Citation
Diario de la Marina

Material Information

Title:
Diario de la Marina
Donor:
Digitization provided by the Center for Research Libraries
Publication Date:

Subjects

Genre:
newspaper ( sobekcm )

Notes

Funding:
Digitization provided by the Center for Research Libraries and NewsBank, Inc.

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
This item is presumed to be in the public domain. The University of Florida George A. Smathers Libraries respect the intellectual property rights of others and do not claim any copyright interest in this item. Users of this work have responsibility for determining copyright status prior to reusing, publishing or reproducing this item for purposes other than what is allowed by fair use or other copyright exemptions. Any reuse of this item in excess of fair use or other copyright exemptions may require permission of the copyright holder. The Smathers Libraries would like to learn more about this item and invite individuals or organizations to contact Digital Services (UFDC@uflib.ufl.edu) with any additional information they can provide.

Full Text
.ta.-S Jl 1.ka, 2es. Itrere 172.
I RI M4 IMj'
DIAlRI DE LA MARINA
..me**pto a ao Corr e e zn.ieno de msltancts oaeme on n la OlIoia cle C orxacm ce lets ~ mae in
DJU.RaCCOclo F AD)Mu~IZBRJcI
l L"'roo oo i.e Bam-oriLo~lo~ n o 6s
.ZULUETA ESQUINA A NEPTUNO I It. 1L---.. I' t.I ..I...,.,,...
iz~~ma zSIMIed.I **--*.*~ tm 8i CO **-- **"4 18111.'.' -- v a
-- rn .r s. ......r..m...Ipr- w... M .......$*** US... 4. 14 a I .... 1
3Z 4& 2s.,&.. TV&n*7ki
deIerana d quo oma".. 1 prso. oin Mercantil. u 5 e *
-o- et-t ot ud rd r a "-.RM t UD D Vin)tld. 0m.
dente altoseell para apoar le lnte. Bs Perar*burge, Jul St 2.-BI ga ee delEmprthe do 2 a. B ee M At"en tral O roes del Celetelmperlo. C.ar ha .ermano edo dr.at oe .. *.......1 *
Dc d eba y e el prilo "o de Pu'et'e"""h"t a . I"Os"iy .". .SO 1doe. .. ....UR s.
MMadrd01.hN y e nlegal d E mor, u n tqua f r oel 1 n el e. 1 A r14 "La eILs"n eo ldt d it
D.Dnoch. DiTRALIAJADORMi le rdoenaltamar. eldnhaeorrldlo.. de g ote&t akadl o" m 1 4
Bi- wlf o ~des I t 11. Avll. ... .... b. 8 ....
S T6mle del Canaltde PanamA pe4thA peradorde Alemtnanla. per he o a IfslAtuAdo hey care &Id Sd.M ( o). d I td4 IlasTA K&oI4iOisas ialon mel*q ataga proposiol TNTATIAD A a WYork, I oeaprndeAres, poai n I. 1r d .d A 100%
lIlsIlelad. Yale4tai do s bare nos MooparlIlm, portaoldn 4aio I,. DGA A, ipa. uitnta 118 Y er I 'l. . C do ..... do.... -- S Ca _n.. c ..o... I
die guerseaslo~ameriea no e on* ltanmes,300chinos Was J0apo* Sa Jufe 9 **D onst.q ntin o t 2.8 n a eentiffrus as* s 5 .. I. -* mm so ti. ~ ~ ... 12)4 I O kl a lmln do MI O
dom los eablem astrondmos que1 o snne 'qe prbyoeta dd rh a s an elt ela que h habl- v t al q uo .0n 1t ed I ilnee al M0. .
ilapavineiadollurgoks ban do1,tU. obrandodleh~ anal,A fl oeereo do o y un tenat l ea o En eta plaa nque e nt algn O pooi .asa s U aadererearde dlaer eleollpsdeo sol. rarus de 4uAlesson los quedan meJo- eontra oel sultln de' 'urquia. deoeo de ipmpir nlnguns venta se o .0. N. ...
VIITA DE NA 8 ADt resresulado. y eI dbl Co ste yes tesv llderess. 14seIdeh. Samuel".N
YJIRI DR TINA BCUADII& tes rsu|ades. Notitha, a (Id.er do )a 0 do G.1 e hop 4. l. 0Cu0 hr.. l v0 go PO t tXlO*5 .ts&"fnt
aLINL A INVITAOION 14 BRIHORAZADAS m- asnSio .o n el meredo aeon do. d utroF.rru ao Glx+a. simnae, ecb.ra mot.roo
Isa ileglado a VlIaLare ina dlvi-. el, Ete dde Waeaon, Ju. Areas 1ork, J'tle 1* ma a .. ,I ny b ta mtl o. a1.1. ....... l Ob eA. S B.
iIn deld esenadraA Ingless del At-l* Ie1 -IM-I bAr6 omorejefo do Io Mnde Cubs, 6 pprelento 11.0l. 0 ns e s oper tras Ms a breEpea- a364a se o. dp dCub d "o 1.letres 4 16 o l mnosroglitradlsdalt" sRi~d)'Uoi III quo D ban Isoltdo vairseido. 11.0 ..s4111 Ia so.cuond4lq0Feas..
14utlocoupusesta dq tree bnques plenipoteelaloso del Japn 6t. que t moris ta dI ds ne aW Asai eetdovrisls. 10? .s d & a U VAL .fa u .ta.. N dos, 4 pot eel,ex~ t1 e6+, 9l. U u~m~ o A ;.L Is"~~o Wol 6&,164l do~te IsW rto.-,6 N JN CONTRA DM1 REY 6 a al ayer, gaild por Is tarde del d em es e $1.78. toanm, oos amrte aueroo Ok rto a So 108 as
Bin prevla salerisselds legal hbi mlmodims, atedsemltiva,para Desous pipel oimtal, d l., I..A K ......la ua m
ilrmulado Per Mdrid unas hqJ Im- Wshngtel, sin hab4r querdo seep- 4 &4.11 per 100. t ond 4v 19 .318 20.1f4 3ea s IN 0 aled9m iad ast5-el preulo rmadsper odou Joaquin Costa ar nikunAe ade 1 tteoen que se o moobre Londre,h0 div ban. eod4r. o 19. i 0diebn 1.314 oeine d o o stem.. .. .1 1 ae4. ......
parts. X dov 1 1.~ C.." ea $ ~ iloe Wl MWO L'5b5a"! Y N&ad eu Ia quoe s dlrtgen ataques person* Is blae, oleujeio I de nalsoxeuSl- quero A $Lo8.70t P a .i.1 4a.4 e a voo..6. B...e i. J 130
l" al Rey, a s on 19 inde lag's, Alefaide 4lmit soren Loadres 4 Ia vi", 9. a 1.*4 9.348 om 4ss 1.3 3 oer Hb a14n 14 J A
0.am deeollvo hlnohlo dete do Pa lrips d o g quo tenSt ord In 4.1fd". dir I I s M V A POR. R ....
aCtunos rep bl f n. om "ito fl,. tle-t imloante dl.Mikcdo do do d~msso- C*Mbis. ,obf PArfs, 00 d. It. 1. 1T A a lg u n o o Aep s, 6 shPr so m 1 4 1 8 olm eklo. 2 1 9 .1 14 Id .r 1 4 i t s,+m a iK t 2 0 UTIA16,~~ l~lele Ida pr meie n A64"atus 1eul fiorwdar .. .. ,, tn pue.les eit libertad per oerlen deol rnse uvIJa der sobre I 7, 0 div. 6Sn. l1a.p re ll Ji 4 s ISanal, 3 Mse RAN
Juevque entfende ep ltaesa EXPI)ION CN UN UASONBRO quesO6 A 960.ta MJIdousoaslenterru.-leoen hofY Compasi Cubana do AJ ohe0 Int,rgs oloo dd I do do.~ Is ...... ... 34 4 b, N.w-Y, '
Clltrfiag-oge plmaa,4 els. t 9.8 4 1D g doI& sti s o 2 T0
CAnUDIO a Boni l e a is, qgrn tla,.@s t otIu / ro.ie, po). 494, 001 / 9 sj 9.84 s aS ,8 l Jo4 4i ,V2re y Prog.res.
339erural illuro.h4 404 940 onit I4 Redotsr 4o~ ISO..
Hoy. se ban eootism o enla Bols I t --AH heehad boy ess6a An e6 te y lete, 2.15 ct. Plt a atms ............. *... )eva trisA de oleo ..31 80 SA*JRA4
lbr esl llna 4. puerte a e dera el eSonero de les MAst0ado, et pil 8.38 e. lta i 79.718 a 80 Iemmiar d Obasu.oe a L o bA 65R a tees. 1aIdes 1lenfEston, y de l. AZdeard. mlel, ou plass,3.1l th Yi.r Adonot--lil han etertu-ado asbna. Jutio it d io -m.mtlo Alrones. Julio U Montety vewYrk.
y~ do to$ Aslfidi noonjlmmm e l t e t se llltshn t l ...A.* 2-4 ----=+--- Orlabi, Fir a 7P y VeradruL+
EfS I S 278 bonibres qile teutitAm basttle, MAnlemolloet#en terstersaqS7.3 be P' 8ll.masl~m*seto. Judo e~sa3raes y TVeou.
ESTADO U ham peresdO. pot Sob"o; .e:o ]irlns, ptent.e Minnots, A $.00. I0 ons CoMp. d. 'Ga y lectrcldad, COTIZACION OPICIAL P.RI oe..lv .mifo.
A 10%. ig A,25 Esruluor, N~w-0r3.aso.
~- de los demals estAn heridos 4 han t- Londres, Julo 1. 8 son. P. Cl'Ardoenms y JdoaroA126 DL Ecto eOrlen
0erviclo do I la PrensaAeodoa fride quhbadurasmA* 6 ienosgra* Ailear contrItuga, pol. 99, A M. 81. SN id. Id. eboolit, A la. i BDLSA PRIVADA PUERTO DE LA HABANA
- es y un Wrn ndmero de ellos teron Ma ado, 10. 614.
gun373An~ea doromlaisa(doIapitol m4om nnnn ILWrM DAL. BANCO IFAlOL dot[a Idis DUQUB8 DE TRlAVESIA,
LA } T 131 TINA ezxtraloi lest agaut. A doude les habli Asdir de re lhn (de I' patd f a as S ASM valu. EUQ N BB TAVE.IA iaso laso fuerr.A do las explosl6n Ch. O dent4f r n3O dai th. Id UIPJU U Lu zTJ s c aet s retoO a o l r OrN R LDOS 098for BYV, Juli2*- Nor ha B1do li feaouereosoet Inellnandeo 0nsolldades d.InterAs.,,oT. VUeol qOeft. oaOrom rOSil 30944 A 104 Do bnly .a rnt"ret apsal Presidents oosevelta pldamentsobts nabanday es o Deuefntosne InglAtlrra, 2.112 pot co O- 01 CIAL vresab e owraeeeiopet. 3 Metz.l to r a.oe 1& Dotes fit IA qt tl 1fblerno 44 tibias biause qa ore ua ban& asue p olento. eLsio AM 11103 ICHOQO POILIOOS coo corga S leilbit ndlta8034 motes pple eval al gnblerne d6 (btlan bable que si ways it pique. .Oro os roaticos con ourpse A oolb tnameh
Inat sta t las pot anelas neutAale l, C patro po t o espailol, es o up6n, .ter (m a a Vtr lolde p.i. d.eD 28
AU00 9o0o00eerd, Wida Aeuordo LL1UADA D9 MR DR WITE 9 "Rd 14.... "mpohUto 8. 3. illpb11. ---a d Di .
quo tonlo leo pInlpotenclarlost uss Paris, uleo 21.-Ia lilegado aqul .P Alo LIf 6 8 P,58 F aphs............... g..... 18 (lalve.ton, ?p. IO4ua.
1Jaonesm Fatm ess, boy, $Jr. de Witte, Jefe delos pleu. Ilo3 franceas, -o t e- r A neas, l p. . 1 Mobila vp. b Mo I.
ete5 t sm"" oe. potenclarloo r-oss y fud reelbldo -en 3b l on Iposearla. 1
4 d40 4sUcoa. es e one Im estaidn del terrocarllporulgr" '.. -. 411it Buq es con regiso abira ea Po
'j W~ sd 10 si V 4.
i Ull pr.oba t s, odnesd ru q..r. tanceses 7 J20 p D~, I....... 11 al. .Dew, B W.)rpor no goEg per
A ~ ~ ~ ~~~~ 11-1.11 sy lie ssde valsple.Dee s s 'ms1Nacrsorkv sms. ] prZbe
, ADOSUNIDOS cIA ut ,n "s aon La. s. re. vi l d tI i.s lao .) in. -ts. pori
1'O'So~ G~amzpaios&a.~r .Lmntfr0a Jp4,j.E do~ad 190y. I& It**~ Us Boo11Ci.dlav 4 opo 11$13 D2Ig.t.tof.po
o 4 s stad i iAUnD i h e b b eUs ear T ade "rad a t An S 6* P I sk aIt a., eats p 0 l A1 a e & l V.. Ie 7wu.es soi. 'Idl) bates suca Gloolars,
j;,j sooIIr M i r e sF(u' do 90draws, ro~altssall61 Ml tap.1111 OwI Ca~~t euv&Ykotk, vp. am. Noorparo or .1
, do C1hA ef quo vue la IMa. Mr. SalfoursJetoedelgablute y cele*. Temperatures satmr 9W7* F. Ass" aaritN erpe poa BMnI6 Com a as Cuban Nueva o, k, o p. am. MXontvmy .pr aidey hps A se eoloeadab LNaJo so abslolutl br4aronm 1 usalarga gonfereaelOJ. lI 0 a. M d lel e rt 4a. I. . ea ....... 3t4 p. e. obl r Ple6
id.40401aloIp 1is 654WM .mMid....3In 77 ....-. N 40111, cp. eb. Mobile, POf IA& V. PIotOA
HA DISPUESTO DE LA SUMA DE
Llsmamooseivlds del tener e~ltlgntomskede~
pliazdo lit I labon, espe. iliibto en dead; y ow"e
0alamt~to do, las .efigmis ore. nufntin osrti. es too ritenso y
aey y:I:uu gust, so. CIEN M IL PESOS (100.000 )
f. e l4UI J RiII 0 uo 11"' 1 4 W A ". k.
UD &ift' l DEA uqp qu 3 uP 5 E pP)=0ra ESeg-L s EXTRAORDINARIOS, A LOS FUM AD0)ES DE ESTOS 'CIGARROS.
IDEARTICUT.441DEFAR .4 r
do'lr.:'t I -lit, ** t MSpre el** qUe b aem~is de lst upbnes, do UNO a CINCO MIL, que inclulmos'en todal cmietillas, los funmiidor
yil oremat 7 bonce*
.omad t:s,,oa, 1 Iar.ee;i"ge c go in VALES para regalos extraordinarios, quo serin entegadeoc al portador, I a preentacin
En eu0h a rx saft hr pared. Io eilouterdo prhivmes. t Is 4
s-- ,-. -.o i. e d do dchia VALES, en GALIANO 100, Habana. C
reputedosartisto% grals dos y oleo .
gettn a1e Itadas. NOTA. )henoloIonee A todo0 los
Ho los ior4 we ..pWoodasa dq.Cu.a..avana' Commorota o.
SUAREZ & Coa.-O'RJtelliy 50 y '46.
emp-gy g gy e II~ilass) rlt ui rt[ f A ae mejor reconottuente conoeldo hatt1 i dla.-Presnlado elas Esp Iloneede gn u s le
hurupa y Amirts A que ctourrid.-Una cocharada allmeuta wlue o EPS F9 N
T E R O Y A L I 3 'C A A D A ML A -Uu coo lmwa oal de 3 -eo C aiL iLC o qu Ituw 0 y R M .
T 0 R, 1w1)8A Cr6dito VitaliCi.o Cuba 0
Mia sl d.esba d..pre aeudaaKade SO(IfIBDAID MUT PUAD)E P.tOT.ICC IONYAIHIOS e O iVIDA)S E
*,t-: :t*:.e:*-:::: --dd-a.dJ. . +..go or.,i...i, d I..,...o Si V. compra CORSE MISTERI0, habr emplea4CoRRAZA&4X$ IA 4RL& votxVloosoal.
c-Alp Ept- LA iL' D oeu aA y tale vauali ouare baJomien l e a.t. su ^
A-1a, obrape ii J. tiW.AN y O. A. OtWST. renes. 1 yn4oa s e r do bien sN ier. Neptuno 8o.
AJssdede IQUA R TR. N reta suo en oe prlm.oeoa L 1o vldI, unosrtoUdo el Uldl del M r LeDOuULA..
he nt(+a do (ubsa IIIIMIJStO8I yW. 14. COOI gMt I. iu itwrKo VITAUAOIO Dii Cl.bV a"un-+mm l U Impr 100 de liono. a..el rSgo 5.VLOOA
Iteparteb e9 per 100 de los 11necto s nrn a de latnS easre Obilne* D- m sr.o6 4 1.1,
. rio dejeo isted de war a mg- a .i f .ees n. m ep 1nrent tssa.llgoe s, Au UI wIqal,rue"laa llr qina do eeoribir dea do re **O Wee~tnsew oena ee em er p cona
-C.AN FABRIA INPECIAL DE BRAGUERO8
SUSTRAS ESPECIALIADES 4. I'.A. *141,0, UISP,1
?1ou d.IO 4. nal ar NW-Y 40.'0 Zotw=sWgaW 4. '4,0enIse Aailltig A Aaard.-Prola o01 Ien I Io.(b arlst,4l y an lA lm.-FtIparoste
'C'"~s j* asa I"' *W- 80 0 0. 4. do ess bloodas ""4 reemes4I O Per 1& 00111"a 4od~e~ 1 1161Aa. cuse,
* an UOtiia.'.ftoe Cita do COM? IAVENTA DE I IUtENIAAN I1'ARI
Celu 1e lll d Agolaldo Ito p0oesd.llA 1 1ol ae~ oc 00j!d Ito v ,omeveC iJD e Vi nlJg,"mt
IIP41MIR.
. Y .ao. -~,,--, .-a M" Dr.l~jJ M .
A s l es us N. a a w~daoo eitjano do Imo eadba-!
on edascoasi do d 4 epp 1110 M 1 4 MO 0 F
ZFVor I4 dEWn y Cuba ro paeen ea r.
E nejor ralsatd erknq We she-laEer plcer .-onnwn p.--eo.mm.tar.
''aolen tubrct lOalmll dloo'R W8
VEINTE ANO8 se ,impaWt es el de ""/ .Caa//, J --., pXd. "tury.,oa
rebeldes, roumatisimo, stfihlis,
5 ptm m lupos, oAneer, sam, parAiliais
1rseos i ang s m ON"f" F otw Lifermededes -le la piel, on
Dt =efetor: Dr. P.J. VA LDf.tRse T ~mGAe 1200. deride d, qtu na v hesa s. ".'1" r cho ear o 4curaci64t, so.
........ w.-* ,*.e- .** h *** ar ts .sie
9+~ ,, eu..mean o, MA ,7S4 Ombinet. Elotro-M6dioo American
sumeammemme..m- liatba S.COalll/A GRATIs, TUJDS IMS DLAU, D)32 AtI .. MM RI6O* Y Di25 WPMTIVOil DW 1O A l.
em toda labaa y per Isa de Cuba 1os incmparab yeebres
.......: O LT D MATIAS LOPE




IIA.IU'

0 A llniO D E 1 .1)1010.N \ "o',,w '.U .f 2 '" rov on o do tilot"nodo I dad. m .e dAS
D,,edO y debe o iropirarse 0 iwel r d, Cuoo setiA El dien q l.gmu* A lIr r- I.? i adomeflde
Iem de Mr. Cleveld quiem en u manoa do ear ana soeelenven d Al-leleo eA -l-a
S volvi A Peee mndo Jer6 men Predete de le a voluntadel o Mn y pro- colde on eq ni at ern- me"ls extno e aerhf
imne Pturot prn con rarse Unldoeo puo e 4 to o ep vecho pie oe e d on a pren el e o retario sme ee der dis unei e
ie9ag imnte A bear l]a m r de de preectoe de ly coneedil dios, in r ar on ourome; sit del Dt1ech R sol6, ganan ee e .letir m iaes t. do sqmo
leo Repblicas, ddamo m much pensicaeet A laUtiliadoe on em. atoo los d ey. te y mpp. 1 Othe 1 que pso r deja p
qe el eos ten lo queo e problems tiese y agentee i no los da, el 6Sl t e o- eelo 1- or0nti l pe- 44 -eti teaierr s t
reconfortele ofre s lade u aer sectors ectve, A otra nay lo justifica todo. Es ia po- ra sleausr el or, eI r6 men 1contentendo est eepirrafte
n e o f t q u fe o n l a u m e r s g ot m e s i m a g i e d o a l a@ g e I l l e d e o n m 6 v i l e g q u e fl s y d o o o p e t n y le s hem
C inetan qu perigu6 t e do s a s de nee06a. E loo CAars do lee prm9vechoj.t duales. go po s r ru lvinddes ad
ou ditimes afis do so v6 a n I so spndiente sin e ph4m, Ieae per sweurs represeoses6. mbria lodide soar on n optimism. no eeegials ara la n o n E pl ha preenoldo htas d a v a, po qe 'no sin pr. steMto, r umoe* 60e a o -L u ema, e
nio, om e lo Yfl m wm, I v q u i er ye" do in ter k s h o ts e e o e lo, n o on tat-v s el p ri, y en od e oV &e s wge ur i h e-; tm l S5 e be ., 7atomm laft ts, p e ree e a
a ueblo ndo A I vid provincial 6 loal, ino ezoluel- dirneia, epeo sln alarms. Fel dt yn, oyan qtodo oeos "m so e re m*e.* A nowte redo lee naeione sin.de des y con Atento A trabejary A producer y tiempo par esenue hmatre t te, aeen fe ase t" d asle de e to
obrantee n su Teooreoro, sin noe. .a reforma aranedariaa, d con la preecupa A oidiva d mnto oportu o; pero om el empe eem 'e que 6o mr6 per obto e derro.
IRIPRIO pOW omo .1 ~ ~eob que It 354011& de fai OmaJLml hadad de mfantener an ej6rcito ni I isalaci6 i ivil de roeodi- reedifloar or bre amrulna del a*n novriqteo ame a e er as a u el teoro pler do ere, a do
una marina military, sin la proba. m entoo, la del Pod erJnd leial, la sado, no ha vellad6 on pagr aelerado, puede gr un mo- es u do dinguo de lo des pdles verbl ee o bilidtd,' ni aun Ia posibdlidad, adaptaoi6n del regimen niomunici- mAs de 10o quo me eetaba en pel eo ued funer de lv d 9" Invert r .e sbran d ie Tems o
de eonfliloe exterior; sin toner pI A la ConUtituol6n del Estado, dereoho de e grle, V e ha deo- moento ean que Is ouerm sa d eo )a rtu pareee oalqda m ts lo prere d am 6ge -tur aldad sb superior A ]a do lom posr- faro oot ea m, ehon a 4101 .1 lpereem l iuprocedeproblems alguno-sooial econ6- el problems do la Instruocl6n pd- sentendido de la la r do sue medlos 'dreeisteneial, y intones teeds y de osIdodo, as tl t edv de oon 1t aeeimroeden mioo 6 politico-insoluble, 6 s- blica, que es muy grave, porque legisladorem, admintstudore y nosearfaesta tilerr, domootra tieseada mesqaee sde n dele s persoquiers grave; rico por Is natural. so "estA gastando mucho on ense- gobernante., no exitgiondo o del Continenes, por el trance de Dqads, Sieosy primes del empee a be neeaA&o r" odles peo Loemaleotpeogqa jtr46ndand muehobn omoendo em er
lo]am y privilegiado por la siusa.- fSansa eon reaultado eami negati- ello, A cainblo de s, ibtenci6n, lee rvolnione peridians, pre o ermtoms peeote quo p"l6 l it1s eeh1eetmedo se e ol6n geo rIfloaes; con hAbitos de vo y on todo oso demptoporcio- mAs quo el mantenlmlento del habria qu deir adl6m par a oee n ao to u bl yietes t lee anded moho peo, yutrabajoy eobionestar, era el am- nadoes aI eefuorso; eeso yotros orden pdblico. Poro emple a siom pre la Repd blio. m o lee que Tototr, o o dueodl d o S uaelpo naturalmente abonado problomaa md, tedes urgentee, darse cuents de qua per el cami- p qs ra, A I enbaee oiosein ber q sa e pro-A
eetablecer el goblerio ideal, l so poponen, so difleren, so son- no qua se si a on lo econ6mloo "gG to gterra, dod sem W que m no healtso. a
mejor, el dnico: a Reptiblio mo- oluye porolvldarloe; pero en cam- se llogs en erechura y rApida- LO I. "LO meeIo, soe d1et s. veniA, pee Tat e A o6 eW e proede. r as heqebad
0 asoBe deetta "A vmn; por Oft esot preilet es bqeo'do
dole. blo ee entra eaco en la Aros monte at d6floit, y do quo por el reljo piano elalatiom0 yf0io quedi elfter i ,rd, el emopeoader dJar ontsdo na prijploquestabye
Era... porque so trata ya de Pdblioes; no,se.promulA una ley omaino qu sae sigue en lo pol- CmomG1 30pdSaO o Sbes,pee, e ortdnto lud rIviltglo qpe Joe autore
historia antigua, casi de piehlito. quo no represented an aumente do tico se 1 eg, tambin esP deo* .anao The pedAte, no o e e A pr l ora n* urbitriodoee an parria, A pear de quedeed entences gatos 6 una resta pars el dinero ehura y rApidame'nte, al desosie. j0oyerlas. Unicos imporrtalores cr-ee s P ; "ponu--ce-Wtte to del prueupn o A benefelo de lo so. Ala fechanohantranseurridombe dopositado on Tesorerfa yse vota gode lIo espiritu, quo anunola Cuervo y Sobrinos. ter peanos pdr y sa Irmalq, Cetm qu cas, lvtyemntee rapry.
__ree__e___________._____qu etauqu.eeesaosmmetoao ,sym
que tree aflos. La major do lae el enearecimiento, primeoO del siempro el temor de la perturba- --el tutdeo": ef l emando, ya per rttae ejrdo els
Repdblicas no so ha transforma- e af, despus diel almid6n. y do la ci6n del ordon.. I" WIns agrea : 'q esperanpas do ans ya pori e p eeste*e do Ibas mue
db en a p2or, porque A todo hay ly por diltimo,.en ara Queremos creer quo" el mAN regImleato entea do emlA paln I& efeto e itanrti o o oe be.
quien gone. y ademis, porque o do preentantee, del afrro. He- grave de eos peligro so todavia 1de4Ja tb4o no seableyn". Por deoodes doe Unlde 6A y Pedro de IRoma,
han faltado mimbree y tempo; mos dioerpor ditilno, ydebl6ra- remoto y us per el momento ee- 81 teudrini rea6n los lagleee aI li- voque I4dame m open quest is dade lea nta may Mellonme"lr la pero de trope6n on tropez6n, de mos docir, on opera do qua A al- tA garantida la peaipdbli; pero mar aI emperador Nicol elfater is. agitialbe no se gmrava on Bous, at per asolole6n de 8. 8. el Papa, per loe eirrftt Auttayet se lam tolegraffi quea I rOliol6i 110 me 16 0414o66 hl go- poesdee mortales quo repetides ross
error on error y de fait& on falta, gdn senador 6 reprosentaate slo nuoestro optimismo no em tan ale- es Anteo yer Wa peo tle lorafl-6 queoa isr pla6, ay o ibabinpetee do abrno otalet quo n est doe Vaeeva evoluoionando al. rev4s y pre.o- oqurra, 6 se o ugiera, alguna go qua no oculte quea los medlos clabtobjad l Wil pnepoen erno a u ea prbld do pblo 1rom co ta rentne erit parindoe A dar el sallo atrAs, otra nielda igualmente benefl quo e on peno n uo, en Jie; T, an eM ea lap a- o e eta tq6 doe pe.t gtr4 qu e ro nlaeo rest troe
one or eaoarI g que ee eatfin pomiendo en inego, at Jas y, o Bazeps y on loin ta BOW ese eane &qu6 meederi l- Pert- A Croe que is Verdederswot lIbMe
ata que Ilego A roerse efsa pham el pate, y principal- per unos y per otroe, para aegu-. doe Unldo I notleta pro uje been poeUtira d a Ao'6 dos, mAs do ma-. tomando an eagenta leoe proeedlatentos
chalquiera do as Rpdbilca= ite- mento pitra la laves modesta* rar el triun fo on lapr6xima oam* efeeto. "MI our-e die ea tedes Ise tans, es epantosay y, tleas tb-an- empleados porlei eeduee monopoll. ro-americanae del tipo rudimen- El aiiinto do las institueio- parla eleetorial orean recedentee espltale do ita grsde4 aselenea- 4e de lasgsedids podteo.se t saen- adores e is poltt(e y e tmealesres Iuer =8961144t" l d pllt d~ m~mm.- do deledereheke e la4dsos,mmq
tario; es decir, del tipo onvul nee eAt adentedomobre el sufa- funeetm para la eetab lidad de la q Ayer" neomous a ble an U d bk m 6.tSla d m qu muetede lu es or,
aVO. gio, ast oomo la normalidad oons- Repdblioa; porque en loepuebloe raservas, quo Nicola II y Witte ha- pastor ait Jap o goto u Nape fledeela learopor iazdemad d de is
La *Repdblice barata" ha titucional so bassa en Ia divisi6n donde existed el regimen repre. blan tanldo Unea largi y borraseoea on- le6a I; per.to podrlar otto coram- patti, trocado en aIn Repdbliea d pl d- de poderes ,en la diversidad do sentativo, )a conflanzas on el im- trevista. No so habian enteadido; at pliar t aitoel6na, obllgaondo A n ter. pilfarro. Su Congrseo no vote el funoionos; y Aloalde, Goberna- perio do la ley, en lavitl l amprador le baiba disgustado ua ce baUgeremt--y aI otrto, inr1ltai.
pesptifirludad quo tteqe *I frames fsa-. ble-- tomar patrtee aI eoniads'l No ado deapema t oo quo su.
pree1u1to pl |os gasto indis- dore, Secretario iom, Jror, oi d ]as doctri rane, n eI flr cia d "&elehad qu do gablar laro; y hosts- b pourdo ue p thoo Idr by on fren, dlc qu eon Yawano tan scrif.
nsa lee para lae atonciones do der Logislativo mismo, invadQzt la propaganda y on elr. omi- babl adeolaradoqu eeliaiart A Witte tas ddassereode 1o qaehs elo- ado trteneramonerpata derrocar la anidad, y una y otra ley rigen la juriedici6n ajens, provocan rio dedla opinn6a 11b ento ma- d ontre los pleapotenelario y daria tor tfateto, allt ha mzsomdJo an pta timUIscowsial nDed omI me heinconstituoionalmente; pero oon- conflicts de competencia cuya nifestala, son' v ly ie do so- 14 aturAJteAo alt baende Rosn. semana, aereado Ananeleron; y eta sho ean mp n, 44.vI rtudideaber cedo donativos A porrillo, sin quo soluel6n no demandan a1 &irbitro guridad indlsponsables para el o s no partlelps que Witte o" mejrla so stribuye, sen los deps qddo aiporqn usmo hasta h le h ( d 8 P nota~~~~~brade y que readrA A Portsmouth chose do boy, atped&ealId as~slea~oeiepru
hasta ahora a hayn atajado en legal, y todos, sin excepci6n, han manteniendo del orden y para ela n eom l r pr que t o h nee a es andsVoraiele do emter x A d sts7e t .a a lvlame et ~,pa
coodnaio ~ orlosnqu aui:odmadna &rir guridadr india tdq q uaeslt o aono u ao, er y. eagodo-,..l~mt~oS
ese camnino do perdici6n Poder hecho y asguen haoiondo Ap rio envolvimiento do Jy rids po trinufo padres lasmios de laIpa, no itu6i X.Y. uode .1rtedhsvamot. ase .,
PALUDIMO ... LEx1.1.4 - Miggol toio. Nognora, ray muchwastma, aweres.que Vr Va
aee LA IMA e g LAproximare o. vteedader towe I .,&ia
, ,ot *nf~tU ..,.t,,,..l -L
vt ro nt haanquedRewocarrk. eldltj4 e **
cLA Impotencia.-*Perdl- COLON a o lor Into= quo axpeameta n

das seminales.-Esterilidad.- Venbre.- Sfills v. Hernias 6 quebraduras.
Coeautdo d11 la desai.
, 49 IP ABAWA 40
c tas on .

===
:m..m.a- ooesq~. no use wska a. : USE LOJiTIMA
COLONIA SARRA
T aRECAC IlITAo0HZS SOROUEnifA SR1 *t.
6 HADAX&3 C &stes C
_ 0 -!!!r 0*6

ee ~m Opoca.
EL aIMOR VINO DIGBM VO mToavd la "Grantilleae"e norma.
vpa a, Itsana el6a *I extremedeoe a.
sar nolvida do nngua eapeeld.
atids"ioa*aDr Gran a rAbometlm te Worte te York, 0l
libro andmero 12 que trata d e Av deCandul. medades fement a
elm a a 4 c-1 oi mismssanaait Pian tsay
co muceamr dalratilia. Pdass.

y Flee*yersa. mdr$t
Yugs pa a ttatista Ver cm o ie4M allpl Tu~ba4M ctiara!.""'
BSaidam do Ia Hbaana pars X. Orltmmn
(de mueAUve laMseewnt
Baltdas de N. Orleans para a HLLabana VlaJ Tods In. BABADO. La LOw
V. rans i. (L.,a. puoo e.~ u De A a aew or.. ..ass y sem 1s
Eflit11b1 IN 28 DOMLB I
i1eateIsa4ta el aat d dpfa A I
del detl0 aesetaoerm ples. letoe Uld Imeat C t.pa 0 dedo' 1*. U. I" .baeaz 4dhpeclep IterA
W4bM=. 7Ag-Is.p.leodado-oo
5. adesIW. ea egoo*rdo tad. a Pcr& mu d l.'tforn.., rqdtSL.
r. M. Klambury
to"ya e.Wrs o,.
CLIM Wi or. V-

.LD -.

ANOT"Lst tmpal ~m atsoa ablt an a kesae d b th on MIRR* dCOMPAoIA fMsL.ab"j"o tc' p.4"eu- pu.f Btab"l J A d ual" sl"m.-O a6 ror Des 5i IU WsW rustodeal feotoque, soembrquen en a enLs*r. La a
seTaor.. ... rg resibe dreeak en I6 a. .-.4i LAp..
agasde hm*o
l 881ftdIuTMOA s s...p.i. r.... as.....a..asCompsts COIA IA HA.MBURGUESA AMERICANA
A cLIMue ecnzema"d lSt lLUETA 10 (bajos) asttr Amers_.__ A_ 4
PN-~ -Pr oro m ta in a a& op = ,"e SIM w-1ji
n~ ~ otAW~3. dhp..~ ,coad;=l. o1~ORG71J
*.d e =, Ao. Vi~4h.!b1~
Ied AUGUST WIH Md......"Mee. "' 13S1tESals.. t y ,inait.
reetsment pars VIesP eolda deosod hasxs las de li~Eldrlobe*20d UIO *0er4 p 0, o ea
racuz y Tampico ,*1 uer--s....u e....,-.* ..l .C*.AIL
Ide. JULIO dl S feA dmlve. mrdamite all l .A s 1 es4 a 6ASnusq 4" # qpinesetrew a etoe
tCIO]S DE JPABAJH : AVILES -e wi.,... -"iLe -...."--- -- --o
j-Ia.' LIEt! UE YfOES IRSITL II M.,..- -,L .... ial
e Veracruz en 00 hora.d e OspiUtAn ONZA ,lA h 6 o&e dteo md Amre.
.& to.dria.n v .por 2.? FINIlI0S. IqlERDOTGO,.,M Pi's)PInmB stMI laelapttmIN WAigh le
to de io ds .rseajm, ba eraegmu j e soas s, w ar
NA-6IswrM s .*4M C partede rse. #gaca-MBIER MMA
SWdl liEqA"] ar. egsa t*w,1/j n.oaseem' l.. .S -~~etfb~leu'4'd s~le W 'g #eiodw' Dkme it i
pmouo..Jrad.e os.ie a Aosa swks IsOtIi
AIBT RACIALIL O Bl Y.4T 6. L seAt tW
A M r Da4s Aosmtado a720s a ana n m a g a V. E 02 .ia A W .N 5A L Z eAC Ja eA .
FI I Lh 1 4 Cs T* '^ o s ..ms .L.. ."cw.....Ios"*I*O
,BAU0 8. O JstbY.,4
ow- A. i bi'0q41J M t L V- L,t~
A.)JTNU E DeI~Isa4Aa7 U dM*nj, 25 8 EQlUN-JL Ak'WSUAB D S*'ib~d0~
IMNIO LQP 'Y'a- EL VAPOR 01A SOL do M. deo McauP"e Malb
SMARTIN SA.ENZ -- -". .. -a 010 .
0L 4atawn an "tA Crais do Ispg k~W.~uws,~o
"awsow eout Bae a 0s6adoLimareotea, durante t mso de JULIO do *
lwr*ewys L Is alase defLiranl Onmasts. *etx.
M a haoex del. evamea b CdI&y Bareel00. 6i;l3iW
S r. .. .u.- *a ma s e I A.as de la tee.*
-.N AS.- _oa_ .-

. .I




T 1 3

b "Ohual bMm p"N Pal Poodeste *oem K peMreen s
te~atost eM o n eoe Modest dn, tatte e,.
adhaMa
***i tomids ** t~do*u 0iedMeSMe6 2 sas ed io eelgeted tebm waeakedls de s pro. ote, otrs emledee paruedspea pn el mtove a, deoeeMs* A Ifweediti, Jael, Oeg* tO preeyesdo
pquoea. sakCmt y10ee0bodoes. dois Hdlod mesY e04 "eq t*. bles Is a ley persq s seoeoen 1e* groes e haborels pbs- eelades qae aperseen gregadee A la AdIles.ta troaelt uCiviloI be is a geeta; per Su, deqpabe eatedas las
asp 0 1es le ee qI a
a-osote ,sont an'
e~ds dpresla Habanee dispeadnlendores. que ,n el trmino ndo cnoo di, e unAbls fotogroed A la eleoi6n
Codemoque hay dy suisto ltuoroe.. torere a outo ha paado at fleha deortad Ideoatituian do[elA eatchb do las Habanaddisponfonda
ue el trmino o ino dn a
lespoiaoi6n del erlor Gobernadorli6n dbl quoe haysdod i u leturle.
de|ntro tanto ha psado al fical
brar da pare la vista de wte Srecur e rourso dI ionstitu la depa, buena erpuesto potelor O'Farrarrill en ota itrma Insitanoi6n, o ionlor obertor CiI quote esuspai6 dtelar*,tY
rrena elacto deaspe sol6n, '
Dice El andqo veerea del pso go de lonstrc honor fal, a'm6deo 6le mbrdioA que nparlstieron en sta do gdl-t
rocurso.
timos enermedad ae Genaeral Mso.flor OFarrith en at. tl~s itn3 n.
tania, quo bi 6me h torpor Pr quo supontnohab de praentjurse tif tr laproyeeto do aplay dispol6u.ee
Dice E Mundo acerca dot pa. go do lho aorairfos al'na6dloo 6
marela fadioquleati er nonv dl. time enformodrd at General Mximo O6moz m
Proto ab do ue prosentarse aUs insasaf proyaoto ds loy disponlendo quo it Tosoro Noolontpages Is osioteacin facltatve, del litolvidablo generialois mo )dAIMe UMaim Pdtdndebod iquo ei a ua ley join-

SAI-OSANAi'U.1 ji I4-db n-as* en lus arbers rpeaj sr taltla
' ''
J~OLW D =I,
.- I ...
ODONITALINA
?nrpars agis Iimsa,
DR. TADOADELA
Una lntruooi6n quo la
aOOmpaaar xpliea e m o
doe d umra.
See entestra
on todaa Ins Botlea
K y Droguerlal.

tels
OiAiQLUCA INYNAU(A
gseasas
-i. p,A35d oS a"
.In-,ms:1*4 O: perr lapo s pas o m Omeloa qs ml al. on4lt v b" wuis r aman ble -rU, mysta ar w91s easge io. sbs a as e apa a sealed sa t u
4., e |,ql tett
I& 1w aln y g mito w yO P p oe rque per ia slah pi
"a m "be 4II II14 "lo 06l
* f N test asba g* gdroavlIro
dson p tI& s, q Asqas n a 1tat6 we soabe *ab* lo e
*IaIo aone teetaluA a-ah11aea 'apa5 a u boss, u ot "oatmeat 00 I "lslmIh S uo mi mI 06 a ese 6"o IoIe

- I

ts, p erse OsM at wo te
** Me~ t neeMrme
.e hau ; tar0doVme f*miiasa4* u dees t k oedL
to n n ut*ra*s eSsa
%- ev- s
prla a muner.o esal aspee, Is adueaels Iseatttra deloetiolo debe sor abbied. porTest 5 eatido de d600to neodsL
pago depu6s de prutnetido.
El Lierul y LR.liep46sa16no sostineno que el s Ries Ri. yore, seo"Oretario deo Hlolenda'ee, i dunustdo I 1 poltt. dtm arrollada por oe uSr retrio da
Oootneacl~e, Br. Froyro do AndrAdo, y sai eet o hae nantfe du, al Pi l oaato qAen, eseg uids, hubo se olebrar un eonerencia on el r. Freyre oael
quo le reflrl6 Ibque aha.. Con ta lretvo dqen anmbos cologus queohay tirante do roe-a lone entree los dos scoretarios.
Ellto sarA soe pero haste horn no ao von teiafes do quo eso tiranatez rIxtt~.
rPreleamn e peOtrata do oej persocalidade qtIene, la unia
or le vive de an earAtery
pare oonvivir y tierardo.,upa otra, smetidae A darios heouest. si una perfecta-identidad e enterAe no los rantitee en ~ratrlecco
paz y armonfa. ~ t
jNpMot ot
inn omr$ en eeia consi6n to que peai6 no haoe mucho ouando se Gooeoa que pot anAlogos motives estaba daspuesto A dejar el gabineo el soefior Montalvo?
Al eneargars6 el Sr. D. Enriquo Villuendae do la direoci6ji del Dia tano, do Oienfuegoe, esoribo un editorial que dirige "al pdblico y A la prensa" en queomlenas modoetamento pr recordarnoe u historla revoucionaria en la guerra y on la

ja &dact'6n
Los c6mdnodos y fimos
"l31imbres." .
Magnffico surtido on todos los
0tios.
Juegoe de. Sala,
Stilonad,
Medal,
B3anquotas de Piano,
0ARIMIO 8, PASCUAT BISPO 101. "
,,cu I I .
Dr. Manuel Delfin."
mE.r)co D1Niw1,Os
Cosoeasa do p iL 5,-le, r1 0 A. oat I-

No reoerdaba hobo .alo .?g so is-eutaba 4 at saloe 4o qa era oqulis mngre, q"eadbse les jioep asustadej; I exzteomaoiuto e avdl. atro do4ea semblatbg sea oque algo do extrafo emeeth es 6L
s al a-u paoe wats apea* aw wbWe malt o A O
dtd amela see s loa
Ao I"sb o squo al16 .'d1o".,.
06 bbav b64se P6
AN so ehsto "an;6o
I am,',, esloom k pww~ s lo
re kWIt, .e so..el s/i~t* dO d
ro6, lela pt a aser
esats.
goes he puse *Ir bal do oat
bun~dsn
lmapoma~eisms
La tsadasa sla nsAMts qu Be msqas pEssmeth teate4 pqew pul o am ass asse do bler s e-

ras-s-odado on los mrnpos, de- uMenAdo los trabsos elecltorales, A legado onI s GeUnetauyete y, on prvibi6n de o doee6deesom sd por ditime, miebebm del pal Valedanocurlirdolap Is la e mon depes de datnos 14 daro ones y et idago PenAl
expio 6(n de perqu 0 Yoo y l i le.a n part que sor. part
periotlon b on pr ab p* eflre& I uo do aquel derehoipt- litic
no at Gobleroo dtp oe itoIo I las pewalld.4o Pfiea.- rel d6mine, erminee or e4l : d 9e el abueo 6 ooaMleadel4in IA
Ba ote pewtie t1od*a 4 err- d l itin, para eonelmeito Ei ds tee e"Jelae p esmastl m qo. i~i1. 8i
doea 4.ooterad is ameWs s y*-el s.b- Ae se haee para qtte, l ig do d6n to eea arims. Aqee atee tlo el momento de is inkhel6n do ar A lee labeetPebtlese ya5 se me **I- .s aidle pedsa tismee toE pOtl o s 9gl soi M art d- i m
qsler 6 soe alteas i4rAle elganO j aotsels eqIbtatbsieat.e Is Y m09o que nadlei los steatvrdad. am bes A hoser polties do ldoe ite tean A tfiempo laos re-. eeaepte y do paklreth eo. Y e oeps- ouerani. sot, anloaomista, vedredA mues. tras eluiansruo t soiartnce sh Con mucho gusto ortanos doIit itaeirs hiotoria emn edes les respite ..... Clara, y saltdo A lag personey ,a ano- .R1-_ .-.fa,JS nt Clara,,e, nalidad ensando queremos coeserva lr ltperii independiente: t sa a tes equivumeado ne en ayer quoe Nota Impt ,- seA tode da.
e or h & y sam A n dem j I)
de lar o ent hds 9. eelbrro loselyIem fa Iho
sA o ste pot ft"Bs ldamntera st otsvodoera soude str, hm eia imodl 7 e bob*o4 *" a s aperodr do neps todulas, rmdo
soemo surldo po elaaionl i dds det a dao" tie(ique ardamnoral) A dile tn Ato-e a errso l inr a lde etines, ee Gettrdo A tlde itna. Plsa defsalm de e es m oprbemy .. . .
soaberta. .os lorharipot de- raaeo eentorp ieen odoneo 5lgd o De "irbe le-exs -- orp o .. vir ie pale I a a m el rfol6 y ji quo preparadOt do is ... '.ta-ip atm ,io n blbav Velebrarou,. Io41 lemontoo fu no) a War- 9466V itl tdeoeqt"srudady lArmi.m. .via do
,do$ I Im ndifereaionm mta etros, A fer do indepeudidntes, rido
lusono querid,. flos quo e in dsen platlm4ls eoo v erdadtern compete. 4 i S;om ltpor onlr todad beeta digna aotltal, quo damnetra, 9brll
so ewitt slifritO por Is usilids do .. .. .
do Cast porn bieno e.s deicha Q lesnterioem. quo Aeleberno sl4n 1 merhills samado do les mejored Pteseos la M Buenos son los propsltos y perhe er rospitar en todo tieapoelo ADe muyr~ ite ide ld que peea- dreehoa dello idadiano, como rimer fels
S-svtrnleti umpllmlento d los d dberes
Lo que Rde la nes quie aqnrIaIonstituealyn sloy eftislan oum p n, porqne de no umpllr- todo been oludiLdano. e sal'e eti an e4o de desterrar Qo eate proeeler, quo elebramos, as uis ptrson~A, vas sultido on ln prtims elcelos ualaro spre lelonu o o dtecs aera na erded; 7 ol ilmar quo el Sr. illcend, horadseripohationtibutdoeon Po periodista. tIleva pora ventaia .6bi, AIs obc grandlosa do baser d r. Villuendas, rpreetanto y deoensar nuentra ivea Repbliek soomo 61 no podrA snero preoo aor br Ineolmoviblo y gautlee boe CAM
gQsar d I nnidad .rolpr n-- speramos todo del ben- do
de, unRpdoliba demor1ORIst /atra va A tr quo enatlir- tdrito euerpo queen, hey per nor G4 le los clhtm do tprena qteno hoy, a I oilea garanta -do ordon sent go.al do sse benefteco, taato 00 y sz quonos van dejando con Ar mo 61 los compadecoL in Ou ar- odfo y rivalidadee los par- loyr tioulo. tidos. ratl
Lo cual siompro eaponastituir Cim
ut privilogia quo lucha con RElO
plin pio de igualdad porque asita A regirse' la pren yque
seben ser lo prrnero A proclawar y obedeer los legls adore~ E
do una Repdlpba democr*tioau
La rnealda prun,; ipal do Santa Clara, en vista do quo htetan co- R L
ElL T1IONlFO AL IMO
,Iwsiatura qul.- 1t;qls.P(L .)-tpaiedd er ie e r duds t i lA4 tsVOn eseo Irlosde sde I fAndeloorui'os. EttloquVno bells olla
do ea era Is ave mua ers reu a; atda er l CU
Se. verdadere.-errt," del cxito Do in U e Sservirlan 1 tltnt'd~al mn a' oysln
y del almlrat Toa OI v tl. y dl-- Esta ca
oIpln del ny-relti FTPAflna l ar.ntims ( snrtldo do b
mederlay de plrei l n. y el ,o ode edabosl dr t
leo mbtstltota sIelwtVJ~'a,tods 1 Ig A 1 kl
prftunetn detomr eI'fTJ2"i% quo -a o dessie 11 2"
mantteneo lmprA rorrturi nt "q,o lenpre ata pra seflt
rnbueospel.) y slempre dlapuswtos A h ** luLr perls damA yEor I petri.. rtsble or16s
No e4 pole gor buena -aludsta-ntonJ do extr*ild). ly que limenar eAri tlduo deI&allntal6a doesy r fatsi lle IN 7 l0n totnar 1 Oillmenucl6t dsimy 'rd Ja- 'I2I po6a quo prmr el ior flomoiUea re- lIM M i1 [so.9IN
I %utave tPOM1P 4;tsM. sre oto de o ___________tmanrita ma,; e l w tl .1 ntnare-l te
damos ortt? sI soailA d bler,-b- .io-"bao tos qb
y las cat'Panboo-el 7' .i,
y ban Iogrisdo diiefto r Is meor a a d. 'L
Iosdplomda s dteloJtaw" eoevlton
lee dot.m dotust' aoo.lsos : JAE

la speffdile qu, n ngant preseeto o extreadioe, I. principalpt aus que redosnfe .ol ,extrehsnlooto.
El 2 Jaros,,del Dr. Goacla eo ven. de an Is llntl ,iS Jose, elle de Ik la. bOa Dna. II, esqulnt A n aprlll
g i Jll
oI YoCoAS
FOTO1FOS. SAWIMIAF 32.
eSo hacen seles retratoe A la perfecoi6a po UN PFJO.
Jetatrs, porqe no sle fu6 poelble aoY ea bes 1o d,11a do no mode o.rrible.
-Todo ma do me abandeas... me orelve Iosda-I 4W .- ease
p 4die I. m 4w 4 1 d.to sh be a h~
tar as saqat d4* e8, I
&Q.4 s &Wab&)eq ~r 6 5ta Alt4*m, o M A d adL... a e o l retsmio Wa maoeM btlds .
Ad mta om i~t + a lad6e meastalgd e I o gleeRs4b. honbl .&a asen
I O ..-o ..---erm on.. asl
Ims temmoe bm ho jdo urto
o 4... 0e oials... adg ggs im tr s o.. a to tao, a
Ies tir a o
m as veb a.as. @os I
-b d w 10
=eus- s ab weeme 6...NC QCNM 046oweeo s i.P
mao A Jk...gAMhlobi... so 9606 6 1 L 1 14 lim Pa-

In puorta delOfr toP ed," un a4liado del ,oem, e. do de Ob biles, age.I un esptit del nthmmo de. smento per nemistades po-0 es. sogdn e desprendo de la wi6n que del mseo hecen At vra y Al Nundo. Sde larmentar el suceso. i pot hfi s emnoeza for do xcabarn I e ose?
'rp e I W tPAIUXIgp4t 'Arl" M OA YnO .LU=, 81 A
4 15 de -A st, MsoYM r'MAI
40 RIgo fj l o eis, 0! 'O, samoatsdo Is DOMS sto q ao7t 01p09tt I-1.qj"y s o o dej.54 b*u e s O eSye62 0" copletA* AnotIt, DAA
a "one UBICA pt LARRAARAL
4'SAN JULIP*N."
. -I.Ao tt -Ws
. MANUEL ABRIL
y as embares pars aropl per s e los Estates Unides, unestroque.o,ango y osipafloro do redaeol6n nstrado Jurloonsulto D. laue I, con olJeto do haser una ezexurptr lnropo y pasar unos mses on adre Patri.
sevanmo a estimado companero uuan S lAje.
[IS CAMAJut
SENADO
r fAts do quorum nooe eehbr6 s. syer tarde en est CAmara. 11AR DE REPRESENTANTES
mno6 la seid6n Alas tres y media tarde, bajo la preotldeneia del soonelo P6rez, per eneontrars. anel sefior Gartia Caflizareo probada el acta de lja anterior, so ron varla omannicaoionea del Ri je. 0vo, relatives A datos pedidos por la ara. '

mea"" iek oahlt4 %*
wk ,o were atel do d m4
A o rage des se Aewe
wsord6 seshkele as lease t oem46*1 A deaO A1.e4., ais de qe 4tePNemvaa hme doIs O M6n40ee
06dss de d l ew enteltanos. os rT epiear ede as ga ontersled Sobtll terrs o. nistrative podr seisedolor, *
tar ni tolerar Ia permae aM* de lenocino en WIalein ud e et espitalt4 de provieias; *d M 1terminsedto quOlui "sni e edithe de Its fnerses armed de to Idot pIl pdr econuerrir de uniform A le pa* see y espectAcalodes pblties.
A lIa Comisi6a de Presupledhaes o envlron to amb6n doI s pre4iposa un del .or Le nTiedal Itra q*e por lak seresarsin de ioend is noPAordeod el nagrio d 30 po 6os A lse A soje le a- c pre tante ms n elleene. bAd po loehaber6n do rpstteorrespondiltn abeIn usd Febrero rI del ndla do Herso;y yla-Otr dtael & tSqerrt adloy oncdtsledo u onto de eln io dm A pe AfIer dde 4. binas Monted OMes e ele a.revolucelirio 1. Leopoldo rt e.
So remiU t iA nCowhie ndo I hue.a ide l dbloa unaproposei6 doe seller
C6 reorgauissando el plan de eAtudos en It Segunda Enselan s. El sofr artiies Ortizous r AIla CAmaras iseordse pedir at 4ontiTo tdoe as antesedenteftrelatiers A 14 vilsitde inspeel6 sna ndadA gl j a at Auntamieuto de Vueltaso Io que ou juicio ti iuayelun eto ontrarlo 14 Constituet6o y A tle loe&.Cee que?/" el camino emprendido por el oblt sei es toterlo y quae per ms quoe e dd qe qui no va It patr ends, d pensarse on Ilas cotuweuenefax quo paedan tsver par el pots las vloealei
plnes l que siembra vientos reeofe tem* perates.
Eseor C spedes, rog6 & la Cmara que acordrse pregunter al ecutivo eo virtuds de qut prcepto ]egl y c a u6 nautoridnad dtspul aIad Vits at Ayuutaianleutc do Vueltas.
L CAmara aeord6 per uannlmidadi traslatcor embo ruemgos at l grtivo.
-I tIsenor letaneourt lamduley desa. pueia de celebrar el leaguije meenrado

,ANTE-S Cufrv y Srils.
,UE CONOCE USTED SI UN
ROSKOPF, Patente,
ES LEGITIMO?
110Ym an 18 as[raa r 1o 010uoedic:
ERVO Y SOBRINOS
08 1IIPORTADORIES su olrece at pdblico en general uu gran rillantes siteltos do todos tainalos. canbrillantes solitario, pars scfora desdo
s, ep pur, solltarlos pars cabaltro,
latest. sortijam, brillantes de fants. otm, especialmueute formal narquesa. Ite olos 6 on preclosa perlos & centre, ,
tales. esmersidas, saflros 6 turquesas y oyeria de brillantes so puede desear.
U.-APAI HO .-A RINOUM. 002

INENCIAI

SIEMPRE SUPERIORES, SIEMPRE SELECTOS
MUCHAS Y VALIOSAS SORPRESAS DENTRO DE LAS CAJETILLAS ENCONTRARAN LOS FUMADORES.
7a.es.u G a.
SGralia'3a~o ~B, EI'k azn.. a **

reelaqo is isp A astAllar, la gargaots so 1I eptimi.a.s alpbs.
-Agsa..-.slarnuar yabe resteadb4 at Inmele palelig stba delorte o se as tnumba; ses grite uesen idliesL, ibaba t el*ht. do, blae ou#endo tre do l ae e as pert~in.
At srqd6es seaMO Ma l164mesas 1s ml&Oes o. I 466 44p100 ,64164 sot o benuA q A 4.1 sdelpowp y
*ro d w, ares.m Porese*1 ,ead sO
hdspierte emm pa s *a*P. La p1.6 as 41 ode a emad4o. Saadb, vaw h & pritismda is 5 ldlns ,oppe4ad o .qso ewe, ia 1" tiiges pMt Iesde, seeplaseomo sovmaointra fosot hlU g1d0 de to tneo"640, dt dp.b."sadado. ]il vii6s p oa-l rqokroo n osm"5s dsos a m hoBmoAsoa ers-. !==.115
Im l~lm ma so b l mo'a I p .h" .
mtodul e lsuallas del be*
to as 6 sedm va, on, queaie We IitIAma om e ous ersa4 toort mis em "-m~able a slo aM pabuids al wdugoa" speft 1. teOUdI&A"ods swgtL tis qa r*Ia

agitand le braes eaquel6tios, loo10go millares y millares do persosq que o Il mirsbas, so brtabas do 61, regia.
-Ahoed at lWe ase lmio. al parrids, at OIla, el ladris do wn* sobtiD o, 1s Sra lumiSa sedits4 do se gre, es*ndhdbdo iajo AbiW hlp6orlta d4p ftuS do leuanl. T slpersa t iae gbangresdes plodru, un 4 led equee Is 46 seeo AMl furso o I sabt, quo o f s. qed lan asroeala erto y g edtsp
No dogrelado ob qete abla "e6 oea Is *Ia i e"elsuobo,
y mgmode do f~., aiqUAot
-, AgOes aas6l--4w*ba*ll ri6A ltam y61Aostla qumme k* poeM4 ardel o I& wboa.
-to a tseei o de~ le Mit km e.e ails otdla es hs IMS o antitoo; aomumsl". om WWai W tesed tpol I orts sepsaI ookt*I FI stous ospobeososta Indee esorpe la tob upeaft ldo made.
csoo edle,"a o be ,obo. s4odt le
a '. em us snege y haai .mems. 1 440140404 G&O446 001o4asss sre*AgSlra
I ao*of oersteto do t oI bitlIdmo babla -s- b ts ANA be htariseuAa4 Ido o&

Boandro so lau6 A cogerit"a so uals gido do aers, y padres leeo ses tblel al enello de la botells, me leo dleetes qaue hoebsban eon el erlstal, 4be4 Avldamasle A grandes sorbo4 e ? 1ay6 de la maee o m e ma
sIk reomo 141 litj560 mi bq#Ojli05 dun..w S.m
I'I~do Iamdeo todoeteh"a
6tim bor4 so seria eadehfeds age1 u1 do, a-op6. p6o. d sola. bs oe T .a6 bde iaraoIt iie or[eeeioy e Imp
boo. d~~, Touedu e t Bak
l-so" b1m
abes Ile hahitsbsordsN mrif as"I umes "IV" 4IsJAea.de
El selee as hoer leabse to ben. brom.
Alats m Revarelw a hsvmed 4* la tet6 eesavisin k aonmbas, Iloeld lWSROhUS. @a wo Touits mIsdo, d~ile=saov mi-t94 So ** *I mief-.btee6l m Tes MeaM y ~witurats woe omdedw pufa M*A
I" *I *Sa.

- - ~ ~ A-- -A-- -i -

IT

1

;I




S- r

4,L- 3- is1I

t* equeen etAsensem neores seroetieAre* le akeft do
SF1 1 hmp%7 P" as 440 e to
let. d qu6 os otoU p"em 44100 dt
-. "os aq M ep'rd peam e
pk eaqMeae e at goeavTe rqe sode s00 osteesse*Ao seteretkmeW, Is pefee alone res ta sieemstle PaOUP, o r, LG e stoaFW08oo 0 o CokbeY
rhosieseedc ol or Mora01seOrtiz, IN st"er larreino, 4 -uoa 643delrar1e AbstW N0eodIo. oeseOd t1 seedea del7erautv, quo per med e dto ario b obomserhs sedt portebdsoel pots lo.Nearettmeeose ates
--dIjo-pra quo ale as anA a en gaeporqueasbmen Iquoee so propoon bItneer%voaelI pode"et evto y Iam gYa oea eoeeos daeetie palee ar roar
Ioeteley6s. mfatteando que alosilberIt so e r4opees easmar at leoutvo ei ta eees meles que ent ponlendo enpegralaRe pdbilea y Ia lfoeetit1t oer andale y don'tt efal) enearee Ia neoeolds adoqeo I& Omiasli MItpeelal noubradaparm pfesentar A Is CdMroar n proeeta do reoenss d aleyl noe edralI*veflquo AIe mayor
brevednd.
1W 27 vol.. co te reaSfd reebaseds is enyleada qu pelsosteel seorT ttgaleo, heredtarlos. peeeto retest do lot abereedI1 wdelto so Pogue
pn6 aproe se utnaesladoldos del mno uo niexten en poeeeldu do t1o. rt tLBltde. y7 Mot quo loe posean port itale. hereditaroa.
Pn6 sprobedton& n coioda dU1 motor Oatmanos, que comtnbatt6 el selor Ilortouanson e eloeueate discurs,. para que do los sobrAntea del tmpr46Utito, deo I reesudaelu de los Impoestoas y deo feonds del teoro pdllleo, quo s eInvertirln en pagar dicho b0 pr deato, so detioen soels minoe part cubrr las ateelone que el OAgreeo aenerde. Sitefl or ledrigues Acosta present6 amaeemlnda tendenlae A que deeoes "e milloor so d6stlinen tree para obras pbliefms, no slendo discatidl per haberla ealiosdo Ii preidenela coma una propoelei6ude oley. Teonfeormo el sceor Rodrigues AcotA con et deel &al6u, peld A-a CAmara, mostrindose ota de aeerdo con aquel criteria per 21 voton contra 10.
Bin discausl6n so asproberon lo remtastes articalos-d la eomutlenda dete flor Castellanos, qua ya conoceu nues. etros lectorea, y en lias cuales se eatableco qeaeLsakloqueresulte favot deo cadannodelos acreedoresa devengar el laterdas del.5 per cioento annual, Ailee moventa dfas do pblicafe eaats ley, do. bl6ndoneles expedir porV ldo definitivo haones al pertador que devengarAn igual inters lmugadero per somestreo vencidoe. Leo bono setrin de lan pe. sos cada uno y las fraeeionen do ena ca tidad qne resulten an toda liquida. ci6n sern pagodas on efectlvo. En cada preaupuesto ordinarlo go consgnalaI ma n qup el Cougreseo
acuerde para Ja amnortlaci6u de tso boneo, que erA efectuada mediante sortees. Veriflcado ste el bono serA to' talmlncte destroildo.
A Ila sele aselvantb Ia seal6n.
NOTAS AZUUARERAS
raerFccIoN De LA catK DIa AZl0oAR iteproduclmos de on perlAdleo de Mands el uguleate suelteelto: "NA zany probable qua en upa de at prmer ea oneai U Comil16nl Ci.

I-IIWANST RWILI!DS ItI
ha4", s
FAr LtD.
- *MELLIN'S FOOD",, Stun allmento de ,prep a* reldu facil, nutritive y ie da con los ni-os, verdaderos y satisfactorlos resultadps.
, No so neesita cod. nar,. asto 1o hacemos
*or Vd. Solo hay que mexclarlo con leche, y eat& 11to parxuaaraez
Pdkse una muestra
Ins trucciones pars. usarlo, la enviamos Ubre.do gastos.

m"m " P

De...." oo

$1 Moe sa og'deoshmo mqvo c t "ine mehr se gei
t o d!el I t a r d s I0 doNos meou used. A rourer S ssg 004tk w ""~,p etw m~
Nera MA&er tath oensm!es wst* e** Sdes r vmnrsm que eamm ds
. I ete on ePeu de eera eo.
& I~oa eeesya ta.embrea do omJav Arre ely q ple d 0-oo., olaftvert..smaIa im etrado n Feilptoin do an
sol ca8 stead., petr q EtoMe do
poeoc mum oetatlesa levadlide y ata dl tods loe m& cavetaledei ArIbt rsbea, mee e editor eate0 ealamida4s A l Arieite1 del poal sea
propose dietar I. mcdld saterlormotae e4tdId, A ode feItqtIr la Impieeo46ode tohd It omfsqa. IMp.?
*(60e eq contranio flI prucital
deadmisIatraldea ameraeao prehbir na adl roetLngir IA Impertae6o de dlohe artealo."
Adad.saer eleduseteo ratl v to dieal del estm& y d1 Intesttdlno. el l)r tldi MtarI% a i efte .. all.Mont .T A 4Im IJ
Petlea6n de Ia C(olona lapalots do
Cuba.
Leeomens.kLa brspondowe d.A's. poa, quoee4soer Labra 1meprate en manosdit aeflor Mosteration elm mn J* rwa enva at Preklnte dl Ononejo tie Xt1Imitlmu l~mctslsmep*MOi do C'uba sobre lgunia mudidt qa Oto tree lienerls parsetr anoetee y ctate Ia trpIormentaei6 de spaSa n Mtia.nud u 1obasleaocl6e reprntso6 le
eoes4oted Islullee Presidenee4l Casteo EspaPgot do Is lstoana, del Centre Oalleig, del Deatro Astorisno, del Con, to lpalot y de Is Ameitaet6aroeD pellente y los Diretores dl DIAm o tm l.A MAIN4A y de La tkein a-pa*
Spretende: It-qu senameItate lidro tegorldlplomitlen y 91 sueldi dei I46* presentalto de kspaIa to 1a im s de Cue; 2 qu so intale la LegalCn en un edMiuftleto Iprple y, deoeso, y qeusm pmr cusalquler motidl Estdnau le4ers posibl adq witrlrl6ntostrutlo, et Gobierno eneatee+ uns auseripelda, ena i egurldad de que" quellaeoploneuro paloIs cooperraetivamenste prrn qaoe A repreetacl6n dlplo itlra de Ia nadre p e tiroa u 1,ateto, proplo, Algoo d
su gran pretiglo.
El setter Montero lsue el sehor LI* bra conferenelssan extensmeate sobts Ila pYopuesta de los ILpanfoles de Cuba, declsrando cl primeterque uo de los capatales empeflOs del artal onoblerno sora acentuar hata el oltno extremo poo. sible Ia Intlmldad. ht-pano-nme$cans, fortafdeledo excepelonailment el prssglo y el valor deo locoswlderableagrupa do e.pale qu. viven ea Iantrls latIn y cays cututia y rlqueA Infltuy podereso tnente-oen el imartly.I a us za del literal de la Peninsula. Saraste on imnplomsae.Ora reelbilmlento.
Pampioni it
Proecedente de Frnels scaba do ilear i'ablo d rasatd e
I reelblmiento que to han hecho ua pabanos h aide brtllntfalmo, neudlendo A Ia etceln etewmr al gran ertlsta ksuml onodstAyuntanionto de 1Cuba.

oTImolDve. A
Isamekros poe44sn se sedo. I, ,s.
DINISIA Y MI9.CIRWJIH9.
semna.*
Prat"tru de Iiq oprten ioru div. I Wen-, lot los ni(trdoi mL iA-noilee.. I:ztmmn 10lecill ,lcor ('0e anet(-.,ip
l~meta~s pod~a.. do to" Ios 91woh "oin"m
IDeolo4e e d PH en bsos divtmesirmso, y quelanto coeidhlnd o(re ea poudlempsPo.Voleiumen.
BUs PRII(r MODERAIXM Toe1"."sude 8 P. s&'
CnIllano n m5 58
EL VERANO
3 110$ S l ITO CRECIAiT*
.-MAGNESIA
-- -lSARRA
Mini. uq-l-,s~o 5 u. gw

HOTEL TR OTCH:A -*L
P11I)DID) IIOTbhl NHIMURHAT.
* *** OWsIaO-T' -o** ** 44* a'* *p** I pu. "..u sO.. e do be& wa smm s aWdl. Wo vde *a mm4s ae
006~oa mu4 a~rela sH~~ts poca u~losbaeslade 1.
00444405 i05J110 da Arm-,P4- Of-Ws4% .om.. "
i~m U-tA

