Citation
Florida weekly

Material Information

Title:
Florida weekly
Place of Publication:
Palm Beach Gardens, Florida
Publisher:
Florida Media Group, LLC
Publication Date:
Frequency:
Weekly
regular
Language:
English
Physical Description:
1 online resource : ;

Subjects

Subjects / Keywords:
Periodicals -- Palm Beach Gardens (Fla.) ( lcsh )
Periodicals -- Palm Beach (Fla.) ( lcsh )
Genre:
newspaper ( marcgt )
newspaper ( sobekcm )
periodical ( marcgt )
Spatial Coverage:
United States -- Florida -- Palm Beach County -- Palm Beach

Notes

Dates or Sequential Designation:
Began with: Vol. 1, No. 1 (October 14-20, 2010)

Record Information

Source Institution:
University of Florida
Holding Location:
University of Florida
Rights Management:
Copyright, Florida Media Group, LLC. Permission granted to University of Florida to digitize and display this item for non-profit research and educational purposes. Any reuse of this item in excess of fair use or other copyright exemptions requires permission of the copyright holder.
Resource Identifier:
on10385 ( NOTIS )
1038532305 ( OCLC )
2018226750 ( LCCN )
on1038532305
Classification:
AN1.F6 P35 F56 ( lcc )

UFDC Membership

Aggregations:
Digital Military Collection

Downloads

This item is only available as the following downloads:


Full Text

PAGE 1

Black Friday is known as the start of the Christmas shopping season, but the unofficial kickoff party for the glories of holiday eating, drink-ing and socializing comes two days earlier on Thanksgiving Eve, sometimes called Black Wednes-day, Blackout Wednesday, or even Drinksgiving. Family and friends are back in town. Nostalgia is nearing its yearly peak. And with few responsibilities for days to come for a lot of peo-ple, other than stuffing themselves silly, bars and restaurants across South Florida prepare for a night that ranks somewhere between New Years Eve and any given Sat-urday. It is typically one of the busier bar nights of the year,Ž said Kevin Offer-man, owner of City Tavern in downtown Fort Myers. He staffs up as if it were going to be a weekend night. For a couple reasons, obviously its a holiday the next day,Ž he said. Another reason is a lot of people come back into town, family comes back into town from college or elsewhere and they want some-thing to do the night before they spend all day with their family.Ž Black Wednesday revelers would also be well advised to take an Uber or a cab, as police departments too are gearing up for Bars, restaurants, police prepare for Black Wednesday BY EVAN WILLIAMSewilliams@” oridaweekly.com SEE WEDNESDAY, A16 X www.FloridaWeekly.com INSIDE LESLIE LILLY A2 OPINION A4PETS A6HEALTHY LIVING A16 BUSINESS A18MOVING ON UP A19REAL ESTATE A21ARTS B1 COLLECTORS B2EVENTS B6-9PUZZLES B15CUISINE B19 Download our FREE App todayAvailable on the iTunes and Android App Store. PRSRT STD U.S. POSTAGE PAID FORT MYERS, FL PERMIT NO. 715 In the KitchenJames Strine walks the line at Grato. B19 XPetsLucky needs a home. Can it be yours? A6 X Food and Wine FestEvent attracts the culinary world’s top talents. B1 XWEEK OF NOVEMBER 17-23, 2016Vol. VII, No. 5  FREE Patinkin gets casual The returns for a show at the Kravis Center. B1 X BUSINESS OWNERS ARE FINDING ITS PROFITABLE TO GO MOBILE “It’s a business you can be very creative with ... I think the concept is fun and different and I think people like things they haven’t seen before.” — Kelly Calistri, owner of mobile boutique Couture To Your Door HE PREVAILING IMAGE OF AN American small business owner is someone forging her own professional path by the sweat of her brow „ and often the skin of her teeth. A demanding service schedule, long hours and an overhead that includes at mini-mum a lease, insurance and inventory can make the idea of becoming a simple shop owner daunting. Factor in a staff that has to be managed and paid and BY LINDSEY NESMITHlnesmith@” oridaweekly.com TSEE DRIVEN, A10 X Matthew and Amanda Somsy of Curbside Gourmet, one of Palm Beach County’s most in-demand and visible food trucks.VCOURTESY PHOTO

PAGE 2

A2 NEWS WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLY We deliver for you. At St. Marys Medical Center, weve been helping families bring healthy, happy babies into the world for more than 75 years. Thousands of expectant parents over three generations have selected our award-winning services, renowned team of compassionate professionals, and our Birthplace Suites because of the peace of mind that we deliver. But we dont do it for the recognition. At St. Marys, were a caring family of highly experienced labor and delivery professionals helping families just like yours to grow and thrive. From births with no complications to those requiring our advanced Level III NICU, we deliver for you. Schedule a tour today. Call 844-447-4687 or visit StMarysBirthplace.com COMMENTARYHalcyon daysIt is Thanksgiving time again. It took a long time to get here. The 2016 elec-tion cycle left little room to anticipate anything but its conclusion. The nation is exhausted. We smart from self-inflict-ed wounds. We brutalized our electoral system and the democratic systems sup-porting it. No one can truly say when or even if our democracy will fully recover. The grievous injuries done are still being tallied. Radical populism rocked the nation to its core. The rest of the world looks on in confusion and dismay. If America were democracys church, it would be time to call for a revival of spirit; for good shepherds to come and lead its flock from the wilderness and into safer pastures; for the demons of hate and violence to be cast out that threaten our unity; and for the moral corruption of false prophets to be revealed. I imagine it like this because democracys church is like no other. The words and deeds of the Founding Fathers are the rock on which the church is built. The Constitution and the nations Bill of Rights stand as witness to its members. It is a living church infused by free-doms spirit and the rule of law. When the churchs glory shines bright, an altar call must surely follow. It invites congregants to stand and pledge alle-giance to the United States of America, one nation, under God, indivisible, with liberty and justice for all. Its wisest elders nod in affirmation. They know a fiery end awaits congre-gants refusing to repent their hateful, wicked ways. They warn: Woe be unto those who abandon their fellow Ameri-cans at the gates of a nativist hell. Judg-ment day will come. A democracy that abandons its historical values and prin-ciples endangers its very soul and the temple to which it is entrusted cannot prosper if its leadership abandons faith, hope and love „ and love is the great-est of these. We bow our heads and say, Amen.Ž Well, I am not expecting this sermon or an altar call to conscience any time soon. But the celebration of the Thanks-giving holiday is a good place to start the soul-searching and healing. This national holiday is a deeply American tradition. We, the people, come together to give thanks for the blessings we commonly share as Americans. Being reminded of this has served us well throughout our history. An altar call for a national day of thanksgiving was first made by George Washington in 1789. And no wonder: Birthing a new nation proved to be a momentous undertaking. One year ear-lier, the final draft of the Constitution finally emerged from the political rapids. But it wasnt a done deal. The quarrelsome states had to ratify it. There were high-level arm-twisting and artful compromise. Few precedents existed to lubricate the way. Imagine how tumultuous the process. Consider the political acumen involved. This was high church, indeed. But the job got done. Nine states ratified the historic document. That met the threshold required for the new Constitu-tion to become binding among all the states. Once ratified by the remaining four states, the countdown began for the transfer of power from the old to the new form of government. That moment arrived on March 4, 1789. On that day, the Confederation Congress handed over the keys to a new government. The first session of the U.S. Congress followed in New York City. Soon after, in late April, George Washington, former commander of the Con-tinental Army, was elected unanimously by the Electoral College as the first presi-dent of the United States. Congress kept on working. It tweaked the founders framework, reaching agree-ment in late September to ratify 12 con-stitutional amendments „ 10 of which comprised the Bill of Rights „ and sent them to the states for ratification. All 13 of the original colonies approved what Congress proposed. So, 1789 was, by any measure, a very big year. Washington thought so, too, but his proclamation called for just a one-time, national day of thanksgiving. But the idea caught on. The holiday continued to be celebrated in the decades that followed. Family and communities assembled to replicate the mythical hal-cyon days of the Pilgrims first Thanks-giving in the New World. It was the first harvest of the worlds oldest democracy. In November 1863, during the Civil War, President Abraham proclaimed Thanksgiving Day a federal holiday on the fourth Thursday of every Novem-ber. The times were not unlike our own „ violent disruption of civil society, a nation deeply divided, with disunion a genuine threat. Lincolns proclamation, written by his secretary of state, asked Americans to make penitence for our national per-verseness and disobedience,Ž and to com-mend to Gods care those experiencing the lamentable civil strife in which we are unavoidably engaged.Ž It implored the Almighty to heal the nations wounds and to restore it, as soon as may be con-sistent with Divine purposes, to the full enjoyment of peace, harmony, tranquility and Union.Ž One can only say, Amen.Ž Q „ Leslie Lilly is a native Floridian. Her professional career spans more than 25 years leading major philanthropic institutions in the South and Appalachia. She writes frequently on issues of politics, public policy, and philanthropy, earning national recognition for her leadership in the charitable sector. She resides with her family and pugs in Jupiter. Email her at llilly@floridaweekly.com and read past blog posts on Tumblr at llilly15.Tumblr.com. leslie LILLYllilly@floridaweekly.com

PAGE 3

Pelvic Health and You Linda Kiley, MD Urogynecologist & Advanced Pelvic Surgeon Tuesday, December 8 @ 6-7pm Palm Beach Gardens Medical Center // Classroom 4Join Dr. Linda Kiley, medical director of womens surgical services at Palm Beach Gardens Medical Center, for a lecture on pelvic health. Participants will learn about the causes of incontinence and have the opportunity to ask the doctor questions. Light dinner and refreshments will be served. Hands-Only Adult CPR Class Tuesday, December 20 @ 6:30-7pm Palm Beach Gardens Fire Rescue // Station 1 4425 Burns Road, Palm Beach GardensEective bystander CPR provided immediately after sudden cardiac arrest can double or triple a victims chance of survival. Palm Beach Gardens Medical Center sponsors a monthly CPR class for the community, held at PBG Fire Rescue. Local EMS give a hands-only CPR demonstration and review Automated External De“brillator use. Participants practice their new skills on CPR manikins. Reservations are required. AFib Treatment Options David Weisman, MD Cardiac Electrophysiologist Thursday, December 1 @ 6-7pm Palm Beach Gardens Medical Center // Classroom 4Approximately 2.7 million Americans experience atrial “brillation, or AFib. Join Dr. David Weisman, a cardiac electrophysiologist on the medical sta at Palm Beach Gardens Medical Center for a lecture on AFib risk factors, symptoms and treatment options available at the hospital. Light dinner and refreshments will be served. DECEMBER Palm Beach Gardens Medical Center | 3360 Burns Road | Palm Beach Gardens | PBGMC.comFOR RESERVATIONS, PLEASE CALL855.387.5864 Heart Attack Risk Assessment (blood pressure, BMI, glucose and cholesterol) Wednesday, December 14 @ 8-11am Osteoporosis Screenings Thursday, December 15 @ 9am-1pm Take steps toward being heart healthy! Visit PBGMC.com/pledge to Receive a FREE Cookbook! FREE COMMUNITY SCREENINGS COMMUNITY EVENTS & LECTURES All screenings held at: Palm Beach Gardens Medical Center Diabetic-Friendly Cooking For the Holidays Demonstration Thursday, December 15 @ 6-7pm Palm Beach Gardens Medical Center // Classroom 4Approximately 22 million people suer from diabetes. For diabetics, the ingredients you use and the way you cook may make a dierence. Join our Director of Food & Nutritional Services and a registered dietician at Palm Beach Gardens Medical Center, for an informative, diabetic-friendly cooking demonstration. Afterwards, youll even get to sample the food. Registration is required.

PAGE 4

A4 NEWS WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLY PublisherBarbara Shaferbshafer@floridaweekly.comEditor Scott Simmonsssimmons@floridaweekly.com Reporters & ContributorsLeslie Lilly Roger Williams Evan Williams Janis Fontaine Jan Norris Sallie James Mary Thurwachter Amy Woods Steven J. Smith Andy Spilos Ron HayesPresentation Editor Eric Raddatzeraddatz@floridaweekly.comGraphic DesignersChris Andruskiewicz Hannah Arnone Alisa Bowman Amy Grau Paul Heinrich Linda Iskra Kathy Pierotti Meg Roloff Scott Sleeper Sales and Marketing ExecutivesAlyssa Liplesalipless@floridaweekly.comSales and Marketing AssistantBetsy Jimenez Circulation ManagerWillie AdamsCirculationEvelyn Talbot Headley Darlington Clarissa Jimenez Giovanny Marcelin Brent Charles Published by Florida Media Group LLCPason Gaddispgaddis@floridaweekly.comJeffrey Culljcull@floridaweekly.comJim Dickersonjdickerson@floridaweekly.com Street Address: 11380 Prosperity Farms Road, Suite 103 Palm Beach Gardens, Florida 33410 Phone 561.904.6470 n Fax: 561.904.6456 Subscriptions:Call 561.904.6470 or visit us on the web at www.floridaweekly.com and click on subscribe today.One-year mailed subscriptions: $31.95 in-county$52.95 in-state $59.95 out-of-state ption s: ailed subscription .95 in-county $52.95 5 st ta in5 70 647 647 .6 4.6 .64 04 04 b he we e web th y y. ekl ekly ee ee o o cri cri sc b ptions: y y nty nty te te a at ate tate -st -sta OPINIONThe way it is Theres a new term for journalists and others who misjudged, underesti-mated or laughed off Donald Trump voters: elitist. Im guilty of the second of those charges „ underestimation „ even if Mrs. Clinton did win the popular vote in the United States, as I expected (I did not expect her to lose the electoral college). So Im an elitist, too. Thats the way it is. There are many reasons people inked the ballot football next to Trump-Pence, punting it into the American future, and Im familiar with most. Family members, friends, neighbors, people with whom I work or play „ many are Trump sup-porters. I listen to all of them. Whew,Ž wrote one of my cousins, a cattle ranch-er and ardent Trumper. Now lets give him a chance.Ž Im good with that. My Facebook feed is not just an echo cham-ber of my own thoughts expressed by friends,Ž as another cousin put it about his own. But I embrace the tag elitistŽ because all of a sudden its a Genetically Modi-fied Organism of a word, a GMO with an altered meaning. Elitists are no lon-ger people who think theyre better than other people. Now, the word is synony-mous with critic.Ž If you criticize Mr. Trump, youre an elitist.Ž You dont understand working people, you dont understand farmers, you never recognized that America begins west of the Appalachians,Ž as a conservative Swarthmore College his-tory professor once said. Needless to say, Im critical of anybody who calls Mexican immigrants rapists and grabs women by their felini-ties, or brags about it, whether he lives east or west of the Appalachians. Im critical of anybody who spends almost all of his life on welfare „ the beneficiary of Daddys money; the benefi-ciary of the money and support of U.S. taxpayers who have to make up what he doesnt pay for infrastructure, for war, for education, for health care; the beneficiary of special deals working Americans dont get, a man who artfully avoided military service or any other kind of service. So its easy to be an elitist, for me and for more than 50 million others. One of the myths about Mr. Trump is that hes an outsider, somebody who broke through the deal-making insular world of politics-as-usual, a man who took on the system, who represents common men and some women (usu-ally white) who have been shoved to the periphery of the American dream by Washington insiders in both major par-ties, themselves special-interest elitists. In reality Mr. Trump is the ultimate insider. Hes the ultimate beneficiary of a system that rewards the wealthy and usually white with charity welfare deals that make winning the lottery look like winning a bowl of Brussels sprouts. But people who voted for Mr. Trump, more than 50 million of them, are not necessarily racists „ at least not per-sonal racists „ or morons, as somebody suggested I might believe. I do not believe that, even though I shared an observation by H.L. Mencken unearthed by a friend of mine: As democracy is perfected,Ž Mr. Mencken once wrote, the office of president represents more and more closely, the inner soul of the people. On some great and glorious day the plain folks of the land will reach their hearts desire at last and the White House will be adorned by a downright moron.Ž That smacks of elitism in both the old and the new senses, just as this com-ment does from a non-American named Winston Churchill: The best argument against democracy is a five-minute con-versation with the average voter.Ž The brilliant Mr. Mencken, who worked in his hometown at The Baltimore Sun for 40 years, represented an odd and hard-to-swallow paradox of brilliant and unsentimental insight along with virulent anti-Semitism and racism. His biographer, Charles A. Fecher, pointed out that Mr. Mencken exhibited a curious mingling of total egalitari-anism ƒ and patronizing superiorityŽ toward blacks, whom he described as intellectually inferior to whites (in his private diary), while vehemently fight-ing to publish books or articles by black authors and criticizing segregation laws that still existed when he died in 1956. That paradox of attitudes reminds me of some people who voted for Trump, a paradox refitted in their cases to the contemporary culture and its issues of immigration, race and economics. For the moment, they have the final word. And I want to share some of that word with you here, part of a message that came to me about 36 hours after Mr. Trump became president-elect from one of the best and brightest of his supporters, Tommy Lee Cook. Mr. Cook is a musician, contractor and blues-club owner in Southwest Florida. Trump is awesome. When the left, right, globals, radicals, all line up against a man thats never been part of their corruption, its refreshing. HRC and the Democrats are the worst thing to ever happen to Black America. LBJs destructive Great Society and War on Poverty have put these poor souls in a place thats equal or worse than the old plantation. Do-gooders doing good whipping out the Government tit for all to suckle. Sad, sick and repugnant. AND, not understanding and looking the tenets of Sharia Law square in the eye and rebuking this caveman evil is an absolute farce of do-gooderism. Study it, know it, understand it; theres no co-existence with these adherents. Its just not possible. America and Freedom are about the individual, not the collective. Its as simple as that, or it once was. Regaining ones self-worth over the grip of the handout mentality will be the solution and salvation of the free spirit once again. If its not too late. I love me, and by loving me, all that my world touches is a better place.Ž Shades of Ayn Rand. Thats the way it is. Q roger WILLIAMSrwilliams@floridaweekly.com ric BRADSHAWSheriff of Palm Beach County Sheriffs Office A big thanks to law enforcement agenciesIts been a very tough year for us in law enforcement. The job of policing communities has become more difficult and dangerous following the horrendous killings and attacks on police officers and deputies in Dallas, Baton Rouge and other cities. Suddenly, law enforcement is the target of protests and blame for every problem in our society. This is undeserved, unnecessary and Im not going to stand for it. Ive instructed my deputies to hold their heads up high as they go about their basic duties of serving and pro-tecting our residents. Yes, there have been problems in how some police officers handled situ-ations across the country and locally. However, as far as Im concerned, we dont have those problems in our jurisdiction. Problems often are created by those wanting to cause trouble. At the Sheriffs Office, I can tell you my deputies are highly trained in not only law enforcement tactics but also how to connect with residents and build trust between our agency and their communities. In fact, my staff has made training a part of just about everything we do. We not only adhere to training requirements set by Florida Department of Law Enforcement but we exceed them. We also strive to give residents a voice and be a part of our efforts in providing policing that is accountable, transparent, and equitable in the com-munities we serve. When we do some-thing wrong, we say we did something wrong. But no matter how hard we work, and how much our men and women sacri-fice to be deputies, our society unfairly expects so much more. I agree with what retiring Dallas Police Chief David Brown said at the tribute to the five offi-cers killed in his city this summer: Were asking cops to do too much in this country. We are. Every societal failure, we put it off on the cops to solve. Not enough mental health funding, let the cops handle itƒ. Here in Dallas, we got a loose dog problem; lets have the cops chase loose dogs. Schools fail; lets give it to the copsƒ. Thats too much to ask. Policing was never meant to solve all those problems.Ž Police officers have done nothing wrong. We take action when its needed to do our jobs and to protect residents, and ourselves, from attackers. Law enforcement follows a simple equation: If people dont try to shoot us, stab us, run us over with a car, or come at us in other ways, then everything is going to be fine. Its called being com-pliant. Officers are forced to take action only when people arent compliant. Once again, I stand behind and support all of my deputies. During these hard times, I ask you to join me in thanking our deputies and police offi-cers for putting themselves on the line to improve safety across Palm Beach County. Q

PAGE 5

FLORIDA WEEKLY WEEK OF NOVEMBER 17-23, 2016 A5 Coverage is underwritten by American Family Life Assurance Company of Columbus. In New York, coverage is underwritten by American Family Life Assurance Company of New York. Policies may not be available in all states. There may be indirect administrative or other costs. M1863C 7/12 Andrew Spilos | (561) 685-5845 | andrew_spilos@us.a”ac.com DR. MICHAEL PAPA Chiropractor | Clinic Director Get Back in the Game Full Physical Therapy Facility Treat Neck Pain, Back Pain and Sciatica caused by t BULGING/HERNIATED DISCS t DEGENERATIVE DISC DISEASE t FACET SYNDROME t FAILED BACK SURGERYWITHOUT THE USE OF DRUGS, INJECTIONS OR SURGERY AUTO ACCIDENT? School Physical Camp Physic al, Sports Ph ysical $20 GIFT CERTIFICATEThis certi cate applies to consultation and examination and must be presented on the date of the rst visit. This certi cate will also cover a prevention evaluation for Medicare recipients The patient and any other person responsible for payment has the right to refuse to pay, cancel payment or be reimbursed for any other service, examination or treatment that is performed as a result of and within 72 hours of responding to the advertisement for the free, discounted fee or reduced fee service, examination or treatment. Expires 12/08/2016.$150VALUE COMPLIMENTARY CHIROPRACTICEXAMINATION & CONSULTATION PAPA CHIROPRACTIC & PHYSICAL THERAPY XXX1BQB$IJSPDPNt 25 Years in Jupiter & Palm Beach Gardens! WE ACCEPT MOST INSURANCE PLANS DR. ALESSANDRA COL"NChiropractor PALM BEACH GARDENS 9089 N. Military Trail, Suite 37 Palm Beach Gardens, FL 33410561.630.9598 PORT ST. LUCIE9109 South US Hwy One Port St. Lucie, FL 34952772.337.1300 JUPITER 2632 Indiantown Road Jupiter, FL 33458561.744.7373 4 4 5 5 6 6 +RPH2q FH&OHDQLQJ6HUYLFHV Palm Beach Gardens | Jupiter | Wellington | Tequesta | Juno Beach www.gardensmaid.com | mirtha.meneses@gardensmaid 561-906-1854 GDUGHQVMDLG The waters of northern Palm Beach County will light up for charity Dec. 3. The 22nd annual Palm Beach Holiday Boat Parade and 17th annual On the WaterŽ Toys for Tots Drive kicks off this years holiday season in North Palm Beach. Organized by the Marine Industries Association of Palm Beach County, the parade will stage and begin at the north end of the Lake Worth Lagoon and proceed north on the Intracoastal Waterway to the Jupiter Inlet Light-house. Tens of thousands of specta-tors will watch the procession of more than 50 decorated vessels sparkling on the Intracoastal Waterway. There will be extended fireworks at North Palm Beach Marina, Jupiters Plaza Down Under on the Riverwalk and Harbour-side Place, plus a grand finale at the Jupiter Inlet Lighthouse. Local country singer/songwriter and American Idol finalist Emily Brooke will be a grand marshal, joining Mo and Sally from KOOL 105.5 on the Loggerhead Marina Grand Marshal boat. Popular viewing locations also include Juno Park, Bert Winters Park, Sawfish Bay Park and Lighthouse Park. The Palm Beach Holiday Boat Parade benefits the U.S. Marine Reserves Toys for Tots program. Last year, the MIAPBC collected thousands of toys for needy children in Palm Beach County making this event one of the top toy collecting events in Palm Beach Coun-ty. Toy donations can be dropped off at dozens of local businesses (listed at www.palmbeachboatparade.org), or picked up dockside during the parade by a fleet of marked toy boat volunteers by waving a flashlight. Boat entries will be accepted through Nov. 30. Boat entry is free and open to boats of all sizes. Judging is based on three factors: lights, enthusiasm and overall effect. The top three boats in each size category, plus Best of Parade,Ž win a total of more than $10,000 in cash and prizes. For more information, visit www. palmbeachboatparade.org or call 863-0012. Q Boat parade, toy drive to return to area waters Dec. 3SPECIAL TO FLORIDA WEEKLY_________________________Peggy Adams Animal Rescue League operates a pet food bank called Peg-gys Pantry to assist local families who are hurting financially and struggling to feed their animals. To help these families, Peggy Adams Animal Rescue League is holding a special food drive through Nov. 30. The drive will help stock the shelves of Peggys Pantry, which benefits as many as 1,000 pets each month. This is the season of giving, and I encourage all of those who can, to help bring cheer to families in need of some extra help feeding their pets by donating new unopened food and other pet supplies to the Holiday Food Drive at one of the many drop-off locations across Palm Beach County,Ž said Rich Anderson, executive director and CEO of Peggy Adams Animal Rescue League. For a list of needed items and official drop-off locations, in addition to Peggy Adams Animal Rescue League, go to www.PeggyAdams.org/peggys-pantry. Peggys Pantry is open Tuesday through Saturday from 10 a.m. to 5 p.m. and is at 3200 N. Military Trail within the double-dome building. Q Peggy Adams hosts holiday pet food drive SPECIAL TO FLORIDA WEEKLY_________________________The Palm Beach Gardens Police Foundations 9th annual golf tournament on Oct. 29 raised more than $25,000 in sup-port of local youth programs and com-munity outreach programs. Held at the PGA National Resort and Spa on both the Champion and Fazio courses, the tournament drew some 250 golfers, who enjoyed breakfast, 18 holes of golf, lunch and an awards cer-emony, all preceded by a Friday evening reception at Brio Tuscan Grille in The Gardens Mall. Money raised by the tournament helps support the Palm Beach Gardens Police Explorers, the BallStars Basket-ball Camp, Suits4Seniors, the annual college scholarship program, annual 9/11 essay contest and other programs that support youth who live in and go to school in Palm Beach Gardens. For more information about the Police Foundation, visit www.pbgpf.org or call the foundation office at 799-4440. Q Police Foundation golf tourney raises $25,000SPECIAL TO FLORIDA WEEKLY_________________________

PAGE 6

A6 NEWS WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLY Learn more at jupitermedurgentcare.com or call 561-263-7010. Jupiter Medical Center is dedicated to providing you and your family with affordable, quality medical care. The professional staff at our Urgent Care centers will see you without an appointment in just a few minutes … and most insurance plans are accepted!Walk in or schedule an appointment online. Choose Urgent Care...from the hospital you trust!In addition to treating minor emergencies and illnesses, we offer: t'MVTIPUT t %JHJUBM9SBZT t &,(T t -BCTFSWJDFT Hours: Mon. … Sat., 8 a.m. … 8 p.m.; Sun., 9 a.m. … 5 p.m. Jupiter: 1335 W. Indiantown Road, Jupiter Next to Harmony Animal HospitalTwo convenient locations: Abacoa: 5430 Military Trail, Suite 64, Jupiter Next to McDonalds in the Abacoa Shopping Center PET TALESPet mischief, mishaps a traditional part of the holidays BY DR. MARTY BECKER, KIM CAMPBELL THORNTON AND MIKKEL BECKERUniversal UclickThe 6-month-old Lab puppy grazed on the Christmas tree, gorging on glass bulbs, shimmery tinsel and more. When his owners brought him to the veteri-nary hospital, swollen with swallowed ornaments, he resembled a four-legged black tick with a pink tongue. A dose of barium to illuminate the intestinal tract on radiographs and force out the intesti-nal contents worked quickly, and before long, the dog was pooping out pieces of glass, string and wire hooks. As a big wad of tinsel emerged, it gave him the appearance of a giant New Years Eve party blower. No doubt all of us have memories of a cat scrambling up a Christmas tree, a swooshing dog tail overturning a lit menorah or a canine or feline counter cruiser tucking into the roast beast. As we enter the holiday season, its time to bone up on pet-proofing our homes to prevent pet mischief. After all, no one, least of all our dogs and cats, wants to spend any of the days between Thanks-giving and New Years in the veterinary ER. Weve gathered some cautionary tails „ er, tales „ to help you adapt your holiday traditions to the realities of life with pets. A pointer we know made the news when he ate a childs pushpin craft made with marshmallows to form a snow-man. The dog ate the entire thing and required emergency surgery to remove the pushpins. This year, the family will be surrounding the Christmas tree with a pet gate to prevent unauthorized ingestion of ornaments or presents. Cats, famed for their ability to leap tall counters in a single bound, and their partners in crime, dogs of all sizes, are notorious for stealing food off plates, tables and count ers, sticks of butter left out to soften, chocolate-covered espres-so beans and marshmallow Santas (ask us how we know this). And were not the only ones with larcenous animals. Dexter, a Parson Russell terrier, lives with a family who made the mistake of leaving a box of holiday chocolates sit-ting on their coffee table. They came home to find the contents strewn all over the floor, with much of it eaten. Dexter, apparently a discriminating dog, picked out his favorite varieties from the box. Fortunately the only outcome was a case of diarrhea, but now family members make it a point to put unsafe food items (or anything they dont want him to eat) well out of their dogs reach. In another case, curiosity didnt kill the cat, but it did cause him to get an unusual bath. Amanda Graves recalls the time her husband noticed that their Abyssinian kitten, Peyton, was looking a little greasy. Upon closer examination, he discovered Peyton was covered in chicken broth. He had pushed aside the silicone lid on a cooling stockpot of homemade chicken bone broth and had gone for a swim,Ž she says. Strategies that can help you head off holiday trouble include decorating with unbreakable ornaments, forgoing tinsel and putting unsupervised food out of reach. To protect her cat Kismet, Sharon Melnyk gave up using ribbons to wrap presents. He would try to eat any kind of ribbon and once bit my finger trying to get at a ribbon I was holding,Ž she says. Choose pet-safe plants, too. Poinsettias have a reputation for being poison-ous, but at most they cause mild stom-ach upset. Of greater concern are lilies, which can be lethal, and amaryllis bulbs and holly. Our pets dont mean to cause trouble during the holidays; they just want to help us celebrate. These simple precau-tions make it easier and less stressful to enjoy the season. Q Pets of the Week>>Lucky is a 3-year-old, 60-pound male mixed breed dog that is well behaved and calm.>>Kat is a 2-year-old female cat that is good with people. To adopt or foster a petThe Peggy Adams Animal Rescue League, Humane Society of the Palm Beaches, is at 3100/3200 Military Trail in West Palm Beach. Adoptable pets and other information can be seen at hspb.org. For adoption information, call 686-6656. >>Max is a neutered male tabby with muted colors, about 4 years old. He loves people, likes to play and interacts well with other cats.>>Luke (aka David Copper eld) is a neutered male black shorthair, about 6 years old. He is very friendly and curious, likes to interact with people and gets along well with other cats. To adopt or foster a catAdopt A Cat is a free-roaming cat rescue facility at 1125 Old Dixie Highway, Lake Park. The shelter is open to the public by appointment. Call 848-4911, Option 5. For additional information, and phot Q Whether they’re naughty or nice, pets often play a starring role in holiday celebrations.

PAGE 7

FLORIDA WEEKLY WEEK OF NOVEMBER 17-23, 2016 A7 A new report has just been released which reveals 7 costly mistakes that most homeowners make when selling their home, and a 9 Step System that can help you sell your home fast and for the most amount of money. This industry report shows clearly how the traditional ways of selling homes have become increasingly less and less effective in todays market. The fact of the matter is that nearly three quarters of homesellers dont get what they want for their homes and become disillusioned and worse financially disadvantaged when they put their homes on the market. As this report uncovers, most homesellers make 7 deadly mistakes that cost them literally thousands of dol-lars. The good news is that each and every one of these mistakes is entirely preventable. In answer to this issue, industry insiders have prepared a free special report entitled The 9 Step Sys-tem to Get Your Home Sold Fast and For Top DollarŽ. To hear a brief recorded message about how to order your FREE copy of this report call toll-free 1-866-274-7449 and enter 2000. You can call any time, 24 hours a day, 7 days a week.This report is courtesy of Chasewood Realty, Inc. Not intended to solicit buyers or sellers currently under contrac t. Copyright 2016 Avoid these 7 critical mistakes when selling your Palm Beach Gardens homeAdvertorial TWO DAYS ONLY! Friday, November 18th. 10am to 8pm. Saturday, November 19th. 10am to 6pm. The Gardens Mall, Palm Beach Gardens.For more information or to schedule an appointment, please call 561.775.3600. H H H H H H H H A A A A A A A A MI MI MI MI MI MI MI MI L L L L L L L L T T T T T T T T ON ON ON ON ON ON ON ON J J J J J J J J E E E E E E E E W W W W W W W W E E E E E E E E L L L L L L L L ER ER ER ER ER ER ER ER S S S S S S S S P P P P P P P P RE RE RE RE RE RE RE RE S S S S S S S S E E E E E E E E N N N N N N N N T T T T T T T T S S S S S S S S BAUME & MERCIER BREGUET BREITLING BREMONT CARTIER CHANEL G-SHOCK HERMS IWC JAEGER-LeCOULTRE PANERAI PATEK PHILIPPE SHINOLA TAG HEUER TUDOR Hundreds of watches from all Hamilton locations for these two days only. Discover the newest collections and limited editions from the “nest brands, including: FEATURING THE HERITAGE BLACK BAY BRONZE VIEW OUR EXTENSIVE COLLECTION OF VINTAGE AND PRE-OWNED TIMEPIECES New scholarship available through Alliance of Women Executives SPECIAL TO FLORIDA WEEKLYThe Alliance of Women Executives has announced its initial $1,000 scholar-ship. AWE is the vision of Vicki Tate, assisted by friends and colleagues Terri Dew, Sharon McCormick, Kaela Lerner, Cathy Peduto-Muzzio, Barbara Shafer and Elizabeth Love. Our mission statement says it all. We are a group of executive women shar-ing business experience and knowledge as well as promoting higher educa-tion for the next generation of women through academic scholarships. Dreams can come true and AWE wants to help,Ž Ms. Tate said. According to a national study by Sallie Mae and the market research firm Ipsos, How America Pays for College,Ž 34 percent of college tuition is paid through scholarship funds and 98 per-cent of students are taking steps to make college more affordable. AWE meets monthly. Meeting, membership and scholarship information is at www.allianceofwomenexecutives.com or at facebook.com\AWEofPalmBeach. Q

PAGE 8

The Mount Sinai Hospital in New York ranked 8th nationally for cardiology and heart surgery is here for you with a local practice in Palm Beach. Mount Sinai Heart New York Palm Beach oers comprehensive diagnostic and interventional cardiac care. Our expert physicians and support staff guide you through therapies and preventive lif estyle changes to enhance and maintain your cardiac health. Patients receive care locally in Palm Beach and have access to the leading-edge research and innovative treatment options of the entire Mount Sinai Health System. MOUNT SINAI DOCTORS HERE FOR YOU IN PALM BEACH For an appointment call 561-627-2210 or go to mountsinaidoctors.org/msdpb4

PAGE 9

FLORIDA WEEKLY WEEK OF NOVEMBER 17-23, 2016 A9 fr ee santa photo November 25 to December 24I-95 at exit 71 Palm Beach Lakes Blvd. 561.515.4400 | PalmBeachOutlets.com santas arrival November 25 € 10am Food PavilionFirst 100 people will receive gift cards from Palm Beach Outlets stores and more! free santa pet photo November 29 € 6-9pmSupport Peggy Adams Animal Rescue League with a suggested $10 donation. Two FREE 4x6 Santa photo prints and digital download of single image for every family who visits Santa. Bluewater Babes’ Fish for a Cure raises $100,000 SPECIAL TO FLORIDA WEEKLYBluewater Babes Fish for a Cure donated $100,000 from the 2016 Fish for a Cure tournament and event to long-standing local charities Cancer Alliance for Help & Hope, H.O.W. „ Hearing the Ovar-ian Cancer Whisper, the Kristin Hoke Breast Health Program at Jupiter Medi-cal Center and its own Out of the BlueŽ financial assistance fund that supports local patients in financial need who are undergoing treatment for breast or ovar-ian cancer. This years tournament and events featured more than 50 decorated boats on the docks at Sailfish Marina Resort, the sounds of the electric 1980s band Hot Pink, the Titos Handmade Vodka WoodyŽ RV, cocktail and costume contests and so much more. More than 2,000 people and over 100 boats came out to join the babes. Bluewater Babes Fish for a Cure is one of Floridas premier all-female fishing tournaments. We feel so blessed by the support of the community, our sponsors, friends and family that we are able to raise more funds each and every year, helping to increase the number of local breast and ovarian cancer patients in financial need,Ž said Jen-nifer McGrath, director. Next years event, which again will be presented by Titos Handmade Vodka, is set for Oct. 6-7. For more information contact Ms. McGrath at 406-2509, Jennifer@bluewa-terbabes.org or visit www.fishforacure.com and www.bluewaterbabes.org. Q Grandma’s Place plans holiday lunch SPECIAL TO FLORIDA WEEKLYGrandmas Place will hold its second annual Holiday Luncheon Nov. 29 at The Beach Club, Palm Beach. The charity shelters abused or neglected children in a safe, home-like environment. The luncheon, starting at 11:30 a.m., will include a wine reception, Grand-ma-tinis by Titos Vodka and a silent auction. Followed by a delicious lunch and a small Live Auction by Neil Saffer. SOCAPRI of Palm Beach will provide informal modeling during the event and Liz Quirantes, WPEC-Channel 12 news anchor, will be the celebrity emcee. Joan OConnell and Lou Ann WilsonSwan are co-chairs, Herme De Wyman Miro is the international honorary chair and Elayne Flamm is the honorary chair. Committee Members include Missy Agnello, Judy Barron, Sally D. Chester, RN, Sue Ellen Clarfeld, Richard Gaff, Eryn Grill, Patti Hadden, Cibi Hoffman, Eleanor Jones, Dina Rubio, Valerie Seif-ert, Robin Sharp, Everett Simon, Deanna Stepanian, and George Swan. Tickets are $150 per person. To receive an invitation, donate an auction item, purchase a ticket, or sponsor the event, please call Roxanne Jacobs at 561-408-3060 or e-mail her at roxanne@grandmasplacepb.org. Q P.B. Symphony plays ‘Peter and the Wolf’ for kids SPECIAL TO FLORIDA WEEKLYThe Palm Beach Symphony performed four shows of Sergei Prokofievs Peter and the WolfŽ with Ballet Palm Beach recently for Palm Beach County schoolchildren, including public, pri-vate and home-schoolers, at the Society of the Four Arts in Palm Beach. Via the sold-out shows at the Kravis Center on Oct. 31, Nov. 2 at the 700-seat Eissey Campus Theatre in Palm Beach Gardens and two performances Nov. 4 at The Society of the Four Arts 700-seat auditorium, the number of stu-dents served totaled 4,200 Palm Beach County children, bringing music educa-tion to life through this orchestral per-formance. Transportation was provided at no charge. The Kravis concert was part of the centers S*T*A*R Series for schoolchil-dren. The symphony performed two S*T*A*R series concerts two years ago, but those were held in the 300-seat Rinker Playhouse. The concerts receive support from the venues as well as from Paul and Sandra Goldner, who donated a $25,000 matching grant for education annually to the symphony, and from other con-tributors. Q Holiday fundraiser highlights history of giving SPECIAL TO FLORIDA WEEKLYHistory, holiday traditions and vintage flair will accentuate the 2016 Opportu-nity Holiday Luncheon & Boutique. The Dec. 7 fundraiser at the Sailfish Club, The Gift of Opportunity, benefits Palm Beachs oldest childrens charity. Opportunity began during the Great Depression, offering hope and help to chil-dren and families who were entrenched in poverty,Ž said Elena Siems, who is co-chairing the event with Jennifer Laz-zara. This years luncheon is a fun way to learn about some other traditions that also began with generosity.Ž Inspirational speaker and historical fiction writer L.A. Chandlar plans to take guests on a journey to discover the real people and the stories behind the legends. Since 1939, Opportunity Early Childhood Education & Family Center has been providing developmental programs for the children of working families in Palm Beach County. Opportunity cur-rently serves 96 children, ages 6 weeks to 5 years. The event is planned for 10:30 a.m.2 p.m. Wednesday, Dec. 7. Tickets are available at www.opportunitypbc.org. Q

PAGE 10

A10 NEWS WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLYthe prospect of setting up shop seems punishing and unlikely. But what if you could subtract a few major headaches like rent and payroll? Or if you could customize a space that is fully available when you want it, but isnt racking up utility bills when you dont? South Florida business owners are buying trucks, vans and buses to pro-vide residents with an array of services that span boutiques to auto repairs and giving customers a thrill at the same time. Its a business you can be very creative with,Ž said Kelly Calistri, owner of mobile boutique Couture To Your Door in Naples. She had a career in medi-cal research but realized that having two young children prevented her from working a regular 9-5 job. She decided it was time for her to pursue her longtime dream of owning a boutique. Originally, having a traditional storefront opera-tion was her goal, but after putting four wheels under her vision, she said she couldnt imagine serving her customers any other way. I think this is a really fun way to do it,Ž she said. I think the concept is fun and different and I think people like things they havent seen before.Ž According to the American Mobile Retail Association, about 82 percent of its members spent under $9,000 on their rig and about 91 percent spent under $9,000 to retrofit it to their speci-fications, less than a years rent on a commercial lease in a high traffic area. Business owners are often able to hit all the same shopping hotspots or at least capture similar customers to break even on their start-up costs within two years. People think, if I try and it doesnt work out, Im out $20,000 instead of $200,000,Ž said organization founder Stacey Jischke-Steffe. Mobile retail services, by following the model set before them by food trucks, rose in popularity during the Great Recession when credit was tight. It no longer seems to be just a trend, Ms. Jischke-Steffe said, and is understood to be a business model that stands alone. Some people might start a mobile busi-ness with the intention of eventually moving into a storefront, but they tend to keep the rig operational because it works. Its been incorporated into peoples business models in general,Ž she said. We hear from a lot of people closing their brick and mortars because they want that flexibility to really target their customer and drive directly to them ƒ were also seeing people who maybe always wanted to have a store so they open a truck first. They might eventu-ally go into a brick and mortar and keep the truck.Ž Curbside Gourmet, one of Palm Beach Countys most in-demand and visible food trucks, opened in 2010 and with its success, owners Matthew and Amanda Somsy have seen the catering side of their business flourish. Now they are exploring launching trucks in other markets. According to Mr. Somsy, busi-ness owners who have a good product can benefit from using a truck as a step-ping stone. Some people think that youre going to make a lot of money opening a food truck and its not going to happen,Ž he said. If you open up for a purpose, if you have a product that you really believe in, its really great to start and get it out there.Ž While Curbside Gourmet still dishes out popular items like its Maine lobster rolls to South Floridas hungry public and participates in food truck circuits, the Somsys served 180 weddings last year and the rig holds a special allure for private events. As far as the catering aspect, the truck itself has helped us for sure. It helps us bring the restaurant to our customers so they can have a house party and we wont have to use their kitchen,Ž Mr. Somsy said. A lot of your higher-end clients hire us to cater their parties because the truck color isnt so invasive.Ž It all seems to boil down to flexibility in the end, whether it is in hours, servic-es or inventory. Scott Keller, who owns Tropical Extremes in Naples and Dallas with his wife, Christine, travels all over South Florida and takes pride in bring-ing new dollars into Collier County with his laser tag and entertainment services. The benefit is that my company brings outside revenue into the county and my staff is paid with money outside the county,Ž he said. The result is that he can afford to pay his staff well and provide better service to customers. Were able to find the people and pay them really well to provide quality of DRIVENFrom page 1 COURTESY PHOTOCurbside Gourmet launched its food truck in 2010 in Palm Beach County. Its owners are now exploring the launch of trucks in other areas.COURTESY PHOTOCurbside Gourmet dishes out popular items like its Maine lobster rolls. VANDY MAJOR / FLORIDA WEEKLYKeri McDonnell owns Unfurgettable Pet Grooming in Naples. She packed everything onto wheels in 2011.“Some people think that you’re going to make a lot of money opening a food truck and it’s not going to happen ... If you open u p for a purpose, if you have a product that you really believe in, it’s really great to start and get it out there.” — Matthew Somsy, Curbside Gourmet

PAGE 11

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 NEWS A11service. Theyre not bounce house staff, theyre entertainment,Ž he said. Mr. Keller simply wouldnt be in business if the pair operated Tropical Extremes in a facility, he said. His ini-tial research into the business 11 years ago revealed that if he ran it in under-air space, the doors would shut in two years. A couple of friends looked at the cost per square foot and an hour-long conversation turned into 30 seconds,Ž Mr. Keller said. They said I didnt have enough to make the first two years.Ž So he retooled his business plan and now caters to private parties in Collier and lots of corporate and college events in Lee and Dade counties. It requires a lot of time on the road, but its what makes his business work, he said. Sometimes, business owners simply like offering their customers the per-sonalized service mobility offers. Once people start offering services aboard a truck, they can offer more luxuri-ous or customizable services, like Keri McDonnell, who owns Unfurgettable Pet Grooming in Naples. Ms. McDonnell started her business in a storefront but packed everything onto wheels in 2011 because she saw the benefit of giving her customers to-your-door service. Her month-to-month expenses are still comparable to her brick-and-mortar operation, but her cli-ent base now consists of regular cus-tomers who keep her very busy. Its just a salon on wheels ƒ with mobile pet grooming, its more special-ized and tends to be more expensive than a salon because Im bringing it to customers,Ž she said. Its also less stress and people get that, so theyre willing to spend a little more for their pet.Ž Ms. McDonnell soon discovered that once she and a new customer have established a rapport, she could provide what she calls a latchkeyŽ service. The customer will provide her with a key so she can enter the home while he or she is at work, groom the animal in the truck and lock up when the appointment is over. They come home to a freshly groomed pet,Ž she said. Well lock up and text that we left. We provide not only convenience of going to the home „ clients dont have to even be home.Ž Then there are the traveling businesses that should have been on the road all along. Wayne Martin owns Waynes Mobile Mechanic Service in Fort Myers and saves motorists a lot of money when their cars break down. Basically, when you take a car to a garage, you usually dont have your vehicle and its an inconvenience to you,Ž he said. If your car is on the side of the road and its quick and easy, I can get you up and running instead of hav-ing it towed to a shop. It saves people money.Ž Because he doesnt have large equipment like a lift, Mr. Martin has to forgo complicated repairs. He can, however, maintain fleets of service vehicles much more efficiently than a garage can. I do serve a benefit to certain businesses like contractors who cant afford to have their truck down. Theres no inconveniencing the company by not having it.Ž Success, he said, depends on finding the right niche where he hopes that he can grow enough excellent side-of-the-road service that prevents people from having to pay for a tow truck. It can prosper very well on a consumer level,Ž Mr. Martin said. It would be a lot better than a road ranger because we could dispatch a mechanic right to your spot.Ž Freedom of movement also allows Mr. Martin to provide a very handy and rare service: used car inspections. Most people in the market for a new vehicle arent knowledgeable about how much to pay for reasonable wear-and-tear and what makes a car a lemon. For an hourly rate, Mr. Martin can inspect as many cars as customers have lined up in the time theyve contracted him for. You do have the right to inspect,Ž he said. Ill go out and inspect it top to bottom „ from wiper blades to tire compression „ and give you an analysis of what the car is and verify the car is worth the money.Ž Mr. Martin echoed the sentiments of other mobile business owners that emancipation from a brick-and-mortar operation allows him more creativity with his services, mostly because he doesnt have the financial pressure to meet overhead costs and be tied to one spot to meet with customers. Mobile businesses do have a few pitfalls, Ms. Jischke-Steffe said, and one is that local ordinances vary widely and prospective owners have to do a lot of research to find out where they can operate and within what parameters. The last thing you want to do is buy everything and find out you cant get a permit,Ž she said. I always recommend people to start at the local level and find out rules and regs before they run out to get the truck and trailer. Sometimes those rules can limit the size and type of vehicle ƒ even if there are strict regulations, there are often ways around them.Ž Its also good to follow business etiquette. Its not acceptable to open in front of a brick-and-mortar competitor. People cant just stop in when they want to and thats a major challenge. Im finding places to be available to them during the day and farmers markets are a big help,Ž said Couture To Your Doors Kelly Calistri. I dont go anywhere near other boutiques, so I mostly do private events. As long as I have permission of whoevers driveway Im in, I dont have a problem.Ž Curbside Gourmet deals with changing regulations in municipalities throughout South Florida. Food trucks cant sell food within Palm Beach Coun-tys downtown area, Martin County only allows them to sell food on private property and in Delray Beach, the res-taurant groups are so strong you cant even step foot on Atlantic Avenue,Ž Mr. Somsy said. You should definitely do your homework.Ž While its great to see large companies embrace the mobile trend in their marketing, Ms. Jischke-Steffe said it takes a particular type of person to own a mobile business and particular type of customer to enjoy using them. It reminded me of the tiny home movement. You have a certain type of personality that really embraces mobile businesses,Ž she said. Q “Basically, when you take a car to a garage, you usually don’t have your vehicle and it’s an inconvenience to you ... If your car is on the side of the road and it’s quick and easy, I can get you up and running instead of having it towed to a shop. It saves people money.” — Wayne Martin, Wayne’s Mobile Mechanic Service in Fort Myers VANDY MAJOR / FLORIDA WEEKLYKelly Calistri owns the mobile boutique Cou-ture To Your Door.VANDY MAJOR / FLORIDA WEEKLYWayne Martin owns Wayne’s Mobile Mechanic Service in Fort Myers and says he saves motor-ists a lot of money when their cars break down.

PAGE 12

A12 NEWS WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLY To register for open house, visit OAPB.org/admission 80% Faculty with Masters Degrees 100% Accepted to 4-year colleges & universities Signature Programs: Aviation Cambridge Scholars Novel Writing Independent Research 9:1 Student-to-Faculty ratio Avg. class size: 16 75+Course electives oered to foster student inquiry, innovation and ideas $5 Million Need-based “nancial aid invested annually in bright young minds 27 Athletic teams with 75% student participation in at least one sport OPEN HOUSE Tuesday, December 65:00 p.m. Refreshments & Registration 5:30 p.m. Program Begins 3151 N. Military Trail, West Palm Beach, FL 33409 | 561.972.9600 | LikeŽ us on Facebook.com /FloridaWeeklyPalm Beach to see more photos. We take more society and networking photos at area event s than we can “ t in the newspaper. So, if you think we missed you or one of your friends, g SOC I American Heart Association Go R e 1 2 3 4 5 6

PAGE 13

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 NEWS A13 Compassion and expertise. These are the qualities for which the Jupiter Medical Center Physicians Group is widely known. People facing cancer, and their loved ones, can trust our team to provide the highest quality in personalized care. We use our decades of kno wledge, advanced fellowship training, and the cutting-edge technology available at Jupiter Medical Center to optimally target all types of cancer.To schedule an appointment with one of our cancer care specialists, call 561-263-4400.Cancer Care with Unique Expertise The Specialists of Jupiter Medical Center Physicians Group Learn more at jupitermedphysiciansgroup.com 1210 S. Old Dixie Hwy. l Jupiter, FL 33458 Andrea Katz, MD Fellowship-Trained Hematologist/Oncologist; Board-Certified, Internal Medicine and Medical Oncology; National Award Winner in Research and Publications Lucy M. De La Cruz, MD Fellowship-Trained Breast Surgeon; Board-Certified, General Surgery; Medical Director, Oncologic Research K. Adam Lee, MD Fellowship-Trained Cardiothoracic Surgeon; Board-Certified, Cardiothoracic Surgery; Medical Director, Thoracic Surgery & Lung Center of Excellence Nancy J. Taft, MD, FACS Fellowship-Trained Breast Surgeon; Board-Certified, General Surgery; Medical Director, Comprehensive Breast Care Program Donna Pinelli, MD, FACOG Fellowship-Trained Gynecologic Oncology Surgeon; BoardCertified, Gynecologic Oncology and Obstetrics & Gynecology; Medical Director, Gynecologic Oncology and the Walsh Robotic Surgery Program g o to www.” oridaweekly.com and view the photo albums from the many events we cover. Send us your society and networking photos. Include t he names of everyone in the picture. E-mail them to society@” oridaweekly.com.ANDY SPILOS / FLORIDA WEEKLY I ETY e d Breakfast at The Gardens Mall 1. Michele Jacobs and Teresa Urqhuart 2. Holly Maisto, Michelle Ketchum and Pam Rauch 3. Michele Schneider, Pam Rada, Robin Galanti, Michele Bachoon, Tammy O’Rourke, Robi Jurney and Kim Jones 4. Front row: Lynda Lomangino, Karmita Gusmano, Melissa Mickle, Tina Mahoney. Back row: Maitai Jabour, Shana Sheptak, Natalie Alvarez and Erin Shea 5. Terri Nissen and Martha Ahr 6. Michele Jacobs, Marcie Tinsley and Jean Wihbey 7. Suzanne Holmes and Shana Sheptak 8. Sally Ross Soter, Pam Rauch and Melissa Mickle 9. Angela Sweeting, Upendo Shabazz, Toni May and Connie Frankino 10. John Domenico, Susan Domenico, Allison Manis and Ari Malek 11. Mike Rajewski, Kara Duffy and Tom Cratty 7 8 9 10 11

PAGE 15

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 NEWS A15 .0,.0%)-&.0,!2).-.02."..*6.300%1%04!2).-#!++n rn 0)4!2%/!02)%11(.3+$#!++.300)4!2%)-)-'4%-21!-!'%0! 2nr PGA National Resort & Spa, 400 Avenue of the Champions, Palm Beach Gardens, FL 33418 | pgaresort.com0.-5..$2%!*%!&..$!2!2).-!+%1.02/!)-4)2%1 6.3!-$6.30&!,)+62.'!2(%0!2.302!"+%1&.06.30 (!-*1')4)-',%!+%231/0%/!0%6.30,%!+!-$#+%!02(%2!"+%1. 6.3#!-'.""+%'.""+%3-2)+6.35.""+%rn Thursday, November 24th /,7/, • !01-)/+3%0!"(.5$%0 • 03'3+!!-$.!12%$%%2!+!$ • 0!-"%006%#!-%223#%!+!$ • +!11)#!%1!0 • 0%!$1)1#3)21!-$5%%20%!$1 • +$!6.!#(%$(0),/ • !6#!++./1 • S 0)!#(!312%$ %++.5)-3-! • ,.*%$!+,.• 322%0!12%$.,30*%6 • )#*.06,.*%$.-%6!, • -'31%%&2%!,1()/ • (0),/!-$0)21 • !-*%%.2.!12 • 6WXI QJ • !/+%.!12%$ !,1!-#%22!0311%+1/0.321 !0+)#0%%-%!-10%!,%$.0-+!#*6%$%!8.//)-.(-9(%$$!0!#:(%%1%7XUNH\/HJ&RQ W rn#n GEVZIHXYVOI]RKVEZ]QEGRGLIIWIQMRMGLIIWIFYVKIVWTITTIVSRMTM^^EGLMGO IRRKIVWGYVP]JVMIW fresh fruit salad with marshmallows and cherries nn 4YQTOMR4MI&ERERE'SGSRYXERH:ERMPPE;EJIV8VMI'YTGEOIW'ERHMIHERH'EVEQIP %TTPIWERH%WWSVXIH4MIWERH 8EVXW $78 "! • $30 rrn n 9810 Alt A1A Promenade Plaza, Palm Beach Gardens We are happy to announce we are expanding our successful Wellington store to beautiful Palm Beach Gardens!We are offering special consignment terms to anyone that consigns prior to our December opening. IF YOU ARE THINKING ABOUT CONSIGNMENT, NOW IS THE TIME!Please call...561 814-6997 or 561 798-5222You can also send photos to myconsignment1@gmail.com.Like us on Facebook and download our mobile app. to get special discounts and photos of all incoming items. ConsignDesign&GARDENS GALLERY COMING SOON! BEHIND THE WHEELBMW 330e is everything to everyoneWe all have the one friend who has an outfit for every occasion but is still hesi-tant before stepping out the door. That indecisive pal will love the new BMW 330e. Just like someone who needs to be ideally dressed for every outing, this plug-in hybrid seems to want to please every crowd. It is a premium marque sedan, an eco-friendly all-electric, a roomy family vehicle and a sports car, all rolled into one package. A description like that would almost mean that we can end the review right here, but the balance this BMW has to walk is worth investigating further. After all, does doing everything well mean it can truly master anything? The design of the BMW 3-Series is quite handsome. Conservative sedan bodylines meet the furrowed brow head-lights and hallmark twin kidney grille to create a shape that has become a symbol of success in the junior executive parking lot. There is nothing on the hybrid that alters it. In fact, the only way people can tell its an eco-friendly plug-in hybrid is by the electrical outlet panel on the drivers fender and the eDrive badging on the c-pillar. That kind of incognito is good news for the green-minded manager who thinks the Toyota Prius doesnt have the prestige for a reserved parking space. Conversely, it might take a little extra explanation when pulling up to an Earth Day rally. Inside there isnt much to distinguish the eDrive version either. The 330e comes standard with nice features like a power drivers seat, dual zone climate control and a premium HD stereo with infotainment screen and iDrive. Of course, like any true BMW, theres a huge list of technology and luxury options that can add a mortgage onto this sedan. The only giveaway to the electrified power is a few discrete buttons that allow the driver to choose how the car best utilizes its voltage. The engine bay also doesnt look too different from the standard BMW lineup. The 2.0-liter turbocharged gas motor in the 330e is a 180 horsepower unit similar to whats available in the lesser 320i sedan. What is harder to see is the 87 hp electric motor thats sandwiched near the eight-speed transmission. The combination of the two isnt simple addition, so BMW lists the 330e at 248 total horsepower. This is the same as the conventionally powered 330i sedan, but the two vehicles behave quite differently. First, the 330e is a genuine plug-in hybrid. Leave it charged overnight on a standard 110V wall outlet, and in the morning owners can expect the whisper quiet drive for 14 miles or less. The all-electric power can even propel the car up to highway speeds of 75 mph. But for everyone whose commute is more than a few blocks, there is a better use for the battery power. The 330e can work with electricity in tandem with the gas engine. This creates an interesting situation where the torque-happy electric motor will be used to start from a stoplight and then hand off accel-eration duties to the turbo motor once it has spooled up to a more ideal rpm. Or at deceleration, the gas power will shut down, let the regenerative braking charge the batteries, and then start off again under stored battery energy. It is an engi-neering dance that maximizes both power and efficiency. Because the electric and gas power plants work together so often, it feels like BMW has toned down the exhaust note on the 330e. It creates a very quiet car that never loses the handling sharpness that is the bedrock of the 3-Series appeal. This alluring tango comes at a price. The BMW 330e starts at $45,095, which is $5,350 more than a 330i sedan. Even after tax credits, the most efficient drivers are not going to make up the electric efficien-cy savings of the plug-in hybrid for many years to come. In fact, when factoring in available government rebates, 330e shop-pers looking for premium green machines will not be too far away from Teslas all-electric Model S sedan.But the 330e has a place in this world. Its not the ideal electric car or a luxury car bargain. Instead, with an adaptable master of none, BMW has created the premium accessory that fits every occasion. Q myles KORNBLATTmk@autominded.com

PAGE 16

A16 NEWS WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLYa busy night with an increased presence. We definitely pay attention and place our resources strategically on that eve-ning,Ž said Lt. Seth Finman, public infor-mation officer with the Naples Police Department. That includes more officers on patrol in shopping and business districts including Fifth Avenue South and Third Street South. In downtown West Palm Beach, OSheas Irish Pub is preparing to get slammedŽ said general manager Gary Murray in his lilting Irish brogue. Mr. Murray is originally from Limerick, Ire-land. Were all Irish here,Ž he said. The night typically is not as busy as New Years Eve or St. Patricks Day, he said. Its like having a bonus Saturday night in the middle of the week, and people take full advantage of it.Ž OSheas will feature $4 shots of Wild Turkey whiskey, Wild Turkey whiskey promo girls and live music with the band Axcents. The kitchen at British Open Pub in Bonita Springs will be turning out plen-ty of meatloaf, steak and kidney pie, cottage pie and especially fish and chips on Black Wednesday „ anything but turkey or ham „ for an influx of hungry families. Youve got a lot of people that have their grandkids and everybody come down for the holiday and they dont want to dirty up their kitchen the day before Thanksgiving, so they go out to eat,Ž said manager Cathy Foster. Thats the feedback I get from them.Ž Black Wednesday is usually the second busiest night of the year after St. Patricks Day at The Celtic Ray Public House, a bar and restaurant in down-town Punta Gorda. With the possible exception of Halloween,Ž said owner Kevin Doyle. He doesnt know why that is exactly, but took an educated guess. My theory is that all the kids from all over come to see their parents here and their parents go to bed at 9 oclock and theyre out partying,Ž he said. Mr. Doyles son, Celtic Ray co-owner Max Doyle, will also be out late that night „ working. The Celtic Rays mobile food truck will be at Fort Myers Brewing Company serving classics such as fish and chips, Scotch eggs and bat-tered bangers. He plans to serve many college kids whose parents live in the area. Maybe they drove from Gainesville or Tallahassee and want to see some of their hometown friends or have a beer or whatever,Ž he said. Certainly I like to have a beer after a long drive.Ž Just make sure that the drive comes before the beer (or four), not after. Q WEDNESDAYFrom page 1 One of the reasons Black Wednesday has become a party night is that college students like to reconnect with hometown friends. HEALTHY LIVINGPrepare to quit smoking during annual Great American Smokeout CENTERS FOR DISEASE CONTROLIf youre a smoker, quitting can be the single most important step you take to protect your health and the health of your loved ones. Smoking causes immediate damage to your body, and it threatens your future with increased risks for can-cer, heart attack, lung disease and early death. Many people have probably urged you to quit smoking already, but we all know that quitting can be hard. Just as every journey begins with a single step, so, too, does quitting. Thats where the American Cancer Societys Great American Smokeout can help. This event takes place on Nov. 19 and encourages smokers to quit or to use the day to make a quit plan. Free help is available at all times, not just on Nov. 19, at 1-800-QUIT-NOW (1-800-784-8669) and at 1-855-DJELO-YA (1-855-335-3569) for Spanish speakers. When you quit smoking during the Great American Smokeout, you have the support of many other people across the nation. And youre taking an important step towards a healthier life. Five ways to get ready to quit Quitting smoking can be hard, so a good plan can help you get past symp-toms of withdrawal. Five steps can help. Q Set a quit date. Choose the Great American Smokeout or another quit day within the next two weeks. Q Tell your family and friends about your quit plan. Share your quit date with the important people in your life and ask for support. A daily phone call, email or text message can help you stay on course and provide moral support. Try Smoke-freeTEXT for 24/7 help on your mobile phone. Q Be prepared for challenges. The urge to smoke is short„usually only three to five minutes. Surprised? Those moments can feel intense. Even one puff can feed a craving and make it stronger. Before your quit day, write down healthy ways to cope. Drink water.Take a walk or ride your bike.Listen to a favorite song or play a game. Call or text a friend.Remove cigarettes and other tobacco from your home, car, and workplace. Q Throw away your cigarettes, matches, lighters and ashtrays. Clean and fresh-en your car, home and workplace. Old cigarette odors can cause cravings. Q Talk to your pharmacist, doctor or quitline coach about quit options. Nico-tine patches, gum or other approved quit medication can help with cravings. Smoking and colorectal cancer Quitting smoking can help you prevent many life-threatening illnesses, including colorectal cancer. Of cancers affecting both men and women, colorectal cancer (cancer of the colon and rectum) is the second lead-ing cancer killer in the United States, but it doesnt have to be. Screening can find precancerous polyps „ abnormal growths in the colon or rectum „ so they can be removed before turning into can-cer. Screening also helps find colorectal cancer at an early stage, when treatment often leads to a cure. If you are 50 years old or older, get screened now. If you think you may be at higher than average risk for colorectal cancer, talk to your doctor about getting screened early. Why do you want to quit? Perhaps you want to live a healthier life, live longer for your family members or save money that youd typically spend on cigarettes. Write down your reasons for quitting, no matter what motivates you to make this smart decision. Refer to the list whenever you have the urge to smoke. It will help remind you of all the reasons you want to quit. Remember, you can quit smoking and enjoy many healthy tri-umphs for years to come. Your first quit day may come as a pleasant surprise to you. Making the decision to quit helps you realize and appreciate your own determination. You have the strength it takes to quit smoking forever. For more information and help, see www.cdc.gov/features/greatameri-cansmokeout/. Q

PAGE 17

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 NEWS A17 ANDY SPILOS / FLORIDA WEEKLY LikeŽ us on Facebook.com /FloridaWeeklyPalm Beach to see more photos. We take more society and networking photos at area event s than we can “ t in the newspaper. So, if you think we missed you or one of your friends, go to www.” oridaweekly.com and view the photo albums from the many events we cover. Send us your society and networking photos. Include the names of everyone in the picture. Email them to society@” oridaweekly.com. SOCIETY Big Wigs for Breast Cancer Awareness at The Cooper in Palm Beach Gardens 1. Brittany Hayward, Heather Laughlin and Kelly White 2. Denise Brestle and Matt Brestle 3. Karen Paxton, Jay Zeager and Kimmie Meissner 4. Karen Paxton, Teca Sullivan, Kimmie Meissner and Tamra FitzGerald 5. Heather Laughlin, Claudia Mason and Sandy Strader 6. Kelly White, Lynn Levy and Tammy Anton 7. Teca Sullivan and Erin Devlin 8. Steve Atkins and Kerri Morrison 9. Tony Solo, Sandy Strader and Jay Zeager 10. Nicole Bullaro and Nichelle Rains 11. Tamra FitzGerald and Paul Jamieson 1 4 7 2 5 8 3 6 9 10 11 Dayve Gabbard, Jay Zeager and Claudia Mason

PAGE 18

Juno Beach Branch 14051 US Highway One, Juno Beach, FL 33408 (561) 630-4521 JBh Bh 14051USHihOJBhFL33408(561)6304521 Member FDICEQUAL HOUSINGLENDER RYour Home Town Bank TRUSTCOBANK*PMI Private Mortgage Insurance. Lender paid Private Mortgage Insurance on loans over 89.5% Loan-to-value. Please not e: We re serve the right to alter or withdraw these products or certain features thereof without prior notification. www.TrustcoBank.com No Points, No Borrower Paid PMI*, No Tax Escrow Required and Low Closing Costs! e Home of Low Cost Mortgages How to tell what you’re getting from social media marketing SPECIAL TO FLORIDA WEEKLYBusinesses, professionals and others who use social media to promote a brand often are unsure whether what theyre doing is effective. The usual ways of mea-suring success „ such as how many leads or sales were generated „ dont really apply and that leaves them puzzled. Even people who are enthusiastic about social media arent always clear on what to expect,Ž says Jay York, senior social media strategist for EMSI Public Relations based in Wesley Chapel. One problem is that people mistakenly focus too much on likes,Ž figuring the more the better, he adds. So just what are the best ways to calculate whether youre setting and achieving realistic marketing goals on social media? Here are a few things Mr. York says you should expect from your efforts: Q Growth of followers … You definitely should see growth in your number of followers. This is a long-term game, how-ever, so dont get discouraged if it doesnt happen as quickly as you had imagined. Q Quality and quantity of reach … Think of a billboard, Mr. York says: You can pay to put your message on a billboard alongside a highway, but are the passing motorists in your target audience? Some are, no doubt, but many are not. With social media, you can find the people interested in what youre offering. You can also use social medias analytic tools to gauge how far and wide your message is reaching. Q Engagement … The level of engagement on social media varies greatly. Some people just read or look at what everyone else is posting, but dont post themselves. Others regularly post their own content, and they like and share what others post. Often theyve attracted an enormous fol-lowing. Those are the people you want to go after,Ž Mr. York says. Follow them and they might follow you in return. If they share one of your posts, then youre reaching their large audience.Ž Q Traffic to your website … Google analytics can tell you not only whether your website traffic has increased, but where that traffic came from. Q The immeasurable … Sometimes the impact of social media efforts cant be measured. For example, if one person sees something a business posted on Twitter and mentions it to a friend, that friend might check out the companys website. If asked how they heard about the busi-ness, that person will say it was through a friend „ even though it was social media that got the connection started.Theres a science to managing a social media campaign,Ž Mr. York says. If you want the best results, you cant take a willy-nilly, anything-goes approach. Youve got to carefully determine the most effec-tive ways of reaching your target audience, choose content thats most likely to engage them, and monitor whats working.Ž Q BUSINESS PALM BEACH FLORIDA WEEKLY WEEK OF NOVEMBER 17-23, 2016 A18 | WWW.FLORIDAWEEKLY.COM For the second time in a row, Jupiter Medical Center has received an AŽ grade from The Leapfrog Group, a national patient safety watchdog, rank-ing it among the safest hospitals in not only South Florida and the Treasure Coast but also in the United States. The Hospital Safety Scores, a service provided by the Leapfrog Group, assign A, B, C, D and F letter grades to hos-pitals nationwide, and offer the most complete picture of patient safety in the U.S. health care system. At Jupiter Medical Center, patient safety is our top priority,Ž said John Couris, the hospitals president and chief executive officer. Our recent accomplishments with regard to safety and quality demonstrate our commit-ment to bringing the best health care to the community. Jupiter Medical Center is the only hospital in Palm Beach, Mar-tin and St. Lucie counties to currently maintain both an A rating for patient safety and a four-star quality rating from the Centers for Medicare and Medicaid Services. The pursuit of safety and clinical excellence is ingrained in the culture at Jupiter Medical Center. The hospital hired Dr. Ron Riner to serve as its chief quality officer. To determine their rating, The Leapfrog Group evaluates infection control, procedures to reduce complications in surgery, practices to prevent medical errors and the overall expertise of doc-tors, nurses and staff,Ž said Steve Seeley, Jupiter Medical Centers vice president, chief operating officer and chief nurs-ing officer. Jupiter Medical Center excels in each of these categories, and we are constantly searching for ways to improve upon our best practices.Ž The Hospital Safety Score provides data and research to help the public make informed decisions about a criti-cal aspect of their health „ the safety of their local hospitals. The goal of the Hospital Safety Score is to reduce deaths or injury from hospital errors and infections by shining a light on leaders in patient safety. Leapfrogs Hospital Safety Score uses publicly available hospital safety data to assign A, B, C, D and F grades to more than 2,500 U.S. hospitals twice per year. Hospitals are assessed on 30 different measures from prevention of common hospital-acquired infections like C.diff and MRSA to patient reports of their experiences during their hospital stay. To see Jupiter Medical Centers full score or those of other local facilities, go to www.hospitalsafetyscore.org. Q Jupiter Medical Center gets ‘A’ for patient safety SPECIAL TO FLORIDA WEEKLY_________________________COURTESY PHOTO Genesis Community Health Inc., a nonprofit health center dedicated to serving patients of all economic levels, recently named Lake Worth resident Richard Bolko, CPA, MBA, to its board of directors. Mr. Bolko serves as a CFO/controller for a health insurance agency and health insurance brokers. As the leader of the finance and accounting group, Mr. Bolko is responsible for the administra-tive, financial and risk management operations of his company. We welcome Richards finan-cial acumen to our board, as we continue to expand and provide more services to the com-munity,Ž said Genesis CEO DeAnna Warren. Prior to his current position, Mr. Bolko served in various executive finance positions for organizations such as OJCO, TBC Corp. and FPL. Mr. Bolko is a Florida Certified Public Account and holds masters degrees in accounting and business administration. At three sites „ one in Boynton Beach and two in Boca Raton „ Gen-esis provides family care, womens wellness, pediatric services routine check-ups, testing/screenings, urgent care, OB-GYN services, HIV/AIDS testing, chronic condition diagnosis and management, schooland sports-required exams and dental care. For more information, visit www. gencomhealth.org. Q Lake Worth resident joins Genesis boardSPECIAL TO FLORIDA WEEKLY_________________________BOLKO

PAGE 19

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 BUSINESS A19 MONEY & INVESTINGAfter Trump win, stocks were up for biotech firms and down for gunmakersOne thing I love about the markets is, for better or worse, how instantaneous reactions are to news and events. So while news pundits continue to debate about what a Trump presidency will mean for the country politically, the market had just a few hours between the election result and the market open to decide how to react. And on that Wednesday, the collective market anointed definite winners and losers as a result of the Republican victory. The first big winner of the day was definitely biotech and pharmaceutical stocks. Both Clinton and Sanders were very critical of this sector during the campaign for driving up costs of certain drugs. Many feared that if Clinton won the election she would impose price caps on certain medicines, thus limiting this sectors profit opportunities. With Republicans now in control, analysts predict that there will be less scrutiny of drug prices. As a result, companies from Pfizer to Biogen were up 5 percent to 10 percent. The materials sector was also a big winner on Wednesday. One of the tenets of Trumps campaign was to boost American factory jobs by leveling the playing fieldŽ with foreign corporations. So companies like US Steel soared on expectations that the new president would enact policies to favor domestic steel companies over foreign competi-tion. Another key Trump campaign promise was to build up our military. That will cost money and defense contrac-tors will be happy to spend those funds on our behalf. Already popular because of their dividends, now there is some upside to their revenue and incomes as well. Energy companies also surged on Wednesday. Trump is known for sup-porting energy independence in Ameri-ca as well as energy jobs. Environmental regulations and global warming, not so much. These companies are hopeful that Trump will decrease regulations and open new lands for energy explora-tion. Similarly, banks also had a great day as they too anticipate fewer costly regulations. On the flip side, companies that rely on active trade with Mexico were hurt last week. Stocks like Cemex and even Constellation Brands (owner of Corona beer) saw their prices fall as Trump had campaigned to tear up the NAFTA trade agreement and build a wall on the bor-der of Mexico. Ironically, gunmakers also saw their stock prices drop. With a Clinton presidency, analysts predicted many people would be scared that she would impose more stringent gun laws so they would rush out to buy firearms before these new laws were put into place. With-out this fear, Trumps lack of new gun controls may have the effect of actually decreasing the number of guns being purchased in the near term. With Trumps embracing of traditional fossil fuels like coal, oil and natu-ral gas, it is no surprise that alter-native energy companies under per-formed the market last week. No one anticipates that President Trump will increase incentives for solar, wind or other renewable power sources. Finally, many investors believe that Trumps economic policies will expand the deficit. This is bearish for Treasury Bonds and, not surprisingly, they sold off on Wednesday as well. So while the market picked its winners and losers last week, it will be very interesting to see how many of these bets actually pay off down the road. As he proved during the campaign, Trump is unpredictable and does not follow conventional wisdom. It will be inter-esting to revisit this list a year from now to see just how right or wrong the market anticipated the economic results of President Trump. Q „ Eric Bretan, the co-owner of Ricks Estate & Jewelry Buyers in Punta Gorda, was a senior derivatives marketer and investment banker for more than 15 years at several global banks. eric BRETANestaterick@gmail.com MOVING ON UPWhile vacationing in Italy last year, Renee Schaefer noticed Antica Sartoria shops in different cities and loved the clothes she found inside. We walked into a store in Capri and fell in love with everything about the collection and the beachy chic vibe the brand represents,Ž Ms. Schaefer said. She describes the clothes, designed by Giocomo Cinque, as fresh, inspir-ing and statement-making pieces that women and children feel gorgeous wearing.Ž The Jupiter woman wears the Italian clothing all the time now and feels cer-tain other women in the United States will want to wear the Positano-based brand, too, especially in Florida. With that in mind, Ms. Schaefer and her husband, Curtis Sigretto, opened an Antica Sartoria shop in Downtown at The Gardens in October. It is the fashion companys first store in the U.S., although the couple has plans to open more shops next year. Were looking at Key West, Naples, Boca and Miami,Ž she said. We have exclusive rights to sell the brand in the U.S.Ž The 1,200-square-foot Palm Beach Gardens store (previously home to Izod) boasts an array of the brands signature turquoise and one-of-a-kind garments. Breezy blouses, embellished denim, striking bathing suits, printed cover-ups, dresses and caftans, as well as unique necklaces and boho-inspired beach bags reflect the shops Positano Meets Palm BeachŽ vibe. Business has been great do far,Ž Ms. Schaefer said. A lot of people around here travel to Italy and recognize the brand.Ž Designer Giacomo Cinque only makes a limited number of each item for his 16 stores throughout Italy, and now the Palm Beaches. I try to keep a good price point,Ž Ms. Schaefer said. I want everybody to enjoy the clothing.Ž A majority of the items in the collection sell for less than $200. Accessories start at $15. The couple isnt new to the retail business, but this shop is a new direc-tion for them. They own two Halloween Express franchise locations. Mr. Sigretto, who founded Halloween Express in 1989 and served as president of more than 220 stores, also serves as a consultant for their Antica Sartoria store. Wayne Jenkins, the founder of Wellington-based Captive One Insur-ance, is the lead investor. Ms. Schaefer grew up in Pennsylvania, where her father had a flower shop. She worked for him during holi-days, but made her career in property management and development in New Jersey and Penn sylv ania before moving to Florida nine years ago. In January, Ms. Schaefer will return to Italy to choose a new line from Antica Sartoria for her Florida customers. I love the ocean,Ž Ms. Schaefer said. And she enjoys being able to wear casual chic clothing all year round. Renee SchaeferAge: 53 Where I grew up: Upper Dublin, Pa. Where I live now: Jupiter What brought me to Florida: A warmer climate. My job today: Owner of the new Antica Sartoria boutique at Downtown at the Gardens. I also serve as the oper-ations manager for Halloween Express and Elk Creek Vineyards in Kentucky. My first job and what it taught me: My family owned flower shops, so growing up I was always working and watching my parents. Seeing them work hard over the years gave me the work ethic I have today: Work hard, play hard. A career highlight: Seeing Antica Sartoria come to life. I first saw the Italian brand in Italy and immediately knew we had to bring it to the United States. The pieces are exquisite, unique and special, and really embody that Positano Meets Palm Beach vibe. Its a perfect reflection of who I am, who I have become. What I do when Im not working: Sport fishing and traveling. Best advice for someone looking to make it in my field: Follow your dreams and do NOT give up! About mentors: I am very self-driven, and consider myself my own men-tor. Q Name: Renee Schaefer Title: Owner of Antica Sartoria boutique City of business: Palm Beach Gardens“My family owned flower shops, so growing up I was always working and watching my parents. Seeing them work hard over the years gave me the work ethic I have today: Work hard, play hard.” — Renee Schaefer,Owner of Antica Sartoria boutique BY MARY THURWACHTERmthurwachter@” oridaweekly.com COURTESY PHOTORenee Schaefer fell in love with the Antica Sartoria line while traveling last year in Italy.

PAGE 20

A20 BUSINESS WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLYANDY SPILOS / FLORIDA WEEKLY LikeŽ us on Facebook.com /FloridaWeeklyPalm Beach to see more photos. We take more society and networking photos at area event s than we can “ t in the newspaper. So, if you think we missed you or one of your friends, go to www.” oridaweekly.com and view the photo albums from the many events we cover. Send us your society and networking photos. Include the names of everyone in the picture. Email them to society@” oridaweekly.com. NETWORKING Vincent Cuomo event for Kids’ Dreams at PGA National Resort 12 10 13 14 11 1. Arthur Bernstein, Susan Kaplan and Vincent Cuomo 2. Bridgett Baratta, Brooke McKernan and Leah Cuomo 3. Brooke McKernan, Meg Harnett, Leah Cuomo and Vinny Cuomo_ 4. Craig Bristow and Alyssa Liples 5. Patricia Lebow and Vinny Cuomo_ 6. Rita Driscoll and Emiliano Brooks 7. Christopher White, Dorota Firek, David Shane and Katrina Kahook 8. George Weeks, Abbie Nasuti Bleam and Joe Nasuti 9. Gina Caccavale and Alexa Ponushis 10. Gino Martinez, Barry Heisler and Rosie Matthews 11. John Cuomo, Christine Cuomo Georgeou and Vincent Cuomo 12. Patricia Christensen, Cindy Crawford and Elisha Roy 13. James D’Loughy and Patricia Lebow 14. James Maloney, Carol Dixon, Monica Lokitus and Michael Coella 1 4 7 2 5 8 3 6 9

PAGE 21

WEEK OF NOVEMBER 17-23, 2016 A21 | WWW.FLORIDAWEEKLY.COM REAL ESTATE PALM BEACH FLORIDA WEEKLY Elegant comfort at BallenIsles SPECIAL TO FLORIDA WEEKLYFabulous water views surround this professionally decorated gracious nine-room home. The 3,838-square-foot, four-bedroom, 4-bath home at BallenIsles includes marble and wood floors, custom carpeting, updated appliances, two built-in wine cellars, built-in sound system and three zone updated air conditioning units. Custom double wood doors grace the entryway with views of water, lush golf course and an oversized patio perfect for swimming in the pool, relaxing, cooking and entertaining. Patio also contains raised spa and an outdoor shower. The kitchen is a real cooks kitchen, with convection and double ovens, pantry, lots of counter space and tremendous storage for dishes, glasses, trays and all of your cooking needs. Master bedroom offers wonderful water views, lots of custom built-in closets, sitting area and his and her updated baths, one with pool and patio direct access. From the family room, enjoy listening to music, watching your favorite TV shows, your family swimming or fellow club members playing golf. The three-car garage includes custom built-ins for golf shoes and equipment, cleaning supplies and surplus storage. Lang Realty has this BallenIsles home offered at $1,499,000. The agent is Jay Agran, (561) 371-7224, j.agran@langrealty.com. Q COURTESY PHOTOS

PAGE 22

GLOBAL VISION. LOCAL KNOWLEDGE.We offer access to buyers and properties all over the world, and our agents work and live right in your neighborhoodƒ Were proud to be your neighbor.340 Royal Poinciana Way, Suite 318, Palm Beach | 561.655.8600 For the full list of Douglas Elliman locations, visit elliman.com/of“ces/”orida 1111 LINCOLN RD, PH-805, MIAMI BEACH, FL 33139. 305.695.6300 2 016 DOUGLAS ELLIMAN REAL ESTATE. EQUAL HOUSING OPPORTUNITY. KNOWN GLOBALLY. LOVED LOCALLYWith our of“ce in the heart of Palm Beach and 6,000 agents nationwide plus the international scale and scope of Knight Frank Residential, the Douglas Elliman network reaches across 59 countries and 6 continents. 124 Via Bethesda, Palm Beach, Florida Web# RX-10281525 Ashley McIntosh 561.685.0861

PAGE 23

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 REAL ESTATE A23 Sothebys International Realty and the Sothebys International Realty logo are registered (or unregistered) service marks used with permission. Operated by Sothebys International Realty, Inc. Real estate agents aliated with Sothebys International Realty, Inc. are independent contractor sales associates and are not employees of Sothebys International Realty, Inc. PALM BEACH BROKERAGE | 340 ROYAL POINCIANA WAY, PALM BEACH, FL 33480 | 561.659.3555 | SOTHEBYSHOMES.COM/PALMBEACH PROUDLY PRESENTS G Bn r Err Sr | $3,995,000 | Web: 0076788 | 110viavizcaya.com Outstanding buying opportunity in prized location. Proper Palm Beach Bermuda with three large bedrooms (possible master downst airs), spacious patio for poolside entertaining. Manageably sized property set amongst grand estates. Jeff Cloninger | 561.329.8749 World’s Fair house comes on market in Palm Beach TOPTENREALESTATEDEALS.COMThe 1939 Worlds Fair remains the stuff of legends. Billed as Building the World of Tomorrow,Ž the fair ran through 1940 and drew 44 million people. One of the most popular exhibits included home designs of the future, a promise of a better time for a world bat-tered by the Great Depression and the start of World War II. One of the home designs and winner of the fairs first-place prize as the Home of the FutureŽ was the Fore and Aft House, designed by popular modernist architect Belford Shoumate. Mr. Shoumate was one of Palm Beachs most prolific architects in a career that spanned more than 50 years. His Fore and Aft model was built in 1940 on the Palm Beach Intracoastal Waterway near the ocean, now for sale at $7.995 million. He was instrumental in bringing Art Deco and modern home designs to Palm Beach instead of the more traditional Mediterranean-Revival styles that Addison Mizner had pioneered on the island in the 1920s. His 5,645-square-foot Fore and Aft House is designed to look like a boat hov-ering over the water „ its ocean liner and Art Deco style replicate many elements of the great ocean liners of the period. The home is longer than it is wide and designed with porthole windows and an upper deck with steamship railings to watch the sunsets over the water. Its five bedrooms have outside deck entrances much like the way one would access a ships cabin and the roofline gives the impression of a sail. Tropical touches include ceiling fans, coral-rock walkway and extensive Florida foliage and palm trees to provide shade.The home also has a unique Y-shaped two-car garage, pool, deep-water dock, fireplace, multiple built-ins and some orig-inal furnishings. It is the only lakefront house in Palm Beach with its own deeded oceanfront cabana and has 65 feet of Intra-coastal Waterway shoreline. Burt Minkoff of Corcoran Group Real Estate has the listing. Q COURTESY PHOTOS

PAGE 24

Info@WalkerRealEstateGroup.com Jim Walker III Broker Jeannie Walker Luxury Homes Specialist 561-889-6734 LUXURY RENTALS available... Ritz Carlton, Oasis 530 Les Jardin 4BR/4.5BA $10,000 Ritz 1805B 2BR/2.5BA $8,500 Ritz 1105B 2BR/2.5BA $8,200 Oasis 8B 3BR/3.5BA $9,000 Ritz 1502B 3BR/3.5BA $8,500 Sign up today for the Singer Island Market Updatewww.WalkerRealEstateGroup.com Ritz Carlton Residence 2506B 2BR+DEN/2.5BA $1,299,000 Ritz Carlton Residence 2104B 2BR+DEN/2.5BA $1,699,000 Ritz Carlton Residence 705B 2BR+DEN/2.5BA $1,599,000 Ritz Carlton Residence 1804A 3BR+DEN/3.5BA $3,685,000 Ritz Carlton Residence 204B 2BR+DEN/2,5BA $1,399,000 Ritz Tower Suite 7A 4BR+DEN/5.5BA $7,999,000 Oasis Singer Island 15B 3BR+DEN/3.5BA $2,599,000 Beach Front 503 3BR/3BA $1,100,000 Martinique WT202 3BR/4.5BA $599,900 Ritz Carlton Residence 306B 2BR+DEN/2.5BA $1,024,900 7MRKIV-WPERHˆ4EPQ&IEGL+EVHIRWˆ.YTMXIVˆ2SVXL4EPQ&IEGLˆ.YRS&IEGL Representing The Palm Beaches Finest Properties Ritz Carlton Residence 402A 3BR+DEN/3.5BA $3,600,000 Ritz Carlton Residence 1105B 2BR+DEN/2.5BA $1,599,000 Martinique WT303 3BR/4.5BA $579,000 Martinique WT103 3BR/4.5BA $575,000 Beach Front 1503 3BR/3BA $1,225,000 NEW LISTING NEW LISTING Ritz Carlton Residence 1502B 3BR/3.5BA $1,999,000

PAGE 25

Armory kicks off 30th anniversary celebration BY JANIS FONTAINEpbnews@” oridaweekly.comCelebrate the 30th anniversary of the Amory Art Center with the alumni, fac-ulty, board members, donors and stu-dents during a cocktail party at 7:30 p.m. Nov. 21, at the Kravis Center, 701 Okeechobee Blvd., West Palm Beach. The Armory Art Center was incorpo-rated as a not-for-profit in 1986, after a group of art lovers renovated an aban-doned Art Deco structure. The center opened its doors to the public in July 1987, thanks to its supporters, especially the late Robert Montgomery and his wife, Mary. For more information, visit www.armoryart.org.‘Duckling’ taleIntroduce your child to theater with Lightwire Theater Companys produc-tion of The Ugly Duckling,Ž on stage at the Kravis Center in West Palm Beach at 10 a.m. Saturday, Nov. 19. Great sto-rytelling and the timeless message of Hans Christian Andersens fairy tale are modernized with a neon (and more) lightshow and dancers wearing puppet-like costumes outfitted with electrolu-minescent wires. The show is best suited for kids age 5 to 8, but kids of any age are welcomed. 832-7469; www.kravis.org.Follow the light to a cureThe annual Light the Night Walk in Palm Beach County takes place from 5 to 9 p.m. Nov. 18, at the Meyer Amphi-theatre, 104 Datura St., West Palm Beach. Hosted by and benefiting the Leukemia & Lymphoma Society. Walks take place after dark in more than 200 communities across North America, where the lan-terns burn brightly as neighbors, friends and family unite to shine the light on a cure for blood cancers. A second walk takes place at Sunset Cove Amphithe-ater in Boca Raton from 5 to 9 p.m. Nov. 19. Info: www.lightthenight.org/pb.Korean film ‘Sea Fog’The Mandel Public Library is a good resource for free screenings of foreign, international and independent films, and its also a great place to borrow movies for free. The next film is Sea Fog,Ž screening at 2 p.m. Nov. 20. When seafaring Captain Kang learns his ship has been sold he decides to take on the job of smuggling illegal immi-grants into South Korea. In a dense sea fog, mysterious tragedy unfolds, sl owly HAPPENINGSSEE PATINKIN, B13 X SEE HAPPENINGS, B12 X ARTS & ENTERTAINMENT PALM BEACH FLORIDA WEEKLY WEEK OF NOVEMBER 17-23, 2016 | SECTION B WWW.FLORIDAWEEKLY.COM Patinkin returns to Kravis with ‘Dress Casual’ If youre a fan of Broadway musicals and popular songs, this is one concert you wont want to miss. Theater, film and television star Mandy Patinkin will bring his solo show, Dress Casual,Ž to Dreyfoos Hall at the Kravis Center for one performance, at 8 p.m. Sunday, Nov. 27. Mr. Patinkin said he will interpret tunes from the American Songbook accompanied by pianist Adam Ben-David. I love to sing,Ž Mr. Patinkin said. I always have. I started singing in the syna-gogue when I was seven years old. One thing led to another. I did musicals, then someone said why dont you make your own album? Ive worked with Paul Ford for years and we learned hun-dreds and hundreds of songs, many of which have gone into this concert.Ž Mr. Patinkins solo show had its genesis in the late 1980s and has undergone many variations. His notion always has been that it should be an informal, inti-mate evening of music that he shares with the audience. I call it Dress Casual, because I dress casually so that Im relaxed and comfort-able,Ž he said. And Ive had the time of my life doing it. Come relaxed. Dress casual. Were here to get away from the outside world for a while and take a vaca-tion from it.Ž Describing himself as a guy who is lyrically driven,Ž Mr. Patinkin has chosen songs that tell stories and one compos-er with whom he particularly resonates in that regard is the legendary Stephen Sondheim. He, like me, sometimes has a battle The Palm Beach Food & Wine Festival brings a celebration of its own this year as it marks its 10th birthday as a premiere culinary event in Palm Beach County. What once was a three-hour dinearound showcasing shops at the east end of Worth Avenue has grown over a decade into four days of dinners, semi-nars, and tasting events held in a number of venues in the county. It will again cul-minate in a grand tasting at The Gardens Mall in Palm Beach Gardens. David Sabin, president of Brickhouse Public Relations in Palm Beach and fes-tival organizer, is happy with how the event has grown up „ and out „ in its 10 years. Back in 2006, the little dine-around event was planned for the 150 Worth BY STEVEN J. SMITHssmith@” oridaweekly.com BY JAN NORRISjnorris@” oridaweekly.com Chefs offer samples during the Grand Tasting at last year’s festival.COURTESY PHOTOSAttendees raise a glass during the chef welcome at last year’s Palm Beach Food & Wine Festival. HUNGRY? HUNGRY? The Palm Beach Food & Wine Festival marks a decade of bringing culinary stars to the areaANYBODY COURTESY PHOTOArmory Art CenterPATINKIN SEE FOOD, B14 X

PAGE 26

B2 ARTS & ENTERTAINMENT WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLY NOVEMBER 25TH – JANUARY 8TH STAY • EXPLORE • SHOP • DINEExperience the Old Florida Yuletide Cheer of Downtown Fort Myers! www.RiverDistrictHolidays.com • SPECIAL HOLIDAY EVENTS • Festival of Trees | November 30-December 4 Holiday Stroll | December 2 Creative ARTs Market | December 9-10 Downtown Countdown | December 3125+ Shops and Services 50+ Restaurants and Entertainment Venues 20+ Art, Attraction and Activity Destinations WIN A 2-NIGHT STAY DOWNTOWN! enter the HOLIDAY GIVEAWAY Stay ‘n Shop for the Holidays! Save and Be Merry With Our Specials for Downtown Accommodations www.RiverDistrictHolidays.com/Stay scott SIMMONS ssimmons@floridaweekly.com A treasure remains a treasure, even if its dollar value drops COLLECTORS CORNERWhere: Auctions Neapolitan, 20 10th St. S., Naples; (239) 300-4613 or www. auctionsneapolitan.com. Cost: $5 The skinny: The brightly glazed earthenware pottery called majolica has been used for popular decorative and utilitarian wares for more than 800 years. Its named for the Spanish city of Majorca, but virtually every country of Europe made some form of the pottery. In England, Wedgwood and Minton were renowned for their majolica. In France, any number of companies made the pottery. But I am in love with the shadings of this 8-inch plate, made by Choisy-le-Roi, a company in operation from 1850 to 1910. This piece draws inspiration from Japan, right down to the cherry blossoms that fade into the rim. Those Japanese influences became more common in Western design after markets opened there in the mid-19th century. Based on the mark of this plate, which bears the initials HBŽ „ for Hippolyte Boulenger, a director of the company „ it was made before the 1890s, and probably was part of a series. I love the carved effect the glaze has on the relief of the design, and it will be lovely as art, preferably on my kitchen wall. Q „ Scott Simmons THE FIND:My mom and I got our comeuppance years ago at an antiques show. We asked the price of something.The dealer replied, Well, if you have to ask, you probably cant afford it.Ž Well, then!Looking back, the dealer probably was right. Her price probably was more than we wanted to pay or „ closer to reality „ more than we could afford. But antiques tended to be more expensive back then, too, both by comparison to what wages were and by comparison to today. For example, I never would have found a 19th-century French majolica plate for $5 at a high-end auction gallery like the one I found recently. It easily would have been priced at 10 times that at a show 20 years ago. It probably still is worth a good amount more than the $5 I gave, but not the $75 or even $100 it might have been worth in the heyday of traditional antiques. Thats because values have shifted.Simply put: What was treasure 35 or 40 years ago no longer is treasure to the collectors of today. But that doesnt diminish the quality of the piece or the enjoyment I receive from looking at it. In fact, the lower prices on these treasures make them more accessible than ever to own and to use. Thats all the more timely as the holidays near and we debate whether its too much work to use the good dishes or silver. Why limit their use to the holidays?Fine china? Yeah, you cant put it in the microwave, but use it every day and enjoy it. Life is too short to eat off of plastic. Use a gentle cycle and liquid detergent in the dishwasher. Yes, the same can be said for silver-plated and sterling flatware. Get it out and use it. It will glow with everyday use „ no polishing necessary. Sterling silver can go in the dishwasher, though the knives fare better with hand-washing. I hear over and over again how someone has this set of china or that set of silver but never has used it. Get out the good crystal. Treat it gently, but raise a glass and toast the hope and happiness of being together with loved ones. Then do a quick hand-wash and put it away someplace where its easily accessible, because youll want to use it again and again. And, perhaps with the pa tina of time and use, it will become even more of a treasure than you previously thought. Q A 19th-century majolica plate by Choisy-le-RoiSCOTT SIMMONS / FLORIDA WEEKLYThis 8-inch French majolica plate was made in the 1870s or 1880s.

PAGE 27

THE PAINTED OX 5 800 S Dixie Hwy, West Palm Beac h THE CONTAINER STORE 1 1201 Le g ac y Ave, Palm Beach Gardens gy on 6000 Glades Rd Town Center at Boca Rat o

PAGE 28

B4 WEEK OF NOVEMBER 17-23, 2016 FLORIDA WEEKLY r nr PRESENTED BY n THANNUAL 7!$#!! 8 / 0 4 1 + % 2 ) ! 5 2 3 666 % 2 / 1 / 1 % -2051 S. Flagler Drive € West Palm Beach, FL 33401 561-832-5328 € www.ansg.org Gallery Hours Wed Sun, 10 am 4 pm ANSG Members Free, Non-members $10 HISTORIC HOME, ARTIST STUDIO AND RARE PALM GARDENS OF ANN WEAVER NORTON # $.( r 9 "$3+ r"!$$ 1( 3+ 3+ n3+ '))&1%3,.* 3+1/4*+ ()'%()2 Aligned with the F estival of T rees Celebra ting Design Through the Decades, this exhibition will focus on artfully ca ptured moments of design through the ages. Each room of the Ann Norton Sculpture Gardens Galler y will feature different decades of iconic photography.ON DISPLAY through DECEMBER 28, 2016 presented byIn partnership with The Gardens Conservancy and Sentient JetA SURVEY OF CONTEMPORARY THEMES Michael Massaia GALLERY TALKS WEDNESDAYS AT 11 AND SUNDAYS AT NOON LATEST FILMS‘Doctor Strange’ +++ Is it worth $15 (3D)? YesYou know youve seen jaw-dropping action scenes in movies. What you dont know is how jaw-droppingly awesome the action is in Doctor Strange.Ž Please, dear reader, if you enjoy grand visual spec-tacles that push modern visual effects to new limits, do not miss this movie. Director Scott Derrickson (SinisterŽ) takes the sidewalk and road bending of InceptionŽ to the next level and then some. Characters fight on the sides of buildings and open portals to different dimen-sions. Skyscrapers split in half, floors change shape and size, and so much more. These arent just excit-ing action scenes; they are fantastic visual sequences that truly have to be seen to be believed. The story holds up well enough. Dr. Stephen Strange (Benedict Cum-berbatch) is a brash, arrogant neuro-surgeon. His work is his life, which explains why he ignored a relation-ship with ER doctor Christine Palm-er (Rachel McAdams) for the sake of his career. As happens, life soon humbles him. A car accident leaves the doctor unable to use his hands, and there-fore unable to work as a surgeon. After numerous failed fixes, hope emerges as Strange learns of a paraple-gic (Benjamin Bratt) whos able to walk again. Soon Strange is off to Nepal to meet The Ancient One (Tilda Swinton), a sorcerer with mystical powers who, in her own words, reorients the spirit to better heal the body.Ž Stranges super-hero training henceforth begins. The villain is Kaecilius (Mads Mikkelsen), one of The Ancient Ones for-mer students, who wants to manipulate time and welcome a dark lord to Earth. Along with The Ancient One, her pro-tge Mordo (Chiwetel Ejiofor) and a spunky librarian named Wong (Benedict Wong), Strange tries to stop Kaecilius and his zealots from ruining the world. How does this fit into the Marvel Cinematic Universe? Wong explains that the Avengers protect the world from physical threats while The Ancient One and her sorcerers protect it from mystical threats. Strange also wears the TimeŽ Infinity Stone, which is the fifth of six stones that will be revealed before the next AvengersŽ movie in May 2018.A word of warning to the easily queasy: Though the film looks great in IMAX 3D, note that (as always) depending on where you sit, even the slightest head tilt might result in a possibly headache-inducing blurry image. Truly, some sequences are visually overwhelming. Usually thats a good thing, but here, given the scale of the images, it can feel like a bit much. If you have a big meal beforehand, and/or are uncomfortable with intricate surgical procedures, go ahead and watch in regu-lar old 2D. You will still enjoy it, and save a few bucks in the process. Mr. Cumberbatch „ who almost didnt do the film because he was busy with HamletŽ on stage in London „ handles himself well amidst all the computer-generated images surrounding him, as does the rest of the cast. Theres also a decent amount of humor here, mostly from Stranges wise-guy remarks, that the otherwise gloomy movie certainly needs. Ultimately, though, its the bold and imaginative images that make you say Wow!Ž a nd will have you leaving the movie on a high. Q dan HUDAKpunchdrunkmovies.com >> Stay for the credits. Thor (Chris Hemsworth) makes an appearance. FILM CAPSULESTrolls +++ (Voices of Anna Kendrick, Justin Timberlake, Zooey Deschanel) Trolls Poppy (Ms. Kendrick) and Branch (Mr. Timber-lake) try to save fellow trolls from being eaten by the bigger, badder Bergens. The animation isnt impressive, but the mash-ups of pop hits and the strong message of finding ones own happiness are enough to make this worth recommending. Rated PG.Jack Reacher: Never Go Back ++ (Tom Cruise, Cobie Smulders, Danika Yarosh) Ex-soldier Jack Reacher (Mr. Cruise) teams up with Major Susan Turner (Ms. Smulders) after theyre both framed for murder. A mediocre sequel to the 2012 hit, its predictable and strains to create interest. Even the action is boring. Rated PG-13.Inferno +++ (Tom Hanks, Felicity Jones, Omar Sy) Robert Langdon (Mr. Hanks) wakes in Florence, Italy, with no memory of how he got there, but soon is thrust into stopping a deadly virus that could wipe out half the worlds population. Director Ron Howards (A Beautiful MindŽ) pace is brisk and the story is a fun puzzle to piece together. Rated PG-13. The Accountant +++ (Ben Affleck, Anna Kendrick, J.K. Simmons) An autistic accountant (Mr. Affleck) is secretly a highly trained killer in this action drama from director Gavin OConnor (WarriorŽ). The role is perfect for Mr. Affleck, the story is gritty in a good way and the action is solid. Rated R. Q

PAGE 29

FLORIDA WEEKLY WEEK OF NOVEMBER 17-23, 2016 B5 Federation Jewish empowers livesWith your help, we are empowering Jewish college students to stand up to anti-Israeli activity on campus.Changing. Empowering. Inspiring. 100 days f Impact O n #G ivin g Tuesday ( November 29), a nswer th e ca ll or g i ve on li ne a t j ewishpalmbeach.or g FLORIDA WRITERS A piercing narrative of what binds and separates parents and childrenQ The NixŽ by Nathan Hill. Knopf. 640 pages. Hardcover, $27.95.Riff is the word Im looking for. But which defini-tion will succeed in making the con-nection to Naples resident Nathan Hills grandly ter-riff-ic first novel? Here are two from the online Oxford English Dictionary: (1) A short repeated phrase in popular music and jazz, typi-cally used as an introduction or refrain in a song; (2) A monologue or spoken improvisation, especially a humorous one, on a par-ticular subject. Many of the most astounding pas-sages in The NixŽ are in a kind of riff style, but the best are extended riffs that go on for many pages. They are boldly and darkly satir-ic. Laura Pottsdam, wayward student of Eng-lish Professor Samuel Ander-son, is revealed through riffs that express the self-indulgent thoughts that run through her mind and slither out of her mouth. She is at once airhead and supreme manipulator. She defeats Samuels attempt to bring her plagiarism to any kind of just resolution. She exhib-its a shrewd gamesmanship through which she threatens his career, a career already threatened by his inability to deliver a promised book manuscript to his publisher. Readers first meet these two characters, and many others, in scenes set in 2011. The major piece of Chicago news that summer is that a former radical female hippy, now middle-aged, has attacked Governor Packer. That woman is Samuels mother, Faye, from whom the professor has been estranged since she walked out of their suburban house-hold when he was a boy. Now she had found and lost herself in the violence of the 1968 Chicago riots. This inventive novel is mostly fashioned by filling in the blanks between occurrences that happened during and between those polar years. A large cast of characters is needed to do this imaginative work, and an astounding representation of cultural and physical environments anchors and validates the characters who moved through them. Samuel is something of an addict. He spends way too much time playing com-puter war games, in this case World of Elfscape,Ž inside of which he is Dodger the Elven Thief. Learning about the game and its allure is important to understanding the authors vision. For Samuel, the game keeps his mind off how far his star has fallen (and his mar-riage fallen apart) since being named a sure-bet young author at the age of 24. His addiction, however, is nowhere close to the complete absorption into the Elfscape fantasy of the gamer known as Pwnage. The riff that captures Pwn-ages failed attempt to free himself from his all-consuming immersion in this fantasy is one of the most amazing sty-listic feats in the book. At once hilarious and tragic, its a kind of shorthand for the theme of emptiness that dominates The Nix.Ž The loss of his mother gen-erates the emptiness in Samuel, who succumbs to writing a scandalous attack on her, the woman labeled the Packer Attacker, in place of the novel he cannot produce. Various degrees and manifestations of emptiness define characters like Faye (defined by departures rather than arrivals), her immigrant father, Fred, who is lost in memories of his Norwegian boyhood, and both Bishop and Bethany Fall, childhood friends whose lives are intertwined with Samuels in psychologi-cally disturbing ways (though Bethanys role later takes on redemptive power). Mr. Hill skillfully marinates his novel in recent American history: the 1968 election season with its Vietnam War shadow, the echoes of 9/11 that conjure American vulnerability and the slumbering economy that distinguishes the mood of the 2011 sequences. The earlier part of the frame is advanced by the fictional appearances of historical personages, notably Hubert Humphrey and Allen Ginsberg. I dont read many 600-page novels these days, and yet I might read this one a second time before the year is out. It is so rich in observational power, so mas-terful in tuning emotional experiences, so carefully balanced in interweaving its story elements, so richly and evocative-ly stylized. And it is so true to the expe-riences of those who have sojourned that territory of time, place, crisis and personal evolution. The 600-plus pages went by very quickly, without the temp-tation to skip any of them. Widely praised before its late-August publication, this imposing and highly entertaining first novel is certain to col-lect further accolades. Q „ Phil Jason, Ph.D., United States Naval Academy professor emeritus of English, is a poet, critic and freelance writer with 20 books to his credit, including several studies of war literature and a creative writing text. HILL ar c t. o st a s x Ž o f h e e d o n s y r d arrivals), her h r e l E t g u S h r phil JASONphiljreviews@gmail.com

PAGE 30

B6 ARTS & ENTERTAINMENT WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLY CALENDARPlease send calendar listings to calendar editor Janis Fontaine at pbnews@flori-daweekly.com. THURSDAY11/17 Clematis by Night — 6-9 p.m. Thursdays on the West Palm Beach Waterfront, 101 N. Flagler Drive at Clematis Street. Terry Hanck sings the blues and R&B. Info: www.clematisbynight.net.The Atala Chapter of the North American Butterfly Association — 7-9 p.m. Nov. 17, Pine Jog Environmental Education Center, 6301 Summit Blvd, West Palm Beach. Dean and Sally Jue will speak about Rar e Butte rflies of North Florida. Free. Guests welcomed. Info: www.nabapalmbeach.org for more information.An Olde Fashioned Holiday — Nov. 17-19, at the Fieldhouse at Old School Square, 51 N. Swinton Ave., Del-ray Beach. This is the Pineapple Grove Chapter of the Southern Handcraft Societys 24th annual show. The juried arts and craft show features all hand-made items, plus food and candy, raffle prizes. Hours are 9 a.m. to 8 p.m. Nov. 17-18, and 9 a.m.-2 p.m. Nov. 19. Contact Madeline at mhincken@gmail.com. Palm Beach County Natural Areas Photography Lecture — 1:30 p.m. Nov. 17, North Palm Beach Library, 303 Anchorage Drive, North Palm Beach. Benji Studt gives a 30-min-ute talk and slide show. Learn about the Adventure Awaits series of free photo workshops in designated Palm Beach County natural areas. Free. 841-3383; www.npblibrary.org. FRIDAY11/18 St. Mark’s Episcopal Church’s Fall Festival Bazaar — 9 a.m.-5 p.m. Nov. 18-19, and 9 a.m.-1 p.m. Nov. 20, St. Marks Youth Center and Gym-nasium, 10635 Gardens East Drive, Palm Beach Gardens. A silent auction, beach cottage chic booth, bears and specialty crafts, Christmas items, childrens toys, handmade quilts, gourmet and baked goods, estate and costume jewelry, and a variety of specialty vendors. Info: 622-0956; www.stmarkspbg.org November’s Sip-N-Shop — 1-5 p.m. Nov. 18 and 25, at Straight From the Heart, 12100 U.S. 1, Suite C, North Palm Beach. Ten percent of the days total sales benefit Place of Hope. Info: 775-7195 or email AmyleighA@placeofhope.comThe Jove Comedy Live — 6 and 8 p.m. Nov 18, the Performing Arts Academy of Jupiter, 6743 W. Indiantown Road, Jupiter. The early show is a family show. The 8 p.m. show is an adult show. at www.QuiteFranklyShow.com; www.FrankLicari.com.“Jacques de Beaufort: Aesthet-ics and Surrealism” — Opening reception at 7 p.m. Nov. 18, The Box Gallery, 811 Belvedere Road, West Palm Beach. On display through Dec. 15. Curator: Rolando Chang Barrero. RSVP at Eventbrite.com. SATURDAY11/19 The Junior League of the Palm Beaches’ Deck the Palms — 9 a.m.-4 p.m. Nov. 19, at the Palm Beach Convention Center, 650 Okeechobee Blvd., West Palm Beach. More than 125 vendors, a VIP lounge ($40 cover), silent auction and a showcase of the leagues community projects. www.jlpb.org. The Friends of the Lake Park Library’s Book Sale — 9 a.m.-2 p.m. Nov. 19, at the library, 529 Park Ave., Lake Park. Info: 881-3330. The Jove Comedy Live — Nov. 19, Palm Beach School for Autism at Suri West in Wellington. Get tickets at Eventbrite.com Lighthouse River Rendezvous — 6-9 p.m. Nov. 19, Jupiter Inlet Lighthouse and Museum, 500 Captain Armours Way, Jupiter. A waterfront party on the banks of the Loxahatchee River and Jupiter Inlet will feature live jazz by Davis & Dow, a 40-item silent auction and food and beverages from local res-taurant partners. A copy of the first-ever art-photography calendar featuring 12 images of the lighthouse taken by local photographers will be included in the ticket price. Tickets are $75 and can be purchased from the Museum Gift Shop, by phone at 747-8380, Ext. 101, or online at www.jupiterlighthouse.org. SUNDAY11/20 Sunday on the Waterfront — 4 p.m. Nov. 20, Meyer Amphitheatre, 104 Datura St., West Palm Beach. Features the Palm Beach Atlantic University Symphony with featured artist Brbara Padilla, a runner up on the fourth season of Americas Got Talent.Ž BYO blankets and lawn chairs. TUESDAY11/22 Left vs Right: The Battle For Israel’s Soul — 2 p.m. Nov. 22, Temple Shaarei Shalom, 9085 Hagen Ranch Road, Boynton Beach. Moderated by Brett Sandala. A second discussion will be held at 7 p.m. Nov. 22 at the Mandel JCC, 5221 Hood Road, Palm Beach Gardens. This discussion is moderated by Brooke Wiener. The discussion will focus on the varying views on Israel and the Middle East conflict. Guests speakers include Johnathan Jeremy JJŽ Goldberg and Jona-than Tobin. Info: 242-6671. Register online at jewishpalmbeach.org/leftvsright. WEDNESDAY11/23 Art Pop-In Palm Beach — Gallery with art by Edouard Duval-Carri, Dan Leahy, Silvia Lizama, Austin Manches-ter, Patricia Nix, Carol Prusa, Patricia Van Dalen and Michelle Weinberg, 101 N. Clematis St., downtown West Palm Beach. Open 2-8 p.m. Nov. 23-Dec. 6. Info: 818-9952. LOOKING AHEAD Clematis By Night — 6-9 p.m. Thursdays on the West Palm Beach Waterfront, 101 N. Flagler Drive at Clem-atis Street. Info: clematisbynight.net Q No CbyN on Nov. 24. Enjoy Thanksgiving. Hippocrates Thanksgiving 2016 — Noon to 4 p.m. Nov. 24, Hippocrates Health Institute, 1466 Hippocrates Way, West Palm Beach. Reservations are required for this vegan Thanksgiving Cel-ebration. Adults $40, Kids age 5-12 $20 in advance. Adults $50, kids age 5-12 $25 at the door. All proceeds benefit Hippocrates Scholarship Fund. RSVP to 471-8876; www.hippocratesinst.org/thanksgiving2016.Ballet Palm Beach: “The Nut-cracker” — Nov. 24-27, PBSCs Eissey Campus Theatre, 11051 Campus Drive, Palm Beach Gardens. Tickets: $19 and up at balletpalmbeach.org AT DRAMAWORKS Palm Beach Dramaworks at The Don & Ann Brown Theatre, 201 N. Clematis St., downtown West Palm Beach. Call 514-4042, Ext. 2; www.palmbeachdramaworks.org. “Tru” — Dec. 2-Jan. 1.“Collected Stories” — Feb. 3-March 5.“Arcadia” — March 31-April 30.“The Cripple of Inishmaan” — May 19-June 4. AT DREYFOOS Dreyfoos School of the Arts, 501 S. Sapo-dilla Ave, West Palm Beach. 802-6000; soafi.org/events.Fall Dance Concert — Nov. 18-20. Meyer Hall. Prism Concert — Nov. 30 at the Kravis Center, West Palm Beach. AT THE DUNCAN THEATRE Palm Beach State College, 4200 Con-gress Ave., Lake Worth. Info: 868-3309; www.palmbeachstate.edu/theatre/dun-can-theatre.Fall Collection — 8 p.m. Nov. 19. Features Miami City Ballet, Ballet Palm Beach, New World School of the Arts, Demetrius Klein Dance Company, BAK Middle School of the Arts and The Dancers Space. Part of Create.DANCE.Florida. Tickets: $25; series tickets $45. AT THE GARDENS MALL The Gardens Mall, 3101 PGA Blvd., Palm Beach Gardens. 775-7750.What’s Cooking? With Miss Nancy and Grace — 10:30-12:30 p.m. Nov. 19 in the Kids Clubhouse, Nord-strom Court. Get Thanksgiving-ready courtesy of Macaroni Kid with Chefs Hat and placemat decorating. www.thegardensmall.com/thegardensmallkidsclub.Santa’s Enchanted Garden Pho-tos — Through Dec. 24. FastPass available. Pet Photos with Santa — Nov. 20, 27 and Dec. 4. AT THE KRAVIS Kravis Center for the Performing Arts, 701 Okeechobee Blvd., West Palm Beach. Info: 832-7469; www.kravis.org.Ask Your Mama: 12 Moods for Jazz — Nov. 18-19. Ron McCurdys Quartet performs Langston Hughes Project. $32. PEAK.“The Ugly Duckling” and “The Tortoise and the Hare” — Nov. 19. A production of Lightwire Theatre Company. $12. Family Fare. AT THE PLAYHOUSE The Lake Worth Playhouse, 713 Lake Ave., Lake Worth. Info: 586-6410; www.lakeworthplayhouse.org.“Death by Design” — Nov. 17-Dec. 4.Movies in the Stonzek Theatre: “Harry and Snowman” — Nov. 18-24. Director Ron Davis will be on hand for a Q&A Nov. 20, after the 6:45 p.m. show.“The Entertainer” — Nov. 18-24. AT THE LIGHTHOUSE Jupiter Lighthouse and Museum, Light-house Park, 500 Captain Armours Way, Jupiter. Admission: $10 adults, $5 children ages 6-18; free for younger than 6. Jupiter Lighthouse participates in the Blue Star Museums program. Children must be at least 4 feet tall to climb. Tours are weath-er permitting; call for tour times. RSVP required for most events at 747-8380, Ext. 101; www.jupiterlighthouse.org.Lighthouse Sunset Tour —Nov. 30, Dec. 14 and 28. Time varies by sun-set. $15 members, $20 nonmembers. Lighthouse Moonrise Tour — 4:45 p.m. Dec. 13. $15 members, $20 non-members.Twilight Yoga at the Light — 5:45 p.m. Nov. 21, 28, Dec. 5, 12, 19 and 26. Mary Veal, Kula Yoga Shala, leads.Hike Through History — 8:30-10:30 a.m. the first Saturday of the month. A 2-mile trek. Minimum age 5, ages 13 and younger need an adult who is at least 18 years old. Next hike: Dec. 3. Lighthouse Story Time & Crafts for Kids — 10:30-11:15 a.m. monthly in the Seminole chickee hut for story time and a craft activity. Ideal for kids ages 8 and younger. Bring a small beach/picnic mat. Free. Next story time: Dec. 6. Res-ervation required. AT THE MALTZ Maltz Jupiter Theatre, 1001 E. Indian-town Road, Jupiter. Tickets: $56 single tickets. Ask about the four-play and the five-play package. Season tickets are $202. www.jupitertheatre.org; 575-2223. “Me and My Girl” — Nov. 29-Dec. 18. “The Producers” — Jan. 129. “Disgraced” — Feb. 12-26. “Gypsy” — March 21-April 9. AT MOUNTS Mounts Botanical Garden, 531 N. Mili-tary Trail, West Palm Beach. Info: 233-1737; www.mounts.org.Stories in the Garden: Garden ABCs — 10-11:30 a.m. the second Saturday. Stacey Burford, youth services librarian, reads, sings songs and teaches kids age 2-6 in the garden.Next date: Nov. 18. Free. AT PBAU Palm Beach Atlantic University „ 901 S. Fla-gler Drive, West Palm Beach. Performances take place at: DeSantis Family Chapel, 300 Okeechobee Blvd., West Palm Beach; Vera Lea Rinker Hall, 326 Acacia Road, West Palm Beach; Fern Street Theatre, 500 Fern St, West Palm Beach; Rinker Athletic Cam-pus, 3401 Parker Ave., West Palm Beach. 803-2970; pba.edu/performancesPBA Theatre Presents: “The Marvelous Wonderettes” — Nov. 17. Fern Street Theatre.Tauni De Lesseps Student Art Show Opening Reception — Nov. 18. Warren Library.

PAGE 31

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 ARTS & ENTERTAINMENT B7 CALENDAR TOP PICKS #SFL 11.18 #ONTHEIRTOES Q“Jacques de Beaufort: Aesthetics and Surrealism” — Opening reception at 7 p.m. Nov. 18, The Box Gallery, 811 Belvedere Road, West Palm Beach. RSVP at Eventbrite.com #HAHAHAHAQRodMan — Nov. 1819, Palm Beach Improv at CityPlace. Info: 833-1812; www.palmbeachimprov.com QBallet Palm Beach: “The Nutcracker” — Nov. 24-27, PBSC’s Eissey Campus Theatre, 11051 Campus Drive, Palm Beach Gardens. Tickets: $19 and up at www.balletpalmbeach.org An Evening of Diverse Chamber Music — Nov. 18. Vera Lea Rinker Hall.Sunday on the Waterfront: PBA Symphony — Nov. 20. Meyer Amphitheatre.Oratorio Chorus Concert: We Praise Thee, O God — Nov. 21. DeSantis Family Chapel. AT THE IMPROV Palm Beach Improv at CityPlace, 550 S. Rosemary Ave., Suite 250, West Palm Beach. Info: 833-1812; www.palm-beachimprov.com. RodMan — Nov. 18-19.Improv’s Annual Turkey Contest — Nov. 23.Cedric The Entertainer — Nov. 25-27. AT THE SCIENCE CENTER The South Florida Science Center and Aquarium, 4801 Dreher Park Road, West Palm Beach. Admission is $16.95 for adults, $12.95 for children ages 3 to 12 and $14.95 for seniors aged 60 and older. Admission is free for kids younger than age 3 and museum members. Hours: 9 a.m.-5 p.m. Monday-Friday, 10 a.m.-6 p.m. Saturday and Sunday. Info: 832-1988; www.sfsciencecenter.org. Our Body: The Universe Within — Through April 23. LIVE MUSIC Cafe Boulud: The Lounge — 9 p.m. Fridays, in the Brazilian Court Hotel, 301 Australian Ave., Palm Beach. Info: 655-6060; www.cafeboulud.com/palmbeach.Camelot Yacht Club — Jazz sessions start at 8 p.m. Tuesdays at Camelot Yacht Club, 114 S. Narcissus Ave., West Palm Beach. TCHAA! Band performs. 318-7675.The Colony Hotel — 155 Hammon Ave., Palm Beach. Info: 659-8100 or 655-5430; www.thecolonypalmbeach.com.Q Motown Fridays with Memory Lane — 9:30 p.m.-12:30 a.m. Q Saturday Late Night with the Dawn Marie Duo — 9:30 a.m.-midnight, music and dancing, plus cameos by Royal Room headliners and other celebrity performers.Q Royal Room Cabaret — Nicole Henry, Nov. 19 and 26. Don Ramon Restaurante Cuba-no & Social Club — Live music Thursdays through Sundays, 7101 S. Dixie Highway, West Palm Beach. 547-8704.E.R. Bradley’s — 104 Clematis St., West Palm Beach. Friday, Saturday and Sunday. Info: 833-352 0; www.erbradleys. com.The Pelican Caf — 612 U.S. 1, Lake Park. Jill and Rich Switzer, 7:30-10 p.m. Thursday. 842-7272; www.thepeli-cancafe.com.Q Dawn Marie & Giovanni — They play favorite dinner and dance music 6:30-9:30 p.m. Tuesdays.Q Jill & Rich Switzer — 7:30-10 p.m. Thursdays.Respectable Street Caf — 518 Clematis St., West Palm Beach. Info: 832-9999; www.sub-culture.org/respectables. The Tin Fish — 118 S. Clematis St., West Palm Beach. 223-2497; www.tin-fishclematis.com ONGOING The Ann Norton Sculpture Gar-dens — 2051 S. Flagler Drive, West Palm Beach. Admission: $10 adults, $8 seniors and $5 students. Free for mem-bers. Info: 832-5328; www.ansg.org.Q “Eye on Photography: A Survey of Contemporary Themes” — Through Dec. 28.Artisans On the Ave. — 630 Lake Ave., Lake Worth. Info: 582-3300; www.artisansontheave.com.Q Irene Jalowayski “One Women Artist” — An opening reception takes place 6-9 p.m. Nov. 19. APBC Art on Park Gallery — 800 Park Ave., Lake Park. Info: 345-2842; art-istsofpalmbeachcounty.com.Q APBC Art on Park Gallery’s Members 2017 Exhibit — Submission deadline is Dec. 21. The Armory Art Center — 1700 Parker Ave., West Palm Beach. 832-1776; armoryart.org. Q “New & Now: Work by New Faculty Fall 2016” — On display in the East and Greenfield Galleries. Its a multimedia exhibition featuring the work of artists Rosario Alborta, Judith Bert King, Jason LeVan, George Mesa, Ryan Parente from Infinite 3D Printers, Aimee Schulz, Vishan Seenath, Stacy Sollisch, Anna Torlen, Julia Townsend, Terry Widner and Betty Wilson. The Center for Creative Educa-tion — 425 24th St., West Palm Beach. 805-9927, Ext. 160; www.cceflorida.org.Q “Wild Florida” — A group exhibition featuring native, wild Florida pho-tography. Through Dec. 17. The Cultural Council of Palm Beach County — 601 Lake Ave., Lake Worth. Hours: 10 a.m.-5 p.m. Tues-day-Saturday. Info: 471-2901; www.palm-beachculture.com.Q Evenings at the Council: Open Mic Night — Nov. 18. The Flagler Museum — One Whitehall Way, Palm Beach. Hours: 10 a.m.-5 p.m. Tuesday-Saturday, noon-5 p.m. Sunday. Tickets: free for members; $18 adults, $10 youth (13-17) with adult; $3 child (6-12) with adult; younger than 6 free. 655-2833; www.flaglermuseum.us. Q “Edward S. Curtis: One Hundred Masterworks” — Through Dec. 31.The Florida Trail Association Loxahatchee Chapter — Leads nature walks. New adventurers are wel-comed. Get info and register at www.loxfltrail.org.Q Okeeheelee Park Walk — 7:30 a.m. Nov. 19, Okeeheelee Park, 7715 For-est Hill Blvd, West Palm Beach. A 4-mile leisure paced walk. Call Paul at 963-9906. Q The 25th Annual Big “O” Hike — Nov. 20-25. Walk the dike around the lake for a day or two or all six days. A reg-istration form is available on the web site at www.loxfltrail.org. Call Roy at 422-2189.Q Trail Maintenance in Dupuis — Nov. 25-27. Work off those Thanksgiving calories by helping out. Mow, clip, and blaze the loop trails and ocean to lake hiking trail. Meet at Gate 1 at 8 a.m. Call Bea at 644-0777 or Fred at 585-6386. Harbourside Place — 200 U.S. 1, Jupiter. Info: 935-9533; www.harbour-sideplace.com. ONGOING: Q Live Music on the Waterfront — 6-10 p.m. in the amphitheater. Q Nash Carey Band — Nov. 18 Q Live Music on the Waterfront — Noon-4 p.m. Sundays in the amphitheater. Q Davis & Dow — Nov. 20. Q Tai Chi Class — 9 a.m. Saturdays. Cost: $10.Q AMPed Yoga — 10 a.m. Sundays. An all-levels vinyasa yoga class led by Jennifer Martin. $10. Alison Berkery offers at kids yoga class for $5.Q Annual Tree Lighting Ceremony — 6 p.m. Nov. 19. Q Jupiter Green & Artisan Market — 10 a.m.-2 p.m. Sundays, yearround.

PAGE 32

B8 WEEK OF NOVEMBER 17-23, 2016 FLORIDA WEEKLY SYMPHONICBANDOFTHEPALMBEACHES 'Tis the Season ... for Music! Join us for Holiday Fun in the SunŽ Night in the Tropics e Night Before Christmas * Miami March Israel Shalom e Skater Waltz And More! Saturday, Dec. 3, 7:30 p.m., Eissey Campus eatre Saturday, Dec. 10, 7:30 p.m., Duncan eatreTickets: $18 561-832-3115 www.SymphonicBand.org CALENDARQ Jupiter Green & Artisan Market Mid-Week — 3-7 p.m. Wednesdays, year-round. The Historical Society of Palm Beach County — Johnson History Museum, 300 N. Dixie Highway, West Palm Beach. Free admission. Info: 832-4164; www.historicalsocietypbc.org.Q “For the Love of the Game: Baseball in the Palm Beaches” — Highlights of Americas favorite pastime in Palm Beach County. Archival photographs and historical artifacts„some of them donations or loans from our community „ tell the story. Jonathan Dickinson State Park — 16450 SE Federal Highway, Hobe Sound. Park entry is a suggested dona-tion of $5. Info: 745-5551 or email friend-sjdsp@gmail.com.Q Canoe or kayak river tours — Every Friday and the last Saturday of the month, from 9:45 a.m. to noon. Rent a canoe or kayak at the parks River Store or bring your own for this leisure-ly guided paddle on the Loxahatchee River. The tour is free with park admis-sion. Registration in advance is required at 745-5551. The Lighthouse ArtCenter — Gallery Square North, 373 Tequesta Drive, Tequesta. Hours: 10 a.m.-4 p.m. Monday-Friday and 10 a.m.-2 p.m. Sat-urday. Admission is $5 Monday-Friday, free on Saturday and for members and exhibiting artists. Info: 746-3101; www.LighthouseArts.org. Q 3rd Thursday — 5:30-7:30 p.m. the third Thursday of the month. Wine and passed hors doeuvres reception and exhibits, concerts, lectures, art demonstra-tions, live performances and gallery talks. The Mandel Public Library of West Palm Beach — 411 Clematis St., West Palm Beach. Info: 868-7701; www.mycitylibrary.com. Q Get Published with the NaNoWriMo Writing Series — 6-8 p.m. Thursdays until Dec. 8 and 6-8 p.m. Nov. 22. To promote National Novel Writing Month, participants will begin working towards the goal of writing a 50,000-word novel by 11:59 p.m. on Nov. 30. Local author Daphne Nikolopoulos (DJ Niko) will mediate the sessions. A series Come Write In National Novel Writing MonthŽ meets from 1:30-4:30 p.m. Nov. 21-23, 26, 28 and 29, for writers to bring in their favorite writing tools and work on their novel surrounded by other local writers. Q Pilates: 10:30-11:30 a.m. Thursdays. Bring your own mat. By donation.The Norton Museum of Art — 1451 S. Olive Ave., West Palm Beach. Free admission. Info: 832-5196; www.norton.org.Q “Question Bridge: Black Males” — Through Dec. 18. Q Art After Dark — 5-9 p.m. Thursdays.The North Palm Beach Library — 303 Anchorage Drive, North Palm Beach. 841-3383; www.npblibrary.org.Q John Blosser presentation — 11 a.m. Dec. 3. Blossmer, a musician and teacher, discusses the history of the mountain dulcimer and accompanies his presentation with popular and origi-nal musical compositions played on a variety of dulcimers.The Palm Beach Photographic Centre — 415 Clematis St., West Palm Beach. Info: 253-2600; workshop.org. Q “Dead Images: Photographs of the Grateful Dead” — Nov. 19-Jan. 4. From the archives of Robbi Cohn, who first started photographing musi-cians in 1984, and photographed nearly 400 different concerts. She became the first photographer officially licensed by the Dead. An Opening Reception takes place from 5:30-7:30 p.m. Nov. 18. The Palm Beach Zoo & Conser-vation Society — 1301 Summit Blvd., West Palm Beach. Hours: 9 a.m. to 5 p.m. every day, except Thanksgiving and Christmas. Tickets: $18.95 adults; $16.95 seniors, $12.95 age 3-12, free for younger than 3. Info: 533-0887; palmbeachzoo.org.Perfect Vodka Amphitheatre — 601-7 Sansburys Way, West Palm Beach. Info: www.westpalmbeachamphitheatre.com/events/. Tickets: 800-345-7000 or ticketmaster.com. The River Center — 805 N. U.S. 1, Jupiter. Hours: 9 a.m.-4 p.m. Tuesday-Saturday. The Loxahatchee River Dis-trict was created more than 30 years ago to monitor and protect the river. Today its a teaching facility and recreation area that offers programs to enrich the community and the river. Call 743-7123; www.loxahatcheeriver.org.Q Safe boating course — 8:30 a.m.-4:30 p.m. Nov. 19, Jan. 14, Feb. 11, and March 4. Taught by the U.S. Coast Guard Auxiliary Flotilla 52. Free but a $10 refundable deposit is required to reserve your seat.

PAGE 33

FLORIDA WEEKLY WEEK OF NOVEMBER 17-23, 2016 B9 THANKSGIVING AT TABOO ENJOY A DELICIOUS THREE COURSE THANKSGIVING DINNER WITHOUT THE STRESS.$39.00 go to TabooRestaurant.com for menuOPEN 7 DAYS LUNCH & DINNER 11:30 AM 10:00 PM SUNDAY BRUNCH 11:30 AM TO 3:00 PM221 WORTH AVENUE, PALM BEACH, FL 33480 561.835.3500 2000 PGA Blvd., Suite A3140, Palm Beach GardensSW corner of PGA Blvd & US Hwy 1 { City Centre Plaza rr{www.saraskitchenpalmbeachgardens.com Mon-Fri: 7 ƒ -2:45 { Sat-Sun: 7 ƒ -1:45 SERVING BREAKFAST & LUNCH tEKt,s''s>E[^^d CAGE FREE LARGE EGGSE},}Œu}v}ŒvŸ]}Ÿ{9sPšŒ]v& nr" rnnn HOLIDAY BOUTIQUE nn For more information please contact Lissa at LissaS@JCConline.com Sip and Shop November 17 5-8pm Shop November 18 8:30am-4pm Mandel JCC 5221 Hood Road Palm Beach Gardens CALENDARQ Public Tour and Fish Feeding — 2-3 p.m. Saturdays. A staff member leads a tour of the facility, including a touch tank presentation and feeding. The Society of the Four Arts — 2 Four Arts Plaza, Palm Beach. Call 655-7227; www.fourarts.org.Q “Illustrating Words: The Wondrous Fantasy World of Robert L. Forbes and Ronald Searle” — In the Mary Alice Fortin Childrens Art Gallery.Q Campus on the Lake Lectures — 805-8562 or visit www.fourarts.org Q “Dine with Thomas Jefferson and Fascinating Guests” with James Gabler — Nov. 28. $10; free for Four Arts members. Book signing and light refreshments to follow. Reser-vations and tickets required. The Soci-ety of the Four Arts, Palm Beach.Q “The Nazi Titanic: The Incredible Untold Story of a Doomed Ship in World War II,” with Rob-ert P. Watson — Nov. 30. Book signing follows. Reservations required. The Society of the Four Arts, Palm Beach. Taste History Culinary Tour — Learn about the flavors, culture and history of local cities on a four-hour guided tasting tour. This family friendly walking and bus tour boards at Macys (East Entrance) at Boynton Beach Mall. Reservations required. Tickets: $45-$65. Free for younger than 14. Benefits the non-profit Museum of Lifestyle & Fash-ion History. Info: 243-2662; www.taste-historyculinarytours.org.Q Delray Beach/Boynton Beach — Nov. 19 Q A Thanksgiving Weekend art and culinary tour of Lake Worth and Lantana — Nov. 26. AREA MARKETS West Palm Beach Antique & Flea Market — 8:30 a.m.-2:30 p.m. Saturdays through May on Narcissus Avenue north of Banyan Boulevard. Free. Info: www.wpbantiqueandfleamar-ket.com.The West Palm Beach Green-market — 9 a.m.-1 p.m. Saturdays along the West Palm Beach Waterfront, 100 N. Flagler Drive, downtown West Palm Beach. Parking is free in the Ban-yan and Evernia garages during market hours. Info: www.wpb.org/greenmarket.The Green Market at Wellington — 9 a.m. Saturdays through April 29 at 12100 Forest Hill Blvd., Wellington, next to the amphitheater. Pet friendly. Info: www.greenmarketatwellington.com Jupiter Farmers Market at El Sol — 9 a.m.-1 p.m. Sundays through April 30, 106 Military Trail, Jupiter. Info: 283-5856; www.Jupiterfarmersmarket.com.Jupiter Green & Artisan Market at Harbourside Place — 3-7 p.m. Wednesdays at Harbourside Place, 200 U.S. 1, Jupiter. New vendors welcomed. Info: 623-5600 or www.harrysmarkets.com.Riviera Beach Marina Village Green & Artisan Market — 10 a.m.-2 p.m. Saturdays year-round, 200 E. 13th St. at Broadway, Riviera Beach. Info: 623-5600 or www.harrysmarkets.com. Lake Worth Farmers Market — 9 a.m.-1 p.m. Saturdays, through April 29, Old Bridge Park, 1 S. Ocean Blvd., Lake Worth. Info: 283-5856; www.lakeworth-farmersmarket.comLake Worth High School Flea Market — 5 a.m.-3 p.m. Saturdays and Sundays, under the Interstate 95 over-pass on Lake Worth Road. Info: 439-1539.The Gardens GreenMarket — 8 a.m.1 p.m. Sundays, City Hall Municipal Complex, 10500 N. Military Trail, Palm Beach Gardens. Live entertainment from 9 a.m.-1 p.m. No pets. Through May 7. 630-1100; www.pbgfl.com. Royal Palm Beach Green Mar-ket & Bazaar Veterans Park — 9 a.m.-1 p.m. Sundays, Veterans Park, 1036 Royal Palm Beach Blvd. Royal Palm Beach. Through April 30. Pet friendly. www.rpbgreenmarket.comJupiter Green & Artisan Market at Harbourside Place — 10 a.m.-2 p.m. Sundays year-round, 200 N. U.S. 1, along the Intracoastal Waterway in Harbourside Place. Pet friendly. New vendors should call 623-5600 or visit www.harrysmarket.com. The Green Market at Palm Beach Outlets — 11 a.m.-4 p.m. Sundays, 1751 Palm Beach Lakes Blvd., West Palm Beach. Arts and crafts, fresh flow-ers, homemade foods, organic produce. Info: 515-4400; www.palmbeachoutlets.com. Q

PAGE 34

B10 ARTS & ENTERTAINMENT WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLY Food r Fashion r Music Drinks r deals r Fun! DowntownattheGardens.com Sip & Stroll n n r rrrr rrr a r SOC I Jupiter Medical Center FoundationÂ’ s 1 2 3 7 8 9 10

PAGE 35

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 ARTS & ENTERTAINMENT B11 with STYLE! r FREE r rnr DowntownAtTheGardens.com Over 2400 FREE Parking Spaces and Our Valet is Always FREE! n Do wn to wn a t th e Ga rd en s r rnrnrrrnnrrn nrrn nn rn nnn nn Downtown at the Gardens. All tastes for all p eo p le The Blend Bistro The Cheesecake Factory Dirty Martini Fro-Yotopia Grimaldis Coal Brick-Oven Pizzeria ItSugar MJs BistroBar Paris in Town Le Bistro Sloans Ice Cream The Spice & Tea Exchange Texas de Brazil TooJays Yard House Whole Foods Market COURTESY PHOTOS I ETY s Highballs & Hibiscus, PGA National 1. Adam Lee, Brooke McKernan, Richard Rendina and John Couris 2. Chelsea Lasater, Ben Lasater, Shannon Perez and Justin Perez 3. Jay Cashmere, Kelly Cashmere, Rena Toppe Ueltschi, Gina Sabean and Jeff Sabean 4. Genie Smith, Wendy Montesdeosca, Lori Roth, Whitney Perkins and Tanja Ajay 5. Patti Walczak and Paul Walczak 6. John Byrn, Ashley Fogg-Schutz, Jenn Byrn, Jessica Wojtanowski and Dave Wojtanowski 7. Chelsea Reed, Mariana Lehyki and Dina Turner 8. Richard Gaff, Danni Melita, Lauren Walker and Colin Walker 9. Sal Tiano, Kim Tiano, Sara Nestro and Rich Nestro 10. Jennifer Rhine, Beth Mourelatos, Michele Jacobs, Tiffany Freisberg, Erin Devlin, Denise Brestle, Celine Pelofi and Megan Hickey 11. Taylor Aguirre, Anthony Aguirre, Kelli Schaming, Jamie Fago, Joey Fago, Jessica Alden, and Andrew Keller 12. Stephanie Walczak, Elizabeth Fago, Liv Vesely and Jessica Mastroianni 4 5 6 11 12

PAGE 36

B12 WEEK OF NOVEMBER 17-23, 2016 FLORIDA WEEKLY #JMMZ+PFM &BHMFT &MUPO+PIO .BEPOOB UIFQBMNDPN %PXOMPBEUIF UIFQBMNBQQ561-627-9966 FOUR ARTS. FOR EVERYONE. LAMOUR DE LOINLIVE ON SCREEN AT THE SOCIETY OF THE FOUR ARTS Saturday, December 10, 2016 at 1 p.m.TICKETS $27 OR $15 FOR STUDENTS Finnish composer Kaija Saariahos breakthrough opera was described by the New York Times as transfixingƒa lushly beautiful score.Ž The groundbreaking new production is unlike anything on stage at the Met, and it is the dramatic story of a knight on a quest with his beloved on the other side of the sea. www.fourarts.org | 2 FOUR ARTS PLAZA | PALM BEACH, FL | 561-655-7226 Photo by Kristian Schuller revealing itself in the thick fog. Sea FogŽ is in Korean with English subtitles. The 111-minute film was directed by Sung-Bo Shim and released in 2014. The film will be show in the Third Floor Auditorium at the Mandel Library, 411 Clematis St., in downtown West Palm Beach. For more informa-tion, call 868-7701 or visit www.wpb.org/mycitylibrary.World Series For the Love of the Game: Baseball in the Palm Beaches,Ž an exhibition at the Richard and Pat Johnson Palm Beach County History Museum, opened on Sept. 6, with a look at local baseball over the last 120 years. After the Cubs history-making win, explore the history and backstories of the game of baseball through its base-ball heroes, including some who grew up running the bases in the Florida heat. Whats most fascinating is the role Henry Flagler played in the growth of baseball as Americas favorite pastime. The museum is on the third floor of the renovated historic 1916 Courthouse. Mark your calendar for two upcoming baseball lectures: Kevin M. McCarthy speaks about Baseball in Florida, one of his many books, on Jan. 11. Tommy Hutton, the former major league player, speaks on Feb. 8. The exhibit will be open until July 1. Info: 832-4164; www.hspbc.org.Rock showThe 50th Annual Gem, Mineral, Bead, Jewelry & Fossil Show returns to the Expo Center at the South Florida Fairgrounds, 9067 Southern Blvd., West Palm Beach, on Nov. 19 and 20. Hosted by the Gem and Mineral Society of the Palm Beaches, this show features 80 dealers from all over the country offering a wide range of merchan-dise: Fine jewelry, Southwestern jewelry, loose beads, rocks and minerals for speci-men collecting and cutting, loose precious and semiprecious gemstones, settings and findings, fossils, meteorites, tools, and books, plus educational activities, dem-onstrations, speakers and exhibits. Admis-sion is $9 for adults, or get a two-day pass for $12. Children younger than age 12 are admitted free. Get a coupon for $2 off admission at www.gemandmineralsociety.org. Hours: 9 a.m.-6 p.m. Nov. 19 and 10 a.m.-5 p.m. Nov. 20. Info: 588-5458.Prodigy performs Chelsea Chen, artist-in-residence at Coral Ridge Pres-byterian Church in Fort Lauderdale, is the first young art-ist to play the organ at the Kravis Center as part of the Young Artist Series. Shell play the new Mar-shall & Ogletree Opus 11 digital organ, named The George W. Mergens Memorial Organ, in March, thanks to a gift from Alex W. Dreyfoos. The 32-year-old artist earned a bachelors and a masters degree from The Juil-liard School, and an Artist Diploma from Yale University. The Los Angeles Times praised Chens performances for her rare musicalityŽ and lovely lyrical gran-deur.Ž Ms. Chen has also been featured on Pipedreams,Ž a popular radio pro-gram that focuses on organs and organists. Tickets are $30 at 832-7469 or www. kravis.org. Q HAPPENINGSFrom page 1CHEN NOV 29 … DEC 18 This heart-warming dance sensation follows an unrefined charmer who learns he is heir to the Earl of Hareford. But, hell only earn his inheritance if he gives up his true love. Will love or money win? Family Show Time FRI, DEC 16 School Spirit Night FRI, DEC 2 Deaf Night Out TUE, DEC 13 FUN FOR THE ENTIRE FAMILY! (561) 575-2223 www.jupitertheatre.org1001 EAST INDIANTOWN ROAD, JUPITER, FL 33477MALTZ JUPITER THEATRE PRESENTS FOR TICKETS: SPONSORED BY: KATHY AND JOE SAVARESEPATTY AND BOB HENDRICKSONAND

PAGE 37

FLORIDA WEEKLY WEEK OF NOVEMBER 17-23, 2016 B13 Flagler Museum !r! +3'#41 & /,2 %& #!#* #/ 0)+.(*)'%&(*!)&%"%*!# #(% % ,"#"&% ,3#* #/n1 & /,2 %& -/') %%+#!(")*$)(" !*"% )*","*")%'" #&#"/*+( #!#* #/n ##nnnr&(,")"*---# #(+)+$+)&(( r ,")"* ---# #(+)+$+)&(##nnnr F L A GLE R M USE U M h e nr y m o rri s on pa l m b e a ch fl o ri d a r rn +#&'1#&)) 6 )*#!& r 2%)&#+*$+)*)3n rrr rn & #))5 & '1',+$#12/#0#51/ ,/"'+/ 6 3'+1 % #-&,1, % /-&0,$1&# ,/1&*#/'!++"'+ 6 "4/" 2/1'0,/+'+rr 2/1'0$'/01 # +!,2+1#/#"'+1!1 1'3#*#/'!+ 2)12/#,+1/' 1,,+1+'+ 0-/('+ % *,+2*#+1).2#011, 0$# % 2/"+"-/#0#/3#1 & #0!/#" ) # % 6 ,$1&#,/1&*#/'!++"'+ $,/$212/# % #+#/1',+0 Mandy Patinkin, “Dress Casual” >> When: 8 p.m. Nov. 27 >> Where: The Kravis Center, 701 Okeechobee Blvd., West Palm Beach. >> Cost: $25-$135. >> Info: 832-7469 or www.kravis.org. with darkness,Ž he said. Shakespeare did as well. And I think what we all have in common is were trying to turn the dark-ness into light. Another favