9WFM$2"*U498$,4.2$*95$7*82M$2"49$8>*;52$*95$C*55498M$2"/>15#;$C*52$EG//.7*11<$"/+,#6<$2C/;.2FM$2,4$7//.2$E29/DFM$2,4$U#2.2$ED*.#;FM$2,49$54U498$2>4.2M$2>4.+*2-#2M$2>981*22#2$E#3+#C.$C;#2+;4C.4/9WFM$2D4LL498$L*2,2M$>L7;#11*2M$D#48".-14G.498$7#1.2$*95$D482A W!"#2#$4.#L2$*;#$*1D*62$#3#LC.$*2$;#1484/>2<$C;#2+;4C.4/9<$C;/2."#.4+<$/;$/;."/C#54+$4.#L2A$WW)4+6-+1#$"#1L#.2$L*;,#.#5$G/;$>2#$76$6/>."$*;#$#3#LC.$G;/L$2*1#2$.*3AB'&.#,+&'+!3(.A,((,(+C.&)+D3*&.9*,+E'#"&.'A( $ YG$6/>$;#C/;.$2*1#2$.*3$ G/;$*11$6/>;$1/+*.4/92$/9$/9#$+/92/145*.#5$.*3$;#-.>;9<$."#$C>714+*.4/9$D*2$L*41#5$./$."#$L*49$7>24-9#22$*55;#22$142.#5$/9$6/>;$;#.>;9A$ !"#$C>714+*.4/9$D*2$ 9/.$L*41#5$./$#*+"$/G$6/>;$1/+*.4/92A$)#$2>;#$./$9/.4-G6$*11$/G$."#$4954U45>*1$2./;#$1/+*.4/92$*7/>.$."42$2*1#2$.*3$"/145*6$*95$."#$2C#+4G-4+$C;/U424/92$49$."#$C>714-+*.4/9A$ =$142.$/G$."#$#148471#$ 4.#L2$*95$*$+/C6$/G$."#$C>714+*.4/9$*;#$*U*41*71#$/9$."#$B#C*;.L#9.$/G$N#U-HQXHZHEVLWHRULGDUHYH 9>#A+/L =;#$6/>$2.;>881498$ D4."$."#$"48"$+/2.$/G$"#*1."+*;#Z$=;#$6/>$.4;#5$/G$."#$"48"$+/-C*62$*95$5#5>+.471#2Z$=;#$6/>$1//2498$.4L#$D4."$1/98$D*4.2$./$2##$*$5/+./;Z$[;<$*;#$6/>$V>2.$.4;#5$/G$."#$+>;;#9.$"#*1."+*;#$262.#LZ$ YG$."#$*92D#;$42$6#2$ ./$*96$/G$."#2#$T>#2-.4/92<$6/>$*;#$9/.$*1/9#A D0+F'#+ G/>95#;$ [2L*9$:*;//T<$\ABA$D*2$5##C16$.;/>71#5$./$2##$"*;5$D/;,498$G*L4-14#2$2.;>881498$./$"*U#$*++#22$./$T>*14.6$"#*1."$+*;#$5>#$./$;42498$+/2.2A$R!"#$*99>*1$"#*1."$49-2>;*9+#$C;#L4>L2$G/;$*9$*U#;*8#$G*L416$/G$G/>;$42$/U#;$J'&<&&&$C#;$6#*;A$]4."$6#*;16$;42498$+/2.2$49$"#*1."$492>;-*9+#<$G*L414#2$*;#$9/D$2.;>881498$./$5#+45#$D"#."#;$./$C*6$."#4;$L/;.8*8#2$*95$74112$/;$7>6$"#*1."+*;#1.$542#*2#2$14,#$"48"$71//5$C;#22>;#<$+"/1#2.#;/1<$*95$54*7#-.#2A$!"#6$*12/$L*9*8#$+/LL/9$*+>.#$L#54+*1$C;/71#L2$49+1>5498<$7>.$9/.$14L4.#5$./<$."#$+/LL/9$+/15<$7;/9+"4.42<$249>24.42<$#*;$49G#+.4/92<$*95$7*+,$C*49A$ D0+F'# $\#L7#;VKLSEHQHWVLQFOXGH ‡)UHHPHGLFDOYLVLWV G/;$*$\/9."16$\#L7#;-2"4C$/G$J?&$C#;$L/9." ‡$FFHVVWRERDUG FHUWLHG3K\VLFLDQV ‡)OH[LEOHDSSRLQW L#9.$.4L#2$G/;$+1494+$U42-4.2$D4."/>.$+*9+#11*.4/9$G##2 ‡(OHFWURQLFSUHVFULS .4/92$G/;$C4+,$>C$*.$6/>;$1/+*1$C"*;L*+4#2 ‡$GGLWLRQDOVDYLQJV /9$1*72$*95$54*89/2.4+$4L*8498$2.>54#2 D0+F'# $42$9/.$*9$ 492>;*9+#$C1*9A$!"#6$*;#$*$.#*L$/G$"#*1."-+*;#$2C#+4*142.2$C;/U45-498$*5>1.$Y9.#;9*1$L#54-+49#$2#;U4+#2A$!"#6$5/$9/.$+/U#;$+/2.2$;#1*.#5$./$2C#+4*142.$;#G#;;*12<$XUJHQWFDUH(5YLVLWV"/2C4.*14X*.4/92<$/;$2>;-84+*1$C;/+#5>;#2A$ D0+F'# $42$"#;#$./$ 2*U#$6/>$L/9#6$*95$.4L#A$:/;$#3*LC1#<$D"#9$6/>$9##5$*9$/41$+"*98#$/9$6/>;$+*;<$\RXZRXOGQWJRWKURXJK6/>;$+*;$492>;*9+#$G/;$C;#-*>."/;4X*.4/9$./$C*6$G/;$."*.$/41$+"*98#A$^/>$D/>15$>2>*116$2"/C$*;/>95$G/;$."#$2#;U4+#$*95$C*6$G/;$."#$7#2.$U*1->#A$_/D#U#;<$4G$6/>$D#;#$49$*$+*;$*++45#9.<$D/>15$ 6/>$9##5$6/>;$+*;$492>;*9+#$./$"#1C$C*6$G/;$*96$5*L*8#2Z$^#2`$!"42$42$*$+*.*2.;/C"4+$#U#9.$."*.$6/>$9##5$6/>;$+*;$49-2>;*9+#$./$+/U#;A$$$]#$*. +D0+F'# $G##1$ 6/>$2"/>15$5/$."#$2*L#$G/;$6/>;$"#*1."+*;#A$]4."$*$ D0+F'# $L#L7#;2"4C$C1*9<$6/>$"*U#$DFFHVVWRWKHLU3K\VL+4*92$*.$*9$*GG/;5*71#$C;4+#A$^/>$+*9$1/D#;$6/>;$/>.-/G-$C/+,#.$L#5-4+*1$#3C#92#2$76$2>C-C1#L#9.498$6/>;$+>;-;#9.$492>;*9+#$C1*9$D4."$D0+F'# $L#L7#;2"4C$./$ "#1C$2*U#$">95;#52$/G$5/11*;2$#U#;6$L/9."A$$ D0+F'#+ 42$*$;#U/1>.4/9*;6$"#*1."+*;#$C1*.G/;L$."*.$*11/D2$."#4;$C*.4#9.2$./$.*,#$+/9-.;/1$/G$."#$+/2.$/G$."#4;$"#*1."+*;#A$^/>$+*9$;#842.#;$/9149#$*.$DDDAL65/+A"#*1."+*;#$/;$+*11$."#L$./5*6$*.$O&a-a&?-@b(O$./$2+"#5>1#$6/>;$*CC/49.L#9.<$/;$7#..#;$6#.<$V>2.$2./C$49$G/;$*$U424.A +D0+F'# $42$+/9U#94#9.16$1/+*.#5$49$."#$=C/C,*$P*95$N#84/9*1$0"/CC498$I#9.#;$*.$a%'$0/>."$[;*98#$)1/22/L$!;*41$49$=C/C,*A 2/G,1&.(,;,A& !"#$%&#'(#)#!*+'&),#-,'.'&#/%0#)+1,2#3.2*0.),#4*+'&'.*#(*05'&*(6#7'&210*+#)8%5*#'(#$06#9(4).#:)0%%;6 :0**#!*+'&),#<'('2(#='2>#"%10#?@A# !%.2>,"#!*48*0(>'B#)2#!"#$%& !"#$%&'(%()'***+"#$%&+,-'./,&'0!"#$%"&'()$*+,+"$(-'+"+, ‰ŸvPEWŸvšJJJ hvo]u]š}8]]šd]uoZo]vP~]Œšo}8]]š]oo}u‰]}všUWZ]]vvEŒWŒŸŸ}vŒZ}o]švD}ŒZ}]š}]]v]]o]ZošZŒv d}vŒ}oo}Œ>ŒvD}ŒU s]]šW Xu}XZošZŒ }Œ -&''(#.$(,'+"+,(&#/(012321435670 ^XKŒvPo}}udŒ]oU‰}‰lU&> &}Œ¨D}všZUDuŒZ]W 407-788-1923 !"##$%&''($)*+#",-./$01234$%516784$9:+$+;24$-1<84$*1=584$>;??@4$A1784$!BB2$C$!1DB4$167$01671618E !;55$+12$%./'?015(@A' 2$363A'0$"$'9>=A' B.61".A'C3<1.6.A' ;.-"&4.6.A'D%/-".' When extreme weather hits, natural gas generators power homes automatically and are installed outside your home. They eliminate the need to buy and store fuel, turn on within seconds of a power outage, and shut off once the electricity returns. 1320 Winter Garden-Vineland Road Winter Garden, FL 34787-4341 0Hrrs&AXrr Safe & Reliable Natural Gas Service www.langd.org !"#$%&'&()$*"+#,-$$./01$23-$2345-$6)7#$89 BUSINESS PROFILE PROFILE

PAGE 17

!"#$%&'&()$*"+#,-$$./01$23-$2345-$6)7#$89 !"#$%&##'()*+$,&!"#$%&#'()%*"%+",-.%/#0'1)00)0 !""#$$%&!'(%)*+,-.*)%-(./!"#$%&"'(%)%!"$*+,"-(% .'/0(++1/$"2+%3/4%&"$%5'4+67.#00*+.-!&1+*)-2*($-!&%&!(2).!3-(4 .566%789%5%:;8<=%>?@ABC@A>DEF !"#$%&'#()$*! !"#+$!,-./)'-! !"#$! !%&'()!"#$%&$'()(*+,,-(.%&+/$' (407) 880-1007 PROVIDING EVERY FAMILY WITH THE CARE AND RESPECT THEY DESERVE LOOMIS FUNERAL HOMES SERVING FAMILIES FOR OVER THREE GENERATIONS. LOOMISFUNERALHOMES.COM !"#$%&'#() *+!"%(#*&,&-%.%/0$&1%.(#!(/2-34506789:;43<&!=36:9>?‡2UDO([DP' ‡%LWHZLQJ;UD\V' ‡&DQFHU6FUHHQLQJ ‡*XP'LVHDVH6FUHHQLQJ!"#$%&'()&*+,&-".$+*./&(*#01&2(.&.(&3+&4(53$*+%&,$.6&"*0&(.6+)&(''+)1&7)"*/'+)"3#+1&8#+"/+&/6")+&,$.6&0(9)&'"5$#0&"*%&')$+*%/1&&:;-1&<=>?=?@1!"#$%&'(")'*$+",-./"0([DP&DOO1RZ)RU$Q$SSRLQWPHQW 13DUN$YH$SRSND)/(PHUJHQF\$SSRLQWPHQWV$YDLODEOH Schroeder Dental Group 0\$SRSND'HQWLVWQHW .DWULQD06FKURHGHU'0' C on dence! !"#$%&%'(&)*+%$,-&.&$/012(&$234*5&%'*%& +*5&0(*5&$3&0#+'&%3&*&6*0/27&8'(5&9(+/9/54&8'3&8/22&$(:;(&%'(0&9#:5(&36&%'(&03$%&9/6< FXOWWLPHVLQDSHUVRQV2/6(&/$&%'(&23$$&36&*&23;(9&35(,&?#:/54&%'/$&%/0(@&1(312(&36%(5&%#:5&%3&3%'<(:$&63:&'(21&*59&*$$#:<*5+(,&A/5+(&BCDE@&6*0&?&@-.1$,>&*"+.&3(#$)*A&(%&3(#$)*:& W A ""!#$ M !%&"'(! ) M *+$ M ',*( H !'-$. P -'/+ !"# $$% &$"##4 #$ #1t"! !r4&% D ( C .'(-!+ A. M *(0'/ B *'(% C !($&1&!%Specializing in "EVMU.FEJDJOF 4FSWJOH0GGJDFr /VSTJOH)PNF "TTJTUFE-JWJOH'BDJMJUJFT Now Accepting New Patients t8PVOE$BSF$FSUJGJDBUJPO t%JBCFUJD4LJO$FSUJGJDBUJPO!"#$%&!'()*!+,-.!/'0!1#20!%&)!"#$0(!3)'4)5*!6$77)5!8##9!:;$<=!>&)5)!WKH\FDQUHDGWKUHHWRYH<##9*!?)5!7#0%&!'04!)'50!*%'5*!@#5!5)>'54*A!!B&)!<##9!/;$2%&!'!/&'0/)!%#!)'50!(2@%!/'54*! >&)0!)0#$(&!*%'5*!'5)!'/,/$7$;'%)4A!!G2@%))0!*%'5*!)H$';!#0)!(2@%!/'54=!IJ!*%'5*!)H$';!%>#=!'04!I+!)H$';!%&5))!/'54*A!K;;!(2@%!/'54*!'5)!7'2;)4!425)/%;L!%#!%&)!?'5,%2/2?'%20(!L#$%&A! 7RMRLQWKHPRYHPHQW)7'2;!0'7)=!'()=!5)'420(!/'%)(#5L!'04!7'2;20(!'4,45)**!%#!L#$0(5)'4)5*A$;'$?'+<$9''($*0/@$A'=#A#<; *)C)+E#C$#=#<; 9C+<7$1'/C$,)A+01$;'$F#(+D)GE$H/<$I+(#EHC##$+AA/<+J);+'#@/;$"+E$)C;$);$L+E<#1$M&C+<7E !B&)!N)<<2)!B$50)5!:'0/)5!:'5)!'04!3)*#$5/)!:)0%)5!#@!K?#?9'!>2;;!&#;4!'!@$045'2*20(!4'L!'%!F);;#>!F$*&5##7!O2PP'!8'9)5*!5)*%'$5'0%!B$)*4'L=!Q$;L!IR=!20!F#$0%!N#5'A!N$520(!%&)!5)*%'$5'0%S*!5)($;'5!<$*20)**!&#$5*!#@!--!'A7A!%#!-J!?A7A!%&'%!4'L=! %&)!)'%)5L!>2;;!4#0'%)!-J!?)5/)0%!#@!%&)!*';)*!@5#7!%&#*)!>&#!7)0%2#0!%&)!N)<<2)!B$50)5!:'0/)5!:'5)!'04!3)*#$5/)!:)0%)5!#@!K?#?9'A!F);;#>!F$*&5##7!O2PP'!8'9)5*!2*!;#/'%)4!'%!-TII-!UA6A!V2(&>'L!RR-!20!F#$0%!N#5'A 'LVQH\QHDUWLVWN#$(!8#;;L=!'0!K?#?9'!UHVLGHQWZLOOKDYHDQDUW*2(020(=!7))%!'04!(5))%=!'04!>2;;!4)<$%!&2*!0)>)*%!N2*0)L!'5%A!!!8#;;L!>2;;!'??)'5!'%!B&)!K5%!#@!N2*0)L!W';, ;)5L!'%!N2*0)L!6?520(*!#0!G524'L=!Q$;L!I.=!'04! 6'%$54'L=!Q$;L!IT=!@5#7!X,Y!?A7A!)'/&!4'LA!N2*0)L!2*!*?#0*#520(!WKHHYHQW7KHJDOOHU\ZLOO ';*#!#@@)5!*#7)!#@!&2*!/$5,5)0%!'04!/;'**2/!?2)/)*!4$5, LQJWKLVWZRQLJKWHYHQW!G#5!7#5)!20@#57'%2#0=!/#0%'/%!8#;;L!'%!4<#;;L'5%,*;;/M(7'2;A/#7A City Commissioner Kyle Becker held a tour of the Apopka City Hall prior to the Wednesday, July 18 City Hall meeting. At least a dozen boy scouts at-tended the tour at 120 E. Main St. 56"+4%&4"+.&7$4*&0()) Z)92>'!6?520(*!6%'%)!O'59=! ;#/'%)4!20!K?#?9'=!2*!&#*%20(!G'72;L!)XQ+LNHVRQWKHUVW6XQGD\RIWKH7#0%&!'%!-J!'A7A!V29)*!>2;;!*%'5%!'%! WKH,QWHUSUHWLYH3DYLOLRQ B&)!@#;;#>20(!%#?2/*!'5)!*$<1)/%! %#!/&'0()C!*%!0'%$5)!&29)!@#5!924*!'04!'@%)5!'!;#0()5!&29)!@#5!'4$;%*!#0! $XJXVWDQGZLOGRZHUVDQGRWKHURUDRQ6HSWHPEHU G#5!7#5)!20@#57'%2#0=!/#0%'/%! %&)!5'0()5!*%'%2#0!'%!RJ.,TTR,IJJYA ![0!?'5%0)5*&2?!>2%&!\5'0()!:#$0%L!O$<;2/!6/&##;*!]\:O6^!'04!\5,'0()!8;#**#7!O)42'%52/*=!%&)!G;#524'!N)?'5%7)0%!#@!V)';%&!20!\5'0()!:#$0%L!2*!$5(20(!?'5)0%*!%#!?5)?'5)!%&)25!/&2;45)0!0#>!@#5!%&)!$?/#720(!*/&##;!L)'5!>2%&!%&)25!5)H$25)4!277$02P',%2#0!*&#%*A!B&2*!@5))!277$02P',WLRQHYHQWKDVEHHQSODQQHG20!%&)!/#77$02%L!*#!?'5,HQWVFDQYDFFLQDWHWKHLU/&2;45)0!'04!#<%'20!%&)25!NV!XTJ!@#57!@#5!*/&##;A!G5))!5)H$25)4!277$02,P'%2#0!*&#%*!'04_#5!%&)!/)5,WLHG'+ZLOOEHJLYHQF#04'L=!Q$;L!I`=!%&5#$(&! 6'%$54'L=!Q$;L!IT=!@5#7!T!'A7A!%#!`!?A7A!)'/&!4'L=!'04!#0!6$04'L=!Q$;L!IY=!@5#7!Y!'A7A!%#!I!?A7A=!'%!%&)!\:O6!K/'4)72/!:)0%)5!@#5!ab,FHOOHQFH:/LYLQJV %#0!6%A=!\5;'04#A7KHVHUYLFHLVDYDLO '<;)!@#5!/&2;45)0!'()*!I!7#0%&*!%#!-T!L)'5*!#;4!>&#!'5)!)0%)520(=!'%%)0420(=!#5!%5'0*@)5520(!%#!'!*/&##;!20!G;#524'A!O'5)0%*!'04!*%$4)0%*!7$*%!<520(!%&)!@#;;#>20(Cc!F#*%!5)/)0%!277$02P',%2#0!5)/#54!'04!#52(20';!ELUWKFHUWLFDWHRU6RFLDO6)/$52%L!/'54Ar9DOLGSKRWRLGHQWLFDWLRQVXFKDVGULYHUVOLFHQVH *%'%)![N=!?'**?#5%=!#5!72;2,%'5L![NAc!:;2)0%*!-.!L)'5*!#@!'()!'04!L#$0()5!7$*%!<)!'/,/#7?'02)4!20(!'4$;%*C!?'5)0%=!(5'04?'5)0%=!*%)?,?'5)0%=!$0/;)=!'$0%=!*2*%)5=!#5!<5#%&,)5Ac!d#0,5);'%)4!'4$;%*!'/,/#7?'0L20(!/;2)0%*!-.!L)'5*!#@!'()!'04!L#$0()5!7$*%!?5)*)0%!'0!#52(20';!0#,%'52P)4!;)%%)5!*2(0)4!#59A!"#$%&'()*6HUYLFHVDUHSUR YLGHGRQDUVWFRPHUVWVHUYHGEDVLV3DU HQWVDUHXUJHGWRDUULYHHDUO\7KRVHZLWKSULYDWH20*$5'0/)!'04!F)42/'24!/'0!(#!425)/%;L!%#!%&)25!PHGLFDOFDUHSURYLGHUDQGREWDLQWKHVDPHVHUYLFHV$FHUWLHG'+277$02P'%2#0!@#57!2*!5),H$25)4!@#5!*/&##;!'04!4'L,FDUHHQWU\DQGLVSURYLGHGDWQRFKDUJHZKHQYDFFLQD WLRQVDUHUHFHLYHG![@!'!/;2)0%!#0;L!0))4*!'!NV!XTJ!@#57=!'0!'47202*,WUDWLYHIHHZLOODSSO\!G#5!7#5)!20@#57'%2#0=!FDOORUYLVLWKWWSRUDQJHRULGDKHDOWKJRY

PAGE 18

!"#$%&'&()$*"+#,-$$./01$23-$2345-$6)7#$58 9/:;<=+:#$>'?)1$>'$ !"#$%&'&()$*"+#,$@A@?+>+'B The Apopka Chief !"#$%&$#'&()%*"+,*%-(.'%'"#$+( %<<#;;$1'/=$?+7+>)0$#?+>+'B;$ +B$>"=##$#);1$;>#&; C>D;$>")>$;+E&0#F G+;+>$HHHI>"#)&'&()<"+#,I<'E 2$A$J'7$+B$H+>"$1'/=$/;#=B)E#$ $$$$$K$&);;H'=? L$A$*0+<($>"#$MG+#H$N+7+>)0$ $@?+>+'B;O$ !"##$% 4$A$*0+<($MG+#H$N+7+>)0$ $@?+>+'B;$A$J'7$CBO$ &#'#()' '#$*'+),#'$,'#()'($-)*&.) Tell Your Story Be a part of our Business Profile program. Your business will benefit from advertising withCall 407-886-2777 and speak with one of our representatives today! The Apopka Chief /()'0+&%#)1 www.theapopkachief.com400 N. Park Ave., Apopka 32712!"#$%&'"$%"(#"'$)*$ +,),-& !"#$%&'#(!)#*+ WUDO)ORULGD9HWVSUHPLHUSHWUHVRUWSURYLG,*-!./-!$*.!0$%!1/$'.+LQJLQDGGLWLRQWRWKHLUIXOOYHWHULQDU\KRVSLWDOIDFLOLW\:KLOHWKLVORFDWLRQLVDIXOOVHUYLFHYHWHULQDU\KRVSLWDOLWKDVWKHDGGHGDGYDQWDJHVRIDKXJHGRJJ\SRRODQGSULYDWHGRJSDUN 0DQ\\HDUVRIPH WLFXORXVSODQQLQJDQG0/*(%'&0%,/*!2#*%!,*%/!WKHLUERDUGLQJIDFLOLW\6WDWHRIWKHDUWNHQQHOLQJLQFRUSRUDWLQJUDLVHGRRULQJDQGZLWKHDFKEHGURRPDUHDKDYLQJLWVRZQSULYDWHSDWLR\RXFDQEHVXUHWKDW\RXUSHWLVYHU\VHFXUHDQGFRPIRUWDEOHZKLOHWKHUHFUHDWLRQDODUHDVDQGDFWLYLWLHVZLOOFKDOOHQJHWKHLUPLQGDQGERG\DQGEDQLVKDQ\VHSDUDWLRQEOXHV ,WGRHVQWPDWWHU KRZEHDXWLIXOWKHLQVLGHLVGRJV$/:$<6SUHIHUWKHRXWVLGHZKLFKLVKHDOWKLHUIRUPLQGDQGERG\$QGE\RXWVLGHWKH\PHDQQRWDSDUNLQJORWRUVLGHORWEXW./0$&1'".$)*$2"&3#/*34$,&'-4&(56 !3%!/""#'(!(&+ SHUODWLYHGDLO\ZHHNO\$*.!4/*-+%#'5!1/$'.+LQJIRU\RXUSHW3OXVWKHUHVSULYDWHSDUNPHPEHUVKLSVDYDLODEOH 7KLVUHVRUWSURYLGHV VSDFLRXVURRPVZLWKSULYDWHRXWGRRUSDWLRV,W$4(/!"#$%&'#(!$*!,*0'#.+LEOHIW[IWERQHVKDSHGVZLPPLQJSRROVSHFLDOO\GHVLJQHGZLWKGRJVDIHW\LQPLQG7KLVSRROQHHGVWREHVHHQWREHEHOLHYHG'RJVKDYHVRPXFKIXQDWWKLVUHVRUWZKLFKFDWHUV%/!$44!1'##.(!$*.!$-#(!RIGRJV 7KLVVWDWHRIWKH DUWNHQQHODVVXUHV\RXUIXUU\IDPLO\IULHQGZLOOEHIHGRQO\WKHEHVWLQGRJJ\IDUHDQGHQVXUHVWKDWDOOJXHVWVIHHOVHWWOHGLQDQGKDSS\WREHRQYDFDWLRQ7KHVWDIILVFDUHIXOO\FKRVHQIRUWKHLUORYHRIDQLPDOVDQGSURIHVVLRQDOFDUHJLYLQJDQG !"#$%&'"$ %"(#"'$)*$+,),-&$ $4+ ZD\VZHOFRPHV\RXWRWDNHDWRXU 7KHVWDIINQRZV SHRSOHUHJDUGWKHLUIRXU4#--#.!"',#*.(!$(!5#5+EHUVRIWKHIDPLO\6RKRZGR\RXPDNHVXUHWKH\KDYHDJRRGWLPHZKLOH \RXUH RQYDFD WLRQ"6LPSOH/HW\RXUSHWVWD\DWRQHRI&HQWUDO)ORULGDVSUHPLHUSHWUHVRUWVDW !"#$%&'"$ %"(#"'$)*$+,),-& !$*.! \RXOOUHFHLYHDOX[XU\IDFLOLW\ZLWKEXGJHWSODQQLQJSULFLQJ !"#$#%&'#(')*"+' "*,(-%,./*0'1,"*'2-'$-3!,"*'24*(*'2-'-24*"'5,$#/#62#*(7 89:';<='>?@AB'C=<@6 DEF='=FBG'JM'G0'?>'FII?B?J>'BJ'=<@DEF='6DB<'>FBD=<'LFEUG'C8V9HK'GL?RR?>@'MJ='BLJ'N'PQ'R?>G0'C8TH0 )$%(!$'#!*/%!"/'-/%+ WHQZLWKDTXLHWVHSDUDWHHQYLURQPHQWZLWKRXWVLGHYLHZVVSDFLRXVDFFRPPRGDWLRQDQGWKHUHVSOHQW\RISOD\WLPH !"#$%&'"$%"(#"'$)*$ +,),-& DOVRSURYLGHV GDLO\GD\FDUHIRU\RXUSHWV7KHLUYHU\UHDVRQDEOHUDWHVHQVXUHWKDW\RXZLOOZDQWWRWDNHDGYDQWDJHRIWKLVVDQFWXDU\ %HVXUHWRYLVLW ZZZFHQWUDORULGDYHWV 0/5 ZKLFKKLJKOLJKWV !"#$%&'"$%"(#"'$)*$+,),-& 7/8"'$9&-.$ +(/:&4$;).,/#&4 DQG <&.#$=&-"$+(/:&4$%4/(>/1 XQGHURQHPDQWOH 9LVLWWKHLUFRXSRQSDJHDQGFKHFNRXWWKHVSHFLDOERDUGLQJFRXSRQV,QDGGLWLRQFOLFNWKURXJKWR)DFHERRN7KHUHDUHUHZDUGVDQGVSHFLDORIIHUVDYDLODEOHLQFOXGLQJDJUHDWOR\DOW\SURJUDP$QGZDWFKWKHYLGHRVRQWKH3HW5HVRUWSDJHBB?>BCD? IRUWRXUVRUIRUIXUWKHULQIRUPDWLRQ9LVLWZZZFHQWUDOIORULGDYHWVFRP IRUH[SUHVVERDUGLQJVHUYLFHIRUPV7KH\DUHRSHQVL[GD\VDZHHN +58"'#/.":"(# 7KH3HW&DUH&HQWHURI$SRSNDUVWRSHQHGLWVGRRUVLQDGGLQJDWKLUGKRVSLWDOWRWKH&HQWUDO)ORULGD9HWVFRPPXQLW\'U.HQW*UHHU DQGKLV ZLIH$QQLHIRXQGHGWKLVORFDWLRQZKLFKLVWKHLUSUHPLHU SHWUHVRUWIRUERDUGLQJ LQDGGLWLRQWRFRP SOHWHKRVSLWDOIDFLOLWLHV 7RXU3HW&DUH&HQWHUVEHDXWLIXOUHVRUWWKDW IHDWXUHVDGRJJ\VZLPPLQJSRRODQGSDUNODQGV Southern Safety Services, Inc. !!!"###$%"&'( 235 East 5th Street Apopka, FL 32703407-814-1895 !""#$%"&'$()*++$ *,$ !!!"###$%"&'( !"#$%&%'()%*+,#"-"+.%/"0#12%"30#,45#1, )'&*%%+,'!-./,*-/,'0.1*2./,34#5-.##,,-")).+$-/$0123*)) !"!#$%%&'(''')%*+$, )'*+,-./0,12&0#.31+2%+4%0 60'07*8#,9:'5&.,$'1,:*-/;4-,#*$.2+ 5.,0&0210.+.678.92#&':;*.'$$. '$.,0<:%+,.=,2&2;<> : P V S D P N N V O J U Z C B O L X J U I V O M J N J U F E S F B D I -0$"-#"/, -0$"-%&$*4*0/4 8FIBWFBMMPGUIFCVTJOFTTTFSWJDFT ZPVFYQFDUGSPNZPVSCBOL‰POMJOF BDDFTTrMPBOTrMJOFTPGDSFEJU‰XJUI POFJNQPSUBOUEJFSFODF 8JUIVTrJUTQFSTPOBM XXXGOCNEDPN]n !"#$%&'"%"(#"' )*$+!)!,+ While TheirPeople Are A wa y, The Dogs Will Play! Rest assured, your pet is in good hands with us! We offer supervised and fun cagefree day care and overnight stays to keep your pet active, entertained and happy. Day CareOvernight Boarding !"#$%&'(#)'$&)*$&)+$,'"#-$%#-.,)$-#.%,).(/0#$1,-$%&+2#)'$"&.$&$-(3"'$',$-#14.#$',$%&+5$6&)6#0$%&+2#)'$,-$/#$-#(2/4-.#*$1,-$%&+2#)'$1,-$&)+$,'"#-$.#-7(6#5$#8&2()&'(,)$,-$'-#&'92#)'$:"(6"$(.$%#-1,-2#*$&.$&$-#.40'$,1$&)*$:('"()$;<$",4-.$,1$-#.%,)*()3$',$'"#$&*7#-'(.#92#)'$1,-$'"#$1-##5$*(.6,4)'#*$1##$,-$-#*46#*$1##$.#-7(6#5$#8&2()&'(,)$,-$'-#&'2#)'=$>(2('$?$,11#-$%#-$%#-.,)5$%#-$%#'5$%#-$7(.('=$@,'$7&0(*$:('"$,'"#-$,11#-.=5LYHU2DNV$QLPDO+RVSLWDO‡(DVW/DNH$QLPDO&OLQLF6RUUHQWR5RFN6SULQJV5G $SRSND)/ ?@A>BB?>BCD? Your First Night's Stay Save $5 OffOffer good for new customers through 4/30/18. Mention this offer when booking. Exp. 8/31/18 1 Freeday of dayboard %E"1-$)3#$)3'$ !4&F$G/:"$H/5").$&#ZZZFHQWUDORULGDYHWVFRP BUSINESS PROFILE !"##$%&"'$()*$+,-$.%$./$The Apopka Chief !"!#$%&&'(!#%)!*+,-!+%&!.//0!&(+/12$/1!3,)!*%42)1%56!"272&4!86!,0!4+/!(%9:2&!,3!4+/!#+2)(+!,3!4+/!;,$5!*:')'4!,0!4+/!(,)0/)!,3!*'<4+!*4)//4!%01!;'7+$%01!"=/02/!'0!":,:>%?!#%)!,-0/)&6!$,,>/)&!%01!$,=/)&!-'$$!./!%.$/!4,!/<:/)'/0(/!4+/!1'&:$%5!,3!($%&&'(!(%)&!%01!4)2(>&6!(,2:$/1!-'4+!92&'(!:),='1/1!.5!1//@%5!A?B?!C,,19%06!3,,16!()%34&6! %01!%!.,20(/!+,2&/!3,)!>'1&?!*:,0&,)/1!.5!D2$$'0%!#$2.6!4+/!(%)!&+,-!-'$$!./!,:/0!3),9!H!%?9?!4,!I!:?9?!G),F:+'/&!%01!G,:!J!K'(>&!-'$$!./!%-%)1/1!%4!4+/!/01!,3!4+/!&+,-?!"!:,)4',0!,3!4+/!:),F(//1&!3),9!4+/!&+,-L&!:)'M/!1)%-'07!%01!JNOJN!1)%-'07!ZLOOEHQHW$SRSNDV'HE F .'/!G2)0/)!#%0(/)!#%)/!%01! 1$20,V.,'6!"19'&&',0!4,!4+/!#$%&F&'(!#%)!*+,-!'&!3)//?!#%)!)/7'&4)%4',0!'&!,:/0!4,!%$$!9%>/&!%01!9,1/$&?!G,!)/7F'&4/)!%!=/+'($/!3,)!4+/!&+,-6!='&'4!;,$5*:')'4":,:>%?(,9!,)!E%(/.,,>?(,9O;,$5*:')'4":,:>%?!K)/F)/7'&4)%4',0!1,0%4',0!:%'1!.5!E)'1%56!A2$5!PQ6!'&!RIP?!S4!-'$$!./!RIJ!,0!4+/!1%5!,3!&+,-? Classic car lovers will be able to experience classic cars, trucks, music and activities for kids at the Classic Car Show August 4. *"/=<"$',$>"#$P'01$9&+=+>$H+00$"';>$*0);;+<$*)=$9"'H$%/7/;>$Q

PAGE 19

The Apopka Chief July 20, 2018, Page 1C See the story and pic tures at the top of the page about Logan Gil bert, a 2015 Wekiva High School gradu round draft choice of the Seattle Mariners after spending three years on the Stetson University baseball team. This season, Gilbert led the Hatters to a super region al berth against the host North Carolina best-ever season.Sports By John Peery Apopka Chief Staff As a player on the Wekiva High baseball team, Logan Gilalso pitched for the Mustangs. The pitching, however, won out and Gilbert parlayed that talent on the mound into becoming attle Mariners following a stellar career at Stetson University in DeLand. The right-handed Gilbert, a 2015 Wekiva High graduate, was the 14th overall pick in Junes Major League Baseball draft. Draft day For the draft in early June, he was at home with family, friends, and Stetson teammates, and June 4, the day after Stetson had breezed through an NCAA regional that the Hatters had hosted. Gilbert, his family, and team mates were on top of the college baseball world at that point. That was pretty crazy. So much had gone into it and it had been such a long season up to that point, a great season, Gilbert said. e were doing great at that point, our team was (still) in the season, and to have the draft on top of that, it was really special. So much work had gone into it since I was little, so for it to actu ally happen and have my family around during that time and have my teammates around when they called my name, that was really special. Gilbert said he knew Seattle was considering him, but he didnt know for sure they would draft him until two picks prior to the Mariners choosing him. s when I knew it was going to be Seattle, he said. didnt know in the days leading up to it. All I heard was pretty much a range of picks that I was like ly to go in and Seattle was in that range. I didnt actually know anyfore. Strikeout king At 6-foot-6, Gilbert strikes and that was among the reasons that Seattle made the Wekiva graduate their top pick in the draft. My size helps. They really like my extension on the mound. They like my fastball and my offspeed (pitches), and my ability to throw it for strikes. The amount of innings I had was pretty good, being a workhorse on the mound, and my strikeout numbers, Gilbert said. Ah, yes, those strikeout numbers. This past season at Stetson, in leading the Hatters to a spot in the super regionals at the University of North Carolina, Gilbert fanned 163 batters and walked just 25, all in 112.1 innings of work as he compiled an 11-2 record with a 2.72 earned run aver age for the Hatters. But it wasnt always that way for the 21-year-old Gilbert. Until my freshman year (at Stetson), I didnt have the ratio the same or as good. I think it came as I started developing my secondary pitches more. Also, I had the fastball that I could use, Gilbert said. dont really try for strikeouts. s something that just happens. s a product of attacking hitters and being aggressive. Id say I focus on not walking hitters more than trying to strike them out. Thats when my walk numbers started to drop. If Im trying to be aggressive, then itll end up leading to more strikeouts as well. Gilbert has four pitches. His fastball can reach the mid-90s, curveball and slider. The changeup is his newest pitch, he said. In youth baseball and high school, trying to hit a round ball with a round bat when pitch ers were humming it at you convinced Gilbert he needed to be one of those guys who is on the mound and doesnt have to bat. s when I knew I had to start pitching. All that was a little too hard once it began getting advanced, he said. His motivation for hard work on the mound comes from his love of the game. For me, Id say s the competition of it, Gilbert said. love the sport. I cant get enough of it. When Im out there, s just the competition. Im somewhat of a perfectionist, just continually going out there and practicing. I love getting better every day trying to compete with other people, but also trying to compete with myself, just trying to be the best By John Peery Apopka Chief Staff For Steve Schwarze, the years of heading up the Special Olympics program at Apopka High School reached a zenith earlier this month when he spent a week in Seattle, Washington, as a coach for the Florida Special 2018 Special Olympics USA Games. Schwarze, who also serves as the football and baseball teams, said he Florida to Seattle on June 30 and returned on July 7. It was a great experience, especially when you had a couple of the athletes on the trip who have never been on a plane, Schwarze said. was very happy how they took the plane ride out and the plane ride back. Most of the time, they just slept and I just walked up and down the aisle on the plane to make sure they were alright. Behind the host state of Washington, Florida had the second-most delegation at the Special Olympics naAll-season athletic passes, along with signs and advertising, are on sale now by the Apopka High School athletic department. Russell Wambles, Apopka High athletic direc tor, said the school is selling all-season passes for $50 and a Darter booster pass for $70. Both passes include admittance to any home sports contest throughout the school year for all sports, although playoff games are not included in the pass. The Darter booster pass also includes special seating and special parking for Apopka High football games. This year, there are six Apopka High home football games. The passes are good only for the person whose name is on the pass. ou can literally save hundreds of dollars while taking in as many Blue Darter games as you want, Wambles said. Each year there are more than 125 home athletic events at Apopka High School. That would cost one person over $600. This opportunity is a great chance for you to affordably watch all your Blue Darter teams in action and give the student athletes at Apopka High school the support that their efforts deserve. The sign packages range from $500 to $1,300, while the football program advertising rates are from $75 to $500. Those wishing to purchase football program advertisements should have their payment and artwork to the athletic department by Tuesday, August gust 24, against Ocoee High School. For more information or to purchase a pass, sign, or program advertising, contact Wambles at 407-9055506 or by emailing Wambles at Russell.Wambles@ ocps.net. Baseball pays off for Wekiva grad Logan GilbertWhile at Stetson University in DeLand, Logan Gilbert led the Hatters to a superregional berth against the North Carolina Tar Heels. Wekiva High graduate Logan Gilbert was the st-round draft choice of the Seattle Mariners.Apopka High selling athletic passes, ads Logan Gilbert fashioned an 11-2 record for the Stetson Hatters this past season. See G I L BER T Page 6C Schwarze coaches at national event Apopka High Special Olympics coordinator Steve Schwarze (l) poses with a Florida Special Olympics athlete while at a Seattle Mariners baseball game during the time they were in Seattle for the USA Games. See COACH Page 4C

PAGE 20

The Apopka Chief, July 20, 2018, Page 2C 407-889-5222 Get the Good Stuff

PAGE 21

The Apopka Chief, July 20, 2018, Page 3C Apopka Blue Darters football coach Rick Darlington will once again participate in the annual Crying Towel Invitational. Scheduled for Monday, August 13, the event has been renamed the 2018 Dave Powers Crying Towel Invitational following Powers death last November. It will be held at Christners Prime Steak & Lobster, 729 Lee Rd., Orlando, and is open to the public. The event, presented by United Legacy Bank, features presentations by the head coaches of four of Central Floridas most respected high school football programs: Apopka, Bishop Moore, Boone, and Edgewater. The annual event is organized by Roger Franklin Williams, a 1975 Apopka High graduate, through his radio program, Talkin Old School. The radio show program will take place before a live audience of alumni, fans, supporters, and passionate high school footthe Crying Towel event produced by Talki Old School. It will be hosted by Christners and presented by United Legacy Bank. In addition to Apopkas coach Darlington, coaches who will participate include coach Matt Hedrick from Bishop Moore High School, coach Andy Johnson from Boone High School, and defending Crying Towel champion, second-year Edgewater head coach Cameron Duke. The event is open to the public and the coaches will mingle and dine with guests at the event. After dinner, the coaches will present their prospects for their respective teams for the upcoming season; historically, the coaches present a very dim, albe it hilarious, view of their chances for the coming season. After the coaches make their presentations a panel of esteemed judges will adjourn to a private room to deliberate and determine the 2018 Crying Towel champion. While the judges deliberate, the coaches will take questions from the live audience. The tradition is all done in good fun and in a light-hearted way that helps set the stage for the upcoming football season. The event historically has been attended by large numbers of prominent alumni from the four schools as all four schools have a deep football tradition which goes back more than 50 years. The good-natured rivalry and reminiscing among the four coaches and their alumni and fans adds an element of jovial camara derie to the Crying Towel atmo sphere. This years Crying Towel takes on special meaning due to the passing of former United Legacy Bank CEO Dave Powers in November 2017. Powers was a driving force behind the Crying Towel event. In honor of Dave Powers indispensable contribu tions to the success of the Crying Towel and his abiding passion and generous support for high school sports in Metro Orlando, the event has been re-named in his honor. cult to think about preparing for another Crying Towel event at Christners without Dave Powers. Dave Powers is the person who encouraged me to revive the Crying Towel event under the Talkin Old School banner in 2014 and his unbridled passion for high school sports in Metro Orlando, especially his beloved Bishop Moore Hornets, brought a special energy to the metro Orlando high school sports scene. Dave Powers passion and contributions to high school sports are unmatched and indispensable, we hope that this small gesture will remind everyone of the example Dave Powers set in pursuing his passions and his commitment to helping others achieve success; and, especially, his passion for the good natured fun and camaraderie of the Crying Towel event. United Legacy Bank CEO Mike Sleaford said, Everyone at United Legacy Bank is proud to carry on Dave Powers legacy in the Central Florida community and especially Daves love of high school sports. I look for ward to attending this fun event as we support high school sports and Dave. Dave has been a mentor and friend to me over 20 years and he is deeply missed. Williams, creator and host of the Talkin Old School radio program and former Apopka Blue Darter tight end, will help to facilitate the programs question-andanswer period and will interview each of the coaches for a special radio show that will be broadcast on Thursday, August 17, at 7 p.m. on FM 96.9 The Game and AM 740 The Game. The program will also be rebroadcast at 8 p.m. on FM 102.5 WFLA and AM 540 WFLA on Friday, August 18. Williams expressed gratitude for the support of title sponsor United Legacy Bank and host sponsor Christners. want to thank United Legacy Bank and CEO Mike Sleaford for their continued support of the Dave Powers Crying Towel Invitational presented by United Legacy Bank, especially in this special year where we honor former United Legacy Bank CEO Dave Powers. I also want to thank the Christner family for hosting the Crying Towel and Christners Oper ations Manager Jim Flanagan for his support of Talkin Old School and high school athletics in Central Florida. The program will start at 6 p.m. with an informal social hour with coaches, sponsors, alum ni, and other guests, followed by p.m. Immediately following dinner, at approximately 8 p.m., the coaches will make their presenta tions, recorded for the Talkin Old School radio program. The coaches will be available for the open question-and-an swer session with dinner guests. Coaches will also be available for interviews with media who attend the event. If a law enforcement agency charges you with a crime and this paper reports that information, please notify us within 90 days if the charge is later dropped, or if you are found not guilty by the court. After verifying the information, we will be happy to publish it. tion to The Apopka Chief, P.O. Box 880, Apopka, 32704-0880 In the period from July 10-16, the Apopka Police Department received 1,475 calls for assistance, responded to 27 crashes, ismade 19 arrests. Of these arrests, three were juvenile arrests. The juveniles were arrested and charged with battery-touch or strike, lar ceny-purse snatching-more than $300 but less than $5,000 X 2, vehicle theftgrand theft of motor vehicle. The following were ar rested and charged: Willie Junior Ander son, 35, 329 Penrose Ct., Apopka, larceny-retail theft/shoplifting petit theft 1st degree property more than $100 less than $300, robbery by sudden snatchweapon, larceny-petit 1st offense, burglary-occupied conveyance unarmed no parts, larceny-grand theft is more than $300 but less violation-knowingly driving while license suspended. Kaley Shatarra Bostick, 29, transient, Apopka, larceny-retail theft/shop lifting petit theft 1st degree property more than $100 to less than $300, trespassing structure or conveyance. Juan Miguel CruzHoitz, 35, 1200 Sheeler Hills Dr., Apopka, resist oflence. Nicholas Edward Franklin, 39, 7146 Sunnyside Dr., Leesburg, trafdrugs. Richard Hugh Gardner, 57, 5368 Aeolus Way, Orlando, larceny-retail theft/shoplifting petit theft 1st degree property more than $100 but less than $300. Erika Aguiar Herrera, 21, 288 Malean Dr., Apopka, larceny-retail theft/ shoplifting petit theft 1st degree property more than $100 but less than $300, marijuana-possess not more than 20grams. Tammy Lynn Horne, 46, 340 Ohio Circle, Winter Park, larceny-retail theft/ shoplifting petit 1st offense 2nd degree 1st offense. Isabel Cristina Mireaddress, Apopka, batterytouch or strike (domestic). Ramon Ramos, 33, 75 Siesta Key Court, Ocoee, hit and run-leave scene of crash involve damage to property more than $50. Jamian Xavier Rodriguez Rivera, 20, 602 Cor al Glen Loop Apt. 102, Altamonte Springs, larcenyretail theft/shoplifting petit theft 1st degree proper ty more than $100 but less than $300, probation viola tion-or community control response unknown/felony/ misdemeanor/juvenile non criteria. David Anthony Saldress, Apopka, batterytouch or strike. Samantha Spring Stewart, 39, 1016 Lisa Ln., Apopka, burglary-occupied conveyance unarmed not parts, larceny-grand theft is more than $300 but less than $5,000. Douglas Joseph Stoneburner, 36, 200 Lake Geneva Rd., Geneva, Seminole County warrant. Christopher John Thompson 38, 28 N. Bulova Drive Apopka, disturbing peace-breach of peace, larceny-petit 1st offense. Valetine Walcott, 74, 3838 Hogshead Rd., Apopka, battery-touch or strike ($500 bond), simple assault-intent threat to do violence ($100 bond). Chumel Nicole Hope Weimer, 24, 5181 Cinder lane Pkwy., Orlando, lar ceny-retail theft/shoplifting petit theft 1st degree property more than $100 but less than $300. Police Beat Crying Towel event will honor life of long-time sponsor Preserve precious memories for generations to come with clippings of our coverage of school events, sports and news about your childs school! Today! www.TheApopka Chief.com to Create a Keepsake! Create a Keepsake!Get Your E-edition Now! Read page by page. Anytime, anywhere & on any device. Home Delivery for Only $25* a Year!* New or Renewal(Orange County) $30 Out of CountyName_________________________________________________ Address_______________________________City_____________ State___________Zip________Phone Number________________ Amt. Enclosed $_____________Clip this coupon and bring it in or mail it to: The Apopka Chief The Apopka Chief CARDS

PAGE 22

The Apopka Chief, July 20, 2018, Page 4C tional games with more than 200 athletes and coaches. Altogether, there were more than 4,000 athletes and coaches representing all 50 states and the District of Columbia. There were several moments that touched him, Schwarze said, and one of them was early in the week. There are so many things I took away from it, he said. ing through the tunnel at Husky Stadium for the opening ceremo nies and youre walking down from the dorms and youve got all these people cheering you on and you walk down for opening ceremonies and youre sitting in the chair and you say, OK, Ive made it to the national games. That was one of the things that I thought was the coolest of the whole week. Schwarze has been leading the Special Olympics program at Apopka High for 12 years and the time in Seattle has made a differ ence in his life. think working with Special Olympics, especially going to the national level, has changed me big time, Schwarze said. The reason I say that is, when I got to the national level USA Games, I have been around those athletes for a year. We went to training. We went to meetings. When we got to the USA Games, there were three things order, Team Florida was going 1-2 in the 100-meter relay down the stretch. One of the girls for Florida fell down. She got back up and got the bronze. e had all our athletes get a medal for track, and it came down to the second-to-the-last day, the 400-meter male relay, we had one of our athletes not get a medal the whole week (prior). We got gold. One of the other things that will be in my mind is that we lost a bronze medal by a 10th of a second in one of the races. The athlete comes over and he is just spent and starts to cry. That really changed me. One particular incident for a Florida track athlete was very emotional for Schwarze. The most moving thing was when one of my athletes lost a bronze (medal) by a 10th of a second and they just broke down. Thats when I had to walk away a little bit. They work so hard for 15 months. They get the invitation. They work so hard and theyre a 10th of a second away from getting a bronze, he said. While winning a medal might not be the most important thing for these athletes, it is something that even Special Olympians strive for while they are com peting. liked how I was with athletes I had not worked with (prior to training for the national event). I liked it how we all bonded and we worked very smoothlySchwarze said. e got 14 gold medals, one silver, and four bronze. All of Team Florida got 93 medals and 30 ribbons. That was a very good week in Seattle. Schwarze was busy during athletes had competitions every day with the Special Olympians and their coaches having to rise early every day. It was also the coaches responsibility to get the athletes to their events on time and to the medal award ceremony My goals out there were to help at practice; pick up the athletes after an event; help walk the athletes to the track, to the lunches; and check athletes in for awards ceremonies. I was all over the place, Schwarze said. As long as youre within eyesight of these athletes and you pick them up after an event and you walked them, it was good, and we all sat as a team under a team tent. Nine times out of 10 we were altogether anyway. Most of our time up there was walking, training, compethave any days off. We were up in the morning at 5 oclock. Most of our mornings we were getting to the track by 7 because we had a long-distance runner who was running the 10,000 (meter race) or 1,500 (meter race) in the morning. The only time we got a break from doing something was going to the (Seattle) Mariners (baseball) game. In addition to the coaches, many of the athletes parents also traveled to Seattle for the national games, Schwarze said. While records arent kept for the Special Olympics, each athlete gives his or her all. lot of our athletes broke their personal best out there. They dont keep the records of what state won the most medals. Everybody shows up, they get their medals and ribbons, Schwar ze said. Everybody walks away with something. Schwarze said the logistics of the Special Olympics was outstanding. The hospitality at the University of Washington and city of Seattle was awesome, he said Everywhere we went, from the time we got off the plane at SeaTac Airport, there was someone guiding us somewhere. Staying on the college cam pus, for a lot of the athletes who would never see a college campus in their lives, it was one of those things that whoever organized it, did it down to a T. What I liked about the week was there was great communication between Special Olympics Florida, our athletes, and our teams In four years, the Special Olympics USA Games will be held in Central Florida and Schwarze plans to be there. be doing something with that. I dont know if Im going to apply for a coach spot or a volunteer, but Ill be somewhere in the mix helping out. ning of the week was a time for The last night we had a meeting. As coaches and athletes, we went around the room and told how it affected us, he said. In that meeting, I said, Ever since March of 2017 when I was told that I was coming to Seattle for the national games, I was counting the days. I told those athletes, ou are the best athletes Ive been around in 35 years of sports. I told the coaches the same thing because in that whole week, we bonded. After trading pins with others from the various states, Schwarze said he came home with lots of tangible items, including a Special in the press box at J. Barnes Field, It really changed how I feel, not only coaching Special Olympics at Apopka and Orange County, but seeing everybody from across the country just bonded, especially in the opening ceremo nies. That was a party. We had a July 4 family night. It was awesome athletes, parents, families. It was something I will never forget. Continued from page 1C Coach: Many events in Seattle were emotional for the Apopka coachSteve Schwarze serves as coach for Special Olympics Athletes and coaches for the Florida Special Olympics team sit together at the University of Washington arena during the 2018 Special Olympics USA Games held July 1-7 in Seattle. The track and eld events for the Special Olympics, which is what Apopks Steve Schwarze coached, were held at the University of Washingts purple track. The ame for the Special Olympics as it burned dur ing the opening ceremonies. Steve Schwarze is the eld announcer for Apopka Blue Darters football and baseball.

PAGE 23

The Apopka Chief, July 20, 2018, Page 5C Gilbert parlays Stetson career into top draft pick Photos provided by Logan Gilbert Logan Gilbert (r) signs his contract with the Seattle Mariners as Scott Hunter, Mariners director of amateur scouting, sits near him. With Gilbert is his family, (l-r), brother Tyler, and parents Keith and Noel. During his introductory press conference in Seattle, Logan Gilbert holds up a jersey with his name on it as he stands between Scott Hunter, director of amateur scouting, and another front ofce person. Logan Gilbert concentrates as he gets ready to e a pitch for the Stetson Hatters. Logan Gilbert led the Stetson Hatters to the baseball progrs best season ever. After donning a Marinerjersey, Logan Gilbert talks to the media in Seattle dur ing a press conference. Seattle Mariners manager Scott Servais shakes hands with Logan Gilbert while Gilbert was in Seattle in June. As his parents Keith and Noel stand nearby, Logan Gilbert signs a baseball while in Seattle.

PAGE 24

The Apopka Chief, July 20, 2018, Page 6C player I can be. Bound for DeLand ter that. Family support Since draft day league baseball players. Hello Folks, chance to catch a trophy eas. early. Continued from page 1C Gilbert: Mononucleosis has kept top pick at home for a few weeks Rains still comin and they help cool things down a bitSign-up for youth football, cheerleading ongoing through August 1 GENERAL SERVICE: AUTO-BASICS GENERAL SERVICE: AUTO-BASICS Overall, 89% of vehicles were in need of at least one service or repair.MAINTENANCE YOUR PROTECTION!Overall, 89% of vehicles were in need of at least one service or repair.MAINTENANCE YOUR PROTECTION! The Apopka Chief Your Trusted Local News SourceCall or Visitwww.TheApopkaChief.com 400 N. Park Ave., Apopka, FL 32712 | Phone: 407-886-2777 Read page by page anytime, anywhere and on any device. Get Your E-edition today!

PAGE 25

Cooper center hosts basketball tournament The Apopka Chief, July 20, 2018, Page 7C Photos by John Peery Cooper Sportsplex in Apopka is hosting the Summer Hoops Festival Live basketball compe tition from July 18-21. Travel teams from across the United States and internationally participate in the second July NCAA recruiting period. Coo per Sportsplex is located at 110 Athletes Row, Apopka, just off Bradshaw Road. These pictures are from a game between 17U teams E1T1 Unit ed and Team Loaded Virginia. Games are for high-school age travel teams with some of the athletes coming from both Apopka and Wekiva high schools. Contests will be played beginning at 9 a.m. both today, Friday, July 20, and on Sat urday, July 21. Games continue until nearly 10 p.m. on Friday and until 4 p.m. on Saturday. Ad mission for spectators is $15 daily.

PAGE 29

Keep those wheels rolling . Keep those wheels rolling . Keep ose Wheels Rolling The Apopka Chief Your Dealership Alternative Full Service Center$ 20When You Mention This AdAny Service of $100 or MoreOFFCoupon must be present at check-in. Only one coupon per visit. Exp. 07/31/18.Call Us Today!2500 PEMBERTON DR. APOPKA, FL 32703407-298-2853Trusted for Over 37 Years Family Owned and Operatedwww.Russellautomotive.net Like us on Facebook! Certified Technicians FINANCING AVAILABLE CARD S CARD S AUTOMOTIVECOMPLETE AUTO SERVICE Tune-Ups Heat & AC Repair Complete Foreign & Domestic Repairs Engine & Transmission Replacement Clutch Service Brakes Service Alignment & Suspension Repair Computer & Electrical Repair RV Repairs Fleet Service Specialist Tire Sales & Service Shocks & Struts Your Dealership Alternative Full Service Center $ 20When You Mention This AdAny Service of $100 or MoreOFFCoupon must be present at check-in. Only one coupon per visit. Exp. 07/31/18. Call Us Today! 2500 PEMBERTON DR. APOPKA, FL 32703407-298-2853Trusted for Over 37 Years Family Owned and Operated www.Russellautomotive.net Like us on Facebook! Certified Technicians FINANCING AVAILABLE AUTOMOTIVECOMPLETE AUTO SERVICE Tune-Ups Heat & AC Repair Complete Foreign & Domestic Repairs Engine & Transmission Replacement Clutch Service Brakes Service Alignment & Suspension Repair Computer & Electrical Repair RV Repairs Fleet Service Specialist Tire Sales & Service Shocks & Struts 2x5 PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Celebrating 29 Years of Service! Family owned & operated. $ Includes Safety Inspection Up to 5 qts Oil MOST CARS AND LIGHT TRUCKS. No Dealers Please. Exp. 7/31/18 Plus $ 1.50 Disposal Fee CARDS CARDS LUBE, OIL & FILTER PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER: is proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. ALL TRANSMISSION WORLD ALL TRANSMISSION WORLD.COM PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER: is proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Call Now for Appointment Coupon Required Exp. 7/31/18 ALL TRANSMISSION WORLD ALL TRANSMISSION WORLD.COM Call Now for Appointment Coupon Required Exp. 7/31/18 Family Owned & Operated We Offer Complete Professional Auto ServiceMost Cars & Light Trucks. Most Cars & Light Trucks.With Coupon. Exp. 7/31/18. With Coupon. Exp. 7/31/18.TIRE ROTATION PACKAGE$ 39 .95 $ 17 .95 OIL CHANGE SPECIAL Monday thru Friday 8am to 5pm Saturday 8am to 5pm (407)880-5784 FILL UP on Great Service! F E #MVR35541 All Work Guaranteed 407-880-3530 Serving Satis ed Customers Since 1987 St. Reg. #MV05682 CARDS PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. Automotive J & K PROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER:This proof is for your protection. If it meets your approval, please sign and fax back to 407-889-4121. Instructions have been followed as closely as possible. 1128 Rock Springs Road Apopka, FL 32712 1128 Rock Springs Road Apopka, FL 32712 facebook.com/ fortsdieselservice facebook.com/ fortsdieselservice Licensed Harley Davidson Mechanic on duty Licensed Harley Davidson Mechanic on duty WE KEEP YOU REPAIRED and on the road WE KEEP YOU REPAIRED and on the road Specializing In Complete Auto Repairs Specializing In Complete Auto Repairs 407-467-7922 407-467-7922 www.FortsDiesel.com www.FortsDiesel.com Oil, Lube, Filter Brake Service Rotors Sensor Repair Injecter Service Cylinder Heads Camshafts Oil, Lube, Filter Brake Service Rotors Sensor Repair Injecter Service Cylinder Heads Camshafts Rotating Assemblies Performance Tuning Torque Converters Driveline Rotating Assemblies Performance Tuning Torque Converters Driveline Transmission Repair Transmission Tuning Ring / Pinions Lift Kits Transmission Repair Transmission Tuning Ring / Pinions Lift Kits Full Service Auto Repair 1328 E. Semoran Blvd., ApopkaOffice: 407-880-6566 Over 30 years experience. We will meet or beat any written estimate on tires or serviceswww.1stperformance.comNext to New Goodwill Store$ 18.95 AAA members receive discounts! with brand new state of the art alignment equipmentALIGNMENT SPECIALISTS1st Performance Automotive Full Service Auto Repair 1328 E. Semoran Blvd., ApopkaOffice: 407-880-6566 Over 30 years experience. We will meet or beat any written estimate on tires or services www.1stperformance.comNext to New Goodwill Store 1st Performance Automotive Uh-Oh! Should've gone to 1328 E. Semoran Blvd., ApopkaOffice: 407-880-6566 Over 30 years experience. We will meet or beat any written estimate on tires or serviceswww.1stperformance.comNext to New Goodwill Store AAA members receive discounts! Go the Distance Full Service Auto Repair 1st Performance AutomotiveALIGNMENT SPECIALISTSwith brand new state of the art alignment equipmentFull Service Auto Repair 1328 E. Semoran Blvd., ApopkaOffice: 407-880-6566 Over 30 years experience. We will meet or beat any written estimate on tires or serviceswww.1stperformance.comNext to New Goodwill Store1st Performance AutomotiveOthers Can't Keep Up with AAA members receive discounts! Full Service Auto Repair 1328 E. Semoran Blvd., ApopkaOffice: 407-880-6566 www.1stperformance.comNext to New Goodwill Store1st Performance Automotive A/C Includes 1lb. freon, evac, leak test & recharge *Most cars $ 8999* Exp. 5/31/17 Recharge(Leak repair extra) Over 30 years experience. We will meet or beat any written estimate on tires or servicesFull Service Auto Repair 1328 E. Semoran Blvd., ApopkaOffice: 407-880-6566 www.1stperformance.comNext to New Goodwill Store1st Performance Automotive A/C Includes 1lb. freon, evac, leak test & recharge *Most cars $ 8999* Exp. 5/31/17 Recharge(Leak repair extra) Over 30 years experience. We will meet or beat any written estimate on tires or servicesALIGNMENT SPECIALISTSwith brand new state of the art alignment equipmentPROOF APPROVAL Important to Check the Following Name Address Telephone # Copy/Picture/Logos Expiration Date Please Sign BelowDateApproval/Release to Print Subject to corrections as noted below.MESSAGE TO ADVERTISER: This proof is for your protection. If it meets your approval, please sign and fax back to 407889-4121. Instructions have been followed as closely as possible. The Apopka Chief Oil Changeup to 5 quarts Shop supply & disposal fees additional. $ 18.95Oil Changeup to 5 quarts Shop supply & disposal fees additional. AAA approved AAA approved AAA approved up to 5 quartsOil ChangeShop supply & disposal fees additional. $ 18.95 up to 5 quartsOil ChangeShop supply & disposal fees additional. $ 18.95 up to 5 quartsOil ChangeShop supply & disposal fees additional. $ 18.95 up to 5 quartsOil ChangeShop supply & disposal fees additional. $ 18.95 Would You Like Extra Copies? You may purchase The Apopka Chief at the following locations in and around ApopkaOffice Location: 400 N. Park Avenue, Apopka Subscribe Online at www.TheApopkaChief.com Subscribe today for only $25 per year in Orange County delivered with your mail! Add E-Edition for an additional $5. Solutions to the Crossword Puzzle are found on page 5B of this newspaper. 407-886-2777 Call the Professionals in Our Advertising Department for Assistance with a Customized Advertising Campaign.

PAGE 30

The Apopka Chief, July 20, 2018 Page 2D The Apopka Chief NOTICE OF DEFAULT AND INTENT TO FORECLOSE MORTGAGE LIEN EXHIBIT A Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT B Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT C Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT D Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT E Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT F Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT G Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT H Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT I Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT J Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT K Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT L Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: 2000 Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT M Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT N Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT O Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT P Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT Q Obligor(s) and Notice of Address: Number of Interests: 4 Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT R Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT S Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT T Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT U Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT V Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT W Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: 2000 Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT X Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT Y Obligor(s) and Notice of Address: Number of Interests: 8 Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT Z Obligor(s) and Notice of Address: Number of Interests: 8 Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT A1 Obligor(s) and Notice of Address: Number of Interests: Interest Numbers: Number of Points: Use Year Commencement Date: Due Date: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: Publish: The Apopka Chief July 20 and 27, 2018 160860 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA Case No.: 2014-CA001345-O FAIRWINDS CREDIT UNION, Plaintiff, v. KING SOLOMON JERRY; JOSEPH JERRY; CAROLYN ATKINS; PATRICIA A. JERRY; ANTHONY JERRY; CAROLYN ATKINS AS GUARDIAN ADVOCATE OF THE PERSON OF RENAE JERRY; CALVIN JERRY; MICHAEL A. ATKINS, JR.; UNKNOWN SPOUSE OF MICHAEL A. ATKINS, JR.; CATALINA PARK COMMUNITY ASSOCIATION, INC. a tion; ESTATE OF FRANCES JERRY, Deceased, unknown heirs, devises, grantees, assignees, lienors, creditors, trustees, or other parties claiming by, through, under or against Frances Jerry, and all parties having or claiming to have any right, title, or interest in the property herein described; UNKNOWN HEIRS, DEVISEES, GRANTEES, ASSIGNEES OR OTHER PERSONS CLAIMING BY, THROUGH, UNDER OR AGAINST FRANCES JERRY; JOHN DOE; and JANE DOE, Defendants. NOTICE OF SALE NOTICE IS HEREBY GIVEN 20th day of August, 2018 at 11:00 a.m. LOT 1, CATALINA PARK SUBDIVISION, AS PER PLAT THEREOF, AS RECORDED IN PLAT BOOK Y, PAGE 106, OF THE PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA Any person claiming an interest in the surplus from the sale, if any, other than the property owner as of the date of the Lis Pendens (60) days after the sale. July 20 and 27, 2018 160864 IN THE CIRCUIT COURT IN AND FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION CASE NO. 48-2018-CP001914-O IN RE: Estate of JIM OSCAR COOPER a/k/a JIM O. COOPER, deceased NOTICE TO CREDITORS July 20 and 27, 2018 160865 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP001992 -O Division: Probate IN RE: ESTATE OF DORCAS MAE WINFREY, aka DORCAS M. WINFREY Deceased. NOTICE TO CREDITORS July 20 and 27, 2018 160868 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-000124-O Division ____ IN RE: ESTATE OF WILLYLEA E. PHILLIPS, Deceased. NOTICE TO CREDITORS July 20 and 27, 2018 160859 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002172 In Re: ESTATE OF JULIAN L. KLEIN, Deceased. NOTICE TO CREDITORS Julian L. Klein June 13, 2018, Orange Room #350, 425 North Orange Avenue, Orlando, Florida 32801. July 20 and 27, 2018 160858 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA002998-O U.S. BANK NATIONAL ASSOCIATION, AS TRUSTEE, ON BEHALF OF THE HOLDERS OF THE HOME EQUITY ASSET TRUST 2007-2 HOME EQUITY PASS-THROUGH CERTIFICATES, SERIES 2007-2, Plaintiff, vs. ANNA MELINDA BELOTINDOS; UNKNOWN SPOUSE OF ANNA MELINDA BELOTINDOS; UNKNOWN TENANT(S) IN POSSESSION #1 and #2, and ALL OTHER UNKNOWN PARTIES, et.al., Defendant(s). NOTICE OF FORECLOSURE SALE NOTICE IS HEREBY GIVEN LOT 2, BLOCK E, OF PINE RIDGE ESTATES SECTION TWO, ACCORDING TO THE PLAT THERE OF, AS RECORDED IN PLAT BOOK X, PAGE 94, OF THE PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA. July 20 and 27, 2018 160870 NOTICE OF LIEN SALE Life Storage # 610 Thursday, August 9th, 2018 9:30AM Customer Name Inventory Solomon Olowu Patries Hargrett Takierra Corbitt Sigrid Smart Takierra Corbitt Publish: The Apopka Chief July 20 and 27, 2018 160863

PAGE 31

The Apopka Chief, July 20, 2018 Page 3D The Apopka Chief, February 16, 2018, Page 4D The Apopka Chief LEGAL ADVERTISING legal publication on pages 2D-8D NOTICE OF DEFAULT AND INTENT TO FORECLOSE MORTGAGE LIEN HAO EXHIBIT A Obligor(s) and Notice of Address: First Unit Week (s), respectively: First Unit Number(s), respectively: Second Unit Week (s), respectively: Second Unit Number(s), respectively: Note Date: Mortgage Date: "As of" Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: "Beginning Date: Publish: The Apopka Chief July 20 and 27, 2018 160875 NOTICE OF DEFAULT AND INTENT TO FORECLOSE MORTGAGE LIEN CYPRESS HARBOUR EXHIBIT A Obligor(s) and Notice of Address: First Unit Week: First Unit Number: Second Unit Week:Second Unit Number: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT B Obligor(s) and Notice of Address: First Unit Week: First Unit Number: Second Unit Week:Second Unit Number: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: EXHIBIT C Obligor(s) and Notice of Address: First Unit Week: First Unit Number: Second Unit Week: Second Unit Number: Note Date: Mortgage Date: As of Date: Total Amount Secured by Mortgage Lien: Total Amount Secured by Mortgage Lien: Per Diem Interest: Beginning Date: Publish: The Apopka Chief July 20 and 27, 2018 160876 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA2996-O DIVISION NUMBER : 35 IN RE: FORFEITURE OF $3,864.00 IN U.S. CURRENCY NOTICE OF ACTION TO: ERIK A. RODRIGUEZ REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. July 20, 27, August 3 and 10, 2018 160861 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2017-CP-003520-0 IN RE: ESTATE OF RAYMOND O. BECK Deceased. NOTICE TO CREDITORS (Summary Administration) 2017-CP-003520-O, Name Address July 20 and 27, 2018 160908 IN THE CIRCUIT COURT IN AND FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION Case No: 2018-CP002154-O Division: 5 IN RE: ESTATE OF SIXTO ESCOBAR FERNANDEZ, Deceased. NOTICE TO CREDITORS LOUIS M. HILLMANWALLER, ESQ. LOUIS M. HILLMANWALLER, ESQ. ZAMORA, HILLMAN & VILLAVICENCIO July 20 and 27, 2018 160910 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-DR003918-O DIV: 38 IN RE: The Marriage of COURTNEY ALEXANDER COOMBS Petitioner/Husband, and LORI STAMPS-COOMBS, Respondent/Wife. NOTICE OF ACTION DISSOLUTION OF MARRIAGE TO: LORI STAMPS-COOMBS 711 SHERWOOD TERRACE DRIVE, APT #204 ORLANDO, FL 32818 If you fail to do so, a default may be entered against you for the relief demanded in the petition. TIFFANY MOORE RUSSELL July 20, 27, August 3 and 10, 2018 160862 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 48-2018-CP002155-O Division PROBATE IN RE: ESTATE OF JUAN JOSE CORTEZ a/k/a JUAN JOSE CORTES Deceased. NOTICE TO CREDITORS JUAN JOSE CORTEZ a/k/a JUAN JOSE CORTES, JUDY C. DENIS, RHODES LAW, P.A. July 20 and 27, 2018 160904 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001880-O Division Probate IN RE: ESTATE OF MARY RUTH STORY, Deceased. NOTICE TO CREDITORS NAME ADDRESS July 20 and 27, 2018 160896 IN THE CIRCUIT COURT, NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA. CASE N O .: 2017-CA008965-O BANK OF AMERICA, N.A., Plaintiff, vs. TIMOTHY BRUCE SMITH, a/k/a TIMOTHY B. SMITH; DENISE J. SMITH; CYPRESS LAKES COMMUNITY ASSOCIATION, INC.; UNKNOWN TENANT IN POSSESSION #1; and UNKNOWN TENANT IN POSSESSION #2, Defendants. NOTICE OF ACTION Denise J. Smith YOU ARE HEREBY NOTIFIED LOT 70, BLOCK B, OF CYPRESS LAKES PHASE 1, ACCORDING TO THE PLAT THEREOF AS RECORDED IN PLAT BOOK 46 AT PAGE 82 THROUGH 100, INCLUSIVE OF THE PUBLIC RECORDS OF ORANGE COUNTY, FLORIDA Property Address: 1814 Hammock Moss Drive, Orlando, FL 32820 July 6, 13, 20 and 27, 2018 160789 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002004-O Division PROBATE IN RE: ESTATE OF ARTHUR J. PATAKY, Deceased. NOTICE TO CREDITORS July 20 and 27, 2018 160889 ABANDONED PROPERTY LIEN SALE To: 2002 International VIN: 1HTSDAAN12H411475, July 20 and 27, 2018 160909 J&B USED AUTO PARTS INC NOTICE OF PUBLIC SALE P 1995 CHEVY 2001 HOND July 20, 2018 160866 IN THE COUNTY COURT IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2011 CC 009943 O WALDEN PALMS CONDOMINIUM ASSOCIATION, INC., Plaintiff, vs. VELVETH MEJIA, ET AL., Defendants. NOTICE OF FORECLOSURE SALE* Unit 15, in Building 6, of WALDEN PALMS CONDOMINIUM, according to the Declaration of Condominium thereof, Records Book 8444, at Page 2553, of the Public Records of Orange County, Florida. July 20 and 27, 2018 160905 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NO. 48-2018-CA007355 DIVISION IN RE: FORFEITURE OF $9,600.08 U.S. CURRENCY NOTICE OF FORFEITURE July 20 and 27, 2018 160911 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA4614-O DIVISION NUMBER : 34 IN RE: FORFEITURE OF $2,643.00 IN U.S. CURRENCY NOTICE OF ACTION TO: DOMINIC BOLDEN REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. July 13, 20, 27 and August 3, 2018 160826 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA3605-O DIVISION NUMBER : 33 IN RE: FORFEITURE OF $2,267.00 IN U.S. CURRENCY NOTICE OF ACTION TO: RENARDO C. JURINEACK REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. July 13, 20, 27 and August 3, 2018 160827 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002170-O Division ____ IN RE: ESTATE OF TANIA P. CREEK Deceased. NOTICE TO CREDITORS TANIA P. CREEK, KRAESLY M. CREEK STEPHANIE VOLLRATH July 20 and 27, 2018 160892

PAGE 32

The Apopka Chief, July 20, 2018 Page 4D IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA006356-O DIV NO.: 35 MARRIOTT OWNERSHIP RESORTS, INC. Plaintiff, vs. LUZ STELLA SERPE, et al., Defendants. NOTICE OF ACTION BY PUBLICATION AS TO COUNT V TO THE FOLLOWING DEFENDANT WHOSE RESIDENCE IS UNKNOWN: TO: KAREN C. GORMAN, DECEASED, THE ESTATE OF KAREN C. GORMAN, DECEASED AND ANY UNKNOWN SPOUSES, HEIRS, DEVISEES, GRANTEES, ASSIGNEES, LIENORS, CREDITORS, TRUSTEES OR OTHER CLAIMANTS BY AND THROUGH, UNDER OR AGAINST, SAID DEFENDANT 2633 HOMECOMING LEANDER, TX 78641 The above named Defendant is believed to be dead and, if dead, the unknown spouses, heirs, devisees, grantees, assignees, lienors, creditors, trustees, or other claimants, by, through under or against said Defendant and all parties having or claiming to have any right, title or interest in the property described below. YOU ARE HEREBY NOTIFIED of the institution of the above-styled foreclosure proceedings by the Plaintiff, MARRIOTT OWNERSHIP RESORTS, INC., upon the to foreclose for other relief relative to the following described property: COUNT V 4 Interests numbered for administrative purposes: G44228 & G44229 & G44230 & G44231) in the MVC Trust "Trust") evidenced for administrative, assessment and ownership purposes by 1000 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 1082-0300-00, a.k.a MVC Trust, Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida as such agreement may be amended and supplemented from time to time "Trust Agreement", a memorandum of which is recorded in Official Records Book 10015, page 4176, Public Records of Orange County, Florida "Trust Memorandum". The Interests shall have a Use Year Commencement Date of January 1, 2016 (subject to Section 3.5 of the Trust Agreement). AND you are required to serve a copy of your written defenses, if any to the Amended Complaint, upon ROBERT W. DAVIS, JR., ESQUIRE, Holland & Knight LLP, 200 S. Orange Avenue, Suite 2600, Florida 32802, attorneys for the Plaintiff, on or before thirty of publication herein the original with the Clerk of the above-styled Court either before service on Plaintiff's attorney or immediately thereafter, otherwise a default will be entered against you for the relief demanded in the Amended Complaint. Tiffany Moore Russell Clerk of the Court BY: Lisa R Trelstad, Deputy Clerk CIRCUIT COURT SEAL Civil Division If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact Court Administration at 425 North Orange Avenue, Suite 2130, Orlando, Florida 32801, telephone (407) 8362303 within two (2) working days of your receipt of this document. If hearing or voice impaired, call 1-800955-8771. THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Publish: The Apopka Chief July 13 and 20, 2018 160841 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA006356-O DIV NO.: 35 MARRIOTT OWNERSHIP RESORTS, INC. Plaintiff, vs. LUZ STELLA SERPE, et al., Defendants. NOTICE OF ACTION BY PUBLICATION AS TO COUNT VI TO THE FOLLOWING DEFENDANT WHOSE RESIDENCE IS UNKNOWN: TO: WILLIAM LEE SCHNEIDERMAN, INDIVIDUALLY, AS GUARANTOR, AND AS CO-TRUSTEE OF THE SCHNEIDERMAN FAMILY REVOCABLE TRUST DATED AUGUST 2, 1999, AS AMENDED AND RESTATED IN ITS ENTIRETY BY THE FIRST AMENDMENT TO AND RESTATEMENT OF TRUST ON DECEMBER 20, 2007, AND THE ESTATE OF WILLIAM LEE SCHNEIDERMAN, DECEASED AND ANY UNKNOWN SPOUSES, HEIRS, DEVISEES, GRANTEES, ASSIGNEES, LIENORS, CREDITORS, TRUSTEES OR OTHER CLAIMANTS BY AND THROUGH, UNDER OR AGAINST, SAID DEFENDANT 754 THE ALAMEDA, APT. 2101 SAN JOSE, CA 95126 The above named Defendant is believed to be dead and, if dead, the unknown spouses, heirs, devisees, grantees, assignees, lienors, creditors, trustees, or other claimants, by, through under or against said Defendant and all parties having or claiming to have any right, title or interest in the property described below. YOU ARE HEREBY NOTIFIED of the institution of the above-styled foreclosure proceedings by the Plaintiff, MARRIOTT OWNERSHIP RESORTS, INC., upon the to foreclose for other relief relative to the following described property: COUNT VI 8 Interests numbered for administrative purposes: M35950 & M35951 & M35952 & M36001 & M36002 & M36003 & M36004 & M36005 in the MVC Trust "Trust") evidenced for administrative, assessment and ownership purposes by 2000 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 1082-0300-00, a.k.a MVC Trust, Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida as such agreement may be amended and supplemented from time to time "Trust Agreement", a memorandum of which is recorded in Official Records Book 10015, page 4176, Public Records of Orange County, Florida "Trust Memorandum". The Interests shall have a Use Year Commencement Date of January 1, 2017 (subject to Section 3.5 of the Trust Agreement). AND you are required to serve a copy of your written defenses, if any to the Amended Complaint, upon ROBERT W. DAVIS, JR., ESQUIRE, Holland & Knight LLP, 200 S. Orange Avenue, Suite 2600, Florida 32802, attorneys for the Plaintiff, on or before thirty of publication herein the original with the Clerk of the above-styled Court either before service on Plaintiff's attorney or immediately thereafter, otherwise a default will be entered against you for the relief demanded in the Amended Complaint. Tiffany Moore Russell Clerk of the Court BY: Lisa R Trelstad, Deputy Clerk CIRCUIT COURT SEAL Civil Division If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact Court Administration at 425 North Orange Avenue, Suite 2130, Orlando, Florida 32801, telephone (407) 8362303 within two (2) working days of your receipt of this document. If hearing or voice impaired, call 1-800955-8771. THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Publish: The Apopka Chief July 13 and 20, 2018 160842 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA006356-O DIV NO.: 35 MARRIOTT OWNERSHIP RESORTS, INC. Plaintiff, vs. LUZ STELLA SERPE, et al., Defendants. NOTICE OF ACTION BY PUBLICATION AS TO COUNTS VII & VIII & IX TO THE FOLLOWING DEFENDANT WHOSE RESIDENCE IS UNKNOWN: TO: GINA YOUNG HUMPHRIES AKA GINA Y. HUMPHRIES, DECEASED, AND THE ESTATE OF GINA YOUNG HUMPHRIES, DECEASED, AND ANY UNKNOWN SPOUSES, HEIRS, DEVISEES, GRANTEES, ASSIGNEES, LIENORS, CREDITORS, TRUSTEES OR OTHER CLAIMANTS, BY AND THROUGH, UNDER OR AGAINST, SAID DEFENDANT The above named Defendant is believed to be dead and, if dead, the unknown spouses, heirs, devisees, grantees, assignees, lienors, creditors, trustees, or other claimants, by, through under or against said Defendant and all parties having or claiming to have any right, title or interest in the property described below. YOU ARE HEREBY NOTIFIED of the institution of the above-styled foreclosure proceedings by the Plaintiff, MARRIOTT OWNERSHIP RESORTS, INC. ing of a Amended Complaint to foreclose for other relief relative to the following described property: COUNT VII 8 Interests (numbered for administrative purposes: 345337 & 345338 & 345339 & 345340 & 345341 & 345342 & 345343 & 345344) in the MVC Trust rust) evidenced for administrative, assessment and ownership purposes by 2000 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 10820300-00, (a.k.a MVC Trust), Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida corporation not-for-profit, as such agreement may be amended and supplemented from time to time rust Agreement), a memorandum of which is recorded in 10015, page 4176, Public Records of Orange County, Florida rust Memorandum). The Interests shall have a Use Year Commencement Date of January 1, 2012 (subject to Section 3.5 of the Trust Agreement). COUNT VIII 8 Interests (numbered for administrative purposes: J48548 & J48549 & J48550 & J48551 & J48552 & J48601 & J48602 & J48603) in the MVC Trust rust) evidenced for administrative, assessment and ownership purposes by 2000 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 10820300-00, (a.k.a MVC Trust), Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida corporation not-for-profit, as such agreement may be amended and supplemented from time to time rust Agreement), a memorandum of which is recorded in 10015, page 4176, Public Records of Orange County, Florida rust Memorandum). The Interests shall have a Use Year Commencement Date of January 1, 2016 (subject to Section 3.5 of the Trust Agreement). COUNT IX 10 Interests (numbered for administrative purposes: E64320 & E64321 & E64322 & E64323 & E64324 & E64325 & E64326 & E64327 & E64328 & E64329 ) in the MVC Trust rust) evidenced for administrative, assessment and ownership purposes by 2500 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 10820300-00, (a.k.a MVC Trust), Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida corporation not-for-profit, as such agreement may be amended and supplemented from time to time rust Agreement), a memorandum of which is recorded in 10015, page 4176, Public Records of Orange County, Florida rust Memorandum). The Interests shall have a Use Year Commencement Date of January 1, 2015 (subject to Section 3.5 of the Trust Agreement). AND you are required to serve a copy of your written defenses, if any to the Amended Complaint, upon ROBERT W. DAVIS, JR., ESQUIRE, Holland & Knight LLP, 200 S. Orange Avenue, Suite 2600, do, Florida 32802, attorneys for the Plaintiff, on or before day of publication herein Clerk of the above-styled Court either before service on ately thereafter, otherwise a default will be entered against you for the relief demanded in the Amended Complaint. DATED Tiffany Moore Russell Clerk of the Court BY: Lisa R Trelstad, Deputy Clerk CIRCUIT COURT SEAL Civil Division If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact the Court Administration at 425 North Orange Avenue, Suite 2130, Orlando, Florida 32801, telephone (407) 836-2303 within two (2) working days of your receipt of this document. If hearing or voice impaired, call 1-800-955-8771. THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Publish: The Apopka Chief July 13 and 20, 2018 160843 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2018-CA004582-O DIV NO.: 33 MARRIOTT OWNERSHIP RESORTS, INC. Plaintiff, vs. SEASON S. MIKESELL, et al., Defendants. NOTICE OF ACTION BY PUBLICATION AS TO COUNT V TO THE FOLLOWING DEFENDANT WHOSE RESIDENCE IS UNKNOWN: TO: THOMAS FREDERICK GEIGER, DECEASED, THE ESTATE OF THOMAS FREDERICK GEIGER, DECEASED AND ANY UNKNOWN SPOUSES, HEIRS, DEVISEES, GRANTEES, ASSIGNEES, LIENORS, CREDITORS, TRUSTEES OR OTHER CLAIMANTS BY AND THROUGH, UNDER OR AGAINST, SAID DEFENDANT, 5591 VER NI ROAD SEBASTOPOL, CA 95472 The above named Defendant is believed to be dead and, if dead, the unknown spouses, heirs, devisees, grantees, assignees, lienors, creditors, trustees, or other claimants, by, through under or against said Defendant and all parties having or claiming to have any right, title or interest in the property described below. YOU ARE HEREBY NOTIFIED of the institution of the above-styled foreclosure proceedings by the Plaintiff, MARRIOTT OWNERSHIP of a complaint to foreclose for other relief relative to the following described property: COUNT V 4 Interests (numbered for administrative purposes: F01934 & F01935 & F01936 & F01937 in the MVC Trust "Trust" evidenced for administrative, assessment and ownership purposes by 1000 Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 1082-0300-00, a.k.a MVC Trust, Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida as such agreement may be amended and supplemented from time to time "Trust Agreement", a memorandum of which is recorded in Official Records Book 10015, page 4176, Public Records of Orange County, Florida "Trust Memorandum". The Interests shall have a Use Year Commencement Date of January 1, 2015 (subject to Section 3.5 of the Trust Agreement). AND you are required to serve a copy of your written defenses, if any to the complaint, upon ROBERT W. DAVIS, JR., ESQUIRE, Holland & Knight LLP, 200 S. Orange Avenue, attorneys for the Plaintiff, on or before thirty (30) days from herein the Clerk of the above-styled Court either before service on Plaintiff's attorney or immediately thereafter, otherwise a default will be entered against you for the relief demanded in the complaint. Tiffany Moore Russell Clerk of the Court BY: Lisa R Trelstad, Deputy Clerk CIRCUIT COURT SEAL Civil Division If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact Court Administration at 425 North Orange Avenue, Suite 2130, Orlando, Florida 32801, telephone (407) 8362303 within two (2) working days of your receipt of this document. If hearing or voice impaired, call 1-800955-8771. THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Publish: The Apopka Chief July 13 and 20, 2018 160844 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA Case No.: 2017 CA 007456 CLARCONA RESORT CONDOMINIUM ASSOCIATION, corporation, Plaintiff, v. DONALD R. CAMP, and UNKNOWN SPOUSE OF DONALD R. CAMP, Defendants. NOTICE OF FORECLOSURE SALE NOTICE IS HEREBY GIVEN that pursuant to the Summary Final Judgment dated June 18, 2018 and entered in Case No. 2017 CA 007456 of the Circuit Court of the Ninth Judicial Circuit in and for Orange County, Florida wherein the Clerk of the Court will sell to the highest and best bidder for cash at www.myorangeclerk. realforeclose.com at 11:00 a.m. on August 20, 2018 the following property set forth in said Summary Final Judgment, to wit: Unit No. 2511, YOGI PARK CAMP-RESORT (APOPKA), a Condominium, according to the Declaration of Condominium recorded at OfPage 2482, and all exhibits and amendments thereof, of the Public Records of Orange County, Florida. Any person or entity claiming an interest in the surplus, if any, resulting from the Foreclosure Sale, other than the property owner as of the date of the L is P a claim on the same with the (60) days after the Foreclosure S ale. Dated: July 11, 2018 SASHA O. GARCIA BOWEN & SCHROTH Attorneys for Plaintiff 600 Jennings Avenue E-mail Address: sgarcia@bowenschroth.com If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact the ADA Coordinator, Human Resources, Orange County Courthouse, 425 N. Orange Avenue, Suite 510, Orlando, FL 32801 (407) 836-2303 at least 7 days before your scheduled court appearance, or immediately tion is the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. Publish: The Apopka Chief July 13 and 20, 2018 160846 IN THE COUNTY COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO.: 2017-CC015435-O LAKE PINELOCH VILLAGE CONDOMINIUM ASSOCIATION, INC., a Florida notPlaintiff, v. PAUL R. LINDER, et al., Defendants. NOTICE OF FORECLOSURE SALE NOTICE IS HEREBY GIVEN pursuant to a Final Judgment of Foreclosure dated June 12, 2018 and entered in CASE NO.: 2017-CC-015435O of the County Court in and for Orange County, Florida, wherein Lake Pineloch Village C ondominium Association Inc. the Plaintiff, Paul R. Linder, the Defendant, the OfOrange County Clerk of Court, will sell to the highest and best bidder for cash at myorangeclerk.realforeclose.com at m the following described property as set forth in said Final Judgment, to-wit: UNIT 1277, Lake Pineloch Village Number Three, a condominium according to the Declaration of Condominium, thereof Records Book 3465 Page 2253 public records of Orange County, Florida. T he P roperty is located at the street address of: 1277 Saint Tropez Circle, #1277, Orlando, FL 32806 Any person claiming an interest in the surplus funds from the foreclosure sale, if any, other than the property owner as of the date of the sale. Florida. BY: Anthony Fouladi,Esq. Attorney for Plaintiff GARFINKEL WHYNOT 300 North Maitland Avenue Publish: The Apopka Chief July 13 and 20, 2018 160853 IN THE CIRCUIT COURT IN AND FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION CASE NO. 48-2018-CP001167-O IN RE: Estate of LAWRENCE DREW FISH, deceased NOTICE TO CREDITORS THE ADMINISTRATION of the estate of LAWRENCE DREW FISH, deceased, Circuit Court for Orange County, Florida, Probate Division, the address of which is name of the personal representative and personal repforth below. ALL INTERESTED PERSONS ARE NOTIFIED THAT: All known or reasonably ascertainable, including contingent creditors of the deceof this notice is served within three (3) months after the date with this Court WITHIN THE LATER OF THREE MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE OR THIRTY DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and persons having claims or demands against WITHIN THREE MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS DEMANDS AND OBJECTIONS NOT SO FILED WILL BE FOREVER BARRED. lication of this Notice is July Personal Representative: JACQUELINE FOUNTAIN FISH 2334 N. Hiawassee Road Attorney for Personal Representative: GEORGE C. KELLEY, ESQ. Email: attorney@gckelleylaw.com Publish: The Apopka Chief July 13 and 20, 2018 160854 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Five Star Painting of the Villages Court, in the County of Orange in the City of Windermere Florthe above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Windermere, Florida, GR Premium Services LLC Publish: The Apopka Chief July 20, 2018 160871 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under J & A Auto Service lonial Drive, in the County of Orange in the City of Winter tends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Winter Garden, FloriJulian Maldonado Publish: The Apopka Chief July 20, 2018 160872 NOTICE OF SALE PURSUANT TO F.S. 713.78 FOR SALE at VICE, vehicle(s) will be sold for cash to the highest bidder: YEAR MAKE VIN NUMBER the amount owed. All Vehicle(s) are sold as is, no warranties and no guarantees of title(s). Vehicle(s) may be seen the day July 20, 2018 160873 NOTICE OF PUBLIC SALE P ublic notice is hereby given that ACE TRANSPORTATIONS SYSTEMS LLC DBA Ace Wrecker will hold public auction at 8:00 ACE TRANSPORTATIONS SYSTEMS LLC DBA Ace Wrecker 5601 South Orange Blossom Trail Orlando, FL 32839 Pursuant to the laws of the state the following vehicles will be sold to the highest bidder. 05 ACURA ID# 2HNYD18975H523934 03 CHEVROLET ID# 2G1WH55K639260190 95 CHEVROLET ID# 1G1JC5241S7178687 03 CHRYSLER ID# 3C4FY58B53T521762 01 HONDA ID# JHMZE13761T000171 98 HONDA ID# 1HGCG5656WA262683 06 HYUNDAI ID# 5NPEU46F66H093308 08 KOVC ID# L5XTCKPL386021401 98 LINCOLN ID# 1LNFM82W1WY649388 02 NISSAN ID# 1N4AL11D02C149695 04 NISSAN ID# 3N1CB51D04L472118 08 PONTIAC ID# 1G2AL18F387268767 18 SCOOTER ID# LLPVGBAC7J1A00069 01 TOYOTA ID# JTDDR32T210079012 07 TOYOTA ID# 4T1CE30P27U761320 Terms of the sale are cash and no checks are accepted. Seller be made. Said auto will sold as-is with no guarantee. July 20, 2018 160874 NOTICE OF PUBLIC SALE Towtruck Co., lowing vehicle(s) will be sold for cash. Some of the vehicle(s) posted may have already been released and not eligible for salvage sale. 2002 FORD 1FMRU15WX2LA35396 Terms of the sale are cash. No checks will be accepted. Seller be made. Vehicle(s) and/or vessel(s) are sold as is, where is, July 20, 2018 160877 NOTICE OF PUBLIC SALE Towtruck Co., lowing vehicle(s) will be sold for cash. Some of the vehicle(s) posted may have already been released and not eligible for salvage sale. 1998 PONTIAC 2G2FS32K6W2219576 2005 CHEVY 2G1WF52EX59254173 Terms of the sale are cash. No checks will be accepted. Seller be made. Vehicle(s) and/or vessel(s) are sold as is, where is, July 20, 2018 160878 NOTICE OF PUBLIC SALE: JL TOWING gives Notice of ForeJL TOWING all bids. July 20, 2018 160888 NOTICE OF PUBLIC SALE TRI-COUNTY TOWING DBA A&A TOWING, gives Notice of Foreclosure of Lien and intent to sell these vehicles on AUGUST TRI COUNTY TOWING, INC DBA A&A TOWING reserves the 1HGES16562L067584 2002 HONDA July 20, 2018 160907 NOTICE OF PUBLIC SALE BARTLETT TOWING gives Notice of Foreclosure of Lien and 1VWAP7A32EC026880 2014 VOLKSWAGEN PASSAT S JS3TE62V9Y4102302 2000 SUZUKI GRAND VITARA JLS/LTD July 20, 2018 160885 NOTICE OF PUBLIC SALE CASSELBERRY TOWING INC. gives Notice of Foreclosure CASSELBERRY TOWING INC. reserves the right to accept or WAU2MAFC4EN021722 2014 AUDI YV1TS92D521260655 2002 VOLVO July 20, 2018 160881 NOTICE OF PUBLIC SALE: JL TOWING gives Notice of ForeJL TOWING all bids. July 20, 2018 160887 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA6991-O DIVISION NUMBER : 37 IN RE: FORFEITURE OF $14,032.00 IN U.S. CURRENCY NOTICE OF FORFEITURE COMPLAINT TO: VERDY DESTINOBLES 210 PENNSYLVANIA AVENUE WINTER GARDEN, FL 34787 and all others who claim U.S. Currency, which was Orange County, Florida. Said property is in the custody of the Sheriff of Orange County. A Complaint for forfeiture has Court. I HEREBY CERTIFY that this Notice is being served pursuant to the notice provisions of Florida Statutes Ann-Marie Delahunty Assistant General Counsel Orange County Legal Services Orlando, FL 32804 AnnMarie.Delahunty Publish: The Apopka Chief July 13 and 20, 2018 160810 The Apopka Chief, February 16, 2018, Page 4D The Apopka Chief LEGAL ADVERTISING legal publication on pages 2D-8D IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION F ile No. 2018-CP001467-O Division 2 IN RE: ESTATE OF NORMA ANGELICA MARRERO A/K/A NORMA ANGELICA MARRERO LOZADA A/K/A NORMA ANGELICA LOZADA MARRERO A/K/A NORMA A. MARRERO A/K/A NORMA A. MARRERO LOZADA Deceased. NOTICE TO CREDITORS The administration of the estate of Norma Angelica Marrero a/k/a Norma Angelica Marrero Lozada a/k/a Norma Angelica Lozada Marrero a/k/a Norma A. Marrero a/k/a Norma A. Marrero Lozada, deceased, whose date of death pending in the Circuit Court for Orange County, Florida, Probate Division, the address of The name and address of the personal representative and attorney are set forth below. All creditors of the decedent and other persons having claims or demands against a copy of this notice is reclaims with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against their claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH ABOVE, ANY CLAIM FILED TWO (2) OR MORE YEARS AFTER THE BARRED. Norma Emily Marrero Personal Representative Katiria Rodriguez Toro Attorney for Personal Representative Ste. D E-Mail: info@krtlaw.com Secondary E-Mail: info@rodrigueztorolaw.com Publish: The Apopka Chief July 13 and 20, 2018 160845 NOTICE OF PUBLIC SALE Superior Towing of Orlando Inc., the vehicle(s) posted may have already been released and not eligible for salvage sale. 1998 Toyota Corolla 1NXBR18E2WZ102322 Terms of the sale are cash. No checks will be accepted. Seller be made. Vehicle(s) and/or vessel(s) are sold as is, where is, July 20, 2018 160882 NOTICE OF PUBLIC SALE BARTLETT TOWING gives Notice of Foreclosure of Lien and 3N1AB6AP4BL626043 2011 NISSAN SENTRA/S/SR/SL 1ZVFT80N075243233 2007 FORD MUSTANG July 20, 2018 160884

PAGE 33

Get Apopka area news delivered straight to your mail box every week. New or Renewal (Orange County) $30 Out of County Name____________________________________ Address___________________________________ City______________State_______Zip__________ Phone No._________________________________ Amt. Enclosed $_________ Clip This Coupon and Mail To: The Apopka Chief The Apopka Chief Yes! Subscribe today and dont miss another issue! CARDS Public Notices 2D-8D The Apopka Chief NOTICE OF SALE The Trustee named below on behalf of MARRIOTT OWNERSHIP RESORTS, INC. gives this Notice of Sale to the following Obligors and Junior Interestholders at their respective Notice Addresses (see Exhibits A through S2 (Exhibits) for list of Obligors, Junior Interestholders and their respective Notice Addresses). A Trustee duly appointed under Florida law will sell the timeshare interest situated in Orange County, Florida and described in the section entitled LEGAL DESCRIPTION OF TIMESHARE INTEREST at a public sale to the highest and best bidder for cash starting at the hour of 11:00 a.m. (Eastern Time) on Thursday, August 16, 2018, at 200 South Orange Avenue, Ste. 2600, Orlando, Florida 32801. LEGAL DESCRIPTION OF TIMESHARE INTEREST: (See Exhibits for number of Interests) Interests (numbered for administrative purposes: (see Exhibits for the Interest Numbers)) in the MVC Trust (Trust) evidenced for administrative, assessment and ownership purposes by (see Exhibits for number of Points) Points (250 Points for each Interest), which Trust was created pursuant to and further described in that certain MVC Trust Agreement dated March 11, 2010, executed by and among First American Trust, FSB, a federal savings bank, solely as trustee of Land Trust No. 1082-0300-00 (a.k.a. MVC Trust), Marriott Ownership Resorts, Inc., a Delaware corporation, and MVC Trust Owners Association, Inc., a Florida corporation not-formay be amended and supplemented from time to time (Trust Agreement), a memorandum of which Records Book 10015, Page 4176, Public Records of Orange County, Florida rust Memorandum). The Interests shall have a Use Year Commencement Date of (see Exhibits for the Use Year Commencement Date) (subject to Section 3.5 of the Trust Agreement). The Mortgage is recorded Orange County, Florida at Book (see Exhibits for Book number), Page (see Exhibits for Page number). The respective Obligor (See Exhibits for the names of the Obligors) (individually, the Obligor) is in default under the terms of the Note dated (see Exhibits for the Note date) and Mortgage dated (see Exhibits for the Mortgage date) by failing to tender payment required therein (the Default). AMOUNTS SECURED BY MORTGAGE LIEN: As of (see Exhibits for date), there is presently due and owing to MARRIOTT OWNERSHIP RESORTS, INC. by the respective Obligor (see Exhibits for total amount secured by Mortgage lien) PLUS the actual costs incurred in connection with the Default, which is comprised of the following amounts: (a) Principal sum of: (see Exhibits for principal sum), PLUS (b) Interest on the principal sum at the rate of (see Exhibits for interest rate) per annum which calculates to a per diem amount of (see Exhibits for the per diem interest amount) from (see Exhibits for date) through and including (see Exhibits for date), in the amount of: (see Exhibits for total amount of interest), PLUS (c) Late fees of: (see Exhibits for amount of late fees: $250.00, PLUS (e) Actual costs incurred in connection with the Default: amount will vary. The Obligor has the right to cure the default by paying via or wire transfer to the Trustee all amounts secured by the lien at any time before the Trustee A junior interestholder has the right to redeem the junior the same manner at any time before the Trustee issues the AMOUNT OF PAYMENT: In addition to (see Exhibits for total amount secured by Mortgage lien) PLUS the actual costs incurred in connection with the Default as stated in the previous section entitled AMOUNTS SECURED BY MORTGAGE LIEN, payment must include interest at the per diem amount of (see Exhibits for the per diem interest amount) per day beginning (see Exhibits for date) through the date that payment is received. The amount of costs incurred in connection with the Default can be obtained by calling 407-244-5198. INFORMATION: ROBERT W. DAVIS, JR., Trustee, Holland & Knight LLP, 200 South Orange Avenue, Ste. 2600, Orlando, Florida 32801, United States of America., OrlandoForeclosure@ hklaw. com. DATED this 3rd day of July, 2018. ROBERT W. DAVIS, JR., Trustee Tina Harmon Witness Tina Harmon Printed Name of Witness Vilma Camacho Witness Vilma Camacho Printed Name of Witness STATE OF FLORIDA COUNTY OF ORANGE The foregoing Notice of Sale was acknowledged before me this 3rd day of July, 2018 by ROBERT W. DAVIS, JR., as Trustee, who is personally known to me, and subscribed by Tina Harmon, a witness who is personally known to me, and by Vilma Camacho, a witness who is personally known to me. (SEAL) TINA MCDONALD Commission # FF 232920 Expires September 19, 2019 Bonded Thru Troy Fain Insurance 800-385-7019 Tina McDonald NOTARY PUBLIC MY COMMISSION EXPIRES EXHIBIT A Obligor(s) and Notice Address: ROBIN A. WATERMAN, 10401 VENICE BLVD #314, LOS ANGELES, CA 90034 and BRIAN K. MCCLAIN, 10401 VENICE BLVD #314, LOS ANGELES, CA 90034 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: C97348 & C97349 & C97350 & C97351 & C97352 & C97401 / Points: 1500 / Use Year Commencement Date: March 1, 2014 / Book Number: 10719/ Page Number: 5471/ Obligor(s): ROBIN A. WATERMAN and BRIAN K. MCCLAIN/ Note Date: February 26, 2014/ Mortgage Date: February 26, 2014/ As of Date: February 8, 2018 / Total Amount Secured by Mortgage Lien: $14,301.84/ Principal Sum: $12,664.94 / Interest Rate: 13.99% / Per Diem Interest: $4.9217/ From Date: May 26, 2017/ o Date: February 8, 2018/ Total Amount of Interest: $ 1,269.78/ Late Fees: $117.12/ Total Amount Secured by Mortgage Lien: $14,301.84/ Per Diem Interest: $4.9217// Beginning Date: February 9, 2018 /(126435.2563)// EXHIBIT B Obligor(s) and Notice Address: LOURDES NOBOA YCAZA, 2333 BRICKELL AVENUE, APT. 1910, MIAMI, FL 33129 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 14/ Interest Numbers: 165729 & 165730 & 165731 & 165732 & 165733 & 165734 & 165735 & 165736 & 165737 & 165738 & 177338 & 177339 & 177340 & 177341 /Points: 3500 / Use Year Commencement Date: January 1, 2012 / Book Number: 10201/ Page Number: 6553/ Obligor(s): LOURDES NOBOA YCAZA/Note Date: March 21, 2011/Mortgage Date: March 21, 2011/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $18,088.88/ Principal Sum: $15,868.96 / Interest Rate: 14.99% / Per Diem Interest: $6.6077/ From Date: June 21, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,751.04/ Late Fees: $218.88/ Total Amount Secured by Mortgage Lien: $18,088.88/ Per Diem Interest: $6.6077// Beginning Date: March 14, 2018 /(126435.2606)// EXHIBIT C Obligor(s) and Notice Address: DAVID K. SHARP, 7548 EASTBOURNE ROAD, CHARLOTTE, NC 28227 and RADEA C. SHARP, 7548 EASTBOURNE ROAD, CHARLOTTE, NC 28227 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: 239812 & 239813 & 240028 & 240029 & 240030 & 240031 & 240032 & 240033 / Points: 2000 / Use Year Commencement Date: January 1, 2012 / Book Number: 10240/ Page Number: 6148/ Obligor(s): DAVID K. SHARP and RADEA C. SHARP/ Note Date: June 7, 2011/ Mortgage Date: June 7, 2011/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $16,283.23/ Principal Sum: $14,285.78 / Interest Rate: 14.49% / Per Diem Interest: $5.7500/ From Date: June 7, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,604.25/ Late Fees: $143.20/ Total Amount Secured by Mortgage Lien: $16,283.23/ Per Diem Interest: $5.7500// Beginning Date: March 14, 2018 /(126435.2607)// EXHIBIT D Obligor(s) and Notice Address: ADRIENNE KAZARIAN, 5421 DIAMANTE DRIVE, SPICEWOOD, TX 78669 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: 680649 & 680650 & 680651 & 680652 & 680701 & 680702 & 972809 & 972810 & 972811 & 972812 /Points: 2500 / Use Year Commencement Date: April 1, 2013 / Book Number: 10546/ Page Number: 1194/ Obligor(s): ADRIENNE KAZARIAN/ Note Date: March 13, 2013/ Mortgage Date: March 13, 2013/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $16,375.29/ Principal Sum: $14,739.07 / Interest Rate: 10.99% / Per Diem Interest: $4.4995/ From Date: June 13, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,228.36/ Late Fees: $157.86/ Total Amount Secured by Mortgage Lien: $16,375.29/ Per Diem Interest: $4.4995// Beginning Date: March 14, 2018 /(126435.2610)// EXHIBIT E Obligor(s) and Notice Address: FRANCISCO ARROYOS III, 11996 PASEO DEL REY DRIVE, EL PASO, TX 79936-3787 and RUTH ARROYOS, 11996 PASEO DEL REY DRIVE, EL PASO, TX 79936-3787 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 14/ Interest Numbers: E09211 & E09212 & E09213 & E09214 & E09215 & E09216 & E13904 & E13905 & E13906 & E13907 & E13908 & E13909 & E13910 & E13911 /Points: 3500 / Use Year Commencement Date: January 1, 2015 / Book Number: 10767/ Page Number: 8151/ Obligor(s): FRANCISCO ARROYOS III and RUTH ARROYOS/ Note Date: May 28, 2014/ Mortgage Date: May 28, 2014/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $27,665.03/ Principal Sum: $25,218.37 / Interest Rate: 10.99% / Per Diem Interest: $7.6986/ From Date: June 28, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,986.26/ Late Fees: $210.40/ Total Amount Secured by Mortgage Lien: $27,665.03/ Per Diem Interest: $7.6986// Beginning Date: March 14, 2018 /(126435.2623)// EXHIBIT F Obligor(s) and Notice Address: MARCI CSONT-BARRIS, P.O. BOX 392, PINE BROOK, NJ 07058-0392 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 4/ Interest Numbers: F58006 & F58007 & F58008 & F58009 / Points: 1000 / Use Year Commencement Date: January 1, 2015 / Book Number: 10857/ Page Number: 6810/ Obligor(s): MARCI CSONT-BARRIS/Note Date: November 25, 2014/ Mortgage Date: November 25, 2014/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $10,974.52/ Principal Sum: $9,660.21 / Interest Rate: 13.99% / Per Diem Interest: $3.7541/ From Date: June 25, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 979.83/ Late Fees: $84.48/ Total Amount Secured by Mortgage Lien: $10,974.52/ Per Diem Interest: $3.7541// Beginning Date: March 14, 2018 /(126435.2626)// EXHIBIT G Obligor(s) and Notice Address: CEDRIC LAVONGUE HAWKINS, 1717 CINNAMON TEAL WAY, UPPER MARLBORO, MD 20774 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: I57028 & I57029 & I57030 & I57031 & I57032 & I57033 / Points: 1500 / Use Year Commencement Date: July 2, 2015 / Book Number: 10940/ Page Number: 2672/ Obligor(s): CEDRIC LAVONGUE HAWKINS/ Note Date: June 2, 2015/ Mortgage Date: June 2, 2015/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $18,385.14/ Principal Sum: $16,329.46 / Interest Rate: 14.49% / Per Diem Interest: $6.5726/ From Date: July 2, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,669.44/ Late Fees: $136.24/ Total Amount Secured by Mortgage Lien: $18,385.14/ Per Diem Interest: $6.5726// Beginning Date: March 14, 2018 /(126435.2636)// EXHIBIT H Obligor(s) and Notice Address: RHONDA DE JESUS, 91-1037 KAIPALAOA STREET #1201, EWA BEACH, HI 96706 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: J23620 & J23621 & J23622 & J23623 & J23624 & J23625 / Points: 1500 / Use Year Commencement Date: October 1, 2015 / Book Number: 10990/ Page Number: 0583/ Obligor(s): RHONDA DE JESUS/ Note Date: September 10, 2015/ Mortgage Date: September 10, 2015/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $16,267.25/ Principal Sum: $13,950.12 / Interest Rate: 15.99% / Per Diem Interest: $6.1962/ From Date: May 10, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,902.23/ Late Fees: $164.90/ Total Amount Secured by Mortgage Lien: $16,267.25/ Per Diem Interest: $6.1962// Beginning Date: March 14, 2018 /(126435.2638)// EXHIBIT I Obligor(s) and Notice Address: CHAD T. STEVERSON, 191 COUNTY ROAD 740, ENTERPRISE, AL 36330 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: K14711 & K14712 & K14713 &K14714 & K14715 & K14716 & K14717 & K14718 / Points: 2000 / Use Year Commencement Date: October 1, 2015 / Book Number: 11009/ Page Number: 9309/ Obligor(s): CHAD T. STEVERSON /Note Date: September 29, 2015/ Mortgage Date: September 29, 2015/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $20,846.53/ Principal Sum: $18,688.38 / Interest Rate: 13.49% / Per Diem Interest: $7.0030/ From Date: July 1, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,785.75/ Late Fees: $122.40/ Total Amount Secured by Mortgage Lien: $20,846.53/ Per Diem Interest: $7.0030// Beginning Date: March 14, 2018 /(126435.2642)// EXHIBIT J Obligor(s) and Notice Address: JOHN WALSH, 70 HELEN MARIE PLACE, HAUPPAUGE, NY 11788 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: L58204 & L58205 & L58206 & L58207 & L58208 & L58209 & L58210 & L58211 & L58212 & L58213 / Points: 2500 / Use Year Commencement Date: May 1, 2016/ Document Number: #20160212648 / Obligor(s): JOHN WALSH/Note Date: April 13, 2016/ Mortgage Date: April 13, 2016/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $27,945.38/ Principal Sum: $25,037.84 / Interest Rate: 12.99% / Per Diem Interest: $9.0345/ From Date: June 13, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 2,466.41/ Late Fees: $191.13/ Total Amount Secured by Mortgage Lien: $27,945.38/ Per Diem Interest: $9.0345// Beginning Date: March 14, 2018 /(126435.2646)// EXHIBIT K Obligor(s) and Notice Address: BRUCE A. DIXON, 1278 WILLOW FORGE COURT, LEBANON, OH 45036-8546 and STACY M. DIXON, 1278 WILLOW FORGE COURT, LEBANON, OH 45036-8546 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: N01824 & N01825 & N01826 & N01827 & N01828 & N01829 & N01830 & N01831 / Points: 2000 / Use Year Commencement Date: January 1, 2017 / Document Number: #20160545602/ Obligor(s): BRUCE A. DIXON and STACY M. DIXON/Note Date: September 30, 2016/ Mortgage Date: September 30, 2016/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $22,194.11/ Principal Sum: $20,035.37 / Interest Rate: 13.99% / Per Diem Interest: $7.7860/ From Date: July 1, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,985.40/ Late Fees: $130.08/ Unapplied funds in the amount of: -$206.74 / Total Amount Secured by Mortgage Lien: $22,194.11/ Per Diem Interest: $7.7860// Beginning Date: March 14, 2018 /(126435.2649)// EXHIBIT L Obligor(s) and Notice Address: SHANE R. INMAN, 114 MORNINGSIDE ROAD, COLONIA, NJ 07067 and HEATHER N. INMAN, 114 MORNINGSIDE ROAD, COLONIA, NJ 07067 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: N21708 & N21709 & N21710 & N21711 & N21712 & N21713 & N21714 & N21715 / Points: 2000 / Use Year Commencement Date: September 1, 2016 / Document Number: #20160471172/ Obligor(s): SHANE R. INMAN and HEATHER N. INMAN/Note Date: August 25, 2016/ Mortgage Date: August 25, 2016/ As of Date: March 13, 2018 / Total Amount Secured by Mortgage Lien: $22,476.47/ Principal Sum: $20,202.19 / Interest Rate: 12.99% / Per Diem Interest: $7.2896/ From Date: June 25, 2017/ o Date: March 13, 2018/ Total Amount of Interest: $ 1,902.60/ Late Fees: $151.36 / Unapplied funds in the amount of: -$29.68 / Total Amount Secured by Mortgage Lien: $22,476.47/ Per Diem Interest: $7.2896// Beginning Date: March 14, 2018 /(126435.2653)// EXHIBIT M Obligor(s) and Notice Address: JUAN WILFREDO NUNEZ MARIN, MALECON CISNEROS 1356 DPTO 801 MIRAFLORES, LIMA, OF L18, PERU and ANDREA RUBIO BARCENAS, MALECON CISNEROS 1356 DPTO 801 MIRAFLORES, LIMA, OF L18, PERU/ Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: 364948 & 364949 & 364950 & 364951 & 364952 & 365001 & 365002 & 365003 / Points: 2000 / Use Year Commencement Date: January 1, 2012 / Book Number: 10271/ Page Number: 0821/ Obligor(s): JUAN WILFREDO NUNEZ MARIN and ANDREA RUBIO BARCENAS/ Note Date: September 2, 2011/ Mortgage Date: September 2, 2011/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $10,343.58/ Principal Sum: $9,120.01 / Interest Rate: 13.99% / Per Diem Interest: $3.5441/ From Date: August 2, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 871.86/ Late Fees: $101.71/ Total Amount Secured by Mortgage Lien: $10,343.58/ Per Diem Interest: $3.5441// Beginning Date: April 6, 2018 /(126435.2667)// EXHIBIT N Obligor(s) and Notice Address: JOSE LUIS OLGUIN RUIZ, CARRETERA AL CLUB CAMPESTRE CLUB RESC. SN PATRICIO, TUXTLA CHIAPAS, EM 29040, MEXICO and MARCIA HERRERA CASANOVA, CARRETERA AL CLUB CAMPESTRE CLUB RESC SN PATRICIO, TUXTLA CHIAPAS, EM 29040, MEXICO/ Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 26/ Interest Numbers: 772736 & 772737 & 772738 & 772739 & 772740 & 772741 & 772742 & 772743 & 772744 & 772745 & 772746 & 772747 & 772748 & 772749 & 772750 & 772751 & 772752 & 772801 & 772802 & 772803 & 772804 & 772805 & 772806 & 772807 & 772808 & 772809 /Points: 6500 / Use Year Commencement Date: September 1, 2012 / Book Number: 10443/ Page Number: 4195/ Obligor(s): JOSE LUIS OLGUIN RUIZ and MARCIA HERRERA CASANOVA/Note Date: August 27, 2012/ Mortgage Date: August 27, 2012/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $44,533.59/ Principal Sum: $39,725.15 / Interest Rate: 14.99% / Per Diem Interest: $16.5411/ From Date: July 27, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 4,168.33/ Late Fees: $390.11/Total Amount Secured by Mortgage Lien: $44,533.59/ Per Diem Interest: $16.5411//Beginning Date: April 6, 2018 /(126435.2670)// EXHIBIT O Obligor(s) and Notice Address: GLORIA EUGENIA AMAYA-DE-ALFONZO, CONDOMINIO RUI TOQUE CASA EL LAGITO #111 PIEDECUESTA, SANTANDER, OF 99999, COLOMBIA and HERMANN ALFONZOVILLARREAL, CARRERA 27 # 45-62 AUTOPALMA, BUCARAMANGA, OF, COLOMBIA and ANA MILENA ALFONZO AMAYA, CONDO RUI TOQUE EL LAGITO CASA 11 PIEDECUESTA and SILVIA JULIANA ALFONZO AMAYA, CONDO RUI TOQUE EL LAGITO CASA 11 PIEDECUESTA / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: 368226 & 368227 & 377806 & 377807 & 377808 & 377809 & 377810 & 377811 /Points: 2000 / Use Year Commencement Date: January 1, 2012 / Book Number: 10325/ Page Number: 1842/ Obligor(s): GLORIA EUGENIA AMAYA-DE-ALFONZO and HERMANN ALFONZO-VILLARREAL and ANA MILENA ALFONZO AMAYA and SILVIA JULIANA ALFONZO AMAYA /Note Date: November 30, 2011/ Mortgage Date: November 30, 2011/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $13,464.42/ Principal Sum: $11,280.44 /Interest Rate: 14.99% / Per Diem Interest: $4.6970/ From Date: April 1, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,733.22/ Late Fees: $200.76/ Total Amount Secured by Mortgage Lien: $13,464.42/ Per Diem Interest: $4.6970// Beginning Date: April 6, 2018 /(126435.2671)// EXHIBIT P Obligor(s) and Notice Address: ALFONSO LUIS AVILA FADUL, CRA. 52 #70-35, BARRANQUILLA, OF 99999, COLOMBIA and LEONOR EUGENIA MANZUR SOTO, CRA 52 #70-35, BARRANQUILLA, OF 99999, COLOMBIA/ Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 26/ Interest Numbers: 819330 & 819331 & 819332 & 819333 & 819334 & 819335 & 819336 & 819337 & 819338 & 831033 & 831034 & 831035 & 831036 & 831037 & 831038 & 831039 & 831040 & 831041 & 831042 & 831043 & 831044 & 831045 & 831046 & 831047 & 831048 & 831049 / Points: 6500 / Use Year Commencement Date: February 1, 2013 / Book Number: 10517/ Page Number: 1235/ Obligor(s): ALFONSO LUIS AVILA FADUL and LEONOR EUGENIA MANZUR SOTO/Note Date: January 17, 2013/ Mortgage Date: January 17, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $42,772.98/ Principal Sum: $37,974.51 / Interest Rate: 14.99% / Per Diem Interest: $15.8122/ From Date: July 17, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 4,142.79/ Late Fees: $405.68/ Total Amount Secured by Mortgage Lien: $42,772.98/ Per Diem Interest: $15.8122// Beginning Date: April 6, 2018 /(126435.2673)/ EXHIBIT Q Obligor(s) and Notice Address: ARMANDO SANDOVAL, CALLE 84 ENTRE AV 2A Y 2B CC LA COLINA PISO 1 LOCAL 18, MARACAIBO EDO ZULIA, OF 4001, VENEZUELA / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: 716145 & 716146 & 716147 & 716148 & 716149 & 716150 / Points: 1500 / Use Year Commencement Date: January 1, 2013 / Book Number: 10430/ Page Number: 7989/ Obligor(s): ARMANDO SANDOVAL/ Note Date: August 7, 2012/ Mortgage Date: August 7, 2012/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $10,357.37/ Principal Sum: $8,915.53 / Interest Rate: 15.99% / Per Diem Interest: $3.9600/ From Date: July 7, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,077.12/ Late Fees: $114.72/Total Amount Secured by Mortgage Lien: $10,357.37/ Per Diem Interest: $3.9600// Beginning Date: April 6, 2018 /(126435.2674)// EXHIBIT R Obligor(s) and Notice Address: MARIA CLAUDIA DE LA MISERICORDIA GOMEZ MARTINEZ, AV. DEL GOLF 625 EDIF YOO APT 601 TORRE F, NORDELTA, BS. AS., OF 1670, ARGENTINA and JUAN CARLOS ORTIZ GOMEZ, AV. DEL GOLF 625 EDIF YOO APT 601 TORRE F, NORDELTA, BS. AS., OF 1670, ARGENTINA and JUAN JOSE ORTIZ GOMEZ, AV. DEL GOLF 625 EDIF YOO APT 606, NORDELTA, BS. AS., OF 1670, ARGENTINA / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: 394603 & 394604 & 394605 & 394606 & 394607 & 394608 & 394609 & 397118 & 397119 & 397120 /Points: 2500 / Use Year Commencement Date: January 1, 2012 / Book Number: 10326/ Page Number: 3004/ Obligor(s): MARIA CLAUDIA DE LA MISERICORDIA GOMEZ MARTINEZ and JUAN CARLOS ORTIZ GOMEZ and JUAN JOSE ORTIZ GOMEZ/Note Date: November 17, 2011/ Mortgage Date: November 17, 2011/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $19,855.83/ Principal Sum: $15,151.08 / Interest Rate: 14.99% / Per Diem Interest: $6.3087/ From Date: July 17, 2016/ o Date: April 5, 2018/ Total Amount of Interest: $ 3,955.55/ Late Fees: $499.20/ Total Amount Secured by Mortgage Lien: $19,855.83/ Per Diem Interest: $6.3087// Beginning Date: April 6, 2018 /(126435.2675)// EXHIBIT S Obligor(s) and Notice Address: PEDRO NORWOOD, 1269 CORONEL AVENUE, VALLEJO, CA 94591 and ANITA LUCILLE NORWOOD, 1269 CORONEL AVENUE, VALLEJO, CA 94591 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: 885748 & 885749 & 885750 & 885751 & 885752 & 885801 / Points: 1500 / Use Year Commencement Date: January 1, 2013 / Book Number: 10505/ Page Number: 8323/ Obligor(s): PEDRO NORWOOD and ANITA LUCILLE NORWOOD/ Note Date: December 13, 2012/ Mortgage Date: December 13, 2012/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $12,667.11/ Principal Sum: $11,159.65 / Interest Rate: 13.99% / Per Diem Interest: $4.3368/ From Date: July 13, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,153.58/ Late Fees: $118.72 / Unapplied funds in the amount of: -$14.84 / Total Amount Secured by Mortgage Lien: $12,667.11/ Per Diem Interest: $4.3368// Beginning Date: April 6, 2018 /(126435.2676)// EXHIBIT T Obligor(s) and Notice Address: ARMANDO A. PARRA FUENMAYOR, CALLE 59 EDIF AMAZONAS PISO 5 APT 5B URB ZAPARA, MARACAIBO, OF, VENEZUELA / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 20/ Interest Numbers: 827034 & 827035 & 827036 & 827037 & 827038 & 827039 & 827040 & 827041 & 827042 & 827043 & 827044 & 827045 & 827046 & 827047 & 827048 & 827049 & 827050 & 827051 & 827052 & 827101 / Points: 5000 / Use Year Commencement Date: December 1, 2012 / Book Number: 10490/ Page Number: 7793/ Obligor(s): ARMANDO A. PARRA FUENMAYOR/Note Date: November 12, 2012/ Mortgage Date: November 12, 2012/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $33,749.58/ Principal Sum: $28,044.58 / Interest Rate: 15.99% / Per Diem Interest: $12.4565/ From Date: March 12, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 4,845.55/ Late Fees: $609.45/ Total Amount Secured by Mortgage Lien: $33,749.58/ Per Diem Interest: $12.4565// Beginning Date: April 6, 2018 /(126435.2677)// EXHIBIT U Obligor(s) and Notice Address: PATRICI BAXTER, 7340 21ST STREET, SACRAMENTO, CA 95822 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 9/ Interest Numbers: 001110 & 001111 & 001120 & 001121 & 001122 & 001131 & 001137 & 001139 & 001140 /Points: 2250 / Use Year Commencement Date: September 1, 2010 / Book Number: 10105/ Page Number: 4172/ Obligor(s): PATRICI BAXTER/ Note Date: August 10, 2010/ Mortgage Date: August 10, 2010/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $22,576.98/ Principal Sum: $14,979.26 / Interest Rate: 9.99% / Per Diem Interest: $4.1567/ From Date: December 10, 2013/ o Date: April 5, 2018/ Total Amount of Interest: $ 6,555.18/ Late Fees: $792.54/ Total Amount Secured by Mortgage Lien: $22,576.98/ Per Diem Interest: $4.1567// Beginning Date: April 6, 2018 /(126435.2679)// EXHIBIT V Obligor(s) and Notice Address: KEVIN POSTEN, 12706 SE 27TH AVENUE, MILWAUKIE, OR 97222 and MARIE POSTEN, 12706 SE 27TH AVENUE, MILWAUKIE, OR 97222 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: 178512 & 178513 & 178514 & 178515 & 178516 & 178517 / Points: 1500 / Use Year Commencement Date: March 1, 2011 / Book Number: 10177/ Page Number: 1326/ Obligor(s): KEVIN POSTEN and MARIE POSTEN/ Note Date: February 4, 2011/ Mortgage Date: February 4, 2011/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $19,626.44/ Principal Sum: $11,873.92 /Interest Rate: 14.49% / Per Diem Interest: $4.7793/ From Date: April 4, 2014/ o Date: April 5, 2018/ Total Amount of Interest: $ 6,987.40/ Late Fees: $515.12/ Total Amount Secured by Mortgage Lien: $19,626.44/ Per Diem Interest: $4.7793// Beginning Date: April 6, 2018 /(126435.2680)// EXHIBIT W Obligor(s) and Notice Address: MICHAEL J. MARSH, 7191 GRANADA DRIVE, FLINT, MI 48532 and ANNETTE J. MARSH, 5204 CHIMNEYROCK, LANSING, MI 48917 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: 057011 & 057012 & 057013 & 057014 & 071429 & 071430 / Points: 1500 / Use Year Commencement Date: October 1, 2010 / Book Number: 10134/ Page Number: 1756/ Obligor(s): MICHAEL J. MARSH and ANNETTE J. MARSH/ Note Date: September 24, 2010/ Mortgage Date: September 24, 2010/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $9,090.64/ Principal Sum: $7,124.18 / Interest Rate: 13.99% / Per Diem Interest: $2.7685/ From Date: July 24, 2016/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,716.46/ Late Fees: $0.00/ Total Amount Secured by Mortgage Lien: $9,090.64/ Per Diem Interest: $2.7685// Beginning Date: April 6, 2018 /(126435.2682)// EXHIBIT X Obligor(s) and Notice Address: NICOL INES SPINOLA, ALFARO 640, ACASSUSSO, BUENOS AIRES, OF 1641, ARGENTINA / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 26/ Interest Numbers: B79414 & B79415 & B79416 & B79417 & B79418 & B79419 & B79420 & B79421 & B79422 & B79423 & B79424 & B79425 & B79426 & B79427 & B79428 & B79429 & B79430 & B79431 & B79432 & B79433 & B79434 & B79435 & B79436 & B79437 & B79438 & B79439 / Points: 6500 / Use Year Commencement Date: December 1, 2013 / Book Number: 10682/ Page Number: 3048/ Obligor(s): NICOL INES SPINOLA/Note Date: November 22, 2013/ Mortgage Date: November 22, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $49,241.36/ Principal Sum: $43,578.21 / Interest Rate: 15.99% / Per Diem Interest: $19.3560/ From Date: July 22, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 4,974.51/ Late Fees: $438.64/ Total Amount Secured by Mortgage Lien: $49,241.36/ Per Diem Interest: $19.3560// Beginning Date: April 6, 2018 /(126435.2686)// EXHIBIT Y Obligor(s) and Notice Address: WILSON T. HARANAKA, RUA LUISA ALVARES 57 APT 24, SAN PAULO, OF 4332100, BRAZIL and SOLANGE K.S. HARANAKA, RUA LUISA ALVARES 57 APT 24, SAN PAULO, OF 4332100, BRAZIL /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: C15947 & C15948 & C15949 & C15950 & C15951 & C15952 / Points: 1500 / Use Year Commencement Date: January 1, 2014 / Book Number: 10685/ Page Number: 7303/ Obligor(s): WILSON T. HARANAKA and SOLANGE K.S. HARANAKA/ Note Date: December 3, 2013/ Mortgage Date: December 3, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $15,205.69/ Principal Sum: $12,540.30 / Interest Rate: 14.99% / Per Diem Interest: $5.2216/ From Date: February 3, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,224.42/ Late Fees: $190.97/ Total Amount Secured by Mortgage Lien: $15,205.69/ Per Diem Interest: $5.2216// Beginning Date: April 6, 2018 /(126435.2687)// EXHIBIT Z Obligor(s) and Notice Address: STEPHEN A. OWOFADE, 4505 CAUSEWAY COURT, KILLEEN, TX 76549 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 16/ Interest Numbers: B84209 & B84210 & B84211 & B84212 & B84213 & B86651 & B86652 & B86701 & B86702 & B91208 & Continued on Page 6D

PAGE 34

The Apopka Chief, July 20, 2018 Page 6D B91209 & B91210 & B91211 & B91212 & B91213 & B91214 / Points: 4000 / Use Year Commencement Date: September 1, 2014 / Book Number: 10667/ Page Number: 7166/ Obligor(s): STEPHEN A. OWOFADE/Note Date: November 4, 2013/ Mortgage Date: November 4, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $32,712.29/ Principal Sum: $28,429.32 / Interest Rate: 10.99% / Per Diem Interest: $8.6788/ From Date: March 4, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 3,445.49/ Late Fees: $587.48/ Total Amount Secured by Mortgage Lien: $32,712.29/ Per Diem Interest: $8.6788// Beginning Date: April 6, 2018 /(126435.2688)// EXHIBIT A1 Obligor(s) and Notice Address: RENE B. RONQUILLO, ROOM 103 1 LADISLAWA LADISLAWA BUHANGIN, DAVAO CITY, OF 8000, PHILIPPINES and MARIA ISABEL V. RONQUILLO, 710 BASILAN ST INGULAN VILLAGE #2, LANSING DAVAO, OF 8000, PHILIPPINES / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 14/ Interest Numbers: A80213 & A80214 & A80215 & A80216 & A84152 & A84201 & A84450 & A84451 & A84452 & A84501 & A95728 & A95729 & A95730 & A95731 / Points: 3500 / Use Year Commencement Date: September 1, 2013 / Book Number: 10641/ Page Number: 1802/ Obligor(s): RENE B. RONQUILLO and MARIA ISABEL V. RONQUILLO/Note Date: August 30, 2013/ Mortgage Date: August 30, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $19,886.72/ Principal Sum: $17,893.23 / Interest Rate: 12.99% / Per Diem Interest: $6.4565/ From Date: August 1, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,594.74/ Late Fees: $148.75/ TotaI Amount Secured by Mortgage Lien: $19,886.72/ Per Diem Interest: $6.4565// Beginning Date: April 6, 2018 /(126435.2690)// EXHIBIT B1 Obligor(s) and Notice Address: RICARDO JORGE MAYO GONZALEZ, INDEPENDENCIA 115 CENTRO, VILLAHERMOSA, TA 86000, MEXICO and ELENA GUTIERREZ DE SILVA, ERNESTO MALDA 102 DEPTO 204 COLONIA LINDAVISTA, VILLAHERMOSA, TA 86050, MEXICO /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 5/ Interest Numbers: B50109 & B50110 & B50111 & B50112 & B50113 /Points: 1250 / Use Year Commencement Date: January 1, 2014 / Book Number: 10636/ Page Number: 8283/ Obligor(s): RICARDO JORGE MAYO GONZALEZ and ELENA GUTIERREZ DE SILVA/Note Date: August 28, 2013/ Mortgage Date: August 28, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $11,841.26/ Principal Sum: $10,010.20 / Interest Rate: 13.99% / Per Diem Interest: $3.8901/ From Date: March 28, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,450.97/ Late Fees: $130.13/ Unapplied funds in the amount of: -$0.04 / Total Amount Secured by Mortgage Lien: $11,841.26/ Per Diem Interest: $3.8901// Beginning Date: April 6, 2018 /(126435.2691)// EXHIBIT C1 Obligor(s) and Notice Address: PETER WALTERSBARTHOLOMEW, LOT 125. BONAIR GARDENS, AROUCA, OF 99999, TRINIDAD AND TOBAGO /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: D88110 & D88111 & D88112 & D88113 & E22149 & E22150 / Points: 1500 / Use Year Commencement Date: June 1, 2014 / Book Number: 10756/ Page Number: 6236/ Obligor(s): PETER WALTERS-BARTHOLOMEW/ Note Date: May 9, 2014/ Mortgage Date: May 9, 2014/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $14,402.77/ Principal Sum: $12,607.02 / Interest Rate: 14.99% / Per Diem Interest: $5.2494/ From Date: July 9, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,417.32/ Late Fees: $128.43/ Total Amount Secured by Mortgage Lien: $14,402.77/ Per Diem Interest: $5.2494// Beginning Date: April 6, 2018 /(126435.2692)// EXHIBIT D1 Obligor(s) and Notice Address: JUAN MANUEL VILLEGAS, CALLE 16 A SUR #9E-50 CASA 107, MEDELLIN, OF, COLOMBIA and VANESSA GALLO, CALLE 16 A SUR # 9E-50 CASA 107, MEDELLIN, OF 0, COLOMBIA /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 26/ Interest Numbers: G48523 & G48524 & G48525 & G48526 & G48527 & G48528 & G48529 & G48530 & G48531 & G48532 & G48533 & G48534 & G48535 & G48536 & G48537 & G48538 & G48539 & G48540 & G48541 & G48542 & G48543 & G48544 & G48545 & G48546 & G48547 & G48548 / Points: 6500 / Use Year Commencement Date: January 1, 2015 / Book Number: 10875/ Page Number: 7383/ Obligor(s): JUAN MANUEL VILLEGAS and VANESSA GALLO/Note Date: December 12, 2014/ Mortgage Date: December 12, 2014/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $63,157.96/ Principal Sum: $52,962.18 / Interest Rate: 14.99% / Per Diem Interest: $22.0529/ From Date: February 12, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 9,196.07/ Late Fees: $749.71/ Total Amount Secured by Mortgage Lien: $63,157.96/ Per Diem Interest: $22.0529// Beginning Date: April 6, 2018 /(126435.2693)// EXHIBIT E1 Obligor(s) and Notice Address: MATTHEW D. WASWO, 13075 WEST HWY 74F, GUTHRIE, OK 73044 and AMBER L. WASWO, 13075 WEST HWY 74F, GUTHRIE, OK 73044 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 14/ Interest Numbers: F90212 & F90213 & F90214 & F90215 & F90216 & F90217 &F90218 & F90219 & F90220 & F90221 & F90222 & F90223 & F90224 & F90225 / Points: 3500 / Use Year Commencement Date: October 1, 2015/ Book Number: 10882/ Page Number: 4522/ Obligor(s): MATTHEW D. WASWO and AMBER L. WASWO/Note Date: December 8, 2014/ Mortgage Date: December 8, 2014/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $27,470.89/ Principal Sum: $24,947.73 / Interest Rate: 10.99% / Per Diem Interest: $7.6160/ From Date: July 8, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,063.96/ Late Fees: $209.20/ Total Amount Secured by Mortgage Lien: $27,470.89/ Per Diem Interest: $7.6160// Beginning Date: April 6, 2018 /(126435.2694)// EXHIBIT F1 Obligor(s) and Notice Address: ROBERTO PRADO SANHUEZA, GRAL BLANCHE 11688 LAS CONDES, SANTIAGO, OF 99999, CHILE / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: G40623 & G40624 & G40625 & G40626 & G40627 & G40628 & G40629 & G40630 / Points: 2000 / Use Year Commencement Date: September 1, 2015 / Book Number: 10863/ Page Number: 8502/ Obligor(s): ROBERTO PRADO SANHUEZA/ Note Date: December 11, 2014/ Mortgage Date: December 11, 2014/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $20,062.83/ Principal Sum: $17,560.12 / Interest Rate: 15.99% / Per Diem Interest: $7.7996/ From Date: July 11, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,090.31/ Late Fees: $ 162.40/ Total Amount Secured by Mortgage Lien: $20,062.83/ Per Diem Interest: $7.7996// Beginning Date: April 6, 2018 /(126435.2695)// EXHIBIT G1 Obligor(s) and Notice Address: DIONISIO HECTOR REIXACH, REGIS 702, CANADA DE GOMEZ, SANTA FE, OF 2500, ARGENTINA and ANA MARIA LATTANZI, REGIS 702, CANADA DE GOMEZ, SANTA FE, OF 2500, ARGENTINA /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 14/ Interest Numbers: G08208 & G08209 & G08210 & G08211 & G08212 & G08213 & G08214 & G08215 & G08335 & G08336 & G08337 & G08338 & G08339 & G08340 / Points: 3500 / Use Year Commencement Date: January 1, 2015 / Book Number: 10863/ Page Number: 0451/ Obligor(s): DIONISIO HECTOR REIXACH and ANA MARIA LATTANZI/Note Date: December 11, 2014/ Mortgage Date: December 11, 2014/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $29,850.45/ Principal Sum: $26,234.83 / Interest Rate: 15.99% / Per Diem Interest: $11.6526/ From Date: July 11, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 3,122.90/ Late Fees: $242.72/ Total Amount Secured by Mortgage Lien: $29,850.45/ Per Diem Interest: $11.6526//Beginning Date: April 6, 2018 /(126435.2696)// EXHIBIT H1 Obligor(s) and Notice Address: MAURICE MC LESLIE TROTMAN, 2460 MARY JEWETT CIRCLE, WINTER HAVEN, FL 33881 and KIM ANN KELLEY, 2460 MARY JEWETT CIRCLE, WINTER HAVEN, FL 33881 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: G08521 & G08522 & G08523 & G08524 & G08525 & G08526 / Points: 1500 / Use Year Commencement Date: January 1, 2015 / Book Number: 10862/ Page Number: 8283/ Obligor(s): MAURICE MC LESLIE TROTMAN and KIM ANN KELLEY/Note Date: December 15, 2014/ Mortgage Date: December 15, 2014/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $15,576.48/ Principal Sum: $13,044.60 / Interest Rate: 13.99% / Per Diem Interest: $5.0693/ From Date: February 15, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,098.71/ Late Fees: $183.17/ Total Amount Secured by Mortgage Lien: $15,576.48/ Per Diem Interest: $5.0693// Beginning Date: April 6, 2018 /(126435.2697)// EXHIBIT I1 Obligor(s) and Notice Address: MARIA IRENZA CARDENAS, CARRERA PRIMERA #84-25, BOGOTA, OF, COLOMBIA and ANA MARIA MERLANO CARDENAS, CALLE 26 NORTE # 5 N 39 BARRIO VERSAILLES, CALI, OF, COLOMBIA and JULIAN ANDRES MERLANO CARDENAS, CALLE 26 NORTE # 5 N 39 BARRIO VERSAILLES, CALI, OF, COLOMBIA /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 14/ Interest Numbers: 923613 & 923614 & 923615 & 923616 & 923617 & 923618 & 923619 & 923620 & 923621 & 923622 & 923623 & 923624 & 923625 & 923626 / Points: 3500 / Use Year Commencement Date: January 1, 2014 / Book Number: 10618/ Page Number: 8161/ Obligor(s): MARlA IRENZA CARDENAS and ANA MARIA MERLANO CARDENAS and JULIAN ANDRES MERLANO CARDENAS/ Note Date: April 29, 2013/ Mortgage Date: April 29, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $23,396.04/ Principal Sum: $20,949.84 / Interest Rate: 13.99% / Per Diem Interest: $8.1413/ From Date: August 1, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,010.91/ Late Fees: $ 185.29/ Total Amount Secured by Mortgage Lien: $23,396.04/ Per Diem Interest: $8.1413// Beginning Date: April 6, 2018 /(126435.2698)// EXHIBIT J1 Obligor(s) and Notice Address: SILVERIO MOSQUEDA, 17326 ROAD 26, MADERA, CA 936380647 and ERICKA R. RIOS, 1627 JADEN COURT, MADERA, CA 93638 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: 832714 & 832715 & 832716 & 832717 & 832718 & 839326 & 839327 & 839328 & 839329 & 839330 / Points: 2500 / Use Year Commencement Date: January 1, 2013 / Book Number: 10487/ Page Number: 8686/ Obligor(s): SILVERIO MOSQUEDA and ERICKA R. RIOS/Note Date: November 7, 2012/ Mortgage Date: November 7, 2012/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $15,986.56/ Principal Sum: $14,358.31 / Interest Rate: 10.99% / Per Diem Interest: $4.3833/ From Date: July 7, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,192.25/ Late Fees: $186.00/ Total Amount Secured by Mortgage Lien: $15,986.56/ Per Diem Interest: $4.3833// Beginning Date: April 6, 2018 /(126435.2699)// EXHIBIT K1 Obligor(s) and Notice Address: SOUW E. SOFIAN, 7403 LANGHAM PLACE, RANCH CUCAMONGA, CA 91730 and PIXI CHEE MENG SOFIAN, 6547 PERIDOT COURT, CORONA, CA 92880 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: B04728 & B04729 & B04730 & B04731 & B04732 & B04733 & B04734 & B04735 & B04736 & B04737 / Points: 2500 / Use Year Commencement Date: January 1, 2014 / Book Number: 10609/ Page Number: 6920/ Obligor(s): SOUW E. SOFIAN and PIXI CHEE MENG SOFIAN/ Note Date: June 24, 2013/ Mortgage Date: June 24, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $22,846.70/ Principal Sum: $20,024.51 / Interest Rate: 10.99% / Per Diem Interest: $6.1130/ From Date: March 24, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,304.59/ Late Fees: $267.60/ Total Amount Secured by Mortgage Lien: $22,846.70 / Per Diem Interest: $6.1130//Beginning Date: April 6, 2018 /(126435.2700)// EXHIBIT L1 Obligor(s) and Notice Address: PHUSANA AKRASERANEE, 81/133 M004 TAMBON PIMOLRAJ BANGBUATHONG DISTRICT, BANGBUATSONG NONTSABURI, OF 11110, THAILAND and SIWAPORN AKRASANEE, 81/133 M004 TAMBON PIMOLRAJ BANGBUATHONG DISTRICT, BANGBUATSONG NONTSABURI, OF 11110, THAILAND /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: A39133 & A39134 & A39135 & A39136 & A39137 & A39138 /Points: 1500 / Use Year Commencement Date: January 1, 2014 / Book Number: 10607/ Page Number: 1667/ Obligor(s): PHUSANA AKRASERANEE and SIWAPORN AKRASANEE/ Note Date: July 10, 2013/ Mortgage Date: July 10, 2013/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $10,380.64/ Principal Sum: $9,089.58 / Interest Rate: 13.99% / Per Diem Interest: $3.5323/ From Date: July 10, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 950.18/ Late Fees: $90.88/ Total Amount Secured by Mortgage Lien: $10,380.64/ Per Diem Interest: $3.5323// Beginning Date: April 6, 2018 /(126435.2702)// EXHIBIT M1 Obligor(s) and Notice Address: ZARUL AZHAM ZULKIFLI ZAZ, 10 JALAN PUNCAK KIARA 4, KIARA VIEW, SRI HARTAMAS, KUALALUMPUR, OF 50480, MALAYSIA and SHEREEN HANIM BAHARUDDIN SHB, 10 JALAN PUNCAK KIARA 4, KIARA VIEW, SRI HARTAMAS, KUALALUMPUR, OF 50480, MALAYSIA /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: I58838 & I58839 & I58840 & I58841 & I58842 & I58843 & I62731 & I62732 & I62733 & I62734 / Points: 2500 / Use Year Commencement Date: September 1, 2016 / Book Number: 10969/ Page Number: 8875/ Obligor(s): ZARUL AZHAM ZULKIFLI ZAZ and SHEREEN HANIM BAHARUDDIN SHB/ Note Date: August 3, 2015/ Mortgage Date: August 3, 2015/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $18,610.24/ Principal Sum: $16,458.50 / Interest Rate: 13.99% / Per Diem Interest: $6.3960/ From Date: July 3, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,765.26/ Late Fees: $136.48/ Total Amount Secured by Mortgage Lien: $18,610.24/ Per Diem Interest: $6.3960// Beginning Date: April 6, 2018 /(126435.2703)// EXHIBIT N1 Obligor(s) and Notice Address: MANUEL A. CONTRERAS, INTRECOMONIAL LA TRINIDAD Y HATILLO PARQUE RESIDENCIAL ALBORADA APT 72-B, SOROCAIMA CARRACAS, OF 99999, VENEZUELA and LUCILA DEL CARMEN VILERA, INTRECOMONIAL LA TRINIDAD Y HATILLO PARQUE RESIDENCIAL ALBORADA APT 72-B, SOROCAIMA CARRACAS, OF 99999, VENEZUELA /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: I85051 & I85052 & I85101 & I85102 & I85103 & I85104 & I85105 & I85106 / Points: 2000 / Use Year Commencement Date: September 1, 2015 / Book Number: 10982/ Page Number: 7303/ Obligor(s): MANUEL A. CONTRERAS and LUCILA DEL CARMEN VILERA/ Note Date: August 25, 2015/ Mortgage Date: August 25, 2015/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $21,313.75/ Principal Sum: $17,648.75 / Interest Rate: 15.99% / Per Diem Interest: $7.8390/ From Date: February 25, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 3,166.96/ Late Fees: $248.04/ TotaI Amount Secured by Mortgage Lien: $21,313.75/ Per Diem Interest: $7.8390// Beginning Date: April 6, 2018 /(126435.2704)// EXHIBIT O1 Obligor(s) and Notice Address: TONYA P. CONRAD, 906 SUGAR PINE DRIVE, BEAR, DE 19701 and JONATHAN L. CONRAD, 906 SUGAR PINE DRIVE, BEAR, DE 19701 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: H84745 & H84746 & H84747 & H84748 & H84749 & H84750 & H84751 & H84752 & H84801 & H84802 / Points: 2500 / Use Year Commencement Date: September 1, 2015 / Book Number: 10982/ Page Number: 6837/ Obligor(s): TONYA P. CONRAD and JONATHAN L. CONRAD/ Note Date: August 26, 2015/ Mortgage Date: August 26, 2015/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $26,135.35/ Principal Sum: $23,567.61 / Interest Rate: 12.99% / Per Diem Interest: $8.5040/ From Date: July 26, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,151.49/ Late Fees: $166.25/ Total Amount Secured by Mortgage Lien: $26,135.35/ Per Diem Interest: $8.5040// Beginning Date: April 6, 2018 /(126435.2705)// EXHIBIT P1 Obligor(s) and Notice Address: ZIN-MARK KING, 18 CONSTABULARY STREET, CARRINAGE, OF, TRINIDAD AND TOBAGO and CHRISTINE MAYERS, 18 CONSTABULARY STREET, CARRINAGE, OF, TRINIDAD AND TOBAGO /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: G08148 & G08149 & G08150 & G08151 & G08152 & G08201 / Points: 1500 / Use Year Commencement Date: January 1, 2015 / Book Number: 10872/ Page Number: 6615/ Obligor(s): ZIN-MARK KING and CHRISTINE MAYERS/Note Date: December 22, 2014/ Mortgage Date: December 22, 2014/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $15,144.77/ Principal Sum: $13,346.83 / Interest Rate: 14.99% / Per Diem Interest: $5.5575/ From Date: July 22, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,428.26/ Late Fees: $119.68/Total Amount Secured by Mortgage Lien: $15,144.77/ Per Diem Interest: $5.5575// Beginning Date: April 6, 2018 /(126435.2706)// EXHIBIT Q1 Obligor(s) and Notice Address: XIMENA AMPARO FERNANDEZ RUBIO, VIA SUBA COTA. KM 7 VILLAS DE PUEBLO VIEJO CASA 17, BOGOTA, OF 99999, COLOMBIA and PAULO FERNANDO SASTOQUE NESTLER, VIA SUBA COTA. KM 7 VILLAS DE PUEBLO VIEJO CASA 17, BOGOTA, OF 99999, COLOMBIA and FELIPE SASTOQUE FERNANDEZ, VIA SUBA COTA. KM 7 VILLAS DE PUEBLO VIEJO CASA 17, BOGOTA, OF 99999, COLOMBIA /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 26/ Interest Numbers: F11622 & F11623 & F44911 & F44912 & F44913 & F44914 & F44915 & F44916 & G47719 & G47720 & G47721 & G47722 & G47723 & G47724 & G47725 & G47726 & G57011 & G57012 & G60328 & G60329 & G65644 & G65645 & G65646 & G65647 & G65648 & G65649 / Points: 6500 / Use Year Commencement Date: February 1, 2015 / Book Number: 10882/ Page Number: 5368/ Obligor(s): XIMENA AMPARO FERNANDEZ RUBIO and PAULO FERNANDO SASTOQUE NESTLER and FELIPE SASTOQUE FERNANDEZ/ Note Date: January 26, 2015/ Mortgage Date: January 26, 2015/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $51,983.69/ Principal Sum: $46,769.36 / Interest Rate: 13.99% / Per Diem Interest: $18.1751/ From Date: July 26, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 4,598.30/ Late Fees: $366.03/ TotaI Amount Secured by Mortgage Lien: $51,983.69/ Per Diem Interest: $18.1751// Beginning Date: April 6, 2018 /(126435.2707)// EXHIBIT R1 Obligor(s) and Notice Address: ANGELA MARIA LOMBO LIEVANO, CARRERA 34, #16-A SUR #185, MEDELLIN, OF, COLOMBIA and CARLOS A. EUSE, CARRERA 34, #16-A SUR #185, MEDELLIN, OF, COLOMBIA / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 14/ Interest Numbers: H40643 & H40644 & H40645 & H40646 & H40647 & H40648 & H40649 & H40650 & H40651 & H40652 & H40701 & H40702 & H40703 & H40704 / Points: 3500 / Use Year Commencement Date: March 1, 2015 / Book Number: 10886/ Page Number: 1056/ Obligor(s): ANGELA MARIA LOMBO LIEVANO and CARLOS A. EUSE/ Note Date: February 2, 2015/ Mortgage Date: February 2, 2015/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $33,740.84/ Principal Sum: $28,742.52 / Interest Rate: 14.99% / Per Diem Interest: $11.9681/ From Date: April 2, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 4,404.24/ Late Fees: $344.08/ TotaI Amount Secured by Mortgage Lien: $33,740.84/ Per Diem Interest: $11.9681//Beginning Date: April 6, 2018 /(126435.2708)// EXHIBIT S1 Obligor(s) and Notice Address: JANE F. LEONARD, 5221 ROYAL CREST DRIVE, DALLAS, TX 75229 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners, Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: J55905 & J55906 & J55907 & J55908 & J55909 & J55910 & J55911 & J55912 & J55913 & J55914 / Points: 2500 / Use Year Commencement Date: November 1, 2015 / Book Number: 11013/ Page Number: 0623/ Obligor(s): JANE F. LEONARD/Note Date: October 12, 2015/ Mortgage Date: October 12, 2015/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $27,711.52/ Principal Sum: $24,813.54 / Interest Rate: 13.49% / Per Diem Interest: $9.2982/ From Date: July 12, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,482.61/ Late Fees: $165.37/ TotaI Amount Secured by Mortgage Lien: $27,711.52/ Per Diem Interest: $9.2982// Beginning Date: April 6, 2018 /(126435.2711)// EXHIBIT T1 Obligor(s) and Notice Address: CARLA ANN INGARGIOLA, 138 ANDERSON AVENUE, DEMAREST, NJ 07627-1316 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: H90218 & H90219 & H90220 & H90221 & H90222 & H90223 & H98404 & H98405 / Points: 2000 / Use Year Commencement Date: May 1, 2015 / Book Number: 10908/ Page Number: 1610/ Obligor(s): CARLA ANN INGARGIOLA/ Note Date: April 7, 2015/ Mortgage Date: April 7, 2015/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $12,144.47/ Principal Sum: $10,719.49 / Interest Rate: 12.99% / Per Diem Interest: $3.8679/ From Date: July 7, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,052.10/ Late Fees: $122.88/ TotaI Amount Secured by Mortgage Lien: $12,144.47/ Per Diem Interest: $3.8679// Beginning Date: April 6, 2018 /(126435.2714)// EXHIBIT U1 Obligor(s) and Notice Address: JOSE LUIS OLGUIN RUIZ, CARETERRA PANAMERICANA KLM 1090 #455 COLONIA EL RETIRO, TUXTLA GUTIERREZ, Cl 29050, MEXICO and MARCIA HERRERA CASANOVA, CARETERRA PANAMERICANA KLM 1090 #455 COLONIA EL RETIRO, TUXTLA GUTIERREZ, Cl 29050, MEXICO / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 80/ Interest Numbers: H99421 & H99422 & H99423 & H99424 & H99425 & H99426 & H99427 & H99428 & H99429 & H99430 & H99431 & H99432 & H99433 & H99434 & H99435 & H99436 & H99437 & H99438 & H99439 & H99440 & H99441 & H99442 & H99443 & H99444 & H99445 & H99446 & H99447 & H99448 & H99449 & H99450 & H99451 & H99452 & H99501 & H99502 & H99503 & H99504 & H99505 & H99506 & H99507 & H99508 & H99515 & H99516 & H99517 & H99518 & H99519 & H99520 & H99521 & H99522 & H99523 & H99524 & H99525 & H99526 & H99527 & H99528 & H99529 & H99530 & H99531 & H99532 & H99533 & H99534 & H99535 & H99536 & H99537 & H99538 & H99539 & H99540 & H99541 & H99542 & H99543 & H99544 & H99545 & H99546 & H99547 & H99548 & H99549 & H99550 & H99551 & H99552 & H99601 & H99602 / Points: 20,000 / Use Year Commencement Date: September 1, 2015 / Book Number: 10923/ Page Number: 9434/ Obligor(s): JOSE LUIS OLGUIN RUIZ and MARCIA HERRERA CASANOVA/Note Date: April 27, 2015/ Mortgage Date: April 27, 2015/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $179,557.74/ Principal Sum: $161,146.89 / Interest Rate: 14.99% / Per Diem Interest: $67.0998/ From Date: July 27, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 16,909.12/ Late Fees: $1,251.73/ Total Amount Secured by Mortgage Lien: $179,557.74/ Per Diem Interest: $67.0998// Beginning Date: April 6, 2018 /(126435.2715)// EXHIBIT V1 Obligor(s) and Notice Address: ALICIA M. SANTIAGO, 174 FRANKLIN AVENUE, APT. 1, LONG BRANCH, NJ 07740 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: K78208 & K78209 & K78210 & K78211 & K78212 & K78213 / Points: 1500 / Use Year Commencement Date: February 1, 2016 / Document Number: #20160071576 / Obligor(s): ALICIA M. SANTIAGO/Note Date: January 8, 2016/ Mortgage Date: January 8, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $18,550.96/ Principal Sum: $15,713.34 / Interest Rate: 13.99% / Per Diem Interest: $6.1064/ From Date: March 8, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,399.82/ Late Fees: $187.80/ Total Amount Secured by Mortgage Lien: $18,550.96/ Per Diem Interest: $6.1064// Beginning Date: April 6, 2018 /(126435.2720)// EXHIBIT W1 Obligor(s) and Notice Address: ROBERT WILLIAMS, 3368 ROYAL CREEK ROAD, MONTGOMERY, AL 36116 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: N55452 & N55501 & N55502 & N55503 & N55504 & N55505 & N55506 & N55507 / Points: 2000 / Use Year Commencement Date: September 1, 2016 / Document Number: #20160471054 / Obligor(s): ROBERT WILLIAMS/ Note Date: August 23, 2016/ Mortgage Date: August 23, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $24,425.74/ Principal Sum: $21,858.73 / Interest Rate: 13.99% / Per Diem Interest: $8.4945/ From Date: July 23, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,174.61/ Late Fees: $ 142.40/ Total Amount Secured by Mortgage Lien: $24,425.74/ Per Diem Interest: $8.4945// Beginning Date: April 6, 2018 /(126435.2721)// EXHIBIT X1 Obligor(s) and Notice Address: RAYMOND WIBERT HALL JR., 2903 EAST AVENUE, FORESTVILLE, MD 20747 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: M33631 & M33632 & M33633 & M33634 & N68313 & N68314 & N68315 & N68316 / Points: 2000 / Use Year Commencement Date: October 1, 2016 / Document Number: #20160497684/ Obligor(s): RAYMOND WIBERT HALL JR./ Note Date: September 7, 2016/ Mortgage Date: September 7, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $23,062.23/ Principal Sum: $20,510.85 / Interest Rate: 13.99% / Per Diem Interest: $7.9707/ From Date: July 7, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,168.02/ Late Fees: $133.36/ Total Amount Secured by Mortgage Lien: $23,062.23/ Per Diem Interest: $7.9707// Beginning Date: April 6, 2018 /(126435.2722)// EXHIBIT Y1 Obligor(s) and Notice Address: JAY M. GERALD, 3357 WHITE SHADOWS DRIVE, BATON ROUGE, LA 70816 and JENNIFER GERALD, 3357 WHITE SHADOWS DRIVE, BATON ROUGE, LA 70816 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: D03418 & D03419 & D03420 & D03421 & D03422 & D03423 / Points: 1500 / Use Year Commencement Date: May 1, 2016 / Document Number: #20160230304/ Obligor(s): JAY M. GERALD and JENNIFER GERALD / Note Date: April 25, 2016/ Mortgage Date: April 25, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $17,472.01/ Principal Sum: $15,560.38 / Interest Rate: 13.99% / Per Diem Interest: $6.0469/ From Date: July 25, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,535.95/ Late Fees: $125.68/ TotaI Amount Secured by Mortgage Lien: $17,472.01/ Per Diem Interest: $6.0469// Beginning Date: April 6, 2018 /(126435.2724)// EXHIBIT Z1 Obligor(s) and Notice Address: LUIS ESTEBAN OBREGON PASILLAS, FRONTERA 208 CAMPESTRE 2A SECCIO, AGUASCALIENTES, AC 20100, MEXICO and MARIA EUGENIA RUIZ BUENROSTRO, FRONTERA 208 CAMPESTRE 2A SECCIO, AGUASCALIENTES, AC 20100, MEXICO / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 24/ Interest Numbers: N37209 & N37210 & N37211 & N37212 & N37213 & N37214 & N37215 & N37216 & N37217 & N37218 & N37219 & N37220 & N37221 & N37222 & N37223 & N37224 & N37225 & N37226 & N37227 & N37228 & N37229 & N37230 & N37231 & N37232 / Points: 6000 / Use Year Commencement Date: October 1, 2016 / Document Number: #20160487859 / Obligor(s): LUIS ESTEBAN OBREGON PASILLAS and MARIA EUGENIA RUIZ BUENROSTRO/ Note Date: September 1, 2016/ Mortgage Date: September 1, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $56,698.04/ Principal Sum: $50,859.04 / Interest Rate: 14.99% / Per Diem Interest: $21.1771/ From Date: August 1, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 5,230.74/ Late Fees: $358.26/ TotaI Amount Secured by Mortgage Lien: $56,698.04/ Per Diem Interest: $21.1771// Beginning Date: April 6, 2018 /(126435.2728)// EXHIBIT A2 Obligor(s) and Notice Address: VIRGINIA FILOMENA CABO, 2 YEW COURT, WEST NYACK, NY 10994 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: N38042 & N38043 & N38044 & N38045 & N38046 & N38047 & N38048 & N38049 / Points: 2000 / Use Year Commencement Date: November 1, 2016 / Document Number: #20160563525/ Obligor(s): VIRGINIA FILOMENA CABO/ Note Date: October 12, 2016/ Mortgage Date: October 12, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $21,674.53/ Principal Sum: $19,409.95 / Interest Rate: 12.99% / Per Diem Interest: $7.0038/ From Date: July 12, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,870.02/ Late Fees: $144.56/ Total Amount Secured by Mortgage Lien: $21,674.53/ Per Diem Interest: $7.0038// Beginning Date: April 6, 2018 /(126435.2731)// EXHIBIT B2 Obligor(s) and Notice Address: MARCELO CONTRERAS, ANDRES BELLO 1544, ARICA, OF, CHILE /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: N66628 & N66629 & N66630 & N66631 & N66632 & N66633 / Points: 1500 / Use Year Commencement Date: January 1, 2017 / Document Number: #20160596975 / Obligor(s): MARCELO CONTRERAS/ Note Date: October 31, 2016/ Mortgage Date: October 31, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $19,570.84/ Principal Sum: $16,441.81 Continued from Page 5D Continued on Page 7D Public Notices 2D-8D The Apopka Chief Get Apopka area news delivered straight to your mail box every week. New or Renewal (Orange County) $30 Out of County or Subscribe Online at www.TheApopkaChief.com Name____________________________________ Address___________________________________ City______________State_______Zip__________ Phone No._________________________________ Amt. Enclosed $_________ Clip This Coupon and Mail To: The Apopka Chief The Apopka Chief Yes! Sign me up for Home Delivery for Only $25 a Year! Subscribe today and dont miss another issue! CARDS

PAGE 35

The Apopka Chief, July 20, 2018 Page 7D / Interest Rate: 15.99% / Per Diem Interest: $7.3029/ From Date: April 1, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,694.78/ Late Fees: $184.25/ Total Amount Secured by Mortgage Lien: $19,570.84/ Per Diem Interest: $7.3029// Beginning Date: April 6, 2018 /(126435.2732)// EXHIBIT C2 Obligor(s) and Notice Address: VANESSA Y. TORRES, 1133 TOSCANA ROAD, RIO RANCHO, NM 87124 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: N53721 & N53722 & N53723 & N53724 & N53725 & N53726 & N53727 & N53728 / Points: 2000 / Use Year Commencement Date: January 1, 2017 / Document Number: #20160632871/ Obligor(s): VANESSA Y. TORRES /Note Date: November 11, 2016/ Mortgage Date: November 11, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $24,020.46/ Principal Sum: $21,528.94 / Interest Rate: 12.99% / Per Diem Interest: $7.7684/ From Date: July 11, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,081.92/ Late Fees: $159.60/ TotaI Amount Secured by Mortgage Lien: $24,020.46/ Per Diem Interest: $7.7684// Beginning Date: April 6, 2018/(126435.2733)// EXHIBIT D2 Obligor(s) and Notice Address: LILLIAN SEUDAT, 13-15 HERRERA STREET ST JOSEPH VILLAGE, SAN FERNANDO, OF, TRINIDAD AND TOBAGO and RISHMA D. SEUDAT, 13-15 HERRERA STREET ST JOSEPH VILLAGE, SAN FERNANDO, OF, TRINIDAD AND TOBAGO and JOHN SEUDAT, 13-15 HERRERA STREET ST JOSEPH VILLAGE, SAN FERNANDO, OF, TRINIDAD AND TOBAGO and RAVI SEUDAT, 13-15 HERRERA STREET ST JOSEPH VILLAGE, SAN FERNANDO, OF, TRINIDAD AND TOBAGO /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 16/ Interest Numbers: O31226 & O31227 & O31228 & O31229 & O31230 & O31231 & O31232 & O31233 & O31234 & O31235 & O31236 & O31237 & O31238 & O31239 & O31240 & O31241 / Points: 4000 / Use Year Commencement Date: December 1, 2016 / Document Number: #20160643823 / Obligor(s): LILLIAN SEUDAT and RISHMA D. SEUDAT and JOHN SEUDAT and RAVI SEUDAT/Note Date: November 17, 2016/ Mortgage Date: November 17, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $40,386.97/ Principal Sum: $33,893.17 / Interest Rate: 14.99% / Per Diem Interest: $14.1127/ From Date: February 17, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 5,814.41/ Late Fees: $429.39/ Total Amount Secured by Mortgage Lien: $40,386.97/ Per Diem Interest: $14.1127//Beginning Date: April 6, 2018 /(126435.2734)// EXHIBIT E2 Obligor(s) and Notice Address: JAMES B. WILLIAMS, 115 BLUEGRASS CIRCLE, HENDERSONVILLE, TN 37075 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: M34419 & M34420 & M34421 & M34422 & M34423 & M34424 & M34425 & M34426 & M34427 & M34428 / Points: 2500 / Use Year Commencement Date: January 1, 2017 / Document Number: #20160362395/ / Obligor(s): JAMES B. WILLIAMS/ Note Date: June 24, 2016/ Mortgage Date: June 24, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $28,109.81 / Principal Sum: $25,336.15 / Interest Rate: 12.99% / Per Diem Interest: $9.1421/ From Date: July 24, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,331.26/ Late Fees: $192.40/ TotaI Amount Secured by Mortgage Lien: $28,109.81/ Per Diem Interest: $9.1421// Beginning Date: April 6, 2018 /(126435.2736)// EXHIBIT F2 Obligor(s) and Notice Address: JAIRO J. SABAT TARUD, CARRERA 55 #7934 APT 6B, BARRANQUILLA, OF, COLOMBIA and NATALIA NAME RESTREPO, CARRERA 55 # 7934 APT 6B, BARRANQUILLA, OF, COLOMBIA / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: O44126 & O44127 & O44128 & O44129 & O44130 & O44131 / Points: 1500 / Use Year Commencement Date: January 1, 2018 / Document Number: #20170062243 / Obligor(s): JAIRO J. SABAT TARUD and NATALIA NAME RESTREPO/ Note Date: January 5, 2017/ Mortgage Date: January 5, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $18,121.35/ Principal Sum: $15,928.44 / Interest Rate: 14.99% / Per Diem Interest: $6.6324/ From Date: July 5, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,817.31/ Late Fees: $ 125.60/ Total Amount Secured by Mortgage Lien: $18,121.35/ Per Diem Interest: $6.6324// Beginning Date: April 6, 2018 /(126435.2737)// EXHIBIT G2 Obligor(s) and Notice Address: AYETA ZIADPUR, 105 HILL STREET, APT. 3, STONEHAM, MA 02180 and JAMES L. LAWSON, 105 HILL STREET, APT. 3, STONEHAM, MA 02180 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: O95915 & O95916 & O96148 & O96149 & O96150 & O96151 & O96152 & O96201 / Points: 2000 / Use Year Commencement Date: February 1, 2017 / Document Number: #20170099418/ Obligor(s): AYETA ZIADPUR and JAMES L. LAWSON/Note Date: January 24, 2017/ Mortgage Date: January 24, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $17,911.65/ Principal Sum: $15,748.62 / Interest Rate: 15.99% / Per Diem Interest: $6.9950/ From Date: July 24, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,783.75/ Late Fees: $129.28/ TotaI Amount Secured by Mortgage Lien: $17,911.65/ Per Diem Interest: $6.9950// Beginning Date: April 6, 2018 /(126435.2738)// EXHIBIT H2 Obligor(s) and Notice Address: PEDRO ANIBAL FARIAS, URBANIZACION JUANICO CALLE JUAN MALDONANDO QUINTA DAYALIS, MATURIN, AG 6201, VENEZUELA and KATHERINE DEL CARMEN TERMINI, URBANIZACION JUANICO CALLE JUAN MALDONANDO QUINTA DAYALIS, MATURIN, AG 6201, VENEZUELA /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: O47133 & O47134 & O47135 & O47136 & O47137 & O47138 & O47139 & O47140 / Points: 2000 / Use Year Commencement Date: January 1, 2017 / Document Number: #20170051407 / Obligor(s): PEDRO ANIBAL FARIAS and KATHERINE DEL CARMEN TERMINI/Note Date: December 23, 2016/ Mortgage Date: December 23, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $18,623.66/ Principal Sum: $16,377.00 / Interest Rate: 15.99% / Per Diem Interest: $7.2741/ From Date: July 23, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,862.18/ Late Fees: $134.48/ Total Amount Secured by Mortgage Lien: $18,623.66/ Per Diem Interest: $7.2741// Beginning Date: April 6, 2018 /(126435.2739)// EXHIBIT I2 Obligor(s) and Notice Address: SYLVIA A. HERNANDEZ, 13032 BARTON ROAD, WHITTIER, CA 90605 and GERALD A. HERNANDEZ, 13032 BARTON ROAD, WHITTIER, CA 90605 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 4/ Interest Numbers: N40231 & N40232 & N40233 & N40234 / Points: 1000 / Use Year Commencement Date: January 1, 2018 / Document Number: #20170092768/ Obligor(s): SYLVIA A. HERNANDEZ and GERALD A. HERNANDEZ/ Note Date: January 16, 2017/ Mortgage Date: January 16, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $13,915.63/ Principal Sum: $12,313.23 / Interest Rate: 13.99% / Per Diem Interest: $4.7851/ From Date: July 16, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,258.48/ Late Fees: $93.92/ Total Amount Secured by Mortgage Lien: $13,915.63/ Per Diem Interest: $4.7851// Beginning Date: April 6, 2018 /(126435.2740)// EXHIBIT J2 Obligor(s) and Notice Address: LUZ DARY ROA PRADO, CARRERA 8 4-25, CERRITO VALLE, OF, COLOMBIA and SILVIO MONTANO ARANGO, CARRERA 8 4-25, CERRITO VALLE, OF, COLOMBIA and SILVIO SANTIAGO MONTANO ROA, CARRERA 8 4-25, CERRITO VALLE, OF, COLOMBIA and MARIA ALEJANDRA MONTANO ROA, CARRERA 8 4-25, CERRITO VALLE, OF, COLOMBIA and RAUL ALBERTO MONTANO PINILLOS, CARRERA 8 4-25, CERRITO VALLE, OF, COLOMBIA and SONIA MARINA MONTANO CORTES, CARRERA 8 4-25, CERRITO VALLE, OF, COLOMBIA and PAOLA ANDREA MONTANO CORTES, CARRERA 8 4-25, CERRITO VALLE, OF, COLOMBIA /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 16/ Interest Numbers: O81525 & O81526 & O81527 & O81528 & O81529 & O81530 & O81531 & O83933 & O83934 & O83935 & O83936 & O83937 & O83938 & O83939 & O83940 & O97128 / Points: 4000 / Use Year Commencement Date: February 1, 2017 / Document Number: #20170111148 /Obligor(s): LUZ DARY ROA PRADO and SILVIO MONTANO ARANGO and SILVIO SANTIAGO MONTANO ROA and MARIA ALEJANDRA MONTANO ROA and RAUL ALBERTO MONTANO PINILLOS and SONIA MARINA MONTANO CORTES and PAOLA ANDREA MONTANO CORTES/ Note Date: January 30, 2017/ Mortgage Date: January 30, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $30,241.47/ Principal Sum: $26,824.52 / Interest Rate: 5.99% / Per Diem Interest: $4.4633/ From Date: May 1, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,513.05/ Late Fees: $1,653.90/ Total Amount Secured by Mortgage Lien: $30,241.47/ Per Diem Interest: $4.4633// Beginning Date: April 6, 2018 /(126435.2741)// EXHIBIT K2 Obligor(s) and Notice Address: OCTAVIO CANALES, DOMINGO BONDI #1035 DPTO 1903, SANTIAGO, OF, CHILE /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 14/ Interest Numbers: L84652 & L84701 & L84702 & L84703 & L84704 & L84705 & L84706 & L84707 & L84708 & L84709 & L84710 & L84711 & N29106 & N29107 / Points: 3500 / Use Year Commencement Date: January 1, 2018 / Document Number: #20170196816 / Obligor(s): OCTAVIO CANALES/ Note Date: March 9, 2017/ Mortgage Date: March 9, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $26,025.50/ Principal Sum: $23,440.89 / Interest Rate: 5.99% / Per Diem Interest: $3.9003/ From Date: July 9, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,053.09/ Late Fees: $1,281.52/ Total Amount Secured by Mortgage Lien: $26,025.50/ Per Diem Interest: $3.9003// Beginning Date: April 6, 2018 /(126435.2742)// EXHIBIT L2 Obligor(s) and Notice Address: FAIVAOTOA TOLEAFOA, 6130 WEST TROPICANA AVENUE #160, LAS VEGAS, NV 89103 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: O36821 & O36822 & O36823 & O36824 & O36825 & O36826 & O36827 & O36828 / Points: 2000 / Use Year Commencement Date: January 1, 2017 / Document Number: #20170037638 / Obligor(s): FAIVAOTOA TOLEAFOA/Note Date: December 15, 2016/ Mortgage Date: December 15, 2016/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $21,069.62/ Principal Sum: $18,772.35 / Interest Rate: 13.99% / Per Diem Interest: $7.2951/ From Date: July 15, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,925.91/ Late Fees: $121.36/ TotaI Amount Secured by Mortgage Lien: $21,069.62/ Per Diem Interest: $7.2951// Beginning Date: April 6, 2018 /(126435.2743)// EXHIBIT M2 Obligor(s) and Notice Address: STEPHEN M. LACY, 7939 PARKWOOD BLVD., PLANO, TX 75024-5880 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 6/ Interest Numbers: Q72140 & Q72141 & Q72142 & Q72143 & Q72144 & Q72145 / Points: 1500 / Use Year Commencement Date: June 1, 2017 / Document Number: #20170341819/ Obligor(s): STEPHEN M. LACY/ Note Date: May 18, 2017/ Mortgage Date: May 18, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $20,274.66/ Principal Sum: $18,057.60 / Interest Rate: 13.99% / Per Diem Interest: $7.0174/ From Date: July 18, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 1,831.54/ Late Fees: $135.52/ Total Amount Secured by Mortgage Lien: $20,274.66/ Per Diem Interest: $7.0174// Beginning Date: April 6, 2018 /(126435.2744)// EXHIBIT N2 Obligor(s) and Notice Address: TAMISHA MELISSA BROWNE, COMMERCIAL ROAD, GEORGE TOWN, OF ST. VINCENT /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: O70527 & O70528 & O70529 & O70530 & O70531 & O70532 & O70533 & O70534 / Points: 2000 / Use Year Commencement Date: December 1, 2017 / Document Number: #20170295796 / Obligor(s): TAMISHA MELISSA BROWNE/ Note Date: April 27, 2017/ Mortgage Date: April 27, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $21,134.25/ Principal Sum: $18,335.00 / Interest Rate: 14.99% / Per Diem Interest: $7.6345/ From Date: May 27, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 2,389.59/ Late Fees: $159.66/ TotaI Amount Secured by Mortgage Lien: $21,134.25/ Per Diem Interest: $7.6345// Beginning Date: April 6, 2018 /(126435.2745)// EXHIBIT O2 Obligor(s) and Notice Address: AMIR SAADAT, 7095 HOLLYWOOD BLVD., #537, LOS ANGELES, CA 90028 and JENNIFER SAADAT, 7095 HOLLYWOOD BLVD., #537, LOS ANGELES, CA 90028 /Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 40/ Interest Numbers: R09845 & R09846 & R09847 & R09848 & R09849 & R09850 & R09851 & R09852 & R09901 & R09902 & R09903 & R09904 & R09905 & R09906 & R09907 & R09908 & R14106 & R14107 & R14108 & R14109 & R14110 & R14111 & R14112 & R14113 & R19007 & R19008 & R19009 & R19010 & R19011 & R19012 & R19013 & R19014 & R19015 & R19016 & R19017 & R19018 & R19019 & R19020 & R19021 & R19022 / Points: 10,000 / Use Year Commencement Date: July 1, 2017 / Document Number: #20170385899/ Obligor(s): AMIR SAADAT and JENNIFER SAADAT / Note Date: June 16, 2017/ Mortgage Date: June 16, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $104,943.72/ Principal Sum: $96,320.80 / Interest Rate: 10.99% / Per Diem Interest: $29.4046/ From Date: July 16, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 7,733.40/ Late Fees: $639.52/ Total Amount Secured by Mortgage Lien: $104,943.72/ Per Diem Interest: $29.4046// Beginning Date: April 6, 2018 /(126435.2746)// EXHIBIT P2 Obligor(s) and Notice Address: RICARDO GONZALEZ LABASTIDA, PRIVADA VENECIA 8342-25 FRACCIONAMIENTO VERONA RES., TIJUANA, BJ 22667, MEXICO and NANCY ANGELICA CASTELLANOS GONZALEZ, PRIVADA VENECIA 834225 FRACCIONAMIENTO VERONA RES., TIJUANA, BJ 22667, MEXICO / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 16/ Interest Numbers: 005718 & 008531 & 061916 & 061917 & 061918 & 061919 & 061920 & 061921 & 061922 & 061923 & 083752 & 083801 & 083802 & 083803 & 083804 & 086719 / Points: 4000 / Use Year Commencement Date: February 1, 2018 / Document Number: #20170406543 / Obligor(s): RICARDO GONZALEZ LABASTIDA and NANCY ANGELICA CASTELLANOS GONZALEZ/ Note Date: June 29, 2017/ Mortgage Date: June 29, 2017/ As of Date: April 5, 2018 / Total Amount Secured by Mortgage Lien: $38,505.31/ Principal Sum: $34,476.00 / Interest Rate: 14.99% / Per Diem Interest: $14.3554/ From Date: August 1, 2017/ o Date: April 5, 2018/ Total Amount of Interest: $ 3,545.79/ Late Fees: $233.52/ Total Amount Secured by Mortgage Lien: $38,505.31/ Per Diem Interest: $14.3554// Beginning Date: April 6, 2018 /(126435.2748)// EXHIBIT Q2 Obligor(s) and Notice Address: ROSE DIAZ, 91 SALEM ROAD, FISHKILL, NY 12524 and ROBERT R. DIAZ, 91 SALEM ROAD, FISHKILL, NY 12524 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 16/ Interest Numbers: I21304 & I21305 & I21306 & I21307 & I21308 & I21309 & I21310 & I21311 & I21312 & I21313 & I21314 & I21315 & I21316 & I21317 & I21318 & I21319 / Points: 4000 / Use Year Commencement Date: January 1, 2016 / Book Number: 10915/ Page Number: 2204/ Obligor(s): ROSE DIAZ and ROBERT R. DIAZ/ Note Date: April 14, 2015/ Mortgage Date: April 14, 2015/ As of Date: May 3, 2018 / Total Amount Secured by Mortgage Lien: $38,821.99/ Principal Sum: $33,867.12 / Interest Rate: 10.99% / Per Diem Interest: $10.3389/ From Date: March 14, 2017/ o Date: May 3, 2018/ Total Amount of Interest: $ 4,290.69 / Late Fees: $414.18/ TotaI Amount Secured by Mortgage Lien: $38,821.99/ Per Diem Interest: $10.3389// Beginning Date: May 4, 2018 /(126435.2775)// EXHIBIT R2 Obligor(s) and Notice Address: WESLEY J. HESKER, P.O. BOX 1292, PROSPER, TX 75078 and JEANETTE G. HESKER, P.O. BOX 1292, PROSPER, TX 75078 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 10/ Interest Numbers: I96235 & I96236 & I96237 & I96238 & I96239 & I96240 & I96241 & I96242 & I96243 & I96244 / Points: 2500 / Use Year Commencement Date: October 1, 2015 / Book Number: 11003/ Page Number: 6719/ Obligor(s): WESLEY J. HESKER and JEANETTE G. HESKER/ Note Date: September 25, 2015/ Mortgage Date: September 25, 2015/ As of Date: May 3, 2018 / Total Amount Secured by Mortgage Lien: $24,193.05/ Principal Sum: $21,812.74 / Interest Rate: 12.99% / Per Diem Interest: $7.8708/ From Date: August 25, 2017/ o Date: May 3, 2018/ Total Amount of Interest: $ 1,975.54/ Late Fees: $ 154.77/ Total Amount Secured by Mortgage Lien: $24,193.05/ Per Diem Interest: $7.8708// Beginning Date: May 4, 2018 /(126435.2777)// EXHIBIT S2 Obligor(s) and Notice Address: GREGORY F. ARCARO, 12 JEROME AVENUE, BLOOMFIELD, CT 06002 / Junior Interestholder(s) and Notice Address: Marriott Resorts Hospitality Corporation, a South Carolina corporation, as Managing Agent on behalf of the MVC Trust Owners Association, Inc., a Florida corporation, 6649 Westwood Blvd. Orlando, FL 32821/ Number of Interests: 8/ Interest Numbers: J90326 & J90327 & J90328 & J90329 & J90330 & J90331 & J90332 & J90333 / Points: 2000 / Use Year Commencement Date: October 1, 2015 / Book Number: 10983/ Page Number: 6911/ Obligor(s): GREGORY F. ARCARO/Note Date: September 4, 2015/ Mortgage Date: September 4, 2015/ As of Date: May 3, 2018 / Total Amount Secured by Mortgage Lien: $21,140.89/ Principal Sum: $18,885.12 / Interest Rate: 12.99% / Per Diem Interest: $6.8144/ From Date: August 4, 2017/ o Date: May 3, 2018/ Total Amount of Interest: $ 1,853.53/ Late Fees: $152.24 / Total Amount Secured by Mortgage Lien: $21,140.89/ Per Diem Interest: $6.8144 // Beginning Date: May 4, 2018 /(126435.2782)// Publish: The Apopka Chief July 13 and 20, 2018 160814 Continued from Page 6D IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001961-O Division ____ IN RE: ESTATE OF PHILIP MATHEW, Deceased. NOTICE TO CREDITORS The administration of the estate of PHILIP MATHEW, deceased, whose date of death was January 3, 2018, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Ave., Orlando, FL 32801. The names and addresses of the personal representative and the personal set forth below. All creditors of the decedent and other persons having claims or demands against copy of this notice is required claims with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against their claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIODS SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEBARRED. of this notice is July 13, 2018. Personal Representative: KHAIRIYA ABDUL RAHMAN JUMA AL BULUSHI 3926 Gypsum Lane Orlando, FL 32826 Attorney for Personal Representative: EVELYN W. CLONINGER Florida Bar Number: 210382 1519 W. Broadway St. Oviedo, FL 32765 Telephone: (407) 365-5696 E-Mail: Secondary E-Mail: Attorney July 13 and 20, 2018 160832 IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT IN AND FOR ORANGE COUNTY, FLORIDA CASE NO. 2018-CA004531 -O DIV NO.: 33 MARRIOTT RESORTS HOSPITALITY CORPORATION, a South Carolina Corporation, Management Agent on behalf of LAKESHORE RESERVE CONDOMINIUM ASSOCIATION, INC., a Florida and All Owners as Agent, Plaintiff, vs. CHRISTINA C. BRESLIN, et al., Defendants. NOTICE OF ACTION BY PUBLICATION AS TO COUNT II TO THE FOLLOWING DEFENDANTS WHOSE RESIDENCE IS UNKNOWN: TO: TIJS PIETER DIRK SWETS LAUWERS 23 ZWYNDRECHT 3332 TB NETHERLANDS ALLA SWETS LAUWERS 23 ZWYNDRECHT 3332 TB NETHERLANDS The above named Dedead or alive and, if dead, devisees, grantees, assignees, lienors, creditors, trustees, or other claimants, by, through under or against said Defendants and all parties having or claiming to have any right, title or interest in the property described below. YOU ARE HEREBY NOTIFIED of the institution of the above-styled foreclosure proceedings by the Plaintiff, MARRIOTT RESORTS HOSPITALITY CORPORATION, to foreclose a lien and for other relief relative to the following described property: COUNT II Unit Week 03 in Unit 3205, in LAKESHORE RESERVE CONDOMINIUM, according to the Declaration of Condominium thereof, as ords Book 9741 at Page 2312 in the Public Rec ords of Orange County, Florida, and any amendments thereof. AND you are required to serve a copy of your written defenses, if any to the complaint, upon EDWARD M. FITZGERALD, ESQUIRE, Holland & Knight LLP, 200 S. Orange Avenue, Suite 2600, Florida 32802, attorneys for the Plaintiff, on or before thirty of publication herein the above-styled Court either before service on Plaintiff's attorney or immediately thereafter, otherwise a default will be entered against you for the relief demanded in the complaint. DATED on this 03 day of July, 2018. Tiffany Moore Russell Tesha Greene CIRCUIT COURT SEAL Civil Division 425 N. Orange Avenue Room 310 Orlando, Florida 32801 If you are a person with a disability who needs any ac com modation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact the ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, (407) 836-2303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. THIS DOCUMENT IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. HK#126445.0011 MRT #8218919 Publish: The Apopka Chief July 13 and 20, 2018 160834 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001816-O IN RE: ESTATE OF LAURA MARGARET BADAWI, Deceased. NOTICE TO CREDITORS The administration of the estate of LAURA MARGARET BADAWI, deceased, whose date of death was September 16, 2017, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Avenue, Orlando, FL 32801. The names and addresses of the personal representative and the personal set forth below. All creditors of the decedent and other persons having claims or demands against copy of this notice is required claims with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIOD SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEBARRED. tion of this notice is: Friday July 13, 2018. Signed on this 29th day of May, 2018. SARAH BADAWI Personal Representative 1545 18th Street N.W., #601 Washington, DC 20036 Hallie L. Zobel Attorney for Personal Representative Florida Bar No. 748218 Your Caring Law Firm PLC 610 S. Maitland Avenue Maitland, Florida 32751 Telephone: (407) 622-1900 Email: Hallie@YourCaringLawFirm. com Secondary Email: Janet@YourCaringLawFirm. com July 13 and 20, 2018 160812 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-001007-O Division: Probate 02 IN RE: ESTATE OF ROGELIO ARTURO GONZALEZ, Deceased. NOTICE TO CREDITORS The administration of the estate of ROGELIO ARTURO GONZALEZ, deceased, whose date of death was May 6, 2015, is pending in the Circuit Court for ORANGE County, Florida, Probate Division, the address of which is 425 N. Orange Avenue, Orlando, Florida 32801. The names and addresses of the personal representative and the personal set forth below. All creditors of the decedent and other persons having claims or demands against copy of this notice is required claims with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against their claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIODS SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEBARRED. of this notice is July 13, 2018. Personal Representative: Fatima Elizabeth Fatima Rocio Gonzalez Orlando, Florida 32837 Attorney for Personal Representative: MAUREEN A. ARAGO, Attorney Florida Bar Number: 835821 Arago Law Firm, PLLC. 230 E. Monument Ave., Suite A Kissimmee, FL 34741 Telephone: (407) 344-1185 E-Mail: maureenarago@aragolaw. com July 13 and 20, 2018 160828 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-1933-O IN RE: ESTATE OF WILLIAM REMMER CHARBONNEAU, Deceased. NOTICE TO CREDITORS The administration of the estate of WILLIAM REMMER CHARBONNEAU, deceased, whose date of death was August 24, 2016, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Avenue, Orlando, FL 32801. The names and addresses of the personal representative and the personal set forth below. All creditors of the decedent and other persons having claims or demands against copy of this notice is required claims with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIOD SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEBARRED. tion of this notice is: July 13, 2018. Signed on this 5th day of July, 2018. JESSICA MACMILLAN CHARBONNEAU Personal Representative 3826 Marsh Lilly Drive Orlando, FL 32828 Hallie L. Zobel Attorney for Personal Representative Florida Bar No. 0748218 Your Caring Law Firm PLC 610 S. Maitland Ave. Maitland, FL 32751 Telephone: (407) 622-1900 Email: Hallie@YourCaringLawFirm. com Secondary Email: com July 13 and 20, 2018 160808 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002115-O IN RE: ESTATE OF ALMIRA E. ULERICK, Deceased. NOTICE TO CREDITORS The administration of the estate of ALMIRA E. ULERICK, deceased, whose date of death was April 17, 2018, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 North Orange Avenue, Orlando, Florida 32801. The names and addresses of the petitioner/personal representative and his attorney are set forth below. All creditors of the decedent and other persons having claims or demands against copy of this notice is required claims with this court ON OR BEFORE THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against their claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIOD SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEBARRED. of this notice is: July 13, 2018. Signed on this 26th day of June, 2018. SCOTT D. ULERICK Petitioner/ Personal Representative 432 Romano Avenue Orlando, Florida 32807 Lynn B. Aust Attorney for Petitioner/ Personal Representative Florida Bar No. 550841 Aust Law Firm 1220 East Livingston Street Orlando, Florida 32803 Telephone: 407-447-5399 Email: doveattorney@austlaw.biz Secondary Email: info@austlaw.biz July 13 and 20, 2018 160809 Public Notices 2D-8D The Apopka Chief IN THE CIRCUIT COURT OF THE NINTH JUDICIAL CIRCUIT, IN AND FOR ORANGE COUNTY, FLORIDA CASE NUMBER: 2018-CA2023-O DIVISION NUMBER : 40 IN RE: FORFEITURE OF $1,570.00 IN U.S. CURRENCY NOTICE OF ACTION TO: ELIZABETH VELEZ YOU ARE NOTIFIED that an action pursuant to the Florida Contraband Forfeiture on the following property in Orange County, FL: $1,570.00 in U.S. Currency seized on or about the 12th day of January, 2018, at or near South Street and Boone Avenue, Orlando, Orange County, Florida. You are required to serve a copy of your written defenses, if any, to the Assistant General Counsel West Colonial Drive, Orlando, Florida 32804, within 30 days Court either before service on diately thereafter; otherwise a default will be entered against you for the relief demanded in the Petition for Final Judgment of Forfeiture. REQUESTS FOR ACCOMMODATIONS BY PERSONS WITH DISABILITIES. If you are a person with disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact ADA Coordinator, Human Resources, Orange County Courthouse, 425 North Orange Avenue, Suite 510, Orlando, Florida, 407 8362303, at least 7 days before your scheduled court appearance, or immediately tion if the time before the scheduled appearance is less than 7 days; if you are hearing or voice impaired, call 711. DATED this 22 day of June, 2018. TIFFANY MOORE RUSSELL BY CIRCUIT COURT SEAL Civil Division 425 N. Orange Avenue Room 310 Orlando, Florida 32801 June 29, July 6, 13 and 20, 2018 160732 NOTICE OF PUBLIC SALE WRECKER SERVICE, INC., 580 WILMER AVE., ORLANDO, FLORIDA 32808, TELEPHONE 407-293-2540, THE FOLLOWING VEHICLE (S) WILL BE SOLD FOR CASH. SOME OF THE VEHICLES POSTED MAY HAVE ALREADY BEEN RELEASED AND NOT ELIGIBLE FOR SALVAGE SALE. YEAR MAKE VIN# 2009 CHEVROLET 1G1ZH57B394195496 2003 FORD 1FMZU73W03UA74578 2018 JEEP 3C4NJDBB9JT150041 2017 NISSAN 1N4AL3AP4HC471111 2015 NISSAN 1N4AL3AP7FC184827 2007 NISSAN 1N4AL21E17N460935 2001 SATURN 1G8ZK52701Z252718 JAZZY NO VIN 2000 BUICK 2G4WS52J3Y1260976 2002 HONDA 1HGEM22572L046233 1999 NISSAN 1N4DL01D8XC121450 2011 MAZDA JM1BL1VF9B1498439 1994 CHEVROLET 2GCFC29H3R1259587 2006 NISSAN 1N4BA41E66C852325 2003 NISSAN 1N4AL11D33C250148 2010 MAZDA JM1BL1S50A1323393 2008 NISSAN 1N4AL21E08N441455 1994 BMW WBACA6329RFK64982 2013 BASHAN LHJTLKBR5DB00010 1999 FORD 2FMZA5149XBA43971 1996 BUICK 2G4WB52K9T1504616 1985 GMC 1GTCT14B6F2506600 2006 KIA KNALD124X65092122 2006 SUZUKI NO VIN 2006 MERCEDES BENZ WDBUF56J16A834535 2009 TOYOTA 4T1BE46K39U875441 1996 TOYOTA 4T1BG12K3TU787964 2009 HYUNDAI 5NPEU46C19H462778 2001 JAGUAR SAJDA01N81FM03040 2002 TOYOTA 2T1FF28P22C593360 2005 KIA KNDUP132356689309 1997 TOYOTA 2T1BB02E6VC191299 1999 BUICK 1G4CW52K7X4639112 1999 CHEVROLET 1GNEC13R8XJ465523 2009 CHEVROLET 2G1WT57N491101956 2004 NISSAN 3N1CB51DX4L841552 2007 NISSAN 1N4BA41EX7C814372 2010 MAZDA JM1BL1S59A1199074 2004 HYUNDAI KMHFU45E34A346243 1999 FORD 1FMRU1765XLA80296 2000 MITSUBISHI 4A3AA46G5YE171853 2014 CHEVROLET 2G1WB5E38E1103305 2003 CHEVROLET 1GNDX03E73D284705 2010 DODGE 2B3CA3CV9AH226703 2004 TOYOTA 2T1KR32E94C180292 TERMS OF THE SALE ARE CASH. NO CHECKS WILL BE ACCEPTED. SELLER RESERVES THE RIGHT TO FINAL BID. ALL SALES ARE FINAL. NO REFUNDS WILL BE MADE. VEHICLE(S)/ VESSEL(S) ARE SOLD AS IS, WHERE IS, WITH NO GUARANTEES, EITHER EXPRESSED OR IMPLIED. July 20, 2018 160895

PAGE 36

The Apopka Chief, July 20, 2018 Page 8D IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-2169-O Division ____ IN RE: ESTATE OF JOSE EUGENIO PERALES MENDOZA Deceased. NOTICE TO CREDITORS The administration of the estate of Jose Eugenio Perales Mendoza, deceased, whose date of death was February 18, 2018, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is Clerk of the Circuit Court, Orange County, 425 N. Orange Avenue, Orlando, Florida 32801. The names and addresses of the Petitioner and the Attorney for Petitioner are set forth below. All creditors of the decedent and other persons having claims or demands against copy of this notice is required claims with the court WITHIN THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against their claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT FILED WITHIN THE TIME PERIODS SET FORTH IN FLORIDA STATUTES SECTION 733.702 OF THE FLORIDA PROBATE CODE WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIODS SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEBARRED. this notice is July 20, 2018. Petitioner: Jose Cristobal Perales Mendoza Attorney for Petitioner: Josue Merino Florida Bar No. 97337 for CARLOS A. MARTIN Florida Bar No. 108562 628 N. Bear Lake Road, Ste. 102 Apopka, Florida 32703 Tel. (407) 796-2939 Fax (407) 930-9449 E-Mail: EService@ ForestLakeLaw.com 2nd E-Mail: LSantos@ ForestLakeLaw.com Publish: The Apopka Chief July 20 and 27, 2018 160913 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Florida MC Lawyer located at 1676 East Semoran Blvd., in the County of Orange in the City of Apopka Florida 32703, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Apopka, Florida, this 18th day of July, 2018. Dillingham Law, PLLC Publish: The Apopka Chief July 20, 2018 160914 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Odry Vargas Property Management located at 13950 Landstar Blvd., in the County of Orange in the City of Orlando Florida 32824, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orlando, Florida, this 18th day of July, 2018. Yoldry Property Management LLC Publish: The Apopka Chief July 20, 2018 160915 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Hair Nerd Orlando located at 915 S Orlando Ave Suite 15, in the County of Orange in the City of Maitland Florida 32751, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Maitland, Florida, this 18th day of July, 2018. Hair Nerd LLC Publish: The Apopka Chief July 20, 2018 160916 IN THE CIRCUIT COURT FOR ORANGE COUNTY, FLORIDA PROBATE DIVISION File No. 2018-CP-002149-O Division IN RE: ESTATE OF DONALD REDINGER RUPP, Deceased. NOTICE TO CREDITORS The administration of the estate of DONALD REDINGER RUPP, deceased, whose date of death was March 26, 2018, is pending in the Circuit Court for Orange County, Florida, Probate Division, the address of which is 425 N. Orange Ave., Room 3400, Orlando, FL 32801. The names and addresses of the personal representative and the personal set forth below. The estate is testate. All creditors of the decedent and other persons having claims or demands against copy of this notice is required claims with this court WITHIN THE LATER OF 3 MONTHS AFTER THE TIME OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against their claims with this court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS NOT SO FILED WILL BE FOREVER BARRED. NOTWITHSTANDING THE TIME PERIOD SET FORTH ABOVE, ANY CLAIM FILED TWO (2) YEARS OR MORE AFTER THE DECEBARRED. of this notice is July 20, 2018. Personal Representative: JAMES DeMARK 1594 Common Way Rd. Apt. 102 Orlando, FL 32814-6408 Attorney for Personal Representative: EVELYN W. CLONINGER Florida Bar No.: 210382 CLONINGER AND FILES, P.A. 1519 W. Broadway Oviedo, Florida 32765 Telephone: (407) 365-5696 Facsimile: (407) 365-8919 Email: Secondary email: Publish: The Apopka Chief July 20 and 27, 2018 160917 TRL TOWING 605 FERGUSON DR., ORLANDO, FL 32805 407-207-4790 FAX 407-578-3052 NOTICE OF PUBLIC SALE: TRL TOWING gives Notice of Foreclosure of Lien and intent to sell these vehicles on AUGUST 05, 2018 at 8:00 am at 605 Ferguson Dr Orlando, FL 32805, pursuant to subsection 713.78 of the Florida Statutes. TRL TOWING reserves the right to accept or reject any and/or all bids. 2010 KIA KNADH4A37A6634914 1996 YAMA JYA3ALE08TA049137 1998 LEXS JT8BF28G8W5023301 1998 OLDS 1G3HN52K2W4864954 July 20, 2018 160918 TRL TOWING 605 FERGUSON DR., ORLANDO, FL 32805 407-207-4790 FAX 407-578-3052 NOTICE OF PUBLIC SALE: TRL TOWING gives Notice of Foreclosure of Lien and intent to sell these vehicles on AUGUST 07, 2018 at 8:00 am at 605 Ferguson Dr Orlando, FL 32805, pursuant to subsection 713.78 of the Florida Statutes. TRL TOWING reserves the right to accept or reject any and/or all bids. 2004 TOYT JTDKB20U540094321 2000 MAZD JM1BJ2228Y0222023 July 20, 2018 160919 TRL TOWING 605 FERGUSON DR., ORLANDO, FL 32805 407-207-4790 FAX 407-578-3052 NOTICE OF PUBLIC SALE: TRL TOWING gives Notice of Foreclosure of Lien and intent to sell these vehicles on AUGUST 08, 2018 at 8:00 am at 605 Ferguson Dr Orlando, FL 32805, pursuant to subsection 713.78 of the Florida Statutes. TRL TOWING reserves the right to accept or reject any and/or all bids. 2003 CADI 1G6DM57N530130660 2010 HYUN 5NMSGDAB8AH346312 1999 HOND 2HGEJ6614XH538276 July 20, 2018 160920 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under 345 West Fairbanks LLC located at 1615 California Street, Suite 707, in the County of Orange in the City of Denver Colorado 80202, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orange County, Florida, this 19th day of July, 2018. 345 West Fairbanks LLC and Panayes Dikeou Publish: The Apopka Chief July 20, 2018 160921 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Family First Firm located at 1212 Mount Vernon St, in the County of Orange in the City of Orlando Florida 32803, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orlando, Florida, this 12th day of July, 2018. Hoatson Law Firm Publish: The Apopka Chief July 20, 2018 160856 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Pinch A Penny located at 8983 West Colonial Drive, in the County of Orange in the City of Ocoee Florida 34761, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Ocoee, Florida, this 12th day of July, 2018. One Pear Enterprise, LLC Publish: The Apopka Chief July 20, 2018 160857 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Marble Slab Creamery located at 415 N Alafaya Trail, in the County of Orange in the City of Orlando Florida 32828, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orlando, Florida, this 16th day of July, 2018. Eak Onkar, Inc. Publish: The Apopka Chief July 20, 2018 160886 NOTICE OF PUBLIC SALE ON AUGUST 16, 2018 AT OHN7777 NARCOOSSEE ROAD ORLANDO, FL 32822, TELEPHONE 407-293-2540, THE FOLLOWING VEHICLE (S) WILL BE SOLD FOR CASH. SOME OF THE VEHICLES POSTED MAY HAVE ALREADY BEEN RELEASED AND NOT ELIGIBLE FOR SALVAGE SALE. 2015 NISSAN VIN# 3N1AB7AP2FY240624 2007 VESPA VIN# ZAPC386B875006619 2004 TOYOTA VIN# JTEBT14R740030497 2013 KAWASAKI VIN# JKAEX8A1XDDA10862 Terms of the sale are cash. No checks will be accepted. Seller reserves the right to No refunds will be made. Vehicle(s)/ vessel(s) are sold as is, where is, with no guarantees, either expressed or implied. July 20, 2018 160894 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Sync Insurance and Financial Services located at 2233 Lee Road, #209A, in the County of Orange in the City of Winter Park Florida 32789, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Winter Park, Florida, this 14th day of May, 2018. Thompson Insurance and Financial Services LLC and Cal Thompson Publish: The Apopka Chief July 20, 2018 160883 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under C2S2 located at 2603 Cheval St #106, in the County of Orange in the City of Orlando Florida 32828, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orlando, Florida, this 21st day of June, 2018. Shea William Coghlan-Peppard Publish: The Apopka Chief July 20, 2018 160869 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Bouko Spring Home Care located at 528 Jasmine Bloom Dr., in the County of Orange in the City of Apopka Florida 32712, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Apopka, Florida, this 13 day of July, 2018. Jumanie Robert Publish: The Apopka Chief July 20, 2018 160867 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under The Paper Bar Co. located at 1038 Jib Drive, 105, in the County of Orange in the City of Orlando Florida 32825, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orlando, Florida, this 18th day of July, 2018. The Paper Bar Co. By LS, LLC Publish: The Apopka Chief July 20, 2018 160906 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under Your Mileage May Vary located at 3026 Crested Circle, in the County of Orange in the City of Orlando Florida 32837, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Orlando, Florida, this 15th day of July, 2018. Joseph Hegedus Publish: The Apopka Chief July 20, 2018 160880 POWER TOWING SERVICES, INC. 440 METCALF AVE ORLANDO, FL 32811 TEL: 407-948-2338 TEL: 407-948-2283 FAX: 407-948-9498 NOTICE OF SALE OF MOTOR VEHICLE PURSUANT TO F.S. 713.78 (5) There will be a sale of the following vehicles located at 440 Metcalf Ave, Orlando, FL 32811 DATE OF SALE: AUGUST 3rd, 2018 at 9:00 AM 2008 CHEVY MALIBU BLACK 4D VIN# 1G1ZG57B084287845 Tow company reserves the right to withdraw said vehicles from auction. For more info, or inquiries, call 407-948-2338 July 20, 2018 160890 NOTICE UNDER FICTITIOUS NAME LAW PURSUANT TO SECTION 865.09, FLORIDA STATUTES NOTICE IS HEREBY GIVEN that the undersigned, desiring to engage in business under R&T Concepts located at 410 Setter Trail, in the County of Orange in the City of Winter Park Florida 32789, intends to register the above said name with the Division of Corporations of the Florida Department of State, Tallahassee, Florida. Dated at Winter Park, Florida, this 14th day of July, 2018. Robert Temple Publish: The Apopka Chief July 20, 2018 160879 PUBLIC NOTICESThe Apopka Chief LEGALS CAN BE FOUND ON PAGES2D-8Dview online theapopkachief.com 340 FAIRLANE AVENUE ORLANDO, FL 32809 TEL: (407)-851-3953 NOTICE OF PUBLIC SALE PURSUANT TO FLORIDA STATUTE-713.78-THE FOLLOWING VEHICLES WILL BE SOLD AT AUCTION ON AUGUST 12, 2018 AT 8:00 AM AT 340 FAIRLANE AVE. ORLANDO, FLORIDA, 32809. VEHICLES WILL BE SOLD AS IS FOR CASH OR YEAR MAKE VEHICLE ID. NUMBER 05 TOYOTA JTDBR32E152054363 03 ACURA 19UUA56693A089008 03 FORD 1FTRX17W23NB15340 99 TOYOTA 4T3ZF13C1XU101037 98 HONDA 2HGEJ6679WH555772 July 20, 2018 160891 NOTICE OF PUBLIC SALE On AUGUST 20, 2018 at 7AM at Towtruck Co., at 639 W. Robinson St. Orlando Fl 32801, telephone 407-999-4939, the following vehicle(s) will be sold for cash. Some of the vehicle(s) posted may have already been released and not eligible for salvage sale. 2002 HYUNDAI KMHWF25SX2A647366 Terms of the sale are cash. No checks will be accepted. Seller be made. Vehicle(s) and/or vessel(s) are sold as is, where is, with no guarantees, either expressed or implied. July 20, 2018 160893 NOTICE OF PUBLIC SALE gives Notice of Foreclosure of Lien and intent to sell these vehicles on AUGUST 03, 2018, 10:00 am at 6366 ALL AMERICAN BLVD ORLANDO, FL 32810, pursuant TIVE reserves the right to accept or reject any and/or all bids. 1GCCS19W4Y8254540 2000 CHEVROLET L9NTELKE6G1200363 2015 TAOI July 20, 2018 160912 NOTICE OF SALE MOTOR VEHICLE PURSUANT TO F. S. 715.109(5) (6) You are hereby informed the following described vehicle(s) will be sold in Public Auction for cash to the highest bidder. 2010 CHEV VIN: 2CNALDEW7A6271612. Vehicle sale and location: 2000 COUNTYLINE CT. OAKLAND, FL on July 30, 2018 at 10:00 a.m. July 13 and 20, 2018 160847 6x6.5 Get important news when it happens News that can affect you and your family New or Renewal(Orange County) $30 Out of County Name_____________________________________________________________ Address_______________________________________City__________________ State_______ Zip________________Phone Number_______________________ Amt. Enclosed_______________ Clip this coupon and bring it in or mail it to: The Apopka Chief CARDS Get Your E-edition Now! The Apopka Chief Get Your E-edition Now! Special rate! Phone: 407-886-2777 Call or Visit www.TheApopkaChief.com