~Wi1 Di-m DIXW am
la~eo tdeMeU1-Prxdo--Ndnm. 56, HUbm a
Corriente (e CtritA (22) volt. v 50CiClo) JI- aluMbrao, laesos eirz v celefsees6sa, producials mola I&Platt d Ia a mp.p Ma *1el Ved.,lo, (4,0()I eaitlle d fuA), v onndutwda por usIlles sunbteaens, in peligro do acidnts Ii temor do interrupwe.. rvico .ernuente, to mtlkmo do dil4 {ue io tuohe, ya oftablogdo y aciru itatd,, lusdo prirwo do silo. L i U y atuasalelOsM, o(tedeestao y comproliado aIs vista del susripoe. Prooio redcidoes, e o rde66 eon Is itapotaseis de Ia t=****kd&=*, ydismiey~edo ..gthms natmnt el oacem.
, alt. t-1 Jl
iA

h I "s e pod d O bee N il"" ,s
pset. oiOtseeg. a ,
ewp6An A saMendseee bes
prti, ysda"FOft edi o M so" h aeCMWoWlseterse Wonpaleshe a 8* I h...4 mm
4 otIastoe Isesev ve **s*do **o
41hecodrihklc" potat iSen6ttsu74-1 od. I l dea. o e
m0* 7 eme.ede iobiarnadore*oe-.
tMey d4e opleaftl4djsustoAm. LAmes en m dariom-tdlitu aquo en Oberaldo redet see o e was povlvfol atles do It A Storl pow osmex fa obsequiado e se elete bosquet r ds endldtoe sA Is dlputt6d 6lA rtes.
clouio eion, huO fe;j A lei ptotr cudo, uso)-i leonelda"mn entree. goo 1* diowr, per letsi 6 oenes t-- =. es, prelate a ckwr que lame t noted al Aleld detal p.Utlo t ssalves e l Ayutentmletode t1t ttan
Y am sgtalere., mb410 mblandi 7el Gloh~ernee ennethandes Iauleal Se La eoed do.oiris, lo leterrespl6 oaes.
-Noseenfsen tledes. AlthldrA el
Otto A"w m %M, t m quo eyl aiut
viskeo pere-dlea qnMt d4pet y
inetedodentr 11 1
Desde hdose ndirl sn eneeadeatle, g e pG91wrnaot-cApat9p4"i
e-Yomurre Ialm te m
s A fae rnes y me de 14 anan.Gt m Ins Uevlo
Desde, hbede n utoflo pr ealdla 2Ia~d~los HOpteejuace-A, lProvos4er vonil" pec 04 .Apa~do'd otku (Oinrrec nunr u~iaon
Hity, Aroe Awm oy II'IM d# i*Inuti not, 'ha ulk% cM pioceslioi. i;. %ele i do a eare --rus, Aro, Arewlk llidbarsrmin (itmtweela Mre. do y (iomerm- etaenatestadasdopgrta, IabtM reladarm4w o.4to44obalo.non y Mlss an *1 traye". Im.prooaol6 .ew rterrid.su min sin Inldento hatA I& eall de Curalse. rt. Its ttaspa"&por nite I proce16n e toalenwt de leitaterfs do Uare t tso* for Zublesiday, que stata de vigllamel, en Ia plant, y que pal r r ante ael Bnti. alemo e dercubrl6, pero minua tuo t. mino por @l centro ,Am Ile oen ilgual direcunslee-los pr ontawtan~y esalo
lAmAblerto eon el res a w cedse nA4,IrtIb~a o-s dea Alll l r -dl1dsusllon. 44tirtd'lgsitomdeem ie mate". hat64 ,geesbhah int4iel
taM oy.hmaluba sL~dtAkrmtnteA otro limaeknd y qued! osa leptinhlbla deerubrlrse.
Lperna queJ .ltmbl heea leteo squella advertencaal ver queloetaos cuntionuabm obertn 4batpelr -t centraJdI to protain mienran nelA*,Ls.ars4pldos reeltmn la entaidu, lam6 dpijadero at so. flor Zubialcity.
Intes vinuun sat~er tod qutod6 ternisedo a ims r.
ikub su cainno, la pieoieM yiel onlclt tal cartel deterrrabw i. dar ruenta dte In suredido althpltAu de guar-. dia, quien la ordeno quo vodlese Atoinmar el noinmbre del londvtduoquae le hablA Insulitado. %.
MI 1.-ni Z t O lviealrhy. acotapotlado de bo* ofcikoeAg'uNar, Iawa" y t a pr" S6 at pno de Ia ptor colnen. 1a Mtlle smera, jaunto tIl f Madrileno. BetOn I svrsl6I* ele tostetio ile autorimadoo dei souemso, agent do titeIMida Y oft.les del ej*4eito, peer quuet isenur Zebcaldr pidid el uabre Aitprrsonhuan..ntas liaAdlekpa Y ('Its Je waontdmtgOqe lafinato 14vt

ts d# p letka" at s atWe
*.e te. anaIm6 ek p esieF
-* n Ii o
top R Acolppo m o sodoI Vt s ptl Ato e i q n
r5n04** telittewatdemt&
gnolebla d iTf l t saye
dea as 60 *
sh o 1e&nosi le is m4,aeded
*e1 e Al", sqoptk4a dese l sptere' ls tele ga ft V *trroeiat oseldn prcmntabr. 61 u* etee s
Beiates vr~slearloenlsan
masedohrte.reo eisapautenae lat sfe
Crn&yont 7 Olb1areee*e'on"
enledoVartm nem 14 "Wo 40.d tels perfer6n ktprtJ batmtism e. Oore y Coloadewtae.
it MAdhelag
serd Art-ra RDiastIopo rinteedenta General do Esoehas adolaI Irovincia de isantae CIr, eetavoraye Gardens TIlac, d ladeditaedel cretatlo interino do astrueld6a Pbm a a sae yr i .rw.o. Audrad enoor. Dios a l46marseal ate-* tromeril Central parmSantacOra.
MwiranvgTAI
mTa SeamdoresBl Tvan y Baneelt entravistaron myer tarlt 0on0fP4 dteite IA Rprtibl, namb$4adoe I. prmeaoseeti~rwlah meo, peNUbteadd
E.-. yr LA anatRrrA
I dUETA9-Atn.
1 Y R rIEVAJIIIA
HA, F AJiLBOIDO
psesite mteh lesSute Eua Ssno.
SY dispnestsau enIerro para s cOatro do ls-tarde-del dia
deyanbado qsasrthoyr "d*, r-1"0um-suwfI.
1wohlermage, tie.y dema sfaT S niliareuy Anmigese suacri
*in% Li~- sonservan ooearraI & laeasa mnrtuorla, calle d la r Merced ndmeso 28. ppriaeom.
patter el cadAver al (ementerlo, de Conl6n, per cayo favor vivirAn eternmente agradecld6os.
0 1 Ibana 5Of.1. .1.1.., e.100
Merced"eG. Inalado yelit.,
varrit-,Manuela Welihvarria, vu.
Ak de Alaneo-Anloao ltrhern wrIa -Pedro Rodrigues Serpa-3Altoni.Pftes y Wres-Batole Ituity Anfra--Irquierdoy Can.,
p1Win.

de seme u mue,
AIW
aebsmteeet. 30kv p b biour,*
aide el paal .~7e l PO do* Je6 .qulow adololtee4 wiidkmaetlettere et tah ll O
*eJe6os VA y Jom boeraSeae que
LA oAaw as at, itorYeam Igl it Cb. pet m4rf o h wigultad i ea lUWaoke ta asR
ide Jo $ea-4TU 1'Oltotn i4sti delsaeaote. eth beehas para medie resiy do leqailling do k plagn 184a A 0senaele Atreelamae
t" t.,
Snse en"atalat eMeta do ass ema qe e m v-e de manay edge perdsedo an est, ame4644 & oAed
de de ngl sa
qlp Aq alpo quo erVbilom6 nwo86tesrra&A Nk" O sa ti.
" Wteeat.m de at A lw me pue o u 4s s
' yhsf t e al oa d itd aebiq o iP a lem tw at
gdelo.Il-de ea 4o.ede Honor heeho l seatrain poaasweo qor Aquenso Is pemItoSedrAle o
norm dillerroarCedee s 9A JUVANTUD MOMADI
Elm stei.litadam,Pta aeedeeo6, Pyte' tatPl.eattl Ptaasm.tiloa 07" Puddv*Ma gla
NW411I telar-ded Pisre.46 08" heio oi IAemarla y plotMentono V"rd-Airo-y l 4 0 64Ineoew M,' dltiaornlvaoectod-e s o-set Mithocmuaeodona~o" Pe prOas~
*n3*dov'el6brrnegesaattnl, Alas

De+ erlee 48el.486 1tMtt artis dht 4 be o t
Atarr
e ee~mto holmo-. Se.eksoentqu Oedemne el toI*
ent a, ta remoee, si eet ncrla d4
14S $on~~Vr W..oo.H4.I&
dt u elade1tda-Deamt, Br. Gatal.
WdibIi6'Jmw4*.-1lowU
SAtoreLIUTT AR&OY
AVDIN~wuTA
Beettarts LAsago..
LAi,,r . Jo Wo. J
d eft eo0*qoo St. (lvo to.
k~od61*.,O;t, iL"
pWd e9.0Aedo e l.
JWtiiuaarsoncasetraIs In
Powaut e ,nr.e netr4
Ar6 al, fener.* ContmvtnuaoL.In drrti* o ti llomt, ~.G
ISereterdo, 140,. Ptmao. AZI'A~E

O URA Eas010etRA C Vwill'8 d& (18' I uig sDtBS COm
REUMATISMO, 58CR6FULA.
1, L ~I OVOA 1 I UFU0 G' l ,,1U1+l cofl l
I DOLOR EN LAS LLAS ILA EASULA01 DI
COYUHTURAS, (OLCRASl I LEGITIMA
HU3EOsw ENFERMEDAD. A* e .aeahimn. --,
CATARROS, VENERAIS*m.a dsmal as s as
'# i0 u&& floseseo do eamal idlcsaaAte.4boccmhao.v~
CALVICIE. HINCNAZONgY m -j.0 aa.1.eitnei6nda60 msunrmu s u
yBLGRAN PURIFICADOR DE LA' SNS4RE. i asswa ....ae.. ns...wsy
leaUsErstAA B DE ASOMBROSe dcITO. PIeASE EL UW.1@' fes mens set *~n
CONNUMs.*** TSTU **** *a n s .am.... ...e .. ..!.
JAMES F. BALLARD, ST. LOUW 0,. 1. .rIdelm am t o o6
**mm** ..t._.,8tpil--*** .,
- -T, -- ---o-----Bance--Neieonal de- Qube ...~oo
AONAL BANK OP CUA. m046, ad ut-t a le uot mm t O
D.epsltariedelGoblIrno.en atanA s t de Mso ods ssan
c aptalssetdo.................. BeeeO, U. .. y* *.U
I" t 1El -:: : JE'!#r l::-: m s -__U_-CoSa amnao--,nana.3ae, SmMF ,reibsllseMM, St
.#O A B.... s eANK OP u IeAm. Wmr t ~ l as *"". ear m aS .4b" '1 1m" A
O 0 m* oo eeds d i shelak de beaors a camerco da p65kbles a u asrewe
........... ......- .......u
blsls em te eeakJ 9* I *
lis mm rI
.aswe*ait ddesitaltass que peop i~l~mes I sta0 4agsak wade ease
414ftll 6111411 a GO l dm" &t-4pLq9ft** I 40Oh osgefmcs A 1
emN Is 60Kmni a 6w g. Z 8,1 .- b
~tsO~s~dmO~ rh pu~e. As ill.a ".s m4Oe .mws I" ebb" usra. 6U
-I sas5 isloo.00 fafoif a.go A
pos ,Is" ons- ss ...p... s ,,- .oA s m t, Isa**e1 e 4m s .a.t. anX
wa e.*.*** s** m**** sa7 ms.. peenr s.. *alis thome.
"j .uAasEM."' "" ?"0&b gpaig"yke"' 'o- "" "" ..--

- -- -- .~-4----- ~

.1

.. ...... i a-m-1I1... ... -- -1 II.ll. -- . . . .. I -

It r




. E MA~ tr.~ euesqee .fIa 4 4 -g 6
le peea~ e d aie d ed flar eoobI a e< reotaod LMsero se k toroen)riea L de e libe e tled
quofopilAsseeegeo dltaes.*m iteusatnse 1tt1s1 del
, e ltea g~ olo y 4* mea apselsehet ee )t,!4r *et lat*l o oAl qas e
Is .ife ta~ l ~e Do bodo."rw" Sl6 s4 pee 4ded i id ebe /t& e*4lln so 4 qdei les yemst- u dt4 adaMoie d seempeeausla.
.. p~o ~ lmi ll. d I iwlllrfu L~!losvltia e pet us lkadrll hjseas 4. a. 0 0 pnl 6lem.~ 4ill oerato. do as mo
I& JAN I**eepse"bandper dos gi1t Playmmoage qdeormiaat6Irimdeeoobee t l g Aempes t&* I espe
Pr 4at t o g am TA -&Lor Lt .Xm 1" 10 w k-U M0g4to til.toe4 k y do as50900
doet*46 pa dgends no alsra Y no eoe to amedeen con q as mos 6 et br* i14,01o4 w"-s" A quo ste6 almpaps e el mM s se d d a esim., e6pa ie&
o alqMtes plrai uOmaeone m*ae ditee Wlthem.Mlts W@emobed fe 4." fervtseoy ueel e do tede les cte. gaoelaes eari -ore Iea eve. e
re abrasol1, r aOr oum Atogie a4ee uuswes i metiome oa m es s e(1eao na qu sI tA. mdv#0). mLtaoaee s' lrpie 7la**1N agstiedoi c i Lepd 1 lasetsaio r me iW Us t il d I hli". X m"F% fo+ e li u mmeo oted+ d".1 al snll,, eti' do le"eclnp ad z l em oe rk-ela retim i
= o. 1soe r #utha potlee tasIteales.,) lt (rrspedesets. esee grnd pe esti.
le sen--!sae*aai on a ass fmemn do pael libe de tdehW. wese ant idd4eae46 d9reeter aerteedwo.Y y Don AudiS Melishds pod baer
aga py Jan Aebee6. dequissesm**-**MA he smuyeaoSet e qu defe erts.. i.d aI~ s eeuedelde decenate .l Dun sawy~ bense. esu eesematelee 'de
asseIst Lakestom es ae ea.ar IAsm1ts dO arlosehl t 3t p.eam rroe* ( s LA MttrA, 46 i Isnla pdeae.e do
easeetiltea a tan .pot i nleede Dietador el genalslabai I 4a6.al .dnt~erd sts. la_A eatlleten At pedodfd 6 orl6otes mis, sgia t deee a t.
WON "WA"" IoNN100 M"tt m, Pi m ..,o r aleos, 0.01,1w .
drr2taness e46mas. Ilr.e2 r1814,asiese, PeresaMs11014meplural;qea *ut-$461Ahood40 pesar heodo, dd I0ga4e ries seerladfaois do lasreionmas
1e d4r11 ti.ae t t otg* role o sa4pae useds tm oe, atis, do forms brileate, demnr deu g, tdecdas per saettesome soay,
pretelmee.r libettIe, 1te'p**p e on olas m amle. p.eeetone s preea* DE.I ON. la paradasAeleoes elIalees. agnoe may poeo bles emesasda..
a ed p*eo lo teel tt f eis t = obe esbo ibp ue tb t o hel ;edop ertes; quo mins I Pene aA d alote De shaofisnsqute eea U- la o sea6 heo pae deseemaspropls eAftaMt an enos do latriItembe rvte t.tease&Ieitrieib eeoptaba aass n com etrada dor Andie waversel6aaaabiltis, salp. par qus eilatre preodie la gua po tel4 iSpress tar dque oetyrefa-l ItoAi*6* gresmie[ Atllete "* laitr Meled4 werdgsmf k s ar a ig --4 re
diepaoertetto esso e untb Illi rtdeBall-d vetrsiiataesiseleleeassebalerae oaadtd e poelinm o co tempotheoi dLA SI
t e4w eblop vettes4000)eAan rat. .hkeh Ase4J4da ow lso astes eghi-s tersOsidestea e aba 4efirosr *ie. DeD, pud.e-eene eqlseplsee Y.eepe gruedbbe diestif, queo d Washstoerto 46aowsoekBee* *r Montere Je" T no6to in Pree, U.AINAN CALYFA eVeittrt*e,Out 1ttsos settle Its klane opd**o.Isee dnesAMemt roM a MA' teeemioase e oratore den tstoeda n est IamU id a rde 4 at plsIyewaa*9p Jo e y trorstno sanympeagergapy nam Ches probombrnquopoooian. T potph so a esmU yoildeorus Reudw deD. WH: TONI UI AL
er e"tleIstemea enor" A0abrftelabsdeadblet se6wlares per. etertas eloneset*s p y' Ipit lausfiness pdblf6 1 MassewreettLa aIe rleo, perCoalcom
rper6eel oad e6 ..I I aeme4slten dole e Btedaots Unkton, freeds(sk co.a aautdo toucralC freted bat t .lhosuIaeepaeeneondo- RedleAndtble
madbs eiabhspeth4s4detempea o ~eIa babilidad4oWe iflity; Y post a means hombe li apteo, saetocj er A ile. eeaireUi p.irtltiarmentoYe txtA5i lpteit.
l_ a d MAl rblmIIidi~f 4 ytmon Tlo+IObI~q .M461en41 dI l/ ndor 044 m lpok~me~lehr uulP!l]llqte~l l ~ 6 Irdorimtoolpd ditnl6
etIo datlsa"edilta :~,r oxinuT I o steesImraro.4Ab el-iodertn do e nllativ, do grame eoltu.e sor pireets hope ease d q fueen- e sasnkangA
a; sousA Atfekaen quo alelakol h at ier* Zdespad 1toaas e p petltiesqueltlestalsles q 6bis ntusperior.ralgi#-e toiIdefrisdo-aimp"ere oiaj. .**
agpdo elaa.. y. teeprots.ppeespoyed44redeolssyde rAbtor Nouribt laasowipt lessrispreweb igrdamn. ltleda emiT,
atrooa olehapottgiteseelpreeemsome qastlis yss ningdoprop6stoaUUlitarLo, at A as.doeesaW.eseperselia, aburr- n .
togtntve"nted6partid atit9. aspaseetdoedodldrltemsInerdmidad4 losaeiateeilateemay opataodd unde0poroafdsou di 'ad laedn menel6aservildledyeepededeedoeasaln essesassdoaotatio
lesa_9 pathetnapy smeo alatoau6 baleaai ef44 seld-el beaalareo reque- qu l4'dnesebasKOdfoely ysae mi- at m meo ime te- 4 temperate, la ezsltoDH.VIENT
sinindeddo forms y ftanttT of consist
oin4 m mantsderl6sIspo. ifandtbidecoread elea st eanaOe ms Nedabla esea ts o neca pseutooeds, uynaaeparastoe y rll. darIetDr Wiliam e econsiena.
poc'to t4444.p& bifttm.rftaUttto.qqe etl", por que Oabadateadsesumaparerrtielt dteala Waldad, quo no he tehado ral L-M5SIPgRO La4MsiAl t pIIaI calva
er lwo problems. tstsys 1Ild loshehrasqe. e cvia an paLds poltiaIk lltIiort ya.eIeuama e ap ben eharp one s pareteb queer qo=peran que. laseaea sem niiseaA
t a ralit tn ever grivtatefesa tmpoaqusne-fos-partides do euael propioAnimo Erbolas por. liams la pasrtado ouses el quesabe ares F te te pa111sado del quoenestros mte, eMUMte l aplessitala respeoto Aerrobelabpartsnelanssndividnales quo he tonido oeaiM d ntratar at se y tiene pierna4a.warqueds aguardan. 117, 31URALIA 117,
se4~almLjapea~a t ad la. edo*Ulde... queelpligr ti dando forms y conalstemaisaLoa nor Mlidds porquemobcee san pro do entedoa ee portalden assAM I
nosheaserddeedolspreo fundamentaltpatalatBeptliesea promise do dard Cube on gobleaod p6s4lporgqetldebatabsoelaengoo IgealmentelpaMnoinaeleque.ben JUnasL
iaslralasalama n.dmlato proplo. pagablel y porq tacrec di mamera a-b qeuo* past l teo l 4ue
Cdo a t-leheity ha eteet a esathleo6i6d4 pat. o, o, G1llaea.au nero ibro,poneso,- me-quoesn gentIlo iittsterialt, que os ain dedoloreydoomlone, yna deeitrdo kcatio 7 Ia tsoat de vids ttoladdikrid deataque., a s m eee roblema.ltdknlsel planesdz gebtearo. que am labor tin el levetee l enw ddJa na mavlIfqes
oeeblks-p4gsaearevoltelMleaesoda woaek.eO4smse m es console exposerWboes pesade, oons depetomotede oluetracld6a P blai Pfldorase oedsa del D Witbemseon 1iD.(1e
ete, en Ia aoeealdgrtlaAP4 lirm toIlterwoesawae6x4tes,, *teided6sosonu *realpueblosa16- onee ii.leeprimore, angel aleo, ps' reamedfos que lea *eaean see e ado6 dmsewetemeaoneI s suer* eoneleness maelonal, hador.dade mis destau~ideeiAdso pode. la.- erdsieda rasade 0At asbelque eatomri J resgpeereotba de Ea test m 0ne0des i nes 'rom userson
6i.rse4.pignde6esroparte iaeooqaet sieln orge Vis6epAlMepoat qlualeascrew eb t.to lou 6rdees, habl de -orrs* oand eTaqm de entreoaao pre- d menuen *o..w d e
4a nansalsin y 4+l'poinevanc 6 ee lepaine oygoealdmas Ae souabrseterro nry.Is een, d ioaponderi eapaions, do soajet, Ala age"remndqqeddcomelnve a t d Wir.
sat, peaneswdog4i. Ipo bl. NACpdeq9e ) paraltrie, p 4Ml4ai dela analrqulaiU aimblo6a yefdespojo eakegorla doeastal*Anto, -)pro. opar cauldat4 DeN atrsinfle ee- anmkUdedaealvo 4. to do eateaaeteelcegahtla at eliee ktoirn Mistenmbditl M. MIqas 8taauxe, (16' des anteatmei6n ydas ep ers e nut i "' *MMaod kO6a m"Sad eatuneom A veesequroesdoe, geo bud. .equee idp64 est t rea JnUol .toneeblda p rlos numerous .amlg4 qao min peqet'prebh wateramento a t. aN s pe I. telede coameter -*6 hl ado dll. do dftItometohehapposs eooee- e to n quy-tlrmpo l adltan. voluntdlay no sltid;lo.agra trae6taieis em
*..e.ato tpl At*"o.mosi.dentro d'.ea, omo at gsma do A bso milanist no eOna person- no para mo"tra, j I s
Csoafol eupn.deo peatrientma aoppleateiswi ttmeayetaaasmres T.*B 1 1dadimprovisada,needloe.squeon De2 ,S MaLigLet du Fdd estBi Maeo w.aase e? e k. qua mAs latudayeron an Is propaganda. d ampSa tmeld embtildaefo. atJg lsmdetI. Cosojes dd ia (Orna 20, Ba Atd6o dd los Ball (Idbh, evolten sti ,miyqqmebstnon t.gse fesen eeos idai.gira qi, Ir nmovi.- .. pndtdespaleljeoa4 por male .s na)e, Cfu r4o> -me si i
etode. ittied, mAptreyo- ilEtetreas. La ptlnita de e -Qu6pa Vueta datir a nenc qqeer pon laitt- egoel stdepaerA -o.
vldedorndhepdbliquerhseqale. ledottIjIdrp sgquidaesue-proce ua Do I Veauerema leT Avaocparal des, quoeableopdaidodedesoa TloI
leelta qoe'dorruof, no qutse, ml tc I~~ettni7=ioii"i esai n od erm~l ela e$nueve mlat~lu ia OcUpua e aq eb. hbieoddppndocldodoedobhc
-lOadrlptiroe, so qiore, qtisledistdersmdee, 4e neue an carge pleamentepoelo de apttad, macho tempo de furtes dolores deo
la~reltiife q~tidderru6, too qieze, u so d~wtutold Y ezduu0 0 DlleolatGe eo to elo muyegmdde ereg gedo oi urn geiiokle ehe usdd
-conforma, 4qqe seapas niatosloslan qao do alladepende qu-a seam delezna ht ealg may gr adl probada en anm Direcei64 General, eabesande agen neardlgica, ie nada entedle-6pd a its l eblelosoporteadeargmentsamal qqetisaverles' UusAkldlcomolade Madrld, eel delas-Pildoras oga4ss del -r. WII- ,. .
tervnl eny yesadalayatietradnruJoa lerti do yd4anam) defhtdo. Yo no.e vsI ue nobid. Goblerno del Il neo, en discourse par- lams con tan been resl ad6, quo mI deedflo y asamoussato~pes;6f Sid~sas .k..th tidlioneefisaratpoeble de mdvpd gron. loamentarloadoemntea, on trabnlos p. coaitderopbligado Aextender elamme.too [,. (JE (J(4 co'mllo, hbaee apareser poole spara., Cuba esta verdddes; y is pptltlo nol heviktaodm pdares todidtlce razonados 1g es, en dests, persners expresi6o derlcono Iwssrmeere.imdeataA a. *14
-dhesdeaslibretpapqquello~tmo, l m brarlsecon ant breritorla, Ile- mten- berlin. obrailttr aresqnt revelaruin mibr irmlstio Tntoy lantoashlo par is asou. primero dea-n olamporant.,Gucyo sa thedas-esesesaaw L (dearat Dade-aeltUymilto grand ynna eletanels supreme.its: ea tcidn 'de mi doleita quoeosiderp F A MsLIt (itadibaliteleteeatquetr., Aa*r Z ds, e 1 Iostros mbrel amatd Ilegado la cambre don Audr6o Mell- imtl cuarnia realniento marwlsa, y ean.ra.dA w-. aku. paptat 1jerni~rs id. Abodo pelfrosfdtone-A destas defetos cee qua eatm.cetieues, do an prdo tpitaiones do amblelono, gomomecho enal. areas aque antes me aeMi cyd wm letae -.mim asauhmerd que, olesttoedep eatodnaptl acdmano. et m e sn las tmpaeonelllue caracterzau A reaultaban pna cargo. ds tia e a., -ee n*.
let Nhya pe iamualaida uo, otosruu4eV emadti-tdsn bo. eWa n enriAt.to srin loa pco qienlta pa olaU A ,-Seaparse len do toa .persona quo A.g.bi5 a st ldlea u iled.I & D #lTde Fma astai rales: no borraba deo nuestro*esplntu cs r losfrfvolos, con quell a parlnmonia, *epurrale enid tod persona quoe e -e .
el q* ; m pedoditmlaethon lswtaasna *nosra encabia cn onr eetwn'aquelWa4entited yron squlistran. ur or efa idrsRsds eaes aea p4mu2" 11a wardoexteyAeelet4n oelmeaaadie prooedunildooerm tatt, cul mlsen lrabirdypnto, qnilidad dol hombrequetielnecon-on del Dr. Willliams, las bnilldea frase ar t *~* o a.,a.ie annesio. ".
a eci o,,planosate .dedlitarls A ili los matinls amlaos. l as ameri sos c i, A fin de que nowuada n, cla doi an rito y que eatA segliro del de sn agradecido servldor." e eae .1u'h ippebddelll- scalbeo ( bmleatnel librode uluestrase agnestas, Iodd iArVuelte. Ilotruiol ria ifo. Mo r.C xSd. D oe dd idee eaVwqneCoffJ4,deeaadealibor- yestAserithaqbre lApIldas quei Pue PuelaVlitcdaynlnt i pdrideir otro taa Ent el La eurnagla o esu nn enfegnedad: .-eeswtl illditypar deeadtA am nopoebleveeino, viento,ni t-lengatidnft l' crimen,, que Andradeprde i m ijodepliles no abondA los enUalona. Y s aporicia main0a lpodepmoveftnat4,nammuetalevy at el crimen4tigars llearetersee logtra- he deserdepmtl1 turendlitehtos retlxesy "y aI almans yor 6 menor feria, angora o inales- Jl
*Io, e4tlglkltedearde rkn arnmo r de Is edrteza ddoplaneta. gaoveprnepio C grueroas pare que nos permitamoo el tar y deutrreglo del aisteme nervioso, ___ __tlueiSagdeasetesa hasdertop~a4 dbessItat eleor~O~u.teVaritua lito dimllro onindiferenetakoque quesi no se at.nde A buen tempo, 44 444 b, rie e beree, asenado ea dotena erto ep s 4M ro sriou. Nos- Ol permanecen fieleas-sadoctrian, Alaos conduce A consecunenlps ftales parn el
vat pl itot ltllquea, parstrog; sarpeutimar~ emateadero ]aahI ao epull mtgrglde dad a l estudio do problemaescomve-0 omoe4 s4bldo las fe-mftitel. del te4loLn teo$wJ anaaelis I" i&t raim sutu.r.e.. *riuez, a oraa epddnnlmet Ndr os-l aop atimet. t IC que dedlean el vigor do an I .nteleetnalf equthbrio mental del patieite, p orque m
pbeevi im.enyecsu awst as que qne. eaasa que pess3bre anmtroutes-a. a iet stead st d o p a ie oten ncbios m e r vstr atln em delp
tumetpewart -ilnldepnda eia.alb. sd; y piaetiyaasJ elu atermn.s ,pa. g'SI MSl llep- qlentes pars la salad de la patri-a-A sibtem. nervlie se centralean nel aS L Soleasw lfa l.ad,poc IAcuates he- deasmeepas eidaw.Lde ol.e atuglo oett N4~As plene Acald* IL que reelhazan proposeloles vents- cerebre. EP alivio y core14 pne, rg y mstuiecedoamedlioip". Yetaa pa puebla, porloaliso queeon nigdn poque to quden; jocas per-po bacer trale6u &los prin- ettA indadablemente ento dar A los ner is, podeGsne-B .ay?-ti, PAI alain q4*1dlolsd1I1hoi6dadeep. obt a-pmobdgtoneopareld. Noaeetra tveilmcompene s elppol luetldealos sm, on COuy visla nutrieulna ueswetadodedebi- er4sne-reontal-c con flaaquaJeie. fdmaeseatltewaaqtelalnaehadelpari tueelv a ral Iropaganday defense ta l ves congo. Ildadpide. Aquitatlne en prmera I -ltdkw eaal aalje os shs o pan~elllliIl e~, ostiesee eInrnl oworstm
vtiolen do lemn*A primer Iiba hlIt4 ilAdgrporaiara sn blea isu suaitntrM?* rmleren r.teastedet organismo ya meas lag virtudes de las Pildoras Hos,, pis qup nvW vita ldad-tel berebro. 8tel fervor de doe delI 11/ WIllm pant personse
onet. lasmAs balaslpsione es to quepredo. plidas, ()r Wilims' Pink Pills for
a e e trbia* minae etre-vakelomar deonuestras In. Pale People). Tamblen ne saphie.An eli
S t 1wae r's U dr Vera. chas politesa, oada vea ms enecondas cazmeteo en toda debliditld do uno y
esoernFAtaer.-ibrva tn nroaeedleVudaA eso no ocer Ia supremsnla do otro exe, anemia,semgrtelepur, Sen.atioesti msaetrereoruoetrdetesl. Aasuparelilems loque, ni part dme d ellas y omi- maitmo, partisllt pareral, d4ipepsaa, strlatIftVied"Oper cr~m pr t be
ladedolMadra e aegaiisgaantpa do iadeelplan ques1plan yoreldmob. arastdaelaspoeries grandoa reglonesemispnras de lan- palace smopete.,ot us4 9 aatlWlaset. Atua iu e Ine atn eum ns ere s
.,mpemm A dewt. n! wci d ratiterve rn - Id~,tadWcak darnas y. 5 1414- hITA
t.rdesses dediruipleters de deM* ~befl
tees do m u .t.d64a7 ~ "
RD T C No es inIde-.,.,aeg rdinmer.,e naen, iPOLYamrnmea- dlta:-=.. e .tah -** IoiW11 AlfliM
apiaorder Is.156 dl aclhuWpe-IlI'lfl MtUM MUM Clabcn j
OlAI as ,e m os ta hetra blear vi ce
delIr. l smasifola st e .rg g on,.wns*Aftfo. ea N6 d.io. H. a
Itecoe4 pretaddperater.NO idlndaqaevenderiqee.a Aso.lbDn otitems, dis.A.SIeanealname* r" q I iosuSe adlraunm rostro tello "aa~-"
cow "e A 4 ar F tim *6 1 e -t "-", V
. DIluori o E- .inmtSaz I n leb, q la causa tate lx4ts
-, I dllll, i;iiiilm+ -'i~~lll [#qOa, aYo .rv, otc oi r./" 1,
Caae Ilot tamanos. E. .E. B bDrilrbDr etl
ELIXIR DENTIFRICI P ati veCre -u ,o emir uaj paua roet S .I'
oweemas ps a shmo .ot,, e c codt l-in be~o es- am debido.ale: a ea aes ss.o ss a sane s
a Lfb6n de-Reutersd e
a.. ,,~e~soeota nbusam..no. -* ~ p766trdd R~cter es~tstantiatoedel enids,.. s ... -asesm. tern., M.em rawE
11,60,Aes iSlbadd *b pe mayam"ina@,io.or
= 83c o r ElJmbbr1R4-c-11uOamimdo.Bfaz
par"-6estM.vhneve,1.eety aebtASMaoldil a S atra
aP@arpear de elarfs4.IaORES y QBarsallWAS
ehr... .a ..q.. . .. ." 8 5 7 5 m, to .
=dtVAga gip F. aa"I~pco aearoa o fcutoiateIns
a~ts- u
m i
ma PUIi aow
- xk* Zr a

mm.eo ad o .. as a ageN e oeln
assess ..ne e iM*, a s e .l e y ses 5 m I

?*OPATOLICIt*,
D CAL PURO
jr I to

0 h

m

XM UiOM Z j~mggfy r pi=0eefat, hendsa.Arp




AI 11100O~D as poets011A -uiiih4 9~~A~iS 23' XM iM.
bo. et .... Ia p: "_-- .. . -- .. .... .RP ...... -fe..... ....... ~ J.. .....to a & ...m d
--- Dr. d. MU P- -%ulaasa
ees .095s4 "ll dolslq tdt Wlee =I K Io MUA.
117p10be ,.IV1.-)"6 1s. M 9 C
om o lls ek plilloaf A im to ~ t so1A Is~1' I 4 es .5 e
1ue ~me 1be pimmoren alIoe8 dhl sOh-t,. en em dl. Ileumuadee te Ir.-ipsed, IOme wl,Ote sqUW f.'na_1,1 I I3 asaoo~vd to4?llmllooel Sur eOman*
edIIe1. que ha do mottr do temphe n auel44 ~ d brti.N! elI. NhUIII* Slm 19.L IW,~~g4I5 V~O nh~t4, oo-;m~ m -ll
moKIlo o.eaootL mr- OEUAUliAN 10 oflre Vd. 66.s- I iq' m*q. ('rg oo J oat ,nrts | soIe o a aN esad
t.enb doee. ate. de.oUt y lo r. u&qI& Q
oim IrMktldd dM Itn hlseos U 5 b l, ll, U1vI AF =I t0n.Mab. &ta, 0-"' 55YoW0te rrarI*y d1m11 "411p s 4 o l. er r n ha o o Pottid d o t iUnaot dig 4_1 I A
*01iqor elt "for lltro tsto hayslm '.4thR y Do DIA AR- ON is- asOe- l l iN.44 iw. heeg l dl-0 ldetb 11L0" a"
tomeded, udi~a d ledt cid lnf. 1EI QUA IIAN t dceurooete- e osoe l Weld la4 I* delUOS0 Te o)54. Tde todt~o~ e hr 0aR ( oilW1TAos IOO. Wse Mt URlnGAa
tilter i l aueeted eepefiols el t~ral ne0-re de 000 eetit.Ioe~ o1 epte~l pO"~t 5 L. qoes odf~s lorlo re 'rtsI' Ihm6 7ttlois iond
o09ne, Smat.09. pertode side1a sob"asca di ffTM RLAIteali leam~om 6j m matloleel
do amnrtlasc~let nd de $ .1O '9 .e lltlS follttt Iijwomrml do Ctioelll 48, esq. Ompali. 1osetJo~azgL.7tt S. '~ ~ .eu reedwh..
gel~de el hitoto t tnteevo r xa n a I 10 0 qol.. Isa ele rk, ion ti.& Vah rd son raA O h "abr oe1 1s4o MY
firms___4 ____. _ doll Ow l
(e4 o e qeor e tim e heti sv o ted.o 80 Iso Zin atel) a y.ADANA oolt ,l file.~4 M 110.5. 0-00 -d eslsIfd
reesrac. oa. stflalpl boomo iW OV S. Ised Ad C operits prsS is aid- par Is POIMU -i pWouldo e o lee seirblos, leI qStudied do 'al. da elsed c9 tOoo. NO* W ador. P 11 tal, *demTe.14 4
ILO Jo do Sam qbe 4 ps O.e1 ,ee- _____ _sl -r.
b gle se. u fl o o o P 0Au o eeo s t e r n. li eFl s od l ao r l e JOo sb r g v a l r .. d e o d 1 m w .. e r e ". i o 5 A P elned o rt W Saee l Toho, eeseA 00.5)- S ite sor 1 --t-- '
gevantr de r*hardrd Ilamee P. a8 da"vi-a so Lk t AS
nt9 O114't Is" On I me jo st. n one a o uer on COMI[ RLORSR T tl nt'dL
betato dlears do* l d nl d lt.-R sdOw l GU, d.9soaamedo COiAtee, do lO R. CALIXT0 VALDES. = ikIat"am on gk~ey .qwes.~ bijee rc n Luot "*4. Hsb~aalldeJaIdo n~O.-H bajo pr paGU,04 _________61.1"4e a"tdmm I" lirees Bd0 ate ae...4 Wledisd htIos ,~ e
into ays de tel" I erno DIA4 Pdo M 1 1 y4 o- eDM ta. leiSa e-Bo 8o
aq.Is u et6. oesd raa-E eea Ofl(e|na datreom0 too Uaf*needdee htd..g61]tt..hae~z e iazs.tarn l 1. raa1.7j8 55e l~m AQA~o~, e5Aa, 6Oeparadee, ad0.54
gera .e .&: rirtley. ael rnilase. detle, u o de n. ., A. a
lootrat.~m. esolite mq,) reKis fit@ NARO roP IA" 4 2 16 BROllo
"-'-----n'r...... '-- Habana, Agooto 8 d IOL ael doI~eee a*Zmqlemplooo (7padrt i.I Unlvrssdt 000j.ho I!,ee .I4.Osps
(.R .Xaroeat., do UIU~n). m. r. ,, e, a, o ,t* NAI O AGUJAR 1oP.108d| itido~al. A ll~sillne74 QUIAT OArltoAI? -D 115Ut 0 8sd 4 aple o as o a ssl
C0iisnlad0o de Espalia ""te.2i* trt"'y':r.....U (, E EAS Y CO MP ,ltos.- .,' ojrn .- -" otepol. o.aea
o_. o Dr E Fortun ,r. 0 Mont portion p
P, l~~MMelvelt A leg to.en Z"neu al
e% iea do compi reoeoeie e nel yen31 l01 A -ue--eol rl ,--ae. ,112 o A R ARSA e I ObtY p Umoe6s.s nlt Hd oN.. AlvDhadb--MItrud edots a. a'o 3as eaOP AiaA sHoHs. II A mBlAD Ode
doe doNpiapas.trnbeC s n eo tloaa.-lo oi do $1.220Md'. aas.D~e1 n e"LIfaeua 24p d o. J.M.II 48 di eg.t msj;qo DO j" tat rIesoaIL14 a ooo 0ml o W
tbe a.. oebum -laba ldoJalse do 190, Pst tolose e d deos a JIo11.14 LL Da 4.
.abtro tad de -d r' do' eIo"40 JUAN JISK VAlbiD n. ,,s
ID. P.b'l 1tMent**I usemdlwb e sate O11 e le tao d e erea do i 'e f e eibtrtn Eu I~ot D t IC nlv m na oswVlfe4-WN WA
lN e~etlr*.nta~en.'le~a., phmr c de enr pbl erro ner~edo.l p. 111 IR ff J0 __A T BOglE ii Iarml .e ... ] lpuwrld.l6 qnll~lml
' M6 J tie OiY Ma. milotao do e0 .t no* as -00 r a'90 itit..o dd 3892 ntonid L V *1s., do a
odr" OdotnaN o. f.tetAu6Ieqe r de urla. --L- prop.- aLfDICOed* 10 Alofl. y C Iold.itertur Jio Ite. eoa eoolosiJlAl -o i st.
D uefaMoal. lus o o erree. lelerJ o e.. a..- .Idn..tsmhlmrtree.ylida. blkenmt., Mt-dieha y (bruglat gtiieral deo iD I.1 O iiiKZ da o eeel. II =aatm.e.ou
D. r afeli Alared t i..1 d Uol N Y aso s e e romesa us. slahorsy feehae4 t o t, l roads, e
eea" eio.. D. Lombll luk. Jngeeiero Jofe dIts haati qu em arbmospesater.I r bOoe PIt W A SiR ShY,VlAS _R AI AA I550 1-0
" Mdeba udm mettoe*tral, COMO Pl01-dat2. y eeoVo- 2nfermedadte del p oy l ape- partsIsan- Lastn nilK ALQUILAN
" J yel Manuel V ldd. I11s5 alt l-a aala,. .1 Itlgeaoro J10% deft. Oldo el *etw- 4t d*. eon oe le&tedo- M e uLXmSA
__ d Co.llc clDratmeet does Bill~ intrAllu F5tolgea aTo.AIA 0-bO #~ io4) =1 ij tomt t alte itied1.
," Jos Alooeo Ma[. .s~tloeb -- "TC moA lot &UII se Ao bit-o-mpo. .ado de ow,.. Qalimno w nim. 58. AS IIaAYA al-""t P.4. oh al Ogg
Jec arioto l at e r* drgue. aveAGAY V RDCAL1 'AVL eO4 BRAS roose oOei umferl q u r to or emn oo mree le. __-__osl "a y Iernrdo ( ro hreldo quoP ICASo 2 Ad AnAO.-e oLtrhi do geu ardlr teme doet. un" N0Wano mMa
lom..aso 4'bi.- ere Blma o et"I-Hb daL 21dD oto PArid- D4.eettw MU 3 olsssslqtltbe os fa
V n nrale o a n ue o o n l s. d0o I. a e 1 0 H I l e d d e t r d o j p e a d u n r p o l e o ., as e S p aI IM ~ e s m a e d e 6 ~ 0m I
gkoo y ti.te ado b ea vuean A me I s. B.aait..do JettJo* Viinverdo INOL-M oCHARD( bm Ie a R.'""LI"o V"LDE-.-Sa
Mareeli o Fcroy nde h oveL, dcl dsene- low.440 1 bOhtarl ...o ro.-o "" tla"" Dr. Li s do Solo Ln.241 j d.o,...- o.- 14, 0, ...
stvle quall Gesra do postal doblc. Edliet de-L anweed deotdns dora paimkem.-B emteoso doe 0
lo dealeO Jquo~ Ile de1s,-Heni hueslaone dam des ai ite
del~~~de tdmedos am do Ku be lha::o|brn lIs1
"Vlc.-1t o 1 1DA.1Ade ObO1hb*0blNeC Habana, do1 0 = 8 ?.s'lOlo 7
l.Nimro s oz~e ]3|Gl ). AV H61endlI~roposS~Oa Nor man del Hotot74o J P:, i3sitt. U A o leeLAR 3mr e1o..o A be NSLe A 11 4
"~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~~ ~~~rm "r's-t perrl~de *I~ parSlumlltr dtorJeedlda~l tieeUnllnimdl~nltl~e n BAI Is orb-s "ogreA r AUJRR MD M DIMedtt~*4. 8mR% J N 3,$ ..
Ldez ol ebs eOhFObr l ca d.bl a wl rro.-Lae preoml* tee nformee aehn neerlrle.--Juei M. Pot C.ousultaslt deo 0 dell 1 Tlrel*ee 2
1rsO(a oel ablertu yild&a pDo blsJ meqti uoado,_Dircor GeneraL 110 8 1 as ofem 0O e1
" Mllgoel Amor Onreis. ilaboreit.ech, menciouiada.t s Jan.5I- de -T0I iVATIL q ml... ldm.orMoeal.. seeD.e
11100 OarldoCpmrie Sb to qeeestero Pole do od 1)1- 08 d jAId 14m ] uus t~Avu-A MVal7 Do it. D A 2. ma 'oafolsoo0d. R1111 edod. IfonelN a
bhate oL reddoedo Es Pllegs de ;ondleloe A e.I!ud 41 1eqte7 Fs fkta. lr 0. OJAIOAN. 1-1 nalog ?" a ia L p n n e R d r g u e L trado ons ltord l D prtam outo d O br ue I E h I I 11 1 e l l I 111170 4-1 J li lln.n203nD e
" tr.cae ( o D co rea, o is yo. creanlo UU "I n a ,w a SE ALUILAN
--vsteudglodt. cml~n 1 -eSI Diwotro q Oeollatajel Il[aplWl I.1 el bosltoe r e o e s Ml61 aa
pen~ltneoc1e mot.,.ec~ pra posesde. pokweo AQ RA S & U o~~el d Y, sloata
" Joe6 Marrero Ar s fodu-t. smhtl o-a I Dinetroe "j1 amos An nuJbett* 19 dotaad.2Amaliea tag WitIdo4eDrdu e
e Teodo r0Poreda e t Jda. cral podrA adJudeoar privlonalmotl 'u 7Uo- corned.. p' casCt't o tPeA. 9Xfa4I' meA
"nu a. alUSdoaproda 1 d)eaCa dpore' GA6ved cons ruid con todIs AOUII& 0. BLElO 1791. DomiclUotMaeeo, TObe.1 lt L P&Mt mALoedbL ls srlara.
-- DOlllo reL retarlo 4. Ohr.. P'bloea-Bu 0.1. O~elne 047 2641J1 Ms[&isalo. v~tld dode. A,, l teedo'fnidm,
"Monuet Ban Martin. Io..t,-oo,, e?,t.,.Io. 9Iit, ealq los adelantos mn6dornos, pa ].. o o r B"a"tu ,u'. ei-'. CubAT .....17. 016
ddJusto Ceotolaiae Ag oUl ira. n a n D*o004 41 64. _u p ort-otnf Fllt ~pr oDr.ellnr~sL aet.,Jsn, , ardar acci~nos. c umibntos i DPX ole. 1.1 SALUD NlMESRO 8tUBe ,
S)Irod Dtn.- f ie i,,e|fsa C dehlenflcenely Rdaternldadi D tar JUSa] V ds clobsedadlo Is, ssel. loteoms-4 t r
,, Prselso a u e raa,. n R-Hab en Nw-Yor- y Jrrndae daJI) IsmHas&*d.o IeB o Iae nd sori..des.e. lard*- I t., 24 Do 1lO2s.... &,A HL e o.
" J.,,A1. CuA )2 ol. ne .., U.- ~rd,,..er.o.s., a todit do los intcr~ado .,:l~e ~ e. qll~lm ol"tl de P|1e uinV~~ bi 0foanWpto
Domlngo eetPorne drki.ddrlo tm n.laroll dee lec kl Faram'1si nr miflanggl-, C 113 1.31 AGUIon 1t, 9; s 1tW 21lquls6 I)Roa .A IM 9 eA1etnl: l 3Martol 10to0% Nodtigez. o DitaflJSe te, ard o..genna drm g D VA R I eM. _.., d Hr4-10
Jo6uel i m M i bs. ese" anpitoc-uoPm a il ea AL nu osh n anAI~r a5 311 1pdado. sulo a
Use.. Il No. faclltri AR H. Ao r% nI ly *Rornl-a rp.UfLcoIRWZABT. o A .__.s' o a 4
Jusels ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~~~~~i1 Moae vind do Itqm T*Orr&16 MesoioleIt logo oj ollaa.M- leaom o Llvasj *4"ptliaosoNdcna rul irta oIsD UNGRI Q RZ
" '(erpiafa Dgleals .Eip etto. ,mD& v- on nuanstr o naoras In rates so" NA"ayo- A f lTTi j' took& m nsd"ef SIm O..1401,YXI doS 4'NAI O
Q leMauel d s s (1. 1 y con ies. A. -k .., lo: Coslado 11 l e quo ON 8t& 1m s pellr
do ara la fabrcacinde corsets. G C y gm o. Ran i el y r pa o.. a, I took" I. SK bU.A d. ,
SD. DInliao Arrai z Mont.a. Aovi"01, et. ". *1 p Jets qu a& adA al I a cl era a 44 e t enee YmpAcu as e20 4.140 1= 8 Tan.6
o Joe Bala PeMa. dltemos en ot lt dige plhll M4 A km do f0- o g
" VPetoraRo O z (onill0. rslqlehtl n ps e It s at (BsA UEp OS) ABOOAI:O. HIAsA M. ae- es
,PReUACM MAINO-Satef doL 6n 4lo elct u1 Notsllo quo T0enoA A
" Fruleni o Al useo ear.% els o almdad, hall. 6 "--My _1ta aieharn hm fooeep hormes. habrdte tee Antoio* DiazqtG1Zi0 Lun dA, cal do Emp,Kods2 l1 ealos do o 1ords e.al poo& adjudSar erovoittatlan do.IsbotDr.tJ0 6 Rne. .91155, al aoo mse teee.ere o
Is a Coa TO VITAICI, D DI- Pb lesde ,t a. d aum onl 1titant tedtI.d oe deo.Imur ao o p
,, .alona d6o0 J1. de Odo Ob...NRof 1LXCm.14iDr. Luis do l o mUe 1042S *0-*a..- .stin v e sas. s:, i i.b
asA, V,_ d_ mo& Ica qa .li. s T." o.n as,.
to icths20 deJid 190 CA US UUA.-lDspuartnto dfurraj o o bral 'Ttb leo qtlln hsbltaclono en lia 4am a mbaolrt, 6is.41#1, e r, e ierat polio, aguay eva-K" pF. V TUeno 6 e, dlLorenzo __________ JodG m o.CO rs 6oln oMraao.Lspotmatoinous a .Pt O l Jo 0 Aa Io yate ti eId Aai. IInbo ..3"
Gaciab_&_ t ech& -mtde l 'a r e t Is Cani : do sou 6a mIt hl9l .p 4.1 11 r.f5. ml"do moMo& i- dgaA"lB e e 20. e14t 010
lu~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~~~~~RGD U9151 po~~a-lolftdBtlO mao]ags ~ndr nm r, 1 11J rc. niFi~rpa tuati fia, LIoSdmtNel .. t 'll.~ yIau.ald.ela1 nil
Eniress ere nt l iuu a quea o *,ar cnipeda Coel [A tw. a.miad u~n ". Mg aISAJD Is "HAiX 4 eO cb ~V.V84e ..
y1ge Garo C aads. Seci.tor luom .o h. prs dey soncta non R. b IF pJUSfTINfl 3 VTAfO A LB IRTO 31ARIL Mhatg~mcsdl.. do "tw___ v a.ee laaa? a
- -nim oeoFrnsa csalee tentlerobar* doe Is j eon to qor Ao AeetwI~-V~leJJfr ,eeltot.-'dh ABqli 31117 oyA nulas. mpldan opa
Marna i ri gz a ed tao m do 0,70 Pollcarpo Lu n Z.t., ,d.,Cos,.e, .,- bal.a Was aso ala, a hiI"
41ulll p z ~ Z ~ rd Meoar el eptir ent od AgOtorseo ~sti4nnopb C I S" li b n n i 08 11 NA 64210t
4. u.. am b bad. eei. o mt a _D'W~ EItO 14. Totdi m EU i lero ei..e. 'kel 8 L5,.t~ 0 eaa1qeh,6 do- 400 b~ I~~mO
NOU'I aUoE am onIIa U ")., o,.J. -U H -- 11 2
COP~AD EUO 1tro.'6Loeen...dido dish.o(oro6bus JESUS ROMEU. r Antonio Riva s..Ode r --Iia.phoy ois do.Nopan.
C o Tr A JE ENDIO I 16" quo oo n s.. .o,. iOUa SE A2a UIbAN
** -- 7 sr s094s7ad i ?I Olson moendtee~. .- Osh O 7i0 Tu~eoeelaip. lt eo I l a~ltitds- Is.ls le. s.at r. -6a ote ho,ba. hblo t" osIe. e0 o e ear y l
LA A A4 h e1 ..o pete --olf.3 e ll 8*aro uo I99,Ocali-t y vlo.d.eort0 Ue
toIpdroP~ d ujd.al m ed oT s l lt enlst n S. lCOm yVIaso 6 @ 0IM AD too-o dt Io ut crts a 6f
S U Arent. t a to elo sedl oal e Bd ) eon td oparito A Ta"Fh. dtaima ? rtti lo2it'l l SentImdas tee*e1 itasle
LJl t-i1omlenlta aft de ezistomnIslm tlanno osIsaa.~dad de loce (12k meebawo, "e4 3~ ~' / ez Ieeat,f50ae.rn.ml!......a....e.ltlm I~ti. 1 alolla.m ode 04Mml.ti po e.
to i Ma ue a~n M ar ti n CInt l pl o fatli oet a Se,:.'asu o -6111 md'sDit(Uffl byaur xI*'al4
s. r to ie o d ( sJ n a UI tIseva is u d 1oqa .1ao4. g n e 1 0t e l
YAWN reposbl letdc 4)100A4310 .9--J i L ANIOGAD t Obdit l iet Ith dneuroe.I ~vt al- jt w ne t ---i e 91105 --0,1U 10~islmatry URnO 40) ocob It sree Ottrietoentif- BNiijo 8-i seo.aauaeabd e~oa
aeon leneo dlo t on- mt aaat'..5 _ o Ahitsmdesie odmlantooso. CUBAnos more ..htola 0. b 1043 ars 4., tA.. AIFe3. 01
Joe del s _ DnP"0adotbr i 0 i _._ o_ D a .l
Ratapkotado d. Di -c o. qo ..n Lae.. .. t Finlav "001. v 1.p Itol 20-3 it 11 eenteueD NIiPACIOIO LOCAL0~ ~ ~ ~ ~ ~ ~~ E BinsTace nNo-or rods aolap"s el ad)241 Docqstua h ban d ald o a5* tionvsadarsitl eoon ol., sal.05
".1it me s .d do eto".-La Oss podia o onD.rxn oojts.I es '""In
.* 51 5 tdt.$ 15 .30.6 dei Tocroro, nlo "do madara, ..ltasds *ooe pdo hoet d.. .te 0&ea. us sl e benllbde., 4 wre.. rlCa45 a. 4 qnul. _oa 'mbo 10144 1-I7
Domsd reets e *.t po!L re vo +4_ )qamt u&6
t.4,me lot, ,4nla etel ina mpoe m terie dmdrb.a oco se onpl aulelhy Pmsebo~sosrlo Tmay. bnaoo. 80 3Ia Aaai dor~ ddlttos &. a~l l q ( tut sIt Lrrnmo aqlto w. da Ia lt c esw l i..
. p-r il.... tbodttm tuatto on darO0l a&i mdtaais do a1 oeeri -f0. Co. HIm6t110 d
baraentto Rorgeon too lstrsam ras e a elobae t s t r Ismo~o a inf Ai-e flti~a.A VUIL men~ d o r I to seSota mI t~l ul~nanC ~ i e.b ~
104u- Do Ios _o. DR 11. Ititfl lll- i S a. Ud. a a 8poosauie
0943QU P7_]020 1rs'~ m~ dosoe tabioa Y toade yia~f" "as e~tc1*,vs 6 ..."
I0 nues--thssl 4.iin Jasledor INEM&AF DoR 010ORA ud
,,- .- - .ol-ai.. .ne_. s,..'te ...... ....da ri ed. ar... ,ISit .IS .----..U.L ot 1.45 l t. .0 .
ne. d m lerali 0 m le 4 w p a IlAme bl1 a oeIL h1*7um 'eir ne"dl oa 68, i4lqull
1 0 .. molsisosll o p fmela 6. Lo J I JMarla d s e LA 1 m lt P apto. hld be 1054 3.11
oeaesta. __dS Y ,LA --.-].L. r.) gal... 0.. w A aMooo 8H" 6el ""
its ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ .;6&~ UA Is~tCS sells.dnr ,"-u ~e~LVsnlrs4- ue
:;D. mDiolZid Araedzr Noe. ra la Dr.cak e oses 2(~n d~ub Co.Sadi B. se5.I.0I'jtA dollra 1la Java &VOIj~OfPl~,eo l .o
taa 108 is la P ci, Saella PM01.ostoai. N os e a in. Ios.i.7d o yo 1190 g am1 s~OI useo.. bltee. 50 d il,:a
pmi Je gaer be ml.s tartmell n C A e e le sm M~dico ClruJn e Ln Fae"tltsd _e_ a-o----_--seBe2 "__ ___ __ ___ __ 13 dA W.A borehe. 4.14
Vierinal. w Gose n ae z Co00a quo IS s hahiia par so lat do a.(Ahoe)A110 A 0 A A A 2 t& S aailo nb o
-.a.nt...--eea*e,,.,SL.. ec P.D.odLI Pal8in 'o Fr.pa c o A foI Vega 0 Io Ie4 01Apdn SOC1a.. No hall&.- W 90my14 alUJ N c~tc Diuo p-l 4 Rit~ A~ -ol
1.0.,o .1 olesAI. 4-- -. 1.t-e ns-.., s.e r r. E rstu sWn dos.m,-. Dempoac.l-.
"UAlt.orta anol Um. TO VITA l le DR. cu- Opaslta l..a .R
Antoo D L,6 2,y O al a...- DR. G. ma13s Ga6a n6 nsa,. 5 __ I Cl
troJ& Na var Ezp *. prona do Im is edd, 'lepteado d 3 coin~at on 14Xs 6 DR.niatrfroos ROPeI betapst JtEo Mr...t. dseed Alomlaijilt~t Agalla toote lise., "ani' Id- Ige y 2!"E. j ok
Jo era and. AV180 1,08~s NLRA~NTsainB Dr. P E Stu I lN Sn Fe'.CIS6L 0 I an ite He alttile o ca eonltstas 17 S%
Hbn 20dJuido 9M CAJ C11.jDa rla metm. F o,24atsILF.Vdao ine4o5
'ALAi 1. MIfLhDORA" .4 iane e 1 me my -a. 131 rn0.re Io adea
bie"a.Ioe o. d .3ro -Par do~v~ -Ty Jmea omosdIs1"a. osi mneldrl nems = ,T:
'd -.tte, d s boo tie ..,. s Mte st co.1 Co pej r"ptatol de g 2o &T. A
Empresas Xercantff ~ ~ 10 orshat rted avba pa Nourcs Nsold Oamid ya 64H flees4AAALue 3446 "s a o .dataA o
.9~~~~~~~~d i(oa *,Ea 104.1 -Asot dolo1eado __ __ __ __ COX&03 onSE I& call 17 nild~i
e8V 1"Buno mprt BM.pludoshInuL*O 1311 1d.seUa P t sorde' hew.= d4: at oot,*oeeA t oao.lln oe
=. .=- g1- omw.qo.,'"-" u i5 '.a Dr. Jos6 A.,Pr~sn0*- (1--.'5dWUU* .e 0 l. ,
I TL.V '-"
0.d. dol W. 36"t~ e e454.46dc -. bew 209 1aw 7 311 i WsaSl dasiw.tr o.sl cusdr ois
Is a eedeI 4.14be In e rie-*
I l e do "-- -(s D --....
msearatotdkolhoa ti maiou. lAPrelli Porezy vR.l t mA MU 140 em
Ida-j Y d E at e C. y CrstA to Is hot& p d o~ e A AIS4AlIasst e o1 A1 u aim ~ ,1 -m 62 'Lm6 w sIet 4P
IRI a phoo..oves 4 arassm nrAema princia fdos 11.RW"ape64PioiAM 117 q
El Iris' ma S deu. ol I' TADr o t P u&"OwV U l 6V
1.T ...del pmh o Bc&I r nd em a00k per f 39 LP.11 lt = &t~ 00ariels fi_________tie,______l qa cmlors d .ie O 20)A~ Vaosmowe aes anNe lmmro
CeseuleI Ill Pomessam MUTel 010U=a Cia de eAd IFqlaa~ .J
o~db~dCa "IO smeeltds- dii NIm 6T Jos Soft
deb Puerto eM6m VIJamed txiones~1 fsol- ESSRtm- D.Antono Ria aa .ed gleosy ka i
COTLLICED01 to n& is 1).d hrzotl ln MOGPORH~ del Dilm istd sLS ntr.I 4&MVW *cw lro.Is;a~ l tmlk2 etliil I 44
dooh o oa&milo8, elm ~ jaW~ I CARO~ It& ittor a
y ~ ~ S U NI eeoatnuS. Cael- I pian focal. Set a &.w time IS dolas 11 ob If odrn.vou
-.ahn &9snom.iloz a 6aa 7 do Lo

V7W~




St
. g p U LA MARMIA-se 6a aLA matsas.-dAno .Z e 19U9. T
mam m aem l:-aM e lik ll WMIE m m n:vo o
@ ____ s za* & ot. Lp. am S-1
............... q.u a VV Mn4eat... 04 s.Ma.= = 4 MA lm. ss ''- E TU OO
** : .* LA INDIA PALNISTA. EL TURO
---9---~w.'-Lil t Yqee 4jOf tihe S 09040 e soW 1u-, e ~m mI U M.e u di t, I. bsi '.,,-*.+ "a I,., ricl d
Ints ISws 4*auo s inas dl u leseeos de ll u let In *006" 63=0.et0= a.g e "O
ge4 ofeM enormedt ,04guag* **4** nBI DaMO T a1n **L "C naUA = rme s= III OL P ISTI4
GAhm76 y d see A Bro Iao .4Ts -o DeT** rsed aR6n eluea r e OS MNO
else.td .... s.. -pr...,.. .. A sco ms.--mi-o.o l -. -__ ._...
.... .1 bl 0u1 blN ** is 14 ea "t F1Ajm "w "" .
seeoowsu man~es*a Ada* tagg qini dederlo. niU0f OAPW T 1"iD ilI Nup dolJ._ aw Ageni. to l ugar.*Bata -ease feelite
:gu*etWS 6v4l Ya *e l86 po a ao ud fed ate o k m a s de esende ib 14 elodol Capro anel teride Uiu Angeo I de 1 ode t s delde] so o ena ers or nt e &sit e y o bayeu pr r ted a l e &I n a so - l 44rn
men.g N e e l 1 V ieers eusl te d emedemistsl demorl n oa e e -sa.
fat auitoe el dia 18o I e t lodl No o e e le epi a 6 me a s bl"a d d-= t A p- D p M s d d ana I
a1dam e fo la Islels parr qeotl de Leone e;a ,ets.-Blearesaebta proe. seee eem esa ..s.. pa sSa-o edru esa s ermea em to
ula~ A)0 jest.,asw do. Is paeeb yMatoo led~i IIIa, Ijf Ist~ *sum LOS.da noIbE gools, Ne i
P ot W reae a o mis padres m sidetle de W Ee e de sia" deiwn s Carlo so tsI*I n ,onse t nte 1 e n- *e*ro n ae lo 1pnpaslar m dememeltsrs
aver .ha Phegiest y Maris Nieto Al Dl. Seest, m asaltr invitaenes Al igta se sat inleetp t*Pweesntee o us I eoae do tes7h reth ~la43OJaie Stee t --bre A*sedro de **etner, evide de manoe 6 .sangeder
tSo VI M5E0~I40 Cmen NIent doauakNoeen i e 1oe*l d be a d l eO o e na 1-to m e n .OI l1044n -s pier1 cs ess -in
a.t.r In oa '""r .PX Iq de se da to nt
GA E II dlant"4Aclis ellaid do- TgUUNI5Wt45PO0td salcrs.l HidoaLL 06aflrar DNPIXJD COOANI
Pr el enle Iemtso to0teaeetll. s telo de eed s a o ap A It U1MAi .__i_ n lr qmalan a garamuses sonn ess me.4 I el-sedr no salad eso- eleeaet80e e 7 am r eeim so r o C m er J n n nos dea coalorr .c deh 11 _-....1'.1 ;:.:";:: a~:"= ""..,tom Andoa tmbaus rlaa n 4a11 a't11
dse,, eo soffoe "deee1Viley soepo 6e y ot hilnI ft e fesa e- a erne4 .Oo e Ip oo b-0 o l
neestro ~ ~ ~ ~ ~ ~ C4 tIeiti Sgl damom Jon Ter eruseA inrS b sM det* 44 repu Loarr eP' s o loen. raq u burl e n IL enr so loras e t "ot eds la de van
tel dV n, eo ratad d e t awten a td lemt pierde ma. cUmlm d 1 to cate st so tw." o :: 10-.4eoU2 rat n oo. p m y u 1 r al ti-sooal mYs 1* e Ivsdoln a 00etc aromnni" @r d "bound p sadav o eea ssm 340 i o m
plete % AL ,in nA Martsa de Cr- A It me tde sa dt S ie d li I 0. 0 e p0 o de Par AnI. a ro am lien de (OeJO)o$. qR.ed'".. Mn6- 14r uay qwwtfou deIdesnI tre I g eatfa o" d str eo ste det arg.- 0 ea *sesm el 0os.an na a InfoAm n VIB 43 6 Unta 'ri qelo ta* oearse plarla
s. Ne dsede ptini 2et doe tem do *Has- y- -s ope n. ana D 1ms coloertendeos uA ;l a. a so 4-e
f aw l o tf go.is dog emy Jio i d o a rd l Ua raepo ALsano l A cUENRA UN SDAR alOL r aow" c olorasl r* do rl*A don Mapsar o
vitela"n en OIn bse qlu hrita de BaU N#*UR 11r h wmm l d o del ietde 3 *2; r e Cta3ag 2tofuures o doa rrem s tlac t h tDeseen cIosl r seasj o,5ld e dos f a d s. use saleg. MbuI tS- y M Nie00 & D. ha as deeinrbeltsAdin A *i,'4 mat uan e s, se*I Aou.tiae i r dA l r to. ioadoemf tsbaeradedd) uo IF %n nodms I ds ootr
Dequas de levellde, haltr*amhsoloro6abte am O9n or bokt atr o ve at o Lo el d4" I
* Ag itts iseme a itr, ad do -Pyqea qoae hoeos t.o e o e AdAtemal es@O MI t or eaet a de I54.eeesa t saite de s a w)- forman lde asNb, an4 y.ato or ana eA erl
Pet~o il rsdt d e;W Bcilh- 21pe wei y ds....dea raen. an w0An1s br'e doM rad tO sa lg r a rIitod* on= 4s Ba ,m.1oa Mot .. t 0~i 4-11 4r ieisae te o o pi vo vsd t aari30r4 *i e oi 6- en bu .monern d A l de es *tn 0o.
1(hli aufIs rjtj.o I s P s t.GiR 3 Poe IIw do pl Tal aleea~sa dl" d -e Hida loose onaa oin& pa a 6~ estA eleto il esr ones IJoll o a i .. 4I= d oh bo o .. Il la -_ c I a 01n1 4led o..eM la tab I& Cors"e"" p5 iolorq sos4eaa
qh ~itar ons nres t ne-to freNar toetond sta e04ho en el encphae .ad aws .
on I unet eal ela M d q a an 1e4qa tuo n O mv 1) D L10 E sr a Ite tas Ifo ra ne no ri r JseI t do o ** de r t s
tod53sT u rsem, a l e t, b e stl moo s orat r e" e A oUqA te ni ll d aret s la dt e q 1o e te wa 6
mptao acl6 a *t i Islloc rdbo 0411 4. We oirt ae. too rir ai
Secretfm~ee Pa"Fr"o f.f
sh ipM I G e m 'o u grm ped s ao pe~ 7 iidle a con t A C .ai a.I .M1 h r ied ol t ba Nam ai l0 to es a t adIse b.
Ana ls, 0rmea batt y A a' do toregulttos pe rgalorantite. o. Orginalott en hntil crisines tooa n-r En.men. .8.*fi".. _.
li Nierare .30atddeagreamatindh dedje able nqapoir6 At ad edltaden ee e d cA no _ino_ _n __wam so Or fm a t ta.J e .sr
tenmuste 0,hd, eenits Is.i bIrdiU A mf~Q% X. =pt TiewIs---- =m
alIsfla s Na noWleee~gao doons Vtila yrcpo del Eva attI -r t P aemadis pelors. mra eroot laera -n bdncentknroa I tm l ea dn ~ o
n"eg r l Ite sE aig an taJ r a dv e r i o Arwty p d o C i s n e r o d l a r a dp e s ul1 t het 4 s e r I8 SsOl fGI T A
( LA Ag.e 4.eribrIi r Unlen g eSt mimled clessy s, r*Anl r esb ru 6 n Ms e o, A ont dose r op m ma e eam o loe m e n oape. or
A% o eat a a oAde *r ermIaAe e la M D 2MCA essC oof deeaptlae do osn 6aeganga olas 6oaa do aneft t mu l o. al
rdev eepoldt s*l.a O estolo* ht dmblde y ue p eoelut A N O at.-eno Cs ldeen f.Jao.edvWloNtD bo rmanene tae or, od no *s as ovso a slar .
O sp e tlk d4e qn Ilr and oted &m etantvo t 1s.S U OC A ON E j70remauen". IeIro -2 ecco e 9"ln l ea d e r deorr n
"""i:dr sao. mpie. ea A$,,$ad. _BB O A__o_ _.
teeetaa hte agagewl qi eoni do oiu t sir-is t ra c T I7ndeds4o d Anto ** ee l s r o o 1u d nleote Ielig l el rmont
o a al e ae rda- ad op *elive. Irnrlomalectr ,1 -11Wo10 ta 11n111% ~
Peaoets A i-nMloeat Wdloiarmi Uea qltaenerbUt ee aner dd t a e eR k "a als -tteu dse t eIo eaoo se dae& cla dtu tJA
10 I radors-tun deias Ifutn do pCi m otlaveeessB am AttmtaseMleooila Tsn~ o dp do ea c o raic deormem am paris, Aos ts. at "Is. m a llsom a qott do colr, it
Pw odab al@ se A i e m d e asti a P pe g p l s t IIM H so BO M I O son De s o e rido 9L Is.ea or b .,rA n qo d nos n I a i l petes O.el p"altne ote se Yo eucse e*t 0.. Ma as Ao., sc5 0ras1 wa 3neoj d Po F ore s e. as Mr0 4oi-1
trients on uc seot a O n el s Ste ie see on o l eneselees dn 4 s.h o a se dao o-t o 6d
Igo tsaffo d r.S os 4 te*ae eansr q*e*Oa.e O53oAr* IR tW e SB lICTA do, aa Id Iix p e s o.
d* pd ee an steametap wrsson ooM *w a sissl ba de ar, a e qu u ot e easrr helgS6
erdid na oeo i111111kAn eer. 11 rr [ d do od d m isarwaao S oe n I ha 1 a0o a l
P" 04 to 0 Im Its #6ruasi bo enoanjI"netistea q oe dango ls es n Al e e a P AN L a** L to Dlor o0r esd
tpoies us i be evresoly Pseaml vmo awemses ssuprs6eo a ***
a dll.Jk tl y u a v&ai onr at r *o i 8o, o .7ep,14
Eat. jn=O&stlcent. OdO A anod.. 1113U1& IDIVI 1041y
s.*.s's, ieseasr isempsfaolshaol4e****n**oi* ** a~o1~eissol..vacavaoo esd
II tns a'a llr olec rV.~~nuanaoei onlo 0 .l--l. MA l t..,r unctet emud A 0 m s. s. d-p ood l.. k ~ Murpao III id.
,10" amako w- a i, sret" too d LA 'cr od ~b lka fola L~ e e san vmi w CtoA .A liIiua Auxt=1lgade dope~ I U deo. ei w s O- m a Jd.
... :* ** *" - 1 "m -a**aqe
~sae a Mresiued -t seed n~ h~ tl mus.et SM MDqobb.Ish.psalt. e ...(Toe Ai.a
satemo n ~oar me m enaseo, o-- J)~ "ms~ sakaiskwe tV F mmJ- )o -r HN N *M tm sera ----t-~ -~ u *@*o m .. oaoa
a w qO e a ou e dOlya eo r I dtaft 84 haii. he lUaw InsON ,14"M & ; t1'. E-2. eo!m eSahelts, Isom Lc ol n ba .
stI e.l R.- 7* II* *d t
eero a t E01 -ml ajbAu se r **
s)Apg IB8486amma angio (atako 11g fr. &iW 1 4 8alsUs
.selqi.. *"N.:: MTuimd.1lroea- lMlu ton-, sa qoBRt-Ms 7r "m:$n,
a aglgt p~~qu l3i rodtdl uem na e sy t~ al mrnarvlon- d61 11411 04w p~s.otStL3 *1ntd-p1e2Vot~otn bln de0.3t l~al qucdl~~ae. rsoinI o
ulo mil dtp key m ist Ao, cttzuold" n QR05040h Vi0 dttoiolHewilo msa o o1t n ood, y .. naseo st d. dleate elies e
q~iomcamuuthndd) Le l d I-gtleLda stetsa me fS Dese **8*ee 0** ss a dea con
I~1t1A t a L il au t eIt.-rsLa laeme trad5 p-0id o I a 161* e16 a YIU. eI 4d2 0ot 100 4 o
*** MfiB e asse I, ,,,,,ap ..& t.ua.e "miai aoaa _i *at ~ tr
dn a ...IM *****:- ,:. s:e :n 14 o.* .o I o o >s
eks ele ies ( e, table. swIst ma00 qtJ* o Aaktee]td)es dobdom -lo, .ln ea Dooso *re dPam seca masu &en
e q o I. coawls daa. e 2 6 1 m s case dmbor n I a. I* r
tenotetbl vek'. ao obs.le r ayo.s j m &Posntus co q 4&ioeaiirtlda0e" lau,.Jovm gsoelao1tar
foalartsed ownr 7 M olmt- antax- 0os erSU OC U e tONESt: I110A De emse 005 md d floada. o mra.,
*e Ue utrolM AK.-Uoe d* mtile~ do 'rto mode. noeinpoLto e4l hlmul iu~sm0gota~m)0eA4MBR OO II ta14ad-ocmdd 1..u0ornl Potie e'eo eko o el osmo- -,n ,h i a. i nl dadwbeemla v l lI atioollosa. :ativ o ns, s) Ids 4"6 1, arm, ond.ei forma1s- f Def o Isirvd, wli6 'u Ask< Towked. ,6 79qur o ,,,,w", , ,- ,,,
to3 .aiwal olore quo op lla at. tmao1.deim z~rtr o s out.6 as ab asi~ 60 exist yursrmaobr~o.
,Avseen m&oslr nteldon, R OQUICRIo BARRAs $em~auo a. ceusia Aso-------------00 U.sclaas cua. .T. c=lo = = =- In
0041 tmrCoclts'. tP vws meE Dms"i do 0- DsTa1,~s.~ od~e~a A 04tnnoi rleere ala. qA& i n s ,rontd e(.15od a d
,i',so. I, sm,- o was It Atil r* 8, Ado,
Peri-"il Potdot'd V' Xp N inid~ kr zIs6 son oJ qsio olprvelyaIndisnl osensa t eadet p. rr 4L0 1. la 421
a, m l itt i tlad b. N Ued a. lse i 6 ask ole- Kok.
chit "of 6 t inrim e ofnet e, I u tid Wo a idImmmem ".,um ,5*trel flbSL%,re.l- ,, m nPod.oL.meeftos. Saba
ToApiim*rjabnt tru -rmo t 1ea r .o bfd.1Otnttt. ?dl.oadteAt-iruk:tLalse..ln ~ os ~ o dpnl~eae~gnet ir
an at. Sulor Asi poudla s. C e CA wU 0 r Jo.a r ,.I*0245oy -ajoy 18 n. ,Uotm, d ea .
.xI)I6xiPb t e o 4 0 l &Qea nAa I&e rreler l06 mas. Osoj Nd ,ig ,d6 A td tssd m '.h e ,-- 4de-- .lo. actom Las eai 4", 3"C tattletmenI4es qubEr al, TeDu p 4 aR" 4.tU* BI&P Oa blanc.
1i4,a~tamt.ysaut*e lltta. ~ ~mp.4ows n~ uis a yu'd .. osu set.. d o yoere~m.wc~. ~ I u Ooua so c 1mnqSIa..O*&iees J10tetars ekfrile iyP+ l" + k Is ovjrw par Mese ob-N16ysp.1lteoliaaoo.a eak ol
1W tnItalian uwee r6 soZlevi &V les 4" '46'.d~a tie-f' mowmo Id~ taen do Cra 1g,, do~ Be'ga, misv.Oks 414
-L,-,,- -- .....dcte ,--,lm.-- -: eiitie-e tsas. ---_ _ __ _ ls-_________-,, om,.-,.,,, .o, ; Bop a kt L 1..' easo _"11172__:61_06_ oT 1- nJ. VX43 4-2
JR aunneta Ad# solo4arrasus ade t 1jaw d Iii benlime 60. Let, stones urn mnqupcist00s*
- -m e--- .I 4 def Mtgtel
d oe rls L CA_ _ _ __a. otmrilywotlak3jrm Ln rs a
___aZm ol'ot-trtst vh Lo i1sp9 &fent- AAtotf 4 l s 4..35. 0 aomop BalOf,1 e. L h Dean, e -_ -lInes
maduk~dalloadoA Io 11onnn : aaI e g 2 b abi t la ome e = ~ ro.I
jo .1 notabo 4. ee-o doft'Ae. it au j ja tte 6o *140( 12s p asse 11= ay, =re
haldoto.mu U-lea~ ones dod toe n.A d o..mso&O madors:3~*ta5s
at ~ ~ ~ ~ e a-,~ p1otd a0 *I e r, anst. w eatngrfo P osamoos jget.m pro02) del- My csatsibaiosya =11*3ia4la00ad1, 4.
t.U i~l~0. p01 00 ~o U I no paw lb e tadw, p-aiomda In g se' 'b7 io 1 5 f, a~ t ~ jft 1.04.4k a,~ an. cmoron Ai'roams in~ ml ca.i aslao-aao
C161 Sekd;ni n nfmrordI armd Afr a ilie L 2040 4,261. se oa 62
-doilses *m.Ltoitta of muzi. edl.ene1vsdd 14AM I"O' los'n 830ensqacor 1 V A fe do SH Urn me.hec.4.-A~
-3,,~~Ite ,co lc y.~ e 4 b d s b do imprloi lempe4.1 Uu A0I 4ps mr 3e ifmpoeem4 ose oaimeos e ar s so te pore ..s
qu so loib on pouro 14 j6,nu .am.s r3oas0ou~ 4 t
TI~""W Tk iet rd do. j r DAg ti4a,( Iical uY gon.0*Fas* Nrea a.
tw~lardiA d d= 1 -iquist AU = Q nwxmrlw _4)ero s___Jo_________13"'61 Y. wervieto d u. a m la o ui. to Nca
Y ~~~Mb Yt5t1@ 031104 Petne ale se~mqwWf soO23I fo-ui bni 1 10, 513ratoldae P.94~i Aw is lfN..t oioca smes, .14
pedra b oanads. r idPk s '4.av .~. apo on& joa e4.de4. avotos dogb Ame. *finds-~ ~ p' l
efide henoorkes amb4..r oi pc--43a tor qo I&o e ine psta esos eel aevisua essa'tm "Ance~o &~g~ et." d04 ujeco Qs3 Amw p lionairm delm 'Vrolmarla pooirreot14 doorn- so o... oi&.N.abn as LJ mjr
dat^ iivaie Srs.s *,man oe IML1UUI... amAUHIIA COLAI404hU 7.tw *.m d Tie rta.A
elentia a~n-hl =W:~ a"*eam dmM.U hbis
resy ebo oserom cutZIIlutr Cili, qm oftdl. cnsan-ste.JI as emposeeiat y m e
Ujk%-vjwqu-Vro~w~awrIso y dn d#1jp~mdan. espal It, applsbe lose rndaocverr
-e beveai 3 r5m a00 ooclneva0 r__ a .1
do-19 1a 1YA ~ ddd uo t oals Io -aha, oowas do on deped aan e tlen enel.5a*




SDIARIO- DE'LA 3

J-lIo 21 do 10.

NOVELAS CORTAS.
BALADA CLOROTICA.
maghewe eeafteoRe e campt-l plide, 1te los aje Il*** de hdeNt = dit A nbe Ns grl, @el ceteelo demlacre orbitb mejaoe lm. .
Wlnaso iramas toptloo "Seea, -eechledt ke Se, bs apatteba
*par endlit do ma Sol pe- delemm, y ce atiomfen Sa edma oe.
ale648t Un1 a Je se om araneItb A ieM pies,
EIt deitentbs lestmente, soea it. ae" eo lI"do". mOOS al peelo, An, sme *aw nerlia veMo, bei I eeAde ortimedo. escapiede esgre. I dIl do Idli e asm tre bkeso, ;Or4eal -- grilbtob ggl .ia Oh, emelode de pueatitee r js. Tie, ta piedad de ma, mede; ten peses jillas a cloreo ., 4 pe dad d Ini Irentetd.
de pPB jptreat, yeasargoe ei e teir Is frta I oprlmhi entre Ns lie oea m ore aee homron, r braes y plotelob obre seis lablebs bedeMedo em a s obseurs, ioe ba0- son. exte"O em y 'm" alva.. TA vcims plpitlto a" 6re 2
U ., Ipe 4 oyemclteo y e'e'"ltt )Iilmenl HI is wre&6 mOl ru dI1 Meita llegr, faoelheds p- aino mente etreo s e brakes. M enerpo s o eam beAdkioa y pe$ ea tine efkr.tis, agit6 en sasleetS d6bt*s, y qnced6 lile adelkal"ba hints lle, loe fIfo, intet .. Lea m0itils beauilnron troeasebc e om brelto y pagm( fa de tintsm glances, de vapeo liide. ritmoment aSU beao enta aqiolles IA- Y Is dces vottr4 peasdemet ; pill I PI. deo reoeos saiteron de ou puplt y
Y Ie del grape adebano y vibraba ron t.a tints tnaselades 1U lIdanoes eo tmle at em rpa. Y tm aMlienta, l eo, elillladole I m eite. anlna d dolor, naen e setureue all1temeto eaT ea an epurM4fago do e e Io cmo a OIhterbs bejo clhn do nobes grive, el erepAscnlo des-. el pooe dr In tempested. envolvia IS anhereoas t lpleerlsn sobre
Maldreq dr.,iadas abramn se radi. as pdrpera li todiddo %a ol pealeate. lie, apretab n aquolfce monos, lora. JK. UUUea .
Ia largeimnte Y ellls, imipiible,

- ~ ______ _______ --.1

Deando determine V. adqulrlr un buen piano, no to bhegoaln examiner smIt y temar referenclas del
Piano Kallmann
S ms.r..,mendado po los prhc.pa.es proreoresy person.as d reffifdo gulsto IICalCi, sA Be le difleiulta el pago do contedo, poedo nsted ee4tuarlao por mensualildades desdno 2 centenes.
JOSE GIRALT, O'REILLY 61, IABANA.-APARTADO 791,
e 11 alt 15-1 Jt

!'4A 1! U(UIACIIITA a
t MeliaPe me4 1,16e0c 6 do coler pte iantlolr0ea 1 l. e. x14 ldo
.l* hss 1 441
1,14 HOLICI"A
msje a de i 11e acl blame 6 do color pee orlitr u lavee y aydar so too q sebe trtdom qta Un eenrute ae e. 1
me toeA vue 1 18., Vddo.
lawl 4.61
-e"lllt a In laa iRdera qui s eli IU
4 in, qar sea eteoqoneag bueetoe luthrm0m, .tlo It.O no rm0too, Ofule 2% 0111' 26 ISM 4-20
t.a.,rI o" si?:"tr.s'utc I'.' i RamrTn Je Ceeey FRsa1 a soatalaneso Y Fiet&n aelice &Piea do uisa. quo ms pre..nto a pa s o s4 atd* la y da ltoroee. Inoric fod. L: 'omnil.a. San Ped'. 12. 1437 8-20
fPe al at oloieair ina vI-lAtl*er* re*e. li'rala do iopala, d doo m*is y medIo d, cries 1,0ne I nkus telae uer quten reaSide po r ell. 4 auene e.ipse m. .. Ina. 1i asiAr 14 aillo. 1414 In ah s unamuin r dea-colo i"erle er C"ed. .,ralld-d pare Is llmplese
deses an hoo mbre 8Pe actpe y onti* dclao pislr de le .etieae cookers e I
cniqitcbodontssioraa. llana r'cooetanda.orm. Ii. bfrznOa Fregotrc 27 A t104. bot.
Soe ssaledrlt t ar la de mano do mdean 0lad y eobpee4jcl6, deo tn tre.
rIo 11 0 ar mlo. Iynag quim Iseem-le* uea 1ol ee teiet de 2 I. in. p do S* i Mfguel I4 Jnforman.m e deoA U na buen crialds
d,' mano a ldleU cIeleunbradn&|trabejo de ale 1q~to-irelga buen. rouomenimdaaooea.
I- 4-20** *
to coltestlo una mtjer de color. formal pars ms. n"a l. i.t.""". a limpla or" Iebas e. Beldo do contend e, ripsellr a. Ag1lTL 1083 4-2
iaac ase aIln hblue re detlve y lionrtdo pare tr cI cmama. A vendor al "Ceuento Ame.en' quo pg todo obeto rtJ6dov pasdo. 1l3.10 .1 A : T.lot ay 94. Hotel Loi'leo dsp6.lto. a001 4-20
t aa Joven penlnular deses oloearne 'e ojsd .re 6 crda d mare. orbe onr A Ps41 y A Uinq4o0L 2lone bhneou" teonrmd"ela.a. 81 no p bens c". qo no
V butrle. Oirpla 4 1W4 4-20
SE SOLICIT
ut 9 rlada, do su. Inform en el dompel de aa.muic do een Vprl|dloo.
... 0 4-0
o n Jtopa solicits e **e
0 e1 Ce o; no men proteeeloe. ole lo qo. dod.e. era frstbar. lligfrae 0brspia ml. mqo ________ _4_.
1r a& as
2 qoii~ ~ Faniiacil
(0 be**" referenela, ollellas 6 Inersnon eaost 13. & l v 4-3D
Un Joven penlnsular
det malasoa do erlado do nane, sab. Won Sc oblJ~ljemo .s I.e qeloa t oeowleode. In. = =mi C ycO 7 Compaela, bodegs.
311PICITOICIO.
Sc a .Ili .r oecot 0.4,.inn a..
..ad.,d o,+. doOver" a0
TlHN lDOl)0i ll Li IROS
prLll oreoe -"a peeonlito, pare lode old. 6 peehra. Migliue A X J, Agrulr l6=s.B?, ooluoelo, 113
l'"ito e rlmndemu. alrlentan palr v14nto6m r. 10 enomwela, tranaio ouili rasto.! Trisooreic y leeito groadas ou0 oifL's do Irub oej a Au gra epart"
U tenre 0rdelibroaqwetlene viarL h0 deeodpade. 6 ofre pare loveie .. oI
owoc e4. arto pep =44116e yTlrehm "lal Wom, Caccoodo Parts, Olp* 60. LloaOm 4. a.. gr laifeeeote a)* Couterelo.-Aetpnlo Al.,. c o, sas. cee raaldea fUj ec ol ACI-,- 4 1.4-". Aenosnop laacela t gel Ca- -. -Juu-+ Ajisola y 0eentase*, i
a.teentw l-,, n Asmoi Almmn*a, CaP I wi
-e I 11.1ih ..lOttQ e u j6
q4 a' ., a eI. tao oalr ules &*AM son.. ad h'-v eYrk- :1 do t rote. waj116_011 0 Les, li L low 4e ellivtta nua, soelaera pars unas res416n ra 32~~g a6 INyaaII s 164116
piowlde Jlar eateiaoslootte Tito tioe-e iNit SOMJM~A
Ovewadde ooets o R As oobO Cls
11r IN--aT
1". 000"t a m vesi. Woe"maoaou
Ia oqut
!..WeW!41Sv44 l.o-oi am
lOobabi doMaaceo. 46 siol o stao 04
evulds ft ia anee..q o s ilca
L;___ .

de osee
o et amT-l

De***f ceteetme
en iTalo ddpmdeeis eehseds, e *do qup I *ea leen l1ae ma e pt
cos, ** 0st
Mrlelnla ropa~ol bia reconte.nUnS seflorn penuinltlar
debeloaaro de arlado de se.. Ilebo dosompeotrr tt*u a. ollugns6p ea qalec Is awate.4amdc arma eass.a 3.
Iln Itrmlaonlo penInsular deei oiCA '
Ml ree wa mn amlil* detn, ols peat
es. No loony **ei s, eraeda, ansaedora 0 etlar ai0 oe 6 me. so e Os.., 6t.a.P!61er Iu~oe.1ie n4nn laD oemT e a r It em
SE SOkICITA
aenadeodomanmon P s,6m. ,ese m tem netwele sin reps 3mp M
Una eforas penalnstlar de med A nta coliC, dtom collr. daelde de user. S.be u*meen aeud etlgi tlea qe In teeomle In forman Agus.ate li.
10e1li% @St~~~tI
l- Ia '4-19
Lnam criaderapernilalar de nnes se p redG do ptldn, seoma a d e No. pe"" v es aInsas e n ter 'nte clo dee ealeea~orc I losle entesel. fceae qu I. gern11e. Ia.rman Oorrsels name. .
14540 1-19

sit
oun&orl"&de ma oM.1 !"6

nASKJO] pen inulardmsea olocarst Ia inl8m01yI
doorldedeac OUsad 4.-Msr o.Ic a esla al
Tn Jotsn peninsular desea coloare f e161 4
de 4 m a dside 6 rkneders, 8sbefle 1146 brosnd| ocderildAde omao4rns, A;dort; 00 eI- Agncladae po Sgaeton 1~coe1e.p o Suobli- H a bdeJ.Ale ID .~enoqSumss reeoun lnfoeranI Iem n d
lw105 0& oli ecdel e
'Uima JnVo.Si penlnir aer dooe mla7r. dond 4elat 4
ede.6 s e, ,1c edo S 9e *l 9 Tel6 fa
A 0 rt dl fia oh agT e 11aS n qu nc s eto d- Io P
H4 1 ar 1 o ,lc;r qe.
Dees colocarceman buena laann,lerm losmt esl ONV on oa esprllotl r Inform"a Uab.ne -q 1u612 It dldao_dege. 190 0 .o de^e s abe
Una erandermpenilnslar de D. d erdo P cia, peblo Marl
es r boonay abundnto leehe,,dge a oocaloF.. .r ,pomf-e do
A lehe enter iens quiva wl. rar tio Infor.t ie orm .. torja, l
men aba~c A 1m 0-0 or.. pa (le
SE SOLICIT .I M a
SE SOL the rAn.+10T Md
una crinda do aiano..Prtdo 8, bajos* ti
10Jnz 4-11 4m 160fo
Cocluer..Demna colosasinan o-n es. ~ a~e me do omorelo.-Ianforman en Momro ame- Iraonea a Drgil roA Tatller do Leado. rto de Ie M odes
-7 TRABAJO.LA 8RA. MIANUELA IATOS ftlimemontdoT
Coliti, Vve *a ZtnJe. 27.yIo0a*,1&" par MO. doAe de qW
toe edlo A to brm .a g que M ol4.19ol 11 10Ig r Olmote q ,
4! guf Mrrtor
Una buena codlners penlnsulandese Be des, nn cloens fonr a pot*cul dr6 eStableamlonto; me.Mdldaride qo
-Stud*ocsel see lieIcaencluloen ,f0' soIli doi oun M egedoutle nene nad, gitialy trae~r ,loa.lr en seoed, ntonldo quiet t tee. q10 & ir A In DAL inn.. l Mfoto. ., do1 3 L mc, Mnlquo ,
1078-

Casa dn Crandersa.
En onaulado 13 hay ite-pre algu:m de disintoo preclie y do dlforenles tiempo d. padam soperandeaoloeal6n.
lesean colocarp de crindam de mauo ms o rcora poe JOnpoln lar rn ellSmted eo el pate tenon quisa la m 1.rtnueo; i. fcras Nlan I Igee U$ slo., 10175 4-16
e dress onlocar unsa nora penincirat degeolernoabe oner lo mpBbinis y I)& erWj, a cae psrtlelar 6 doItb4selralool.. Informcs Lompssllla 3, plao cHrirpL 1 48 -O
e dmeeas color unat rlida
d mane 6 maJaders, en EgIdo e, lhlr sa.
Og I~l 4.10
Demn colocar dua ecoeiners p...
lumlaroe mlmstadsm aeon &I Al aee alla tAmbi6a oioe0ra pa td. sIc sh bcre. do Isnmme, on cim seo r nottab 6 etleomicul. aI to. q 1iss lr rcapo5s1. WarManOoCrrclee I Iln 4-19

I SOLICITA
Ian kro soe n a1
SOLICITA r aldo l etian e acotu
640 160 adaaarem)OG ma~leo Rand. ec Zsee
ca 7 Vlllverd quo stes els um adteq alao demoo loey tm7 Ihjeoece, 0
VA WWI'*S"*
r SOLICITA
a auerar A og"del 3Moot..
Loeheo peninsa
mug" i&L 2 "14
e
r Ia reoidenei actual ts tap, natural de nll gdarm, n Joan do Pllro, nm sm+ qum I satktem a lel oetlee .D. Adtonlo ; I "Nueva Ume O j 11m,
sloeazo en buena c a atwomendaeiono41"."as idO. lpforpie Moea~does 40 36 16-16A1
eloctrletsta tonoC-pr/ Uco re"& LISO are.. 11 I. GfeorpmeciWe P fdo,/
1,Vk 04 negednli" uied
&Atnol 74 doleda.L 10-18
entrar m hombre doi 10 mittt ease solder races, -r. r le ehe llhaaad~wqml in woieViboro. Pare r.oaJe 10

Dinero 6 jftecas.
I)lero barsto ea hl ptects
Ala7s Asde It mI a sita
ch,=aenlacdreolse. .e baarrIos Vd.d, r,)areelonal. B eomprame an d lef0l
ael. 1 0. 73.6 pOeAset 7i. l*ta
1laaer &1 7 par 100
oho fnes on at, eludre, ma l Cerro, Vo'do y Jea0 del Monte,&1l pot10 yprsa el Lampe el 1 po, 100 an804 mow6 nr ., sen gu"ao 30, J. 4 & 104 2
AlT por 100 o dan en hlp.teeads wasBsoy re hereol s. IstAade p Letims*tal. JOpl4 Io" I-ce geam a"W eccome I i se do*=zpome oomumm r.Jo" B0 y
Faellito dlu o @AtI o pos heen Ota 11nltd 6 ola pee do a gutfe. 11O=clmp2,odel Ion1.

mee adul~de hard***a~er*** Mo de r rh]slerm, 7r Ds IthO4 L
VI-)ADO
*:S*an.e:: 'amae ot i*r. It eat IT 07. & 1 6 & 1.. p a A u l r g e s 4 %, do i A*--1
OAN(IA
a ondeeasIearkem elat k ea de 17 A A oqeet adsams 7receoceQ eroca. Irme. Amrsge doit ,6, lesrrats".
RWliii moses e-m1opoa I 1; vRNDe a na maenDp .tas, a Le an a eetenet, ote 0a
I WN o L I M ae o Siss. on toe1It 00187, sf. a e vemte uis fmtterts
en s teostoo do Is eist. Ye.de de 4
VEDIADO.Dos setares h.168 s 4eee do bell.,4 r e.. $ oio d oeAn e2to eme ose elemi.o, em 1,090yr#eonner. Sn Ir qtMa, MasadAAe de 10117 dC l id o 0%a 11.16-I
BOTICA
as yete Sna bloc eltu.Ae nurtopa, tenoer IL doeKo quoeua&I*ap*. ilmp. JdoV .informart.h 10 -14
SE TENDEUNA BODEGA
blof trtida, ole en e laa li eemeola yec suet ednLAo. luforme Isal y lo,
Masak1a *1, .
a1 caballera.-Vendo un potern psralmo Is oCapital. eo tr 8 eagende. dFi cOPIpc~adel ..per plawn ft d. cm mOml~l ore .eeL Man.go 1 Ja. del
do I ebete, rnscluca eu Guuaqb Isoo .... d- lOje, eftdectu 09epo
ll lnl~m lbell ~t od de. Wc8a ecl
9 C.orral Falso al boder.w
doel do Pedficer, B fr eS 0 lF aa&b,coN I fooda*e:= Tionoun an poe de age n medloL Per a nlowts peej& e P royLodo tlete eaN4ina. D roe he. mx Valdepare Ol po 1.MeHabene.
Cast-Qunlat. En SSBO o o, a. icada Ia krnose C~ ela, do. Labha MadelV k.ddab. oy0 at~e EL 1 .
naiuamea terse* **dbol* flale.. Pore a eal%- w pes e01renuc alolti Tam.
Was $0 ads 01d a "r omUguo, eou do@, habitaloInet, n 4.~0. Infors"0 G. D s Valdepe*254aA
UN SOLARK
So yesde en prod* modemodoon Jasd del )Mote, fejo Nl. at. do loq RepdIo egal efq. Jed mido cell tar" cuadrada. Isfomat luon u. as 1 -11
1o C IIADO DEFIELTItO
"LINCOLN"
SNonovsertsa dfm4. da clL7o 6 asfibdoent 1kd anm p aotnO
040 0 7 11. 1k 4 Lbatle or- so
ness" acnln nA ermas
.1.L forollI l~sageI,p e,elpdory g asol eelco n Culbae men 4. Wisye r2 9" .r 0l 6-J
br de tntbrte do Aamost.
gmodadia ol s a nbuds We
dot ago a odody ro
mo e, s ald | dt .s o eW O mejn blo. DklhcoocagnjPeUldro Ii.
HE ANIMA[ES
2bac ido lla ta, obat d aunt.
dAe 9algo& p d l, outre iel ab undant.. tambeoI Id undo io0 eee do c o atny
e rmalcoloee.o. lU., oto.

HntA DE AIMALES
U ilomaOH eai o'l cahbilaq mtogroo. bosoep heIreto.. Ouesepn 3,Mmnede. Teldbtow kL ltMIa2 Perroedo pures raz.-.e ventde It
AS rtni. w. S Ioer.
ae a mann~'m serd m-

Se solicittin 11(610 ]N PAGAR8 QVEas pal"orsuaaC
repertido t deca"mm7. 9otlS 7".-Erarla I oetd blua illaadoo 5 *n 4 ( 10 Od6aea 863 4-1e m~dbeleo. 10.1tdm. cefiIN~Zes 8EV
Uocieoven dee n colocarse d caa. *eG 461. ,delS llyd8&?7,iI,6fo a eod o ulollodeI rers 0eb%eho el 6 do b"e pdm. Thse 31ee I l-0 .
be Writer pAr. CtdSe b.on a pre bace
Ms .o*0 a Isee ea l 0 se az cro am.rlaZa *fI l qae no e qu.era, dat o .n n a. prese 0o |ne QW l. lopMI 10
saab.~ol I14 Boy wlakm1.3 1-l bea.,7?faso, lit.aoW
HIE StILICITA 3 aln etebiaLmss %t
onratddod e man o q e tfededa o ee 34s i ep'U lo vend s tI llS O 0 llt ch., fueleo2 ealso.. pere qoe se Salom 0.10 u l te doneate, bo 00 a dIt#. a- S M rsaumlonadeIicerqVie 1;1. lmpoarlrta. mcdar, 4 ea, outom aIlda, poea. 5ptodoedq deS.
-- 1031 4. 110 S.l, eal let IguOl, lted edlee. es Mae- aade eInls~ doe i
- ri8. an Wme A MRe aat aflo8om on &w- A to Uin
De oloPoicsrs Ua i nuse erlander o lc.ItI, s 1. Jcem lselao. 5 lge b COD bebaI sbF a dnasLh., sopoedevrer 0" crt o 5 10417 d .Joe-mIs .e asll SI*. 7 naJosesn pa aemerad .eateG 6 isA s o .domn... ca Oft,o da mso 6 Im'A Jalro t;me En Is lTc acuOVend0eUan& bonaace I. ,-ope Meet. 1o a... -'so ep msale.-comod,:eeZOlaslot
-D_4 1 aid m o dam a = b e4e4 P v eu g du 6111AA eI an o .1 all
nJueOs ulodleta to.o.:4.e tdId ,to j 06
pt, dlmfKqq! 8f., 1 4-1 Ma SaItld Imedisto j is ilel ye s
MwaccoGore a o iefora e -do nan I .. us", CAI
l,t rates, do m" 11IlJn = sIn I
Asia. SP" sanmW loo -Z WMco3"a Via
Sole, Iatcrulio. o lmr Hi. Tlame eeLa..1a.i 4 ~ 1418 1 4
Is r-atmko. I-, 13 d-?o eSoLT.ia- obtro so
BeSo soictsa up& ogiaLar-s oM0eia;r a,.,conceder. Lesseawtm"eeno., doeb, bk-e
occi.. qobasoodelia.114 eno 04is, ld. Aiow "a a uao, O7 Aft" ,a ..oea.. M 71,44 . --.
do d en pennsular d o r es&.en, rl Upst~d Joe potena 6 ..clot. eLe ed dai. q I u oel
Is. 0" 21 quo nossiten
-----, -" --- "doo-"- -.
S do Asofa C6a"4; r Iin ad .
kelse do eon... aade. 1 eit- ____ .000 I el S ;
be f use, a. A--34 -!vO~IR~rn. dO complddo.L
e.ed tcm a I alec. J"'R78 ditUc
UlLs r .-rla ,, p e lmsa bi r.do .Ve utile to a dopso,--1 -- o -m a didd-du6 R L014- -t"Vl e e "a as. lae a,
a"ob." oed ~oe9~ oUb
UuEassmiaz ~ ~ idsuid 4-0 e 111uW m mi m-ftes law"O04
- 66 .......6eC.cdateIooc. irz
VocIuedra pabmc aala7 a ein- o= Wi.O zdi i
maca -tA 0 1eoll wc, A.8.Vedado owttaoaaado oe
1300 ___ 000
paaisaaoamdooa cheese Pam,,so
No &icdo" a" u ic wdars4.Ve8S.-,"t3.. oot..
so" do wsame,&O
,easlo d me aed oIt Vob~e. 0 doem..oeals 77 eeWeeoeS0ae e fle 61de Lis" d- ce ULa
Unao be..ee__ 4-10 Vossdosa aol BiccMa apT6
1.1Ure s &a"s.cpoosrapIpsauWOO@e us 894abrsoc .. ce -PeecacParet 06a miqol. aree a0W aO m c c bowto ea. am sb. eu, IK A~ 119179 y a frJ :'a e a 11=46161,S-.~. eaee So&*e. 6o, 4?, i.T...
Wat, do loe. mIcs ampadw lc-O 8. 5014. OU aemta%53*.I Jm 6-a0 -Io.3 0M,

amp e u re.
4-61
e.
trr -atesemo.

UW dorsadodemtbo
,M-. pijhaS m Ia'h.d2, Ia
aN Vit"A
m'ea, 5 le 714 s
do ashes bre.
"Ao .ocdinoODAM4poelow 1-4 hap do mom. Dotol% w erms,"ar **

tell., dnooeotmsV~~INTIa.~
..bi ee ____ y aenouaX
Sm ublo. ITTX) 17 6-1
ON M
Ur

to a 0"0 f~r

U.-

nm us,- e
.ma.e5..O 14 al..
A F% Ii I
I e I.
Met **4ma. LA ZILIA
Budres 4K. entre Apecdk3s O(leris
s rs l4b eo 1945.
I ca." do 8ceon Tot'esedo pedde, nmeela.
re oe aIt*aMe g lode e rta de o.etree61,6do4 spdo M" eesums, "wile asek do, To lea to r de lea Sob e ec oo e eoal rcealA
pe.e seC edle arldoles so tdo e ee IhsIleals, rldo mee r caballero de ep e. Imlliad tae eea meml. qoocestiprulI momerar.
Y btagnlfloos pianos dleeo aso-e r e fabrlcamitee.
$4-v n olte 1 eelA cWs.. ImO0. e par
m14'ow I bued.,140boo.too les. pfan m8lo I toat
iorl,uwo de Iea muebsa gancgl qec el a.1 ec 10n68 It.1OJI
PIANOS RIOLARDS
(Bebbs)
ceart do COes, seabe de oreebr eIs esplclts. bea pse f*leedad t ywotonea do gale, I Rheal. 11.1 | Ftae4 mO bare
to A1.& lafeel 14. 1460 s-12
PIANOS RICHARDS
mnodso uer.o, 3 pedalee. moedeal oehlo qoe eJi.u U, e ed l O aae el qu,
i._msee4+ ann.j ,-l 5d. 8.10. c0 lell d 14 fa*.'
354OACI$Iili'dds dais Iaai8 XIV,
E m l'e de plae 0 e aSSo,
.f ml. porfeetlo e mejee an d eploahble I lod planeS pyel 54 b&rq4d+1 vend. SALAn
*as N1A FAFL 14 e. a amlom rate S.o asa32i
PIANOS
CHASSAINEi RE8
oebode ?rbirlos oot reui ador do polsle.6 p srdte p lndoe 0 berematn SALA,
OCASiON
En Tonle ,e vend: smaon do doemo. 1010 41
am eeri~e Sloelndo p a. cosoe 7 ly Imag 4tnt
us ;f & a pm M6a= Sevenden nlanbilen doe S0 ls
c onu bealndo Mai y llU pe Ituo zrd de firiaee Eisudhekodoe1W4 o
s"o ee., do It y nala~o OttO., largle do aala AlricLaO. AgocelK 8 eoq. Amu
_ n na s ps.
Be venden todn los enoero. do mans fbda, u ngoe pars Oi nue eblocoUrDo in $.unaeTedfonoto. L1 Ia mlame 4 doese l.r umbonoeenoro. Thae. 1 gmt. .o cesrlas 1 4-1a
tIE VJIDIE
e Ioneste 13 lea por Angele a piano rard on bep estadoy medico prlo.
t03 -ISI
CABURA F POTOORAFIC"
tt preclo dofibrlca. RsIoamox gratts la fotograf .
Otro ('olomhns, iportdores deeato fot Jdius.
0.1 N. a Il
BE VID
oun .ct,.0 rajILt
I--v S-li x bkIAC N PIANOS
COONOi9DIA ,8.-T6o l'oo n" 1431 grewvactr%"de ads 6 do 108o..iefaaj .aoae mn, me~loa, eloma epspabeoL ntoo fortag4 .ea c se WIae,&1d0|ai 310 peua clImimemol m etar"Mensu los. _W1n- o
A LOS FOTOGRAFOS
"otnlde, JstaaTI los.. y besrat ea l,lrn.deemplleeloe$ p pI"yeeoas,e lesta dagu~lo cooke 1:10, else paroerop4U, ione nteleedr nto de meP bWee Jseead 24ie
r~non~e 1.d3.d. tg;Z*p ocd Jmpda maspoeree. lan. Auee .
NAQUI1NS a' IrIUA
und. 1A.W 8 is br.!. M U. BIne

SAN RAFAEL I1
Pbries de )l iam.
de0n as )5dtr i h48w"a'
I.. e~se s e* dseen awss det aSa Rafel 5a. .. a s Ji
Mod me mehi. at ath zo I at. do 0. Tm tee mee, (Gre .55dok l, p& e mra ro.a *mm Ne d.4 .0 lege d mual, 4.~l ae-e
d ~ep 4e ss. .~ adce
WAS iei ,,,to. to 4 t t'll md e u .3. ,hde
1th .ia I ii 1.1.

y e ,o- mni I
a dedes t eeosods i
Nft sq n rbea 1
aswIs
0.... Ilm'r.
BUROS ABiRICOANOS
NURVOS A i$8
A LAS, Sn RBeal memwee 14.
MUBBLES
on general.
dHay h ph 3k?
i ,tr wa, to n
ss e ea ie ,
ebW b"J6J akOl
be. slo mmpr e i Uar.
QT 1 V. PAGUi
Idre ad cI modempsleom n "l *m e rd. V esr, dia del Ialaiaan. qe
PIANOS ABMODELO EUSA
Be gar ~an Pr fi -Amlmo U peq bamo at4,e .r 8 rto, b a. V.te lode. PI. Ro'..A. uacid. ad=notieleeadba tu.
IO. V 414 NO"-r 7 p Oeq*V"l.
PL"1J05-TKfM OOMid
PIaPWS OARJEMODEL 0O URA
A40 mbeat eal oadtao '
Al4e11 "ct'28Ietpi.. 4 a
hi.. ~ N M i Were 1unFe p 0,06umn
.= 11J al 4 z

b yeeiahalcS e
LA AuInSA. 94.
eAnbd dino dins a e go.eeq8 preo~sseslabes, 7redes ylpt a
0074

EfPIiti1
Dionitto 3 410A eX;*' A~hbELfO lL'MEB.0 u I 38RBLLA1
m %8MaNO Smt
touaests oN ou *1taodauo L o f d Rtoasabca bra-llate p Are on gonad.o ime.. do mmchii. Boo. p ccreleaeo A psonq uem Vito., mlmbrcdl.eparme a" M7'e&oeee do fta
LA aAd"ot~lnb" mladoe r an
e a 40 eeprudags c b pr dcho ssi l n urt do mp e jor o eariode atas ee4 qut C&t se" 3on dceueko" extitdhudO
c'e tenets~ ebr lat..i 4c n8
ULTIML O1
inuees, proo ds or, p4tt y byt. latest, relq4 y otme objet~os d e
*lamay yPara Wa40s lm guta cOka eo, hwae.grcdes .e-robs deo spbLA MISCELANIA
vso dsael adm. 115 eequim AGo spo, el doe of&
L1 e.le Ilde Iold.eo IlO
bom : o p )e
siea daeor sa d o ac.M, Jededoe
,,. DADOS..
atl e .*.-en .aeda .... as
BOMBS de VAlOR
M. T DAo
braIm eel.m so. metw n. tditfsdaeUE ('h Uak Be Woel 1 Std sl .J e. I1 T&Uer e*%ada d =de eJlal t
H I'm ee Ntefoe A 600 ,'
d, I de v
~ClotsBgMMAS do VAPOR
M.irva, A ertug -s
trial. A pr 00 106 4
k .I '
-17114 111
Mqll o d -vk"c ,

1:

A-

I -

I -

-I -

: 1,

; I

- - I -- :39

-

"Im

. I

I

i
t4
b .A

-

i




". I.,,1r I

Aflo LX Vt5

fi4AANA--8.bade 22 de JAp!io do 1905.

Ntmere 172

P

Tg1g"aM por A1allL.
aRVIele 'TELhLRAFlr
i:rL cde la Maruoa.
ArLmAste on LA MAnWA
NAJDANA.
DEHOY
afdrid. JUndl 29.'
LUBW A- IPAlA
oBe ltalemeadedefinltlvoeace4rdo so. re Wolf Alihmte detalles delose restejes
eee a asloan de eelebrar con motly deI
* i fti doelPresileuto de tA Itepd. bblef tneeasa, e. qua solamente s 'edetendrAtdos dias en Madrid.
ALFONtSO A ALBMANIA
ist acordado quo at Rey don AlKemo Xllsalga ddeSan 8ebastlAn teara AlemanIa el disa 11 del prdxlmo Beptlembre, guardando el mAs kiguros inedgulto aon paso 3por el torrlSoriafraned..
* MI Rey pasar unos euantses das es Cobleasa con objete do asaistir A Ias manlobras militares que alit soa aa do voillear.
W 1RTA A DOIDO
Un tolograma do San Hebahtln Wl. ee quo 0 resldeate dlOenaejo do Minlstros. softor Montero Rioto Saistido a Auna fiesta celebrada bort do delbuque de gueM lagIl6a Dorya.
TORMENTA
La torment eildlea quo deear-er. g6 ayer en esta Corte, h a Interrunmpido on varies puntos lascomunulca clones telegrficas&. rrosos de techumbree do muches edlqjos fueron arraneados per at InuraeAn. El puente de Vallecs so deeplom6 e en 3*s la eres quedaron sepulta. doe muJerea nie.s. De eptre los eseombros ban sido extraldos varlos heridoes, lgunos de le ncuatlm fallecl1 om poeo depuds. S laJo l dlreeldn de ls atutoridad4o s hacen trabojos parm salvar Aos supervlvientes.
Un colegAl publie6 ayer -nos ticia de quoe on vista del rave estado l seflor Yero, Secretarlo db Instrucci6n Pdblfea, y de la desecoiffianza de los mdicoe de "der salvarlo, soe abia llevado au epreosencia el Hombre-Dios.
Y el referido oolega dice queo suprime los comentaripp.
Nootrose 'tambin habmnos reclbido la increible noticia; pero 10o quisimos publicarla, pars quo en e extranjero no formasen una triato idea do nosotros. SHasta, taltando A nuestra ve-

raeidad scostumbrada, negamoe quo era eierts A un corresponIl ameroano que vino Apregu-. tarrines para telegraflar ANueva York.
HIa3yt coaes quo ni-en I s mayor intlinided puleft econlatae s sentir qub el rubor aomemo A las mejillas.
Il Cownerci6, reflrif6ndose al mistno asunto, dice lo quo stguir
BI rMoelmio qfee le ha heho ha ilde grade. Y por sleet no tears, el beelto de baberaldolltsando pass lstem det A Isa ,sletntaa del softer 'te, otorga A Mae an& envidisbls poet el6n pra segulr terelendo s "ministerie".
Dieeanosque el domingo taldrA~ara Oleeftege el ya famoso "110tre-. Dios". Nos alegramos sinueeramete rPt el been nombro de l capital de laI epdbiloa, y tambl6ua porque prefer. woe quo Maneo goee de libertad, Ibertad quo qmisA Ao tardeeon comprometer ontoolaenAdo con esa tei nufos "elenti.fleoe".
Los "Deo Ap6etoles" qua blelerome so aparel6n en Madrid haee algunss ailoe no ojereeron mueho tlempo ao aposotelado.
Y podlera seceder que eonto mismo e oeuraal "Hombre-DiOS", Coys predlea ee eostn tan fuera do lit elan
-Ia qu o er elt sal porou forms pedeai eoo pet an fondo ridfeulo, lieDo do oontradleeones y vulgarldades, per e my A prop6sito pars eonquistar a fe d le pebros enfoerma sonu aie.rada linglda so negriaae y poblada basba y sn esbllo partldoondos como e1 quisters bear pareeldo on so filstco pon las plateras antiguas delRodeter del meundo.
BI ",llombre-Dioa" I
4Y habrA quien protested todavia de loo "brajos" de laGihlrsa
Es verdad, el Hombre-Dios 08 un brujo atenuado por el media criatiano on que as deearroll6 su epritu.
. Ea es la causade que use nuu pura on vez do sangro humauna pars sa curas milagrosas.
Pero en el fondo, las brujet fas afriosnas y ola europeas, siticas 4mnera. Bo 8o las misms.
"Oueeti6n le iIemnpo; dentr do O nif zA la naon
dos siglos quiz& no Ilameran pars eurar al Ministro de ristruci6n Pdblica y los peri6Ico
se convertirfan en nuestros he. raldos gy las genteel irfar-woeprooeel6n inacabable A acampar sabre la loamia donde estableci6oemos nuestro apostolado".
El mundo fu6, ee y ser asi por loe eiglos dlos sigle. Cuando precinde de Ia ciencia cae en loe m o groseros orrores; cuando so sparta del verdadero Dios so

on i A dl ma ridfoulas .-e elu Iisalse oeontra mugro. Y ahlt estan log aequele
pe oet4 es- q**so de* sI* vasmats de t i do replete de ipapel pintalrrajesdo paer le
O e, oeteess4alA "nsa poersoalidad 1- elqtliloe, emlborrodo, donelidoe
- inesa qh no ha aide deseablerta prot el sdor los earetetr de Imlpreets,
o a~.~m de reibir la note sade, peers y mal olleotes.
oAeld do lhaber aide quemada A la buena Comeio, qua thabors so La oportueldad propels pra Ir re.
anoilne iJa CesAyuntamiento hambrs Iuesambe el deperar lis tlrtndolas del ao, e eet onquot el Go-.
deo Vueltee, hablendo quedados re"poml des. blerno empleos A damse euents deo Io
aftil redueldo A etni e, on m/e o quo Is e om rne luo aodde o oes ttoes mal tradnelnamli.sbselle Farwell, del Tribunal doo, iuaploablee at mode de seedo Is 10 etal no podr eotereelar i o t me d ottlells; ir Jorge While, niAes cubmanA; y doe I gran ronven tmVisit. ordenada per la Seeretarlaa vSOres?,-C er de LAdyamith; Mr eta que Pra el progreoo Intelectual delta de Gobernaoi6t. TabmAtlldl. millitar de reeoeioel pales entrafia las adopel6n ade obras dij.ulers Diosce usel incendio dae la admiulnfrltva: sir dketloa de antomes aelg5ales.
na a on nd se lt atigo eretaro do A libra deo La Tea-poer qjemn1oham pe o eeeto U o Tesmork s siar Sanmel Hope Morley, plo--us"do ys on el pa do Ourso, con
e oemo 6 pareeldo etaeto que atigo dt or del Baneo do Inglate 6xite, nsttyereatalessmente al 10de
la explosion del MetdWrl rs. Arnold, atl de aerie seoderns, y A eose
No 0-No s ea personae dignas, seI* peerllilmo 1 de Cyr, de que tenemos
Equa age s ,ti inve stdoslo pode- mlriade de a ejemplares.
Europa y America moo m dee. Per 10 eal "apers Is Pars el Carsoe prtmo, erAn adquTloplalnl l lea qne hai&rA Juatlela ride ejemplareaL dos aquel, bastantet A
rtpld'y frltamnta. relevar tA aetots. Y ha do ser deber
ALTA TtAICIO Els MI LCO DE IAXIMILIANO Inezeusable de Inspectores y SeereteLos perld6dleos anstrhmeos rofleren 'rios, exigir A los maestros quo hagan
las aveoturas del marinerottllano Mi. Ha Ial en Viena, Ios6 08 a feorrar los texto, prohiban terminuantgael Possl, qua, ya haee tImpo, rb6 do edad. I~eoeter Bascb, quA fua m6- menteo a salida de las aulta, y ejersan lo" piano de defeeas d Ia costs de dlodo xsmillano, el empraddor de eequisite euldado sobre la limplesa deo YV eela y hay6 con elaos A Vlast. M6jieo. et doctor o ctomoddm ,manoe do los alumnno, A fin de quo do.En la eaplts l austrsaea recorrld e us pe j hist6rloo. Preanel6 el ran limplae el mayor tlemPo poslble, traldor an verdadero etlvarlo, la !Ute. fn 1t el 1inrortunado emperador eon beneflelo del rarlo pdblieo. tando, alempre in frtnas, veadereQl Y f6 pristgnero y eneareelado, Relevados los Tereeros do Leturm
prodaeto do so robo. edo largo tempo prrado ele o Cb o d tr
to ofreol6 pritare at Ie tdo Mayor deo Islbettad. Al reobrarla, despa per el 'Lsetor Cubaeno" do Ileredla, sa General; loego al miniastrle do Mad- de i es s de oQuer6itamo, regree6 hals IendeIpenyle uno pars sutltas do na. u ambas partea eehasarma a A Austril taleadoque eampllr el do. l o ArnoldyCyr e pauls d
omo lo de 2enterr&Iemperudor2 ?ogrado. Y ni ilstreoa el doe
extrts.Jo y odt 6 gjrdo rlIa s. raneim Jotde Jos dl.mo tomeu tom Jorrero ]ehverefa ha reuelto alD tm suieot" ld ot dw e opaa Franee est do herma.o rosmeonto c problesaa eon o "Amigo
&1AM entdiiasobI at e rods ee.d oo. .lo Nlflos" cya adqulslel[n sotl
rAsee, s INii eslm aboiacardada per Is Junta do Superluteniltallawo ofretadote la devoine6i de Creyenes y 61Cos hechos con denute. los important dodanontos 6 indlesln- toda perfneel6u A predlos barsa- HIe ah los que eniZifuestras scuelas do an direl6ao on Vileus. tusimo so neesoita: obritas fcleUs, eatieta
La prtnsa Italian&a hab16doeletaeelIa prensy ditalnlaa habl6 del ofreeabla Otere(y Colo na. mente pedag6gless stractivas pars I
mienoto yId anoiold *as habiaajuventud, y que deditoadas sparenteolloltado tI extrdleI6 l 1. . an Rafael 32. mente tAn nasola asignatura, despierNate loy6 Is ntlat aoosdoeon ten ideasy eslimulos en las tlerno.
enf do Viena y, alarmadojostamete mu maginacions, y las Ileven do sla man,
* apreser6 hair. A sacar deducaxones clentifloas ~ morr*Slos poeo dfs, enanda adil po- EDleA, sin esfoerzo de memorfa n torture dia esperarlo, el traldor marinero 5* AlgoIarta on pro do sla higlone esco- do ela voluntad, del mnuudo que nos roprsent6 do nuevo en Vona y ae on- lar atl SatOnBeeretario deoIustrucei6 Pd- dca. treg6 A sla poliefa. blies mandaodo retirarde las anulas y Texto do leetnra el del doctor Borre.
8B encontrabs en la mayor tlteorlsa ech a a arroyo, tea umensildad do I- ro, no bace porder t tiompo del nla. emus aqnu, probablemoents, I indeJo A brllos extraojorosqu, dsd los dias con las travesuras deo Zapin, ni fatign preosentarse. de las Ins teuol6, vien atiborrando on sla pronnel sal6n do voices extran
La ozxtrdlil6n eontlnds trantltt, lo armaros y reprosentaudo usa pro- jeram. alain quo e hablaeit leugnaje mis dose, pore no parees qua tendr 6xito. piedad dfl Estado, do todo punto fala, Ilano del pals, ho describe comas do an
n ael Tratada do extradlciel6u no porque 4dle la adquirtIra A ningda tierra, e Inle en el conoetmlento do consigns el hurto comoa motive sau- preclo las earloldade de las elenclas naturaaleute. E E atro 6 cluneo alos deo continuado leas, y hace arg r n sa espirlta el amu
lN EL TItANSVAAL us0, eldeeasoo do manos do los chigqui- la tatorla uoiveorsal.
Ims&OANOALOS IEtITANICOS Ilas-particularmont en las sonas ru- Entremezeladas estan on ans piglna
t RAI de glate a ha nombrado rles- i| doeenuldo dealgunos maesa- Is prose correct y Is rims doaloe. eas
em. oa 4--g de o comprobar trus, hs ao.el alo sobre ellos toda quo grab a on la Imagnluaoldn, con Is d Uf=e4 Ie la Memo. t so l tserole.ro b.trmoloa del metro y la eonorldad del
a del Comit6 presidido per el toulen. QuisAsa el e desarrollo de alganas consonant, Imni,enes yensolauass. to eouneral air Williant Butler. epidemias, eamo sla escarlatina y el as. T ase mximasle altruismo mAs con
ste Comit4 despo de hdo aber rel- rampi6n, qua ea determlnadas 6pocas movedoras, las reoomendaeltonoe mora. sado las contas refsrentes al aproe- doespueblan Is oescuelas, notengan fao. los, mis sanas, dneose, en "1 Amigo chamlento do Is tropas durante Is tor mL ee s na vehlcolo do contagto del Nifto" A los grates ecuerdos de lao guerra sodafricana, ha sdeelarado quo misaproplsffo, que el manoeeo do eos glorlas patrlas, uotleilas de la flora y la miles do racooss compradas no faeron voldmoens. fAuna, lIgeros estudlos del 4 omerelo y
distribaildas; quo desaparecleron mu- Y no ee diga quo exist prooedl- Ila nludustria nas ibnales, Itelones doe ebs uniforms quo reio6 el mayor mileuto pars destrulr el t E lallndtil. geografa, noeloneo brevislmas de geodesorde on la Iidlendeuela. Unsa coss deannolar A la Interven. logla, miueralogia, apicultura y oramlTambi6 aso alude on el docaumento c6n Io oinservible, reallar la inspect. tologia.
A fncionarlsos quo reelbleron deo los el6u y entregarlo A las lumas, y otra Apenas at hay rama del saber Ihu. proveederes do trigo fuertes primal, cosa enagenar 1o que apareee 6till, paor- mano queo no eat eounuelads, de maueque suponlan on total unos cilonenta que constiturva pqderogo elemento de ra fugaz, oen el librlto de oorrero. mil franeos diarnos de ganantla. Infeoeld6n. Ningdu Inspector dird que La agricultura, fauerite innagotblede
RI Comit6 prealdido per el general est roo to quee a sans nadle adquI- In rkluea. cubana, y el dearrollo y Butler no tunais eueargo de buscar AIrir pot aubesta libraeos eublertos do eualidadees de las eplees .anuimadas,

m4t conoedas, do monerst grehea y trtyenste osboatla, rivalom as e6ft los eonejs de I., erperlonela, le man. datoo de Ia soelmogla, Im lulsutas do I rlfrted y IIt, 1 ,fabilldtde4 del amer. Y sl reoenltla, seguraments ullikleO e01 llbero; n ua 6i pir.t let elosa do leturd y leqgual, slo noose pro. PAraiAn do l0.Tdvesn aptritu pars I al at'y y piofandst ousefleaus. Labor pelsgdle a y labor ptr6e la reolistrs lo ihreetoes tae loot do la easetian a6a4tl, aldote de libres ma e s e eoUtue6m de Ii sdefctuo. so qu Is b en volantad do le Interventeres aos trajo.
Y lo auters cubeano lerar4o a. be sbhra Ir*seendental, co-Agrando, eome Brrori, y Aguayo, y La Torre ss vilgaltas, A aIs redeei6a de oes" e. teelaesduIetaciV lmce6n en quo bebe. rAn lo irs nestrms la savia feeon. dantie .* la vid% Intelectual. Lnirtet eo efecto, saber que at Japin-pougo per eJemplo-proeura quo tn todos lom aspects de la exiaten. cla naeiont replandezesa el espirite proplo; quo tiene so Ilteratura pee. liar, sat p dagogia, aso tipo do baques, armiamento do so e)4rcito y explostiroe de on anveneto6n; quep61oVt A boear uso otrom pueblos y otras mass, coanoei. mienlutoque sumenten los suyoes, ian. veuoe que imltar, progreasos que per* feololnar; on tauto nosotroq, en contae. to Intino con Is elvllael6n europea y sinericana deeds largos slglu en eo. n~nuieaci6p con los grande Ideals do libertad y cloeca, at tenemos literate. ra uselounal, n cleoeh propla, of industria local, ti stqulera modeatisimos libros do texto, do eabor criollo, .par la eaoela prlmaria; sino todo copiado, tradueldo, todo prestado, todo agene.
Digs o10 quo qulera la tpe pastaIn sectaria qu pretend hundir A todas las Inteligeneias cubanas eu el prosAlsa. mo vil del Presupuesto, y enervar, en Is luchba grosera derivalidades deo cam. anarfo, la mejores energlas, esoa as* los qlze e aialso y eeoe etudiosoo quo se sotraen at dlaro batallar, y prefe-. ran, .keonvencer do socriminalidad A lo malos patriots, preparar pars Is conquista del porvenir A Is ji6venes Il* mat, son seat lot salvadoreae do Isan. cioujalIdad, los verdaderos apdstoles do la religl6n de la Patria.
Quede sahit Botrero, deeperanzado y trite, coraz6au adolorldo pNr Iacura. ble Mtelcers moral, quo el tempo no el. catriza; carter' aug6lioo que do las ageuas miserias so duels y de las eaterusa lainfldelidades do so pueblo viva pesaro; quenode ahl,-juuto atl pupitre ca. ya posessln no Ie diputartn los atr*. videos lo ineptos, y los deavergon&s.ados; 4leds ahi Ilenadq cuartillas do prosa ficil y sougetiva: ptgluas rics del suave Hvangello del Illen, que has de leer Avldas, y bendeclr agradecidau despus, las ouuervas generaciones cub-e.
J. N. Aainunx.
i tienso eon ta cae 1o bIueqo n l.a
busques n la Ialeuna. Diga la Is cervena
LA TIlOPICAL, que s la melo"qu e so conc ..

IVA y unos creoe que los ejonee son aotpalmente la raz% superior, otros dan eoo de barato, dicieildo que
VllatinosalUNA% volvern & ser los duefo del mundo.-MUTIHOS haeoonjeturamysimpatian con los eelavos, con los asitticos 6 cualquier arot raa.--TODOS, sin enbarg, saimnpaticen con quien 0- Y VI.-12 ien rval au M T R N Ip simpatizaren, y, scan cidaEgni du q "aOc3c5 ooICA EWO BS24 ,.
0-1260 Piden y usan la sin rival pluma-fuente MATE RMAN IDEAL que por ser buena, por no tener igual en calidad ni duraci6n, vende la CASA IE WILSON, OBISPO 52. Jl

LOTES DE BRILLANTES, PERLAS Y RUBIS
Ho acaban do reelblre on el Alm.e6n IumpertAdor do
de J0YERIA Y RELO3ES de MARCELI O MARTINEZ.
Dpdsfto general do los autantleos y legtilmos Belojes de P. IL. ROOKPF EATHNTE, fabrcado s por el unico hjUo del difunto BOKOPF, oreader deo I marea quo leva ese noubre. PldAuse en todas las lteloeras y Joyerlnas deM IU Ia al pr mayor.
Murallat 27 altos. Correo 248. Telfono 685.
o-aW0 SAL-,__ _

TEATRO ALHAMBRA
COMPAft DE ZARZUELA
3EP Ia not n to 10 3 .all0 a 1a a nee a nor" A 0s o LIa"Mtutlica do resortes.
A*los* t EL ORAN MIKO.
M41 IAl

ALF oS PARIS.
Espeoeiaded eI lums de sma*si pa AeIagy somubreros d.o pea para, aliv.
.da.1fons oP
9arateist re Is Altina palsbe 7ey on
amanaskt".lIs
Praguas Ingles I'
USA Uh A QNSNP$VW jmA I tXT
OASA DERAMENTOL
eng SA

Od6n Canto
EBANISTA Y ESOULTOR
"*abe tor dem I emotrueda do muobleos dead. los mA lejoss hsat lo
mAni econOmleos.
UA sOueas eeontrare eltmapre la fi. tham palabra .n leaunela y art6. T4mbl. so ofreo parms reconstruct. 1 do muble aoUgu4 mregtundoloe tUtMlnados I4A On eAs ms 4lonino dotulles.
117 AgWIs1171. Tol6foo 1510. ,,,a5-- u1

Ll INMI PALISTI, =War*eat
ra.~lfl. 6 .
13r. Palaoio

Pidase EN DROGUERIAS Y BOTICAS
i Curaiz Tirifs f e y lt nje, I !:uty
EmuThi6n Croootab,
mu DE RABELL.
TARJETAS DE BAUTIZO.
ZI urtile es i mpIeoe y elegant que so ha visat Arasts el dia, proolas n'sMy red eldos
*9ape mod para S.Aeoras V BeortsuS timbrado en r5ouve cono apr(ohaoes mo* mgrame.

"- OBISPO25.

ta-mb/a ay ouza, TELEFONO 075.

'.1
5 UI

IA EMINENCIAL
"i VY YAIJOSAS SORPRSAS DENTRO DR LAS CAJTILLAS ..N.TAAN LOS FUMADO
1. a A siqe45.
Cxa,-enateat so,41j-aans ... 'Aft

I -

21

-I

.1

-% -NVAM" mbl-- -

- dI I ."

M,16- 1. .1 --l -- dL-AWAL ,MA- -", 'I

, -"PMIF- ....

.... AahL

k I

DET LA MRN
alDICIO ]DE iA..r.A.2e -M
Arao oxe ccea tia Me mesua=a >1aseuiq on ls Oslot a che C Oxzveos co la RTarnItana

L. wm,




I -4-- -- .1-:1

___ODIARIO DR LA ---d*M!R k, .JmuNe 2a de 190.
t r . nI I I i IJ i iii l

DE LISWETAS
(Per t.#4*a).
Yae*Ne*, S-Jnfe A t.
DIAMIO MARHINA.--Ham m.
=ulaenn ftr qn#1ft"& Is (lees
un ~t01ei, si, qne flo. eb
I vie.ti daspnet per Gobrler.
M Jn or de de llemedles que S enceee"ra en 1st diepse detlealdn deo we todivduo quae se die6 ahtot del *I* adesr. oeedis ruals ea ojat. commadante SOmley, emptta4 1re. prem Petre y lnientt OsanOerS, son antia y eonpasam do tos qutwe tr bojen on tse grades eestongds aqul olsstbloiat. rn-dens e etplete. eH ea Noe do squl Porters, Men. diets y Vlltunends, dotd del iacge.
NI corresposaml.
DEL QBISPAJO
EL PADRZ TAUIAt
lQe marerdotoe er auterisede per 1 oer 6bispo parme quaeo HIve & enbo ean etas dless o r d"" Pto rQo pmoatee se deotl.arin I caem ea do Jeu apiell e dn ia1 lUtor ae ls
Caotedil de aLoodres.
Il pedre Vaughan h rcerrleo todes lea paisea "sd amerlcamne en eoe
Ilia ePsRKM, Is morlpetl6n obty.io un
magnulte reoultdo.
50M110 rotTIstOAL
A Is grn Aests quo colhbrasro loa 1'adres JesultaO at di 31 del setual, on honer do Ban Igoaelo do Leyota, mualthili o otor Obispo do media PontLjacl.
Dlea fieta sme ofectgart on el templo do Ikl4..
A orsaItcin UB xmmis
IN -pedre franetieeo fray Daniel ptesoo6 cta mastlml e Otspo all, selores PNlaeto y Valla, antrante ye3rlente Mitotro de la ordson deo San raneeo.
A LAN MAATIIAD
II sor Obiepo dertles DMme seompeosado do an lerretarlo Reverendo 1 Almeal, Astsr t tliardtoalcua de dls ream .o abatina n Iutalids en Ir Iglesas parroqlalMa de a s cludod.
1,0S SUCESOS
D SAN ISID1
ML JUEGADO r ItAL
Ayer ban compareido ante ell Ileen tado Veflor Vld(a Fuly, jous lopeclal do I aua ituelada por los uceso* ocurrldoe eu Is noeho lt 11 do Iol corrientem en at barrio do Sau Isidro, Tpretando declaratc onIe m dcos aunicipalesa serhoro Cueto director del lferocomi., Walling y Polaione, quy le hietro lautopil A los degra ladom vigilant". do polfolm oetflore' Am. pimro iernAndes y Rogeilo Rabasa y eapltAn seflor Portuonso.
eImb6in proetaron deelarel6n lo rit m armero. lroree don Masued0n* C Diana y don JorA liplnoama quleuc opuinaroin qu el peda do proyeetll quo fn6 eneontrad0 en elcuerpo del vi gilante Ift-intras oriepeoud a i.m alta de ilemlngtoun do I maron Le, 41eotemas MaUer.
Tambln examlnInrnn eIns ropa de In eltadoea vigilantes y epItn l'ortuondn, y opIna quo los agoeros hechon por lo proyclilee oorre pon n A I bale
eausero cuya aprecre6n A eian muFA.esr Am a writgundtrm seftoram AetoniO Veil6e y Juan de Dios aunsAle
MIN TnTIGOU
Tamlitn preetaron darlaraen aper el eapitAn tie Ia tetcere etnoin6 do poPle teror eguelra, Joe arlillrom; WiIfredo Dia.y Alols.dro Domn nguez, y le vecicane i#'frtsl d le oiguo Matilnez, Ilim Varona, PFinn" Frometo, Mart Uquileltlo, l)"reel; SAlInt, MurfeA liito, Awa i.onalea y Ioom tilo. D
A-or be hat trouriittto par In Jwfatira e Ite a lan 6erdwo dlopolen. do quo91 toloet Arlanudo +NJAiVX pae i proeotr son erEwtuo A Ia quiula aot i6.de polilN., y 61 tonleuto Ju. IlAn DIcliagmee A I& earut eaiselo. Tambian me bo urdenado ol trnualdo do lto surgenutue Pablo Toralle A In teteats ctaeidu, SIm6n Prea, A Itegla, y A. Meas, Ala segunda e4tael6u.

ldefflaseiaam de edrg 0 oetsetr a
Ye roaase Y dea a ebIo me. dol tlibishGeneal 311spllg llb sn .Wo "d "r I Isel eano al"O s
ye o ee 0 dar & al lifb a
d e dest oe lo m dil7 61 *M p letatA on bil.
Ds. Juip Rk O'FuaisL.
1NECROLOGIA.
Oe profthde gatiellmee sc ahoses eterado dol fhllooamnto ourride ee Is heres"s adee do La oral, o As. tirls, A dead hobk llegade ee bete toie v louleAssgs'allei doill 4)Wtro Pmiy Amrei, npexs aman. ilelima de nuestro querid milgo ntoeato Pltruatdts, laberlee 6 itellgoat Industrial del tmed labsoee y iltembro protainteate de Is Justa DlreetaT del Cetmse t Aterlsoe.
Del t n -itteen@ slers seis blje, an amy the s, sanmidloe Is orfamld
Sua In llurne ab4rassles Ai querido. ri el Is duette, eoe dOtenele ieoste n v-ecta s de una omilln eriSees, pet re lmenteos preabo rs tiste merit l do el rIer, seperadk deo em hjt, lea pe"te doa mn tIm. Deadole.a eolums o eviastmes natro qetlrdae r tgo t*exliLta ls sItere de nuostto doter y Ic.LdesAnes I s rsigDaseTda noesfriapas s m elevar W pe do esa enorno eeaoW ais.
dtUngnido amigo eol Dr. ia nPu.Ale, dtade Pedro lrtntourt es IeImohe do| nil oole. aiUmo d*16 dexzistir e dicha villa Isa rmpetabl y distlnguld dams D! Tinldad Alfaris viuds do Caraballo.
Aoomplfiseoeo eu an penr tosm ditlnguldosl his do Is deanparcslds, caflore D. adoD.r Alberto. Ma. nuela y D~ Botcec, onsome anlel. demis fkmillazm 6 hije polltlt, II. renelado D. Euseblo Alfaria D. Alej Montenegroa n y D. Toniy pllleado
al Set Ptpreme Ireignet6nh peara.frlr tani rode lted.
Rn el pueblo de P*Lnpions dondeore. @1dt. y era g neralmento qluerido y e tnmado, ha fialleoeldo Sr. Vleeto Pra Ifligueqoaano dl conoolroko. mereente D. Martin PA-z lfantg, queen nottra soeledey y eo nuetro comereto go e de grande nalpuinl.
No aspelmoame e corst6n A ta ena quo atllle en ato mnomeutoitb aamigo D. Darllu, et eniametao en les Iine. uetro tetniono dae condoutueto.
ASD7TUS VAERL
AOUTA 15 ROOT
El St. Prutdene liretilo del Bcretarlo i, lIt o d oI loas t .lv uiSdue, Ia ngulent cssrts:
iFfldlfcto do Ia Itlula Life.-N sw Yoik.-JulLo 14, 1901.--Queridoeoor P'reldente:-Le doy groias porsu ftuo teegralma del aeilJulio. Groaan platr pare ml esel sober que m oitrttee elo Delpartmeto de islado es bleti nto. cibla en Cuba. De PntOero pomIrA en relsel6nes on do pueblo pero d coal alempre lie teldotel mayor lutaert, y al cual guardo a m1itasleero onsiderasionete. No hays paln qe uodealt qua ego se apllco tamnblencapeelniuente A uted, ml qurido sellr Palna, A tuteu det-c elempre promperhiad y iltrbs. tur"bitneorglnaate suyo-(tlrmado) Rhlsurdeel. -q lnormblce T. eI. trada IP alwa,-Pstrlaeoo,-lambos .
l Ri, ROR Pt*i
Per el Frovmarril Centrall ond l6 nnouht. pm lta ('le el reprsemenute g ldono y enprZio. *
LAUVAnLZ P;4OYZMro
Temoi eonmlid o qnean realuldo
tmrs d otre lr w ets lia ia, e. bidetp ienl cate oitel, eabrians slt ide do eel i-re mtt "dk ela d itMedalici r Vi leinti Ia", loade ltJta.t sUg tuttle- padrA adquipr I*&e eotosmise. I(O lacra tdilis, 4srom, been soe"sa 1W earto, iss s odlelouec it" r qll-mae do sle pailn, enatntomeite sst.'tits y pecuarlu.
1.0 It VULLTA
STP"hdeott o ade slatopdblstea riotbid eota tasisba te ogiaa udguletet
Rotle Ckra9 S do Jgl, a. m.
Prusolabsteo I la epbilll.
llabana.

ELRl Alolsie dVaeltas en legr-ms
CO dPLACIDO de boy am dice que A la cotro de l
mafiuas hiG o-urt id siln violento teen.
Beor Direeter del DiAsso g ILA di onI a hna Amyilt.mloent. No so ha MARINA. tradoo nd. Hdtaaltmers bsy an lele.
Mtty' sdor minet rage A alted Is p. sio. Co Hun no seitnoos syan+ *.
*blseeonel porehlie do as diga Lo quetenageeloordetraloddarA direeo6a de le Ilgetest lines. Le eted parts ee~lSa tlente, ailgaiA4m. attelpo lae ree .y foresee A Yd. l4 dole quo he d6spe6seo tr0eadade A. supeteess eaiersla, o pnoas deetogiea de ate oble.I
.&.j,- L p.O fe. no par quoe etmeo t an a xpeod eote e
te Julto 2 do 1905 avinve eo de dles ashes. Nodolds
SAlerdi, Ouiboreaddr pe suio titt i6a, 1 AI. Psato as3.1x~mstA --_- -- .
He side separiasdo del earge do Al- cAI sosla ,Pre g.fr edo vi usiA- )l-_le.t,'e do J __ i ilo ... .m dr---44 a A iee........ "o
Sm mm~,wmmmwi doiests per f tmspod LI IBALn tmal de,
3 r-fdo d18o mseI AM I ehmidole 0 *ndto do t m0.boeedoo y Copl ca (l ot, it G .e is olls j--i-I oaIs A3-4-Aes eq-o am- so-bu- 1. Av"olaso Beota b.d,& hw Pnml o"A o ahIntodG O bsq4I M&Us #&0do Is .0AS" 60 WW sa 44 a1 ~l oak ?w 1L G41 q 4 14a1ss 14 .m e Sallwaoss, Invoc .
dolgates o'lasm esae meps So t p s
Ieeulitad easoao Is d boedlel Go IhaMles4esia e at e bMau r ore 4 "e~g e lanodr I d 0 -o a s]-Som alstIs d&eSA rr, pdo
ase s aehI e"sedl esre t- 4a----e
rsayleaoc. Pom domtrIa Al-"rJ d -.
Gldss---nd4ba '---ee imoto hs%
otioolodo I lWt negas o eboL me st4$do01 Aa moeldo 40 hOdioltas 1dLeLskI"COCAL
legates ompitatlas qo9eltogopeee M ik perolo media A We Ubseeele Uoe AMde)soe coois ltAD. Naps.1 Go- Smeuloesloevocinoe do40W5.barrio y A jaol detAWt4andro Rod tGas sotmotoodsuee do.- progrioas. P4. 4mos s bse1b5o, he = or ee usel t dia .8 eerltedoS t101r. lme er ma-opoido A u oatmale-[l-Ito sooD abs m I s e p110 woo"t #Aeds do beo oda- e09oW A t Is6 OudVDo dos -- got
"'ISSI *bwp b"Wme d isi" 81 do low6

STANBUIIDOI
Senv le U d I AmelsA&
DE HOY.
TEMUPORAL DMASTRE0O0
Uaede, Julio so.-Ue440a664d f"id me4.a rsoye per as e tmeet rsl que rmed tdenbeentAse no ntmm. cdsto ie pdehits delo d eeorpo 00. eebrhe qotdeedo esepdtOds m els pes, rsliliammn bemM 94 do tea meuias lte etsits ftrtes" tetones le esmve,qes n takt op* weate tsmlvatnie.
VfIMIAB DR LA Xv Uosl M Ife'.. tffoelrnfe, Jorio Sf. A enceune4 de I exiploald6n que nernee eor A bertoe del etouere, atmclecano Jitminlsein, murleron eL olletl te Imbdere mer treltts y tree motnermne; TO re.nitearonheioel 6 ut oron qemadtrm, y fSatne inun 21, c ure uert, "e o lg aum Cimnibo so rod utjoe .etploseld h. it* 100 ItlOlpremn-t rd ltd oel~6 v.llonemso m Inttbsn eta te 'rmu printer renlanlslntn, cl caliltlAnl|.u ielt Yc"llcg .eI eegmlo e,,lt"ndte,. teritaiteV lter BIe%, quo hobls sie levdo al hp piete el diid4ptrhr. p uromquei l e-lieime o Ip ol6a dt o sp clcdleltlO. t
DUQUR ENO&A ADO, 4
Miuichos (to l o herlildo fleron an.eaduios 6 e arrojaminv iomalt nrtAiinio tt et, raiatlo turo elboeto tI oexploin ) Afanintie evi tar queit ellnquie mso te arielqte, la talni enlatealdo.
CAUSBA DR LA DETIRAUI&A loom qua Is riders, quo eatalid epsttbe in ala condleiloes, p on*I vimijqe r loudI t ltimtneuta ll 6 ,'ojero do laoiolu ltA ioato puerto, btiale ueiid,"iel Rc Iceoelt, flneolonar con plta prolsint iily rotsueitn.
LQS RHBTOS Di PAUL JONIM
Xtiee loL. Jilfl e ,.TologrEflaN i tie GboH lmary que l a oeulndrm del Atlintlt o n int ngntde alairstnt ligtelice, .a ilwato sAaquel punt. t"yendlo lo rectos. del t tdlraute PaIil Juies.
No DMITmw
Ihiud"., Jilto 2...L-ul mlembroa st" bhelduete deierilnaltopon l"onforeitetaquo etebmi-etn ol mnde. no litallr, 4 eAssteeuenclnkdtijdemrotee 'leljmsaove.
LA IUtfADRA AL1i ,iNA
(oPesnh*Ui'Jiulo Mr.-0**yer Il C nql cb LJ esUlidr l|t-lull YlB tat'-loe-l ra (lsllionirell" en nultme itiIanlmntle y l osprlirtpJnatsof4 Celates detk elismAs.
Ds OUHLO GIIItXL
.xationirs, Ju.Io 2?.--So anuneti que talls itrt.d.sto bdligni d Sh pa.-AlrliAi bIlsein4 mii ilmlna oe le Still l.ojugore'", Is pbli los pueblos ito tha lu Or(iaelabua nen v4 diltt tdo 31iriitov) ie. eia, Ignrsrinsle todel enoe mleras" de ias V$ictiles.
SUPRRSION DE MANIOBRAS
Ode"a. Juiiae 9.--A1unolasndeobsatsqwi queei Atliilmols".gu, uwvs1tis alt notdetsa llertblc line. ou ltasel oi c ebra lisa trlplmti auo do lis Wllsett. do InecouxtrII dtMar NcgtsIha ocrdidset lugirliobceos doi las niuudobrasdoe erasso .
VANO RKMPIRO
(Onstaelhnopa, Julio 2...Taa iul. torldadessoeatfherau enu Isupeil o Ia pui leneldutn oi, pe olprtunores relial* rulstelnltadto perpetrado y er mus. tla vilt dotl8ilta. ATENTADO CONTItA ELUfUlTAN
Loendrem Jun, u2,.--.n In mlmja. dAt detTurqla nae lconfriuse l uoella iel entanttettl perpmton ayor otintir 1 SI d t ilel lnlllt t1 cl lall so lievA6 A
-fecttsal atlr tate iide la tinequltati ol hcststa itaba htna itneer iU orneto*e. tie sideniedlolldias; so laalll todavtis on olAtrlo de la tesqulta, ousandee a nrroj6 linua biomi ltie dinattllt eoj. ynexplo't46n math hAitrird Tartae persisit i s i 4I j, ipudleido*I el Bsullsu, quo reiul6 lHeis, restrer A paeio ini i proplo curruAle.*
INOOENTE8 POR PRADORMS JLers,teiJelo *#.-Ka telegram do Cnonstaentisopla, s5 dice flte I 'bom.b dlrigida contra el Sulttln, mat6l esiarent. personnel, entree mldmiid e aose "eunstro ee quim hallban on el alrlode l Isemsquita, OX JJWR l DR
POLICIA AStINADG San eesurgo&, June St.-Anun. elan detlleimioutol Waielo oeeldentall. que aW fetroms mnrs6t poer uns boamba dedamilta4.e Joeel de pl eld deaqtel diets e, net hIouieyo y varies ot1m r reen em, bhatlado ae. bde, ademas, no sgron satdiiro do berides
LA REMOLACOA.
7.*jcu.. ssTo SM. T.* o odmaimsSn aawsisr "n0nuio Ii5E540 go"4
O4 -ICt "
xrm ense nJw #.-Ayritae4
VA roi DapLIO
I t llto eMe s Wis aie 6 (Qamoerdo 460A ploo, 306,620 hom, Ftoses 40 IA. pIluIpL seedfp reese qS*oindispos
As, a dgemse etele put. a Se de lateetde nr 2L do Julin,
Im e dl.,a g esll msnites
Vem d A odoTM 0"R910 4s~o

*
(b pe. 4* s018th ~r
Ut neereoe o teo 0dmbeo i
usM perOiv~e mdoo lando "I*la,
W.XARTIZQUZl
bOAYO LAX"O
Obe dtMso A 'aIbhe sateola to. 4.d. L-..1.,14.1,.
em to p toe&ette.
ML YORiUHA
n Otltea sola6l rso pmt (mrdems eI
,'p as Maruhe~s.
GANADOM
var gr enwr Ka4= tinJa de Tompe tam M. m1te4 istwm o
v 1 *ists~mm act
Vol&%, at aCabo=4 yeoat, 61 toraSe W torem, nsatoe, IN b"eeres, 186 Taes hotus "- va e. ea er rs.
Do thm t elvper Andes, para 8. Arme 6bos4* v eon mS res, 104 tro; 4961f4f*, It termeres, 10 vaestmh ra y 60 yemus
D Ovlveeton Impor e oelpor MIrsa,
l m (). lj tooYvmmn Iue hwm, y 46 IMYUs! t. ..Gr"4. dos 6 )86 vi
I 'Sl... ... do5 %A8 V. Oro amAa8 Ie blcetur IL de e 1 1
Gdom0*. at A 109,E.
pl*M5* empsoma .
usa tus..... .. .lstLus.
L 0plat. .
m Pont ameelti no so *a m."x 6V,
-to.-o
Mb, nes. Jts~l *Yt 130,.

LmJ. de
VoNTAn.R L'UDAi noy.
M 0C e d, ysra .
MI[ ..::elt deban GaIrao abmndk,p of'
we at mdS
RCt e arta 9.0.
0 : Late:r mnten L- Ootaat-1. i
ceuseriless Wo, dobit A) i rri IO.Poes eleddeo be0 s I* '$ qL
A0 .. em ds d.. t9 n qt.
0t zro onva dsr1,$ b e ns tt Lt IT& at, Lmon ehal conJ .ob,
Zt Listaia.adec eaJI sa m esro L3.
lb 'jhe ta e x~Bisten eac rm. d.
De rapa 5 Ottid dea 9K4. A OITI'J OiAVAj -- dotE lta o Uaid.0 e vels me s.laedal .,deSe WAo quoTeql qa-te doeb ma'&pX! y sm
enbrw Ild lir.do $sIC itot Et..d
Art MutaINO.-Pos "t", do P14 o d un dtaf.Manoot .
Poe.wqu. yit
Peod aset lim. Pr ee e a eleft roeta*so .
AG,.I--OSt a-me azltae l a b a do ete. nonecer ogacae ., Ileade I& Aie do
d*10 MX.. eIS.
5 D 0 *10. pe 0a DcL 55 tloa LT q e ] Dma*
ALAPAIRsAlo-Bua nabeta7 Dals. mmd e do9'itO m4e3r ,gal4d. e ALId:N t.- arOu czs alncIS ott
dobetella fartando la L ateMus U pated co tie ds
*6pIOL; As kO. DUO & $5 9Bl1Am**Aar1 e7 e .k a e.
.maaser risede14a OlWa. ANI-D Mesice oytatAolas dea fA R qRO-UldeVoela as 4..
p1e0 111 & a gL do Su 16.
o "tamo asI U AZAFloo TJe4 comeel
Cltaina d 1 us Say zag class
-1 Weme dofan *WqtL
-'d&W 4.6 *sa. prossDsOW am.A O.5Sd o 0.44p.6" .O
-OMil-- Ou aris ooa Cast de p B "a Puorls .. ce b.. bdo | a6.USi.- q*IL
ADepal 4 a UNqtL CBU0&D* Cabarsllo A $175 qtL Dot Unfidam obPJ1.20 Ao2.. CURVIIIII.-Gonts daee Os 01 Stoa.edo Umedie. atoilm~e ro. care. tgim.s
DoN sad. U.N.se
Lagms Aa "do Omu. erdle so Comoit tdo.mt=d-m Od* =tto s c a 44w pbasthe, s.
1*441 U.9aomm 1P f AOlawkOstiase la
Cou! --4&4eOeUmogdaeta", do 1P94A
=W29 08141*.ltssl OILsae
#011a14PlAc"
so .a adesAlo
11"m
.. b-l rle@ A6BY54

swe *0 adee
* -r 4*dltau
a Jft qtt, boM****

UTA&"44- eeemeodo mdbar
ausnrf uA .-" esyas momsesas olrtel
Immimo do I oT* a * s r i.the i.--c e B na--5]
ADIAer-J leady aghtd LOO iMu Eo atoyU*Iwca d Iedoa tl P~oASAcp -#os 0Wemis Wcumte8
041A.A eeautk dnsso e3sdo d T aiI
--DPo so cousmosdl de T eto
T Dti p. Ioil INateDa t dasmotad. TU --nott hRin peelo roatt)4
AJO. -Ae Iat-A a d
east s 1,t 50
VIoA Y NAVAo4 qTALAN.Maps",e -lugtI f tdo &nOr OL,% u&q
WIhqr-od. foft do$8 a n 0oou tk ecitieeL607Ka ndet* ae
Omel ctesawa ,sys m, 1111- 4AVARRM--IVARAto C D L&TL I nm. m-0ao tm pe Tote.
a,"Web. g e. t sdo hd U a O &MO pO.-.c$o1 at as ro*02 on OB.
y ,TIr It.-ne ba te t.. o sms =IIOa do 06"10"VA 6 r O *TAI OaT.. es~"tee 7Held=rert qo M Ute 0 afamis, "Nuado we tloies "dS50an Maw" do~ EuscalAN

- VAPORE8 DE TRAVWA
te.'- O Ait Julio U H*henfeid, Hambmrge.
s4 Orse*b, 'Tork.
34-i'Vgtante, Voraw",y Programo
a. s msier, N*WeOcjrwus Mutto GUll-YerR.
Jalo S MontreyNiew ,. Y vees Rts A. Wilelam, Id arL
o 5 erro Vjeeue
Riena o as Vrseros.
- 17 li~mmt ew-.'lwk.
,, .0 ain wh rk
3 1 Ywussaa. Prowrox V a 311. ?VtLAP. Ca lz a
I Me aeeo"MMMAISS.
11ILbe atltmsr~hohb. W
BALDAIW
Julia 22 Metetey, ,YNark.
S4 Orhm y Viao.iu.
i P Rk VerauyTtampleo. D* Tm VI inMel as,tow-*k. L Mzet4v, N -.Orleom.
to asl bo-W
*,' 29 Stotte GuIle te-wYOraI FlulamL
- 50 Alb0IientDsuy eS9a708.
- U Srtns A. Wiele 'eal+ ,errsu. D 50 Moaerrst, New lYorkp.e
ProgmLm
Sm %tApe6laa Prelrseo ter.
PUERTO DE LA HABANA
DUqUOM Bl TRAVrIL r
IttRADtO
O t 2 *eDo Tam oft )4 dlas,. i Adme. ap
tan re n e iraoe =4 Alado soIbat.
sales ~ Was sis. Ev*-assel Ga Res
kelad, tn IO. Can. &L yO
DO Tama e S A J DOSee0, eon buras, vpam,
MB.amL op. WhIt. n. l41eon. ewa p
eiMs We IFwu.slana Or-p.
aDoo t- .n en a dim v .p'-er ca t
$,-147%, ostergao y
SALIRDo
13 o Mao Miami, an. m artnique.
"T.mpak sp. in Siap Latin.
-at.i. g. l larGsltpert, got lug. DOe ii. lIselp.
o ev .erk. v am, ati.eesry.
am An. n
b p tsa. e"a, p vp. am. Miasi *
Xovimiento d pia~jr
LLUOADm"
Do Tempay Bey Want, en *I vV6 amewlesse. Miami.
lims. JuanLoasN-Aurae-- Peveo--L2se. + e-ia e Padtft-krt. & Gu-ery-4 oueua-5&a sdia. &!=s-i.Mac-- 'ne4-. ae no, dtdo-.-J. Siotlae- mao-T. AJMMoU-- 8eo--. l'-mnde--Je Miosm -w-dUs-. Trespalas-AL MNdos-Ma It.M Tuoe--t). os a--. Rols--. L Deld-J. Caale-B. Maoi-T. Baneilo-IL Itams-U Peree.la los.e-5. Go..
aatas5dst~ti raee-WasnseIGur.
-JL as-L Olle-Asneela NewprI1do SamFiaat~o Lapo-Oerwl Ldoe-etouolo
Do u.-A .--n.o a~rnsa--J. i. d. VAlAmaria.
BAIDOS
Paw Mil&tn.*1vp. oub. Hebt Ores . aa-L Haieriae-IL. Qd# w
atm-Maq W. i'alsonot-ClawdoV. rpJ 13. Drivr.s
Pat&e C#.Nnm.ZMade!an *oR .es-0 moao Miamil
ors. CLa.W AJak-B. IL alsaeciy a.J J. ioloee.
. i i -I
Buq=uu =D.rntu I" i
VMtasl pe SWe
savop.* m n p
. Wawoac (5.WIYP Sin.
Xm. Skd ua.
AOU oateeppsders,
Kell, n, gt.M.Enpe il.Ma"

xs me. oocialot IL A
momrue ppm 03-L C~oen,4gp 1Tomb& per Bridan, Meo
-,. a

-
DR LA HABANA.
DO Omen amlo
ORIsw wrats
linoI ed we so o. s il "lemtes ito tOleraeo to *@a .* ia
nee a u s m n.do aIeS.-M .oN. 4 aemede m*. $mluado. .
I paupoa t sdoer ltn deo sake
qr swatte I *aeodL
Sleep.. .o Om.kd .,..4-.. voIloe O dl ree, er o toere l"~t4e ro erwo.
m ate oda MIFL-l lLt Vie ar** elortod gs M afr eel d
uenutees r ne eomm eeao e o. di r a te p el 0 U t e
V are d o ned a e r
ea.s Pqmdsoe. WAU ieSAL. D.
Y CHEY t IAm~
Aalro eA ldob ta l.DlOeade
car, herlans t osyede fs
sl maahn, a"d ce s
pat le s de r I0 leoile
On mmetagatdtel
nluede .5, gees euycofaaor I.vOdel m =. doPIse as l orserdeaodoe
vn 4anels.Eloverrigvia .
da de omosem-Antoolo Ee ve
Atob.no mmr0 ol e. Z Lsi.r e a W -eac.o.re.c- e
teatsy Asepetsam -Isqulul, nass/ E.P.D
HA ITALLEtIID0
r uiT udJo e or b am le ft am
lasoeculi.di ]a tattle del di..
do baey, ma~lido, los quo aolbra. hermana, Hi y dpoo willae. y MSM qu00oe sw bes, muoe@eOMtelMIM en&mnol A Dim y'm eh-olenaarurtz A is cawtoltuaij% SaeR edo to.
Moraed adaseo 29. pars.awls, r flarelcodiver si eseonteri,
, per cr uyo favor yIYrim obemuient. rsuetd
Kub.sO 4 Jatsp ledo low1
Mercedes G. Ionalodo y lHdiepored ManekM*AVwrrII4 Viado do Aionm-Antoolo Eckeys.
pels- Pedro Reo~at ne"*psAatoolo P6m y 1'Eros--Boetolo It yAns, Isqutu Y*-*su
eltaM o

rt
R.1.P.
Bt lumen St ld mace t .lam 0soo.y msdS de Ia smats la elso1
ci. soSt tA, dQUcosl9 aolemnes hoara on aj linsalmse mo.
Nermaenleoemdettede~ta M. L Alllet tl del QmeA 3b&lloetO .484"aolkpobse
*le10 2 4 del pus"d
Iernnde std.etspehe
*a 94m.smam.. as b44641"feuda&-am oms&an A@.
A t"opoese&d40 I 4obana22 S do Jlla do i ism so JIM

?IILU II lm -,
mabdos do seibir, itims emi6n. Olbaq ,1" Triun6a"
CAS K DE RANETOL
DIR EOTOR: W R AL 6.
~~ oomo AeLsa. es4& glslehu t
m*A

A, it
---ii

-f. ,-r"mai-A -A .d la

nib 54

m

43 q &

t 0~

11

v I, /

. e.




5kiD .LA AM4 A-ISgd do Is tard..-J'e 22A.1 1 S.LA. MASIA-,5 ele la terde.-Jlil 22 0995.,

Ya R&uIe*06UoMe6 be8do bes Mapderno .4s dW & *8*4 mob.. do. inI goblIs-y ada gae. tarns lleern
T N M I ofermeootoeno prel y dAdoerns do doe algams e aT pssed as .le y*' 1 raodos ea sA Fetandedo vIA g4o "
eet of dee limo-sa4si d "mdo Tuelpie, el bobeate do la ple- umee lade hWool do rIN do A ybM'e My
Y. .- I .. . q .. m ie.. I I. ....d o.W on a r, tb W. . *.(..I b A e A . ... .JU L IOnwo dd tm oA i t a1 4 i m
to moehu.04.."-Ne o oott o UseIG se1 611POl~t, .atEeBegif 11i(VIMMMVMo) 7ybegsid m 40"
.o(Iser#e y amrqo at tedle- IedAesdete(Amgmha oeo).-. da W te qe .e a (m a entalnds dei Le 4
,io' _isloirmy--oe...podri s. AM ..o yoIs. l *el.m ( ,- ..l- or). lNatew- ap1
_ Or4ampres de doe a. abi, emiatrg t ema N AlMse eamsr abul Y "Di.rMto de ego"ds et de u de e enteee .n... y. t.s.s a doM &. Aardleote ans ui s el gmeede plateakge avive a lm*~doemop V M *e l pesen mdoafla, p0o b s ooz-. Isoes Uwa44 sol te1ateo
Un1fr ettle~).yleofr""Wee liade patedr. CopeleagesoMheee"teteto ds mseamew quo s'oneen setmrlores per am pese mlate,
whod egi. I* qvo demax y pmeae y. iftel10o465No hiai o. 4 375M4..do qu mo We-e o 7quo z__*"a40.yeIsU p am 10noo et a-- a oeJbde 3,Ot..
medlsso~44g 4 ~b 0 los &amobaquaoo I 94tO Yeat des Caoe Jm GameiO Mas I =on, o4 4o4, A0 oWm jws at, m6mo 3otuua ue,. CIsIfau i4wa I 'loAs10q"toheaprsM01ldn,10 an 01 boloo DPHN. U s1 uol iija "Wssnmsfa.y de.s mif
*6004P an, ileo, dode one wsesoeeal 1e otus* .. itoquedo ealopeot que del hoo UiTree. A obsems
se.- to e- paleto y ente usn has do plmelae, re- YT 01 bereo Anl, A1 spoetls, t01 eq eelatam do m.we pededemude IW AO
eonpesmotke ecooes 4 Wlso, y algu. eede fedpor l elopr- AdoedVllie aoem, BoniadeeIosut. s tms o Arra d4 asqlow
1u1V=0 mba. ~ ~d 46p Co1MO0i4. Albitydc r an. all mseartrsd ah" 74o~mets feaotuores li. 1)e notelcmomlso~vI 4.14 P..P~o l~t OI ~u
_ ap eeba ne qoe- U ans m, Ad -ard beeans entrad es ta e mpudie M rs s o a llbmener ne eke t tIdeudo dedmi&btie. n ns
m-a lee de Pssm noeMjas itepr Redeneoea Abe e on l arelanehs eeequea n m oj'o enied uml abis eeaeris i
--m---A I6 e ai. y qurdto r i mto quo s o deo qy o NbeTLQUJ 07Irade n 4came leR vil y dn em alate A 4 r ei le a t al t do quo .4
er We nton I&aldus t a i e ota s, a so, on ea ea ro ue at. t deed* 1874, sin quo drats ts ato A whmish 10 sl um M a d* M d32. ...(1 doleasoities Uides, afree do apamoeaUeealohadeadee a slaemphae. hablaide a una palaobra, limi. d do Mawo. 4,i0s .. ..a
W" "4eatC"let s sohe I s.aminatsprlIebI o t e LONGINeaS "LONGIESlp" "* A."h lor do"ve o ^usad "'. 0." =Is il"l.o
e e atque va dmAlaqdaantod, y qa sn- a q to leatleddo. Iorremnte, q mo enwdid. ,e. Baentre et ar s
*gg-. ** ,. d., ,~U p p.6., selodmo ie~ts do! arteO @ml 01.Idim gBfagig iii % Ad @ a~oh. ti. ire 4144u. Ayt ntt a rk A~t IESES of fis"iP ...",o""": "" "...Joyerls. uicos imoraR r ; ,- rb-ut .A"iA.- g"u"o,.o MIt, to.. .,.
ttra,14ma als A 3e i i 1mometml hN*i. o$10amly 64switmem ho i n1p010tnrdm o- 1!um l,.aboIwsda o-n.
.Jo s yPdae a. e adou l leeo erminuieu, que no to en escasu que to altgns hersedel dia de yer, slrid
b re e A_ __lsYlgperseeleatres.6eio__ anesrtro audge Beedeo Botheeo pari
embllrela haba Me aemouee 4 loptts el i(riVa (Brs. Cee preder oote o do ta prote~i conpahlaruo na .m topopelerided
.lP00aApe), so, Med ewt(Sts" Gabaoti etplko, m ai mel times en ue de que disfrta eltableetweeo y el
joyer m Ro alaosoaea, oroobrasabsio.b1a- ""to 01 agis___________________demo
A. R.-Uespecto isheeeetd 6 eor lis), y el Desmoude..(rts. Sera. d tescemmlenasquel nearrarla ordite de que gosan Io artleloe a.
* -I -,S-I **i 38 uo.o'" ":"'.:. OBISEen O.F 38,+ I"'*-,i""""""""**** **
atoeldoA los Ifomsp 4l GOeelIado eom osle, veledo et tle negro. a -mra m ieds.fU.i1h. Un centenar de persoms entrarm
geo e donds umoteon**eot tnto qqueea .de t*pIOadidee de Oracit a labovodad do ee sta renete en a atigua a.ss de Willon en slleld
-lit lbro Ilulode M'ruipr., que fem la SrIe. .Pedndes d. laref AR RA. ]frili'{SIN s DE DAII UVIAB. la.sases de nahehor, no so m, tod de paragus inglee. huegn do.
se strlbuye A Ornote eti ye fem 06servaln quoedh,er alempre o- ,i a niesdaooncl.dtsrlho. eir que todas salero tcompcklsdd
de dudla que to seelit6 D. Attlo do ri b ied doIdal arll en s10 ... lIt qulet n Istrthuye is determiad6n que to es uarn create do, delpa6
Oatro, fesid 2,rtaR q 1u m qule pele quo batlU beNiess o de ireerae l ftbresl det la pol.tiam do hbere oneido de lamperoprd
dar hasn broaAasel o. lash&eadrmyquenlaeeena ath uwho -- tel p lrde pott da da rel ariedo compfoell do. A
$_3de A _lbba _vaAttatenr-1 -aaehas* /a )I Pambate ce a a e tg ?"Prelsmente ** dia, ster, hab-i
- ~ go -u-ap~t o6p lucia -pod-,eeta ae
Oild lke I'ImhESp**0to id do Ut-*lcer*s- toti.w-tiee s vlt, d :edlea oelsoln mare
_foree (Vi~erreal), A Is piaerwdecena* aselm-prgn, nl as4pineevsa
" ve ( rse. Co en) y d Itdb 6 woB p r J D u ante oa ks noeh a. do tU aeblas va. etenat p l at m areh anto i va lid d de
- de(Vllrrel, Pqaer, B" eW rl J6vee"de&bun homer pama pot pu5o, tods eltegntilmes.
qrveasssele& o y S1tator), aa eotmesOasies tresi Is eatlesla levando Ilinterna y beduoI Reomueadamo al quo neeesite 4.
'ItrhbasArevi mtas e aeseritel ea selesi em emlalr, (' rine. Pem edW nImetlsma neyotros reae nslehismb quirkrnou paraguay que pass per Obc
d ilievadoAleaquales e.ll.m a de lamc, J ee (Nes Dvi)y' y.a mogmudewau bleReletas, eys nlater-" po52, doade enentrau lo majprs
delidameloa, q aessy.-n yo ( uee n eDIa qeras a s-e vt mdies* s r qt ae e areelbe cm pilastlanr
dme boa Ans ,a ran,_.witi(pohs.ofroynn" yoeimqwete.ss, d e,
ela eatu oq pkaleal en. No esla Aeeel it ffsele ua de ea o Aea. o a herabato
segrada lspintam, en que 4lasrae se pintras de Ie Vandle kns, DuA.
deom aVeluqu. y Marie, d OAysyIia. y emaba s reeaei. lm ja- Parbr i ancdio Is
Aliao, de Fortuny y Vlilegua, dyjdme- e-rnde, goa reoeoi ADmot, deootla sinerlesd Oiro es doeUrtod. Ie *u*i2
ae Alada y Borels, tants paede amenqerias asUpfools, y lei tieisv aeydo bua gen *eDrlgadsmo lo .gallepr. Y pera Itenar e haeeo., con enerne.6 eeess te ija de ts g rsetl y Don sAles do selnto.as a lo s
Teyalho a ropaato 7lehv lko n,111s.l atame l m l mtow OKilm. Ovirm* ea n l *r tou ecreai lte k uentaprgm qops prOi
ponTesho propIato egl Us dept qupe lles que aellaun8 r. rom o-menta ates deeded aymedeearrata NACIMlIENTO
d at teatro A dheirsre u pa hoti- Peraedes. recs e do le eceos per so de services. Proceded Arma de Inft-. DISTRSTO NORY.--I vurda bitum Iss eer itb6ell ro a imlaoe Aqoemnr, 0dote s aturl e p rt s belless, pe r L o y tes y andab al s riged de aadore eltnl ; 3 henhr u Idauce legtima.; 1
deoprtando del Mase on quoe yea. e grats, r la l tora do aen ento PmdeCtlu- van blanco natural; 1 yarn negro n.
spiaudido otso Lubo, y compmaeron porrl degaltre d o ibailes. ietuna dOupabsladl6mo4 etreolera tural; I hembra mostia nturea I 1lpara! o lilbro dlversoe admeros de t. de la moons de Albiou Ia proelama el lee de Brigada, con aAntlgiedad de 183. bra ban ntu.ra.
allegre ypanetoal oaseprable s bo, alsdolabr ss do ea Bu hlortsa miltar es msy brillante, y Is R UL It.- Iuln O as.
Oqla y Lle entastamos despa u eas nesp.y do general tompaea eELaUn risl&ma tnI;2 varones blaumdscylegtios;
i.t.moa: ::.- .--=a ol-tamdor bit.: con sqe gurbo andal. qub po- rnaudlmI unnbtl ignntural; 1 orn.
vOd e u4sio 4, aeer e n w o -1.oo.Anet ornsemie!. Iwas o c retanie-nerviedos. rooda, sntlgoArm ts tIfeo DA b R lTONca l -gttlsca. IS
oeseraodel libreod A 1a ejaos. Aesot o en quo antervatan en l etlnla de los hltorla. BI usOmero i do tiens ; seen. 1mwTltro le hra---I hembr blane nitu*
alga er o, dlegro y ea Jend y ag ojore yen sao arteres quet os 1era a- t y inc a no s de dtd, y mAidecn, ral, 1 vatrn b lanco natural,
accede, on eteeto. Blargumentoop. grealdcomAeesecIantoadel Delssado, mlenta o do servielos. Mand. DIamTIIT ombT4.ra- I var6n blano lea re si de tnaso ohrade an elee es so quedab an porplejoe no eablendo perb r o nt a&deuane thn; I varnegr atu ral;heba
ol pretexto para merA laeeendl- ent deedlsse. Yo, franmemente, me ICgrofo uo GoberoM tr ee cbl etioa ntul; I e tr
emtlo Imlqmhuemllmsu-qa~bl e y i ~nia itIa~veiL. DEI'UNCIONIIB
Verans tpos, raqm atesempromeoage. qulaboa otan tr geaelro Y no deaee- Da Don lae.opoldo ManD FurNt.Era
Oas Aul eneseaosm oatutrleo y sars a. ablts lempro eomo ball6 anoche Noen a drid, ondane s mt e ablmandlo otto, Zaldvert 74 alos, ilibna. Cropo 8.
als proe yoee, l a o DAvl ati Auo Is franca e, rlna del Guertpos. I a l ta y mwye aa tie tubelar ll paImonar.
dto.y le gqo agas. X Dit y oberain a. tidel edneddb ,entr-in* p tia current ytrse dnerr.dos, tree DgrlW sUR.-Genamo G6mes, 10 me.
himitta.El.idi .ro 6do etecah; sen. O iTt ferm34ii henbr beaic .natu
al aaod. yea mlj ynmle a s ateri m de .len P-deIantinllel dent4esopleo, eloeoupare o si lfatlann, Glorla 180, mealogti.Uncobehemies racean a grte comalifad l:dmndB del .mehflan, anslltoria mn- Au tTR Htenoz, 80 asI Cuba Alam*.
4to reteto par mwAIsev. 41.emirt d y e ag. Yo aiaet.mdLo roo 1o lbeno311'r4!, ini 1lre
la tee a Il titllsa epn- *arlr IAen ay ato lta.ezeelentey ujuim sta fama deo aetivo b iqut, uaisatol ,
r e p ParmeeerhAuuieyohbya viato t e. til6tado, Jutiflhel ascenso que ole D0", rnlm arE- An Carmen VaIle,
tra.sue sulf re W e)aerqc oy ban ano oonevrdklo La hOrs, 7bana, Znuliets aE)(, deblL
S -- I nta y nu rew aiosmn nuve afloade mornamom .-a el Alvares,
" a ded reint y tr sd serices.y am me,.o mule pEspana. Lau o Beneled" teo
-rea g t el ndmero 0de a elsa. y no obhitante ohollm.-Fptto Armand ,7Bsao, Im.
Irtas condtelenae que psaren acsoy fit hane, J. dl mite 200, Ictero graveivores do la fertun., n eseeno n nl[btdlo Roigello Aj), IT sia Ibana, VaUe 2,
.....,e tl a u.plti.o. N tad A ,ee.tord a itnaea deblllda d eAng.dafta .-IteT lleorrnr,
asi oqd onequ o ps room arr f h ana J de laMoe 269, tt ru grave.
vo"ee dp I brttrua, &juw~l t xiot afl ebidn, Itt allo Ajt 1ao, flabnv al llemEn la EIg)CA Ropa y Bederfa, damos rsn at r Pusensubister tes2 ato, HelaidstZeanj.yPrenco,
"""~"odoo odies per Ilsd -IhEW so tn do :1aLL fitw dt'orel trilurnatisrino imedd..ate.-Oarimeu Loin.
A 2"(A todosloodiseJprlasLven.La primaere do CuJsa aurnisfie de Mba. bar,I i., HIamna, Santiago 3K, aeraml 6 -RePRI Xa08.Y UIj tI %lenao; las eguad eubani; tudsmi edle piln. -Oft-Illa (6muz, IS aila, Habas,
toen, m po ra dimtinguirse. Bn Jonquto 41, tukbsclusis putlmomr.
S dnic ea que d r R E QIATTIZTA 8IT DURACION IPARA UN A9O. Man no hy so solo.ints ommy -Marla liores Granail, I mIlsaaCes ued op eputr on o lftIrito; sue cltinde de n a Coaordia1lo s, aeetia c atearl
sa 9adea 5 entavfunsello. So visten Paraguae y Sombrillas on plNC0 MINUTOS. aolddeoualadene pern-,mtwh- HIuMUMBN
Amnque acumstoe airvan Anaes (mlinele
WW 0T Alfl AS,hI K lt M Ua Oro oftwair o lt *i,** *Ns -m- -m ...-....-............... 2e
. M 1imet 1e Awfurin de- Matri o..h relWio......... 0
had pM r-ii nlto t ie Aoftr*. a..!.- Matswl OibtM .
sntalrad no d uan jo. do va ls .ri un ttiir o (civii........... 0
0-14 a-s 0, it 4t-i bmle arm. ..L ..................

KOfu fltEIM
JouM4avass iTN IMPaioo, PAI Ant
* oaeo assomni)
lelas
11.-Loe regIs de Is laetanels mito reeneujsooadleloes do la. letanelsiaauol. Ic dlusos l e pies
-al4lplenteo; disse reglas as Intles. riu, adaed, Iat trata do In relate. VO All4leetanoels areltapn lo patrae lthysigibleuaus L&A-g ,6Mg AI'IFICIAL
be .emdo sto&
leelsedeaea b,
Ado edlwd. om lb so% ao simof 04"O 19- 4-46e bumiow ads
Looh* na
hIpshaWo
aa mssmemsino asdbe
ibiso
w **tmli i M t t
sld le e optaen. y
L__M~ bttgp 44e, 6 pele a

te$Iall6n A mAto de 100 grades coibLrlo .n
Lenhe herkta
1.-la tle hervhl 6 lentod. at bafto marfau.a 100 grades, dole detae al nl dObuto de ios veiVe y eatrme Iorms. Lalbeo debe saer havida te. leetd en ete.ellm ad. oeo horns, eCana memes.
Esterfillands Elttlidlod
1&-le.teebe mterilisadaA-ustlem a POeAAPUJA4WiMA. 100 grade. puodo eonservaree mis tlompOl pre-otentem maultar4 omaosebusoso
Opemla9adI16. -Lcsi Otlotl, Is poeies ,
do. y Is iegei deelolioo
4.410 e. o. os sener amles a
1.-e0 goode sa 1 r emmma I poosoo lbioedpuoialrd..
Wtowllokm
20..-F-ar.* *a*1e ; ahAtO, pedo eusploeoo moo.eu met.r, un o de vldrio 690 u -. do. a ml, quo esom aes. Do 0seb asdoas leve -mag of adSH 01 ul- I looko, Icotoled mo asuim"oIs hnT.4 doq s e mlldm4 asW eedoo"tewolwasgan
,-Nuod.obp-lo tambi6a*1 01.
Stx.--In sala ises & bel )is PF0464osdie as Iu
We AS MSS batose coo
9" e ba bico
MEWx Peosaae y686pro**400601M ~ do~i~
is :uolin Sodmbdl.
ca )a .
aSlow mbef
IedweA A R N

vigilarseeal nilso econe oar ouidado quake en Is t1eeeela atersel y ona It axte.
DIs5)I'E.
BI destete
2.-Coealotel tdeotee on lauspen-. ai6n do iIsaetsoel, y, per o itante. en daral llsflo otros ilamenteaditlnts A It leehe. ie progreoaivo, eunando as. allimesntolw easablhtogadalmen-I to la laenetss, y i-mseu ousando It remsplahs-deaspeals. iDebe proaeam el deete progrwlo aI bruK.
-27-Mlouiatmse ae osM &a toeae at Dill, taste mayoree polgres earrA si datetrs l L
Nunn.e vsno ,
2.--8 oi e oel. daerte "elnaeo dpu eter no do. ber oettarse u e detts
=--M W--P- *G um"& WA-la aeiea keol6m adIlda, peme*
j. P mplollaesn&s.auts. do ha
IMO-iny moiltodn
mteadlies.ue mah eanagthdaleeem anI b s m eat .
nllhlentsl
sm asmi si p "erm
Meerse4eper aineMsooewabls
1.-Demosee ls iona dles ase
it th mase d eea ides has 3 gS oss&irs uAse7s. M
"wOdmom*sal desd, 16dB
3Ld-o e MlgrasA e bowtet&e. les ghandea ee o saA eye boeeta e pe0ase abaa s. s .
Ish* p dome ts aeatas.

Agil at solfno.
.-Debe d4sule at nsme un po o de agus freamr y pam auna 6 doBs vacoat diel pe msna maJodlatimmoute des. pale do samar. ( agna deberA er hervida 6 Ittada.
. na mess.
4.-A mehea nifles monore-de 18 woum, me Is sfeorn n levartoe A la sme on II family y darJes peda. ettes de o6te 6 do squ61 allmentor msl, n% legumbrm, paslteoeo dalee., frota, ete., quo eauamu daeto n m et6. nsgo no proparade adn rpet- oIls.
La-que so dice.
5.-At entasma leas nilos per esta cease s. a-slapder qua eagMn eultermoa de.dwars, do diseterts, do edlers infenti, do a., int46m, do semnsld,*a. do suala#4 oe., emande esta io so mA, quo uembres pam. evo a.twit *I dale aemade per amsatmes
inwrpt-.
Impr&eples. ~ fems
86Ndsy aleshllss.
3L-No-Adlm amae atsifato a -,
Aos, mdeatiotdy podmmomed 1s n..n. Asos). .masem 4
d .eld~a, 4, vis, sessa M eee, at babblee Lablaoso slgmmo, quo a.
M h e )o oshegouel m P
A of pea@ 6 Se -a smeales p.
Lask. do no.0.
7.-a 0mlobd asp
-tIs 4kWea 1a Tomb~e
m-eo- IIdo Isnwi baciesee s sosme me b4madse as t l ob esp talmpit
feedp % nplseeds 1
mkbohr y*= 4W o m an osr d"a wlee0 L ms tids Idbs dotse dora"e bee Ddeo l a0 mat ds. Uem ao ~oo" d80o e 6Uptmm s."A LI
.potblt dumato el eno. Deb to.

norse prteuei6u eon le cambio brn.ces de tlmpeaure.m
S Afr lhr.
10.-Drmauto el dia, tl6aue at iOo el suayr tempo possible al alrs liI, A las umbra. I Nire iure y froeon a allmeolo vital pr. la tier1ass ariatu. ras. IAas parques, plans, oilla diat mar, eta, son lagares quo dA n etar coatantement freoueatadet par Ios nims. Tumbla dba lieydrueles at oampo poer eble a leaWe altoar la o da pab s y do.sd pada-cons* gaJr aguea pua de Ia. Ieor eslidad.
Domradlr seol.
1L-I ctA sno dobrA-dorslr con sinlge.-otrm rsos oismima ea. Ina. I sares. idonus, prepAre do meodo oe vealeate Iguna otra ams juato )la do li madr plreml saes en a amsam d de L
eso do metseo .
1s.- also aestemmasehs haes do amese debs darwr de l6e esneam 4 odr. Vet!.Isnoms ., ab.dot-Pru asian" laa.a Iaoios soah S seo8o Oe dobeor latestmdi pat sa"e..
SisdlomuM, Patomlog
y Aseiemolgratutta. 13,-He as da meAtelast Baia./ a I Ne. el paa" g I-I6delalsdee.
* auss, oo pOco -"rt*& I-)domps esp n aaitisy Ja dbm
-o. we"%&- rbo"We
ds mam umets dote s166 P pes s sorI doe to deaseel us emepo o meo*so*ld aa. LIAmmosaml
Pofe sdmi Pos gauiasols at
Ieomo 1 als o V Sabrue.
nes 00o oISIOalOCsote AM l
pas h%bea a. o easap.4W 04
y Rumg mdonsp gu sms, at
am ioee steavksates.
MINai lob6ogoeat de&t 0ml noes & b. Pam a!.ps-oa--o Atsoia
dleaa~udine uo 11 o a" "omi.

iemile iudispamto y qe rquiere als. tllons"i a idmoo.l pe deseuidu, pnlede Neate~ r que ~ell pean hu laI dtarreoa as haan fatalmeto graeOs.
Premaueldn.
A presntaro Itaiarats a pdda. w f slitanesn mediedeisne, y dieele At nian e616 agua bhervds, coa 6 sin asdear blano. basta quo sm hays eoa itdo.al asitme
15.-Vednw5 st nio adete ito ha. br eumplide un soil doedad; yrige amn sautes de prineiplar l deadonl 18.-Be reamen, tods madlo debo tenerprosoloe 1 aligt lnsal
Ourn, deol omblio.
a) Que ps-a earte y earsr ol om. blige do an l, aso permit4sLqu so ase one medlo quo.l paquota aapt,. to, A manas que aI bta an m ae
a prtelataltat raA.aw .
b) Q(ae dob leare peed mlms6
ae lajmoadt e toa~et
dibs d sold, s oe p V ieddi etrA a hb~o, aemcfc ta pram"or trIomi A see atA s se y rosae, emmitalds per iholtaltve y eoa.e
as I otlee slmtes, a to ds-i t ool dauleieiaTons.
f) On"w Ispt" rief* a)a 3dlee40.f i o irdl
e t.b. 1
per Oimad Je* 4 do esdd,
k aJamose -eaelp s44t
k~eawspaserdmaa~ad

-01 'A -e

... lo go,
p I d" am

M Be a Jeme64asqoeta d&6e0

~*1

P ass

;I

I.

M




4 DIARIO DR LA NARINA-Kdalm iW 1*.N*Aladie so do 1i60.
etres A4"Ouems as we 0stlpr amaa eers Simple 7 ansspile del and le le OgNg )
Nabanras COMIIl LLA dIt- -A-=e .
-nm ".a. 140 u se sees ye e s s o do pu te.** t aw dxos as y
*og 5toto a _e_ at es OW poe hea
1 1 :. m. qMlbts, eemo e a 1 r I LA FIESTA GALLEGA 1ie),.igy.*-e,,. m n ht"M '
me ses ymad eo pr Idltied- en oape r it irs iionds de omb. Pdial o be SeM .e w.bIs- amemoes mooe qee a sbligen Ab t a
is ally yads f s6e6 ls A dder. A 1 EMr mr et aesed r lis *. Fed N
se te tg 4#i i p s w omw d tea-ow flwh Jrs m ttog IIII4W de Iseow 1 1 Z~ w a- to
d.4e dsees j oerihloe Ietw q.
estees palm Iseeasg Vaeee s t que Ikv6 A trmie falls me pe64le at! to A lAPsA.
leproeIse "urn ele de la trees so- otor dmio yos ad *Ibe fe ea tt Rotl s deeteess P rdpo Itar e den I "
t4.d0 n ab eer ee le at bre. cards d aate q ue e e p.eil.12 pe le qeeel t s
l. laos Solete do dni, les tie n- 6aiseme y Pr antirons adml t a idol. dpo ale dgo *iocl d e "to 6 ee0IN
doome hemitton Norteeo, Meget. Pr A 1)o1 Qwtrjte I an tereer salda Prlr p p e ro d Jel 46, on uppre. Re e
ly ISel.I capiritnol %Wo*, &I** y' f*4 mons do sit reaclmsNle yOft. litscfreets 16L a16 Stages*1l6 asuse *1IlIimbs"*% 04Uo
ty. Mbiou doode Is sosrvb ie dois 0168 tie as rosete pass qee Is mie AI t0e= NZ )0t oftiTS4@J"~~ "Hole 4 hw qw besmt"146 P9lllA delliuaprte i~bo eibotSt
?o.elg. ,,o-ll, do Tens ,oneedo, "me pree. A lw ole p. se., --. Is.a -..vodtxa 141
Amali Nis, coe slenpre, Intore. me Olde, y moamelaias y desabeialte. A las haso.-Us medt.sets des- Muesoam M 0 ***
anlids, deoollAbaonu 0r pali. tO4, come Angir4 el aimdleo le seb. troyva v a4 se de attlf- Baaedee s.....-.................. 1w w
Y tree Marla IsA tre j4fge, be. to. Aof sall6 Soho cn al be*pOd. 01e6represeekede an combat de m p, Mt 1 pe del puref a ,l se. Ao Do fdo pteamed, atlbe111
ls y ditingalden, Madra abiln do to del bachller, y sin b a mdrIs pwea ripo s ,s 4Ps .............. 4g ge. ede r o arj~aattt ie ltA Ite
Weber, Matta Galarrags dte ~neha y quo A vida 6 merte hlria de real. A la eho y et-Un motrteri, lisemIdtee .................. 44 que Ms t s Aea4Lt.-Ags,
Is hermos Maats (ea. tar matt Intemt sall4 dese Saneho *m deero)em variedes, uit plem de Lelemee ........................ (artA hemy bae ed bele L&s rIo e-Ag Is,
Poer laslt1t, algunnsiliritAn gra. hoelga deeir quo tar per aP oblige. arttelio repreoeotade Ub sembtoe de 1* ... I. U....t. trrle.. h6% r.a. Antue..so
elms, 7 ettre ella ls, se1oria ldo el6n primerl s de halrse esmoot, 0omet.. .r CA UA-d booeewleis l4maq ites ele em
Franie, a0 des ambles amligultas paus lngdn ad4sante Aball 6A b. Alas oe oymyedla.--Un aortes, ** IX****.. d "tote o eisoma e e tedl es di ait. ~ perree har t on id* t *.
mv y Maria Toreso,. rro e eeh6 armado al comtino parat ot M doetmyer, ua pien reraenta- Ju *l* .... .* 4g* e frlt, A t ler Nar so d o v sea e m empll 1ae de y ategro e
,n oa l6 .. . . .. .. a ir 444 d e s ro y fi s A n1D A P it ai r e m en i a x i : : sl a "m t6 e~
Y en plates, en un palesI, le bella miAt antds at eaptr villanteleos e e da poe tna eetrella mAgleso. Abes ...es. h.s .. ......4 eeion me deN ar etimdees Oon lode s emen ,e La y ee
dama Aetilue Culmell deo Oleea, r*fi4~e. A l"Usneve eneee2eatrtoe -U moe- Mrupa dep1te ... 4 qeo lateresa l pie y todo estuder te. ofoee tede lee dents Ao A lne
Is spe de uuetro slmptieo Jefe de Alg p6do saemeater on Shaneho on ter. slets destroyer sn pless repr Rpt .......................... ts n is es suterlor do Is p6teele o eate, qe I enteee sltlet
Poleft, el general Rafael do (trIea. aftet6n A l AO Ila i ltimS free que 1ntandonp4l darml 1 t, don peeteat o. Ree s fe de laplas 4#roehs,is quil o Ia s lo behe ets Ie ia maeaot
M resto tie I oeveortenet, tee soe l sotn lhbre cond que le argny6 Ala Is ~ueve,-Un morter e dee. l)aNnos itoprNo ...... eotn trah to den e dique atr Po flta4 e e.ra leO, esdlemoe. an olsio: -"Diseoro tralgo, difo Bae. troyer, as piea slegeris la'bando. Amese mea leaaes.. Y at peneteoun so0 l dtltee dl deltteees.
lin velto lea vtteeas de AltIes A elm, qua as to qu Import, gasdea po. a &*I ......... IN Vetter orneeieanto j'au"Nit.1
onelwdory leolmletsdolooo ml tndootdn y sln dabo de usd1.. y sifdaevdyeuatdnAiCtsuaveycustt-- T4h ePa i1o.poPr armt ......... M PerIetpollel del ue (rterseloeBntoe- AntllOAC111
r te mpo --Traed Tlbass martde, "isedestry" no& pieYti40*40nape. ordft ....a ..... al Iso Co mm md &Ie goo" Joses ureea1oolheop.n
La animscl6n es mayor ends l e. dijo Terem, y sn ganados per squt A e a p toi Sa n e.. d ........... :. .......... 144 alel prlmeridl strto.
eneendlalo 5 ................. l. U A OAIleUCIIA n fjte o Ala es ,
mana. 1 slpr al, que e 0 quiers qoe leeha b tt h prt perl 44 epleape- .Bmists .. . BI viglianto namero. e lpolletdel 2Jut A l a Sa u rie,
l* yales ganado no habrels heeh uansa flor IIorelo IDtrlb, qs hae so et debut M=tro ............... 88 puerto at tegresar de s reda dehl a Jl a aonae
Vlojers neva en el mndd." Noera todo illm. eats estpital y n eompeteneta eon Faltts Alas ut.orade.... s dl euent al mrgeeto do guas do hia yz hamee.nltl uqens
Butre el nnmerose paste quo Ileva plans patenas en el hogar panetnol! el senor Pedro GonsAlea, con lie %I. Infreei6a Alu teyes... 170 ber opreado una eanhoho trlpulad mr inluAndomea Ia h lt5 boy el Moeorrey A Ila plays aetcrlea. 14) terto quoe Bancho lior6 con l a e gnleutes plessas. mbriagus y esendalo.. 10 clean ladlviduos, Is cual so vole fateo promasdomerea n Ran lans seorme Mara Teresa Ay. Aora Antenia sla tifermedad y muorte. A ts neve y medi.-Un ramillle Detseoto...................... 27 l melle de llacedlados, no octtrtendo hornetlamor traequlleas
la de 6mnes, Entraels Hbeydrich de del Ingenloao Hidalgo, y mLs tierne. to, ses destroyers vartades, on piess A 6n ........................ 9 noveddlea. ao tnomy sinp ,
Frrer, Maria Moatalvo de Ar6ategnal mente canto mIs en pellger Jol vieron de fuegee brlllantes on lo ecoleroe del VaJt r laboletlue ....... 5 Dieon ndlvidam no han podldepda. d Iiesaiod y Dalee Maria Pre Rilcart deo SAn- de fenecer; "per, con lted om 1 s.. IWe. Maltrato do animal ......2 lear Is proptdd do ISi mest.onad& a t maeeto
hes Fuentee, perteneeents A labe b re br indaba of a1ns, y is regoe(j4 A las dies menos enarto.-Un rat. Etupr ..............1..... So 6 ehepta lspector Oenral del "u e gdo ss l
s soeledad ba ners. Boaeho Pease; quoe oto del heredJar lego llete, sets destr yers variado.-Un PIutge del hogtr .............. 10 I Petrf
Lleven todte un Vlje any fells. borra 6 fempa el haeredero a onemoria pieas reprehqntando an chlstoeo m11- Desertores .............. ALARMA DEINENDIO BI aL MALSU oon.-rP de m
do aI pen quoe rea* dqite e muerto." nerojapon* de grn combinase6n m6 Teetativa de suicidio .... 1 EnAleemlleedelenrtoy qultodie. ple se l d esoi t o. S* Y como suele duee quo manerto el enlee con fuego chinecon Insulton ........................ 10 ltto ocurrtai eooehe, depdoen lo ees, d e d
N perspectivel, trees fieetas. perro so seb6 Ia rabia, mnuerto Don A Ise dle.-Un ramillete, sole de- Fales denauela..*** .. 1 an rloipio d leeasdlo A mu de a meeda
La primeras, el mlareeles, el eieltal Qujote no haoia pars q6 mooeetrara troyer varido, uns pIeas repreea. Parrieltiq frustrado ........ I beraprendido fegesl soedovarso A
de liano quo ofreoerA Gentilo Nt6es Sancho 4 la sobris dean amo conside- tano la ta doble de efeeto gatorlo ,aftse n luger ptlleo. 4 eases de moqulsil qu eelas ben s Paedblo Lori Gap en ebsequio de lea oeles del Ateoee. raelone y earlflos qua no pontia le ha. con cambioe brillantes. Perjudo ...................... I pareMs Po et seeo. Oberte e r, el
I programs, may eeeogide. blers tentdo on vida de Don. Alonso. A as dies y carto: m .t..I........d 8 Ar 4 e l mris esomerl Ti red, ette*
La otta esta esla de d Beeedad del Pens661-8ncho--que to polllneos le Un ramillete, eels destroyera varla- alaltsentorde motdna 7 sooa o braves momenas una clRk.d R
anryr i-F~deaderes de amede 7 doeIse bombs. elealel ee y7 ---'
Yeedo, el sAbado pr6tizlmo, par eels. porteneelan y que Dofa. ptoia l ha. doe, una pleas Tepresetando an her. Atropelles ..................... 15 1sealderetitdaedid ao l
brar eldelmo qulnto anverarlo de sa cta tuerto reteni6ndoloes en aon poder, y moso elreo do eaballitos eublerto per Coae46n .................... .. mento desputd yla paslels d puerto
fundae46a. quit6selos A lo hadanto m tesner de so ensa do eampatl de lueooesde caloree Aablto.......................... 8 d eents do lo oeurrldo tl ebor Jut es e e, o.
ColtirA en ano ballet. DIoo at de la outlets. vartado, Analisndo con e eamblo de Atentadoe ..................... 68 de guardian. Asrds de miadrnes, Chambers.
A propesitode laoridaddel ededo N~o dobl6 hacerlo sf, piorn.e, dice una pa de fnento brillanto con dos Sustratldemnre... 8 TcTweSte p deoe r, Irceflmana.
me dice as entuslasta seeretarlo, el td "Todavla antes depro.eder alrada. e.ergas do fusilerf. Falstedd ................. ...... 5vDoola efa, (eIa ol.
amigo Nemeslo Galll6, qua on motive m, ste (Rancho) debl6 hal-lar cos ella A las dlez y media: Lidas d gallon ......... 40 G I IA'. ..... ..es.t.
Poseer onlmoles sIn tltoto 18 rer
de dicho aniversarlo y come gracias s- ( I, S Antona) st so consideraba con Un ramlllete, sets destroyers, ae Imprmlenela timrrar. 5 -- ,' M. Ton.
pefal, la Directiva ha acordado, quo titos bastants pararenperar lasbe-s. plaza representando ana estrelLa flam!. Beetro............... 1 Los TEATROi oY.-ollo0onal, LA IOTA FrAL.Ion sefores qpe so hagan oeloe durante tsa. 6 bntentar n arregio; y solo enan. gera. Usurpoeln de tribueo. el onemat6grafo y en Payrt, el blos. Plane el s too cantos de am
los mesee de JulIo, Agosto, Septlembre do considered vulnerados a Jercho, A las once meano carto: nes ....................... 1 copto. la L c enAT a
y Octubre, no estarAa obligados Ia- haa rloovalerato laleyl....'' Pardies, Un ramillete, sets destroyers varts- InJurlas ...................... 1 Ambos con varladasybonitas vistas. m-Ie y dies ml
Stlsfacor cuot de entrada. mi Z, qu o eot ese de infantil y dos, una plers obellseo 6 olupo do trees Infraocil6n A la leIy do Im- E Albiea doe tandas.d mjr
Y el domingo, en la glorteta de la qui-bra do slmplfcllimoal Td his di- cnabios con centro glratorio de brillan. puestos ................. I A ls ocho: LaReoltosm. lOnando so depelna le eae hats Ios
playa, sla tercer do Ias matIn04 do oo esotTd, hombre do temple, baibado tea, decorada con loea apropiadas. Malversaeldn de caudles. 1 A Is1 teves Bt premtode onor. po la temporada. con pdas, acemetedor y caballoresco, Eta plaza slmbtlica da comlenso con Adulterlos ..................... 8 En esra itima, etreada anoee -Pace la do ml eposa-dlee Ge** quo respiras quijottemo sanq per todos et nombre del pirot6rico, liea 1 es- Erge lis d e diner.. o y lonjero xto, etarP de6n--es ado min ms orpreodent. Todas
Ecos de una boda. tat poro y tienealamente ilena doetner.- cudo de Gallciay la inscripol6u "Cen pend quernevos couplet sobre pr osI a leai zeohn elae. sme a elo
L3 baddo naeoia qu tent .. ............ .. 2 qncr nnevoa couplets Babrs peaitouh ax Donbas__seIs_____a) ______L bodade unaselloritaqu recuer, too. notnertosfechosydeofehos A pun. tro Gallego", dfoalizando con don PrMairgo le d o o ......... 2 deactualidad.
da slempre, Is sociedad baba en el ta ide lanza, propones compo:endasa.1los baterfas de voladores de divermos gatn- Ustr nombre supatesto..... 1 6784 Los earteles de Mat unelan Ael encanto d eas Ideal figra, dan gracJa andantes y les remites A It joy Gon tal niclonea y de mdltiples cofores. Longi- Interemanto metedrama LoM doa psRdee4 anjestiva y do sum ojos do sofladors la pa amonia obraba Don Qa;ote! 1Eos tud de esta fgura dies metros. ERVos Y en Alhambra, A primer hors, La
linda, Ia'esplritual Margot Carbelo. ojeraplOs ae mostrard6u Sanchot Par- Hiabrd adema de ocho A once nna Pres eonducldo........... 25 taeea de rebortesy despn, pms *7*
So reclbl6 anteayer en la Haban lao die- y pardles mil vecee, que has aca. retreta ean el parque frento al edilclo Citatonee Judielaese ..... .18160 mike. t . .A.___n_
nottlia del matritaolo de laeorita baddetetooolpecotttodoslosoa. qneocapaestn ocledad, po laada AuxlltoA lasatordade IS. Nada mAa. .... .
Cnrbelo, to Las Palmas do Gran ioht o y con todas Ias aventuras quo do 1eneflencl. Iden A partloar.s... 14438 L OL.- U IO USIAL
rise, con el ditinguldo caballero An- en el undo han sido y Iraiu A d- Todos lon fnegol ser4n quomadon on Idem en Ineendlo.... 380 mumuN dao S I dAc
tofito Herris y Angolo, capitA do arti chooo fin. AUendN. atiende A Is Indig a azotea de aste Ceattro y soAlaeida deProfeores deoesleAs t noaci6n del Hlidalgo: ,jqujhjjtl qua if. varloiglobo. autrldades ............... 7 qu Salta junto Aila playst ea proyeeto.
lera quo pose, adem6; la carrera, d dO gu s exeto e o judiotal fue. HubrA tambAn an premlo de 50 pe. Id. etretadoes A sus dae j al ,hato do qu egsa P I en u Igo pae doo
* Ingeniero civil. -o.. .............. 80 ~ oqos-qci? set neA n.et. tLsi2 o
8 many orenco de loa alcftaesetn ute Y U sU LEY sco pars ol plrotunlo quoa lelo doe. Am ocupa.....O..... 190a te"t" d **" a .* a tleaeoe lo.
Fi a jn A rmus oeupad So ............ 00 19800 .. ........... Lad:.............. ....~Itua A I" ......... V. .......ts~~ ~ ,M. a *I T*& e e M rt
Sn padr e s director do ]a M ae tran. DU au )A aus j er &s brigs, sus I s C om iSi6a nom brad al efecto, pro. Q uM n r so* a s e n o op t r. SI e o dii
--- Iguoi at do nil niemanat Jiaila~ pro~scaoaou dm1l S. d* |
so de Artillerfa de Barcelona. pre.ttoms, so volnted?. Y no poa. sente mejores fuegoa deartiflelo. Total .................... 00o9 und bat e m l pe h ansaeJo I m&elt- 4.
A la apitl del Prfnelpado marcha- din pensar nt declr at beer otra cosa ElI piroteonio Seflor don Pedro on. Ioabaon Jue 21 de 1 0. lb m d an rana d* .-I a.
in lo novic, sompafafos de ]ini, Ins qua so daban al mundo A auplir doe. Mses regals para set dielarades on el ALEJANDRO RoDRau Un eanto porque hean liegde t.. .
Sbell hermana deo ar, para fijar fle eols de ley 6 amtpotenelas do ela msnmo da tre volalore de unad BlrJRllJef. y un lanto porque so mrehant 000I10 iRSTAUANTS
& 1I a 0 e amde n c a aJuntdla y a d n a g r lo d a t l d o b le o o h a n u e d e e llo s u n O P OI I A n oo o a s* m e rcmha n
A reserns do emrou. A.Ie toando at Inioso dobla golp eeando ao do p edl an eo. & person name as 'a
Ile rodos do Ia bad&a seonlla in. d d n,+ r.ltaJ lio doaslmadon ra o do lores varlado 0. stela baio", Teox 'l~o In-- O fe
furmael6o, coplarb aqul, tomindolo do gbeotes s pua n tge o astnduro A s d do elmar6a, Juoan Moreadal el popular tie do A Ldotao sn 6 6
ano de Jos principales periddloo do A dea la ]oye%. S lay fn s lana A Is sof, a.m., 21 dotroyer. TICIA ARIAS d o de ia gAn p ro de ob p o t s oa a
Canarias, Ia otleta referente al tousa. con que hirit6, derrib6 y ultrajd A la A las doe, 21 destroyers. esqnI Cnba, y per eso no oe o lie sa. as 1 ms uOP ARtomI
n. justicia, A Ian oeho de Is Roche deeds I aso- va la Corraentsb al ontrao I e .ne des8a para e tmpo quA se O 4M* 5
Dive aI* El refrn ir deo so en celodra eat4 so ea del Teatro Naeloual2l destroyers. Aer la ru ron fa ornt, haea an estableeliento a erte maA looa
"Anter : Aoa punto, y dicho por el antor, qu a. __s de dos habttaclones tteroree de laI del piblo, quo vA A asill A proev Teou
"Antler iitan Aue amla, luoso- be quo as a aeluras eeltn liena e mA niumo 9 de lo cile do Teoeto do aquel celado bonito y elosnt., d
Roy, Par q i r ortuna sedonta ocrlorsn ass asperor, quo Pam s srra, Sbax
rIT )larga it belo hll do on no pligro y ainelore; *I de adroo d BASE 'ALL deagratnt penpenale bllra nel ose 01 ." e-" Itlit
toe quoee ilgo don Jos e Ctbo, lo eaor dd boern, t-mpiado rar Sanoeo, Ls c e. e proploe l n do d nig, e d o ao posIlo ,
e n poS quo 7 ni o f trout eau dompr6 Al't o esa mal, pu de lis berred len l-nair p s roadep dnoir elsu bsaajll e ao or a s ul sc poit ea o4 s
ta badea. Ruens pa 1f o i am o e LU~rKAI Viesta rA voelso do Joads del Monts re d u erslls y eoyG Iua Jare. nta ga porn 61 fr odo ho a d Ban6uencra ma orae, Imt y Is tlioe alqpulola A do tn re mro a model n p ouede ver on as. assilgras d Iaboa iasto As dinero aqlog,,,e po. r d afla se touarA o losterrenon di Tridr, quen manifite r auente pl6ndldO vldreros tode a qua pas
ep Curbteo, om amlllte rmsnte e Iga n sodo regroe6 co Do en Quijote de arl s Ia n interoasmenten ta tre cnon locurenl e boes. pr equella coma. ee, exhbin to asen se amis ania autnr dAo me ltrs nnovenf do Ior "'dqabs" Rmaie etea El odifalb a do conlruetM6n antigea, La Granada no 61o poe on CAuda- IGARPENTL P1-UlLY tuqO o
druposlljosloanatac a, ane6lo. Heapil estab lin, gu eAeeBeye ee i44secmaed ne eoe la VireM eltOrae ce e. u eos. o*mnue heoe 4a
M quo DeO s U Jpemo r sinl fole o el hna." Iy sas rllla sa (roa ) yA- e nereoeo porel oalel pd- dela an gra talea de antdo dota o s lAseej .o s d te rea.
en samo gradm. d td on p 0r eharashes. a do $1 dm grar Ms a oale 0 as 1 lw#.l
A parte de a e deA mp e o e a preo atade r qua fer do betrr. dien Iei anlmaeda pam e a tlr A t noldpal, ijut diot6d ees parettr a s or, quoa pitete conl me- do. brme Sp laIl
t egalJon do rao n dj9 8a quo Sactho dosh moaueha mal puan Ioe players dte arieto Pin, m tyore d rale. jore'd trnjero, aine qe e repro. .ae
lOet qu esle han leehopor m aueol doe aquerer andar r I gandays. pr qulere aprobarle A loee do lbertAzoy, soiant-nraenCbddlry V NDIO I
q u e" u t d e O a A a m a np md i a s q i t q u y o *4t~ n ra se C u b du l n ov rm t h ey e o d c e r n m e a a t d e t k e s ee d eE TMC I N
*q a h a d os i l osnr a sm a a1 o a b i. .u A re v a n . s a
bdao relaeone.J oirmwo do aqat quoa qua porentonee a no babda prqa ti6de, o r m ala Msrtaa y Pnltora, eombro fabrs inMrtesra rz y Ie S M
d Ami tro on rd- ado uelo en petamleto do IA pota v d Vls6, eed otro au naad y rq do one a
Oer s laigan a s ee a s d b i s at 95* pVe t l a e ri u l *e a d e ~ o les el blm es o set
dia lllgranSa d or, debei da A s e etar ai eO puta a soeorat s ado V s q#m tl derta to me. nJos Cire de p esroplodoei eo l aa jev4 o toI-v .s eo ele sa bs assign de. Qo M O te prlot ld as m 15 an Stanees de to t M ad amde o as Mad e ais. tRdades y el eot tt Inquebeantabbo lao d
opseat.etan, y t t oltronria. t c 7I lte" e. a s J pee l e etaanldg a s. ll lt l e o. d g otldg mo an dt
y orIginales qua causaron o a pdmtr-. Antia hubleradao moeo at do taer do, qu Jusgarl lro base del Asus. .Tonts IsMrteomoCu quo- UADALU -S aa bIls -&I
Tdsons t dL Maleaa Iena, Jullo, 1905 "a BIQ *Ant IsMr~~ M asa c Useses.P-A en ae@irisM pi
M detod ." ri, aol 6gio a epiloeebaeo, QlA. em lajdol daa altaeedo do mparendo on a iie devoto do Is Virgen del Carmen ero. aleaesos deri
die otoe deads syut, per la YellOt, y en 8 11P y soleo bion podia ha- 0 ante 4 Jun .er00n lonal desl- bran maslas en a Igleal do Unadalu. OcadmO t' lOt, DOrS
dad d ryan venturoo elegldo. ceOl eebrnOla i regoeljo y dare saps, Los clubs Colorbla yCerro0,.e4', p0 premeo sot tots orplaedi4a e "M HL RIS-%
a la. 1e s 1 etss... e b4 My eo. Un Is .es A do I.& aml do ts. lan qse 4 oI .e.. e.ee 1 W
FA malon., en Cl camp-ento do Noeqhio Z gt-I' lani bian. Ma.asedofolgo AlA de dotIr. lie.sa, falls" a.or 14a asaais, 814. I4eattasleksmmos.sa" o0m. fir. CORRIJAN
Coln0ta I& manias del lmp4o Co. eds 1 plo Il huns, qut at ma ee- toesr lager a deals *stealto lo Is plM ,Ads Mtede s aria dee de, i 8t&s O, aAlt, tAd i olOb
4."+.,~v.+.." l o.. o., ..toe he~ n .,. ,.+q h. odot (k.in .. par- s....., de do + d ndeis a.ui en
D146 quo pteside at ,Jonea duster Juan to.a hueo at aloe, ofine quo dLa has elaub rm y e, oe attorrenosa, soodo
doD6 onlEa lf(,o o ms les o fd ostd alooouite Careneeum pstnsgid qo o. o~le."
d 1)0 8-P04940g 00d oooo s & ml do Marine, Caee. I allas imp-Ap
lsr smlmo A Is lIegmds d4 tree Mt#, delee quea eran a do Is *eoath. Del Campamoseo Clumrbla y Moarle-s Eate ed sa
q9o *Aa do. aAis uua y medh, 1l6 y yO A6 qsoaeql mdn so tioe on noes. dle yoveJrahaea psrtiae_ Al teiadtar Wt stis calls do SeM ACe.
oboe&64AW parao 1 kealado do Ia o. 'a suaolllae, eao&otneauer. P4sa. rise" dot ( quo essa oeada se a* *I4 tetsqeL Avpo4m a inmeoesswas t b mQuo sea morius, 1)' r Foledos 4Apis.. da0*. 7yaladt Us 4L~612403. Paoq,--YT vwteeos di Alb~en.-.3uNoevhm
o 40 e A Is gleieta do Ier otte 1edoy de ssgaro SWltMa ]R XPlqkee 4e Habana S. Gawbln do Fs md". o los uy o -- X L .1,eej-i. 0 ml dractoigTi eq0w dptm A Mae"
(Dolomelda, Ua n oro i.4eto do pe 0pele,I A ,4 do polo rise ndee, yd so le 140, o d 4 We 81446111. j.oin stupoo
,,t.e011104 do". a
lasheSo'1 daaprt.nel~ tra on rclain poet ia. ~.' 1 ,P ~M04ef-n l W s IS amny au roimeore 66 in, ~ aeea ~e.o gn
Aber, quo mbeA quVisitoA Jun Gelacge, bole, per ti. so laqiord, doie P Ine. m Tdea a tueo o, = of dfts. n
YA M49L Ke sao me ad iat 74t rwttt ilke---- Y sodsaW elmsdade son to &so- nc
pat. sob11 some gale. topoe 0150.a- LA LIGA "BAALIY'p Pe W vnlgltuoas? T ca e IoLIdi
10101640 0 am *a lorkkao C, y quo prmoste blowee 9irl&SoleW o Pulle t& Pol *Is .1 b0sIoa __"q" e' l_ I" d p
ad- emodom gut pta C eleb ie s 16n aztra rdl. omed Wotn A. Us L U. A welowtoo
,sawn6H 1001o of annuls'e do Id, 7 l, ms a es la yt Otte Poa o 40144, as I& monad, del mietto, ca- dst-inevo A a Ind ado saimnodes n %. Th quo Is Tie. DOMi smum A 1*s oe y iss"a bINs amigao t s do Uu mpeit 4n I so Is11 Amio. 15j- baem don Mdarsse Imom lir, do gas holediao y' soilleoas obao con I oqee
10 A do bs e6paik. y.Istem 1MD08A. 91 Itas OlUno 0ma60 6 d. an d 01 d4-4 1Me y o olor nuy doe.4i o ioupe do Mads, Io v a- pm- d" ler gla, e 0 y be),
wals fit NX pfoeou~. I l i i lULL Ia ai moda ld m ties"a- --&I Ade loupte scadenj. dot 04 1
tisboi-oIogtias01 vos t s"UnoN.- A aoel_ _rtas --__________TI as Ao e-utA- t A l"1" "
,4+ Y1it. 01
Easaoa-Pe .,, e.,,,aa 3. V me .31 m~mdeas..U ,_ doe .. A L, wo, e n.
U AW In-- At.s"7.
-V/+@1, - N A W. qm -- a e 4l4dIke oXm .,.o, .. .. ..aoe m I' 01.mpS.....4 Eo __l. .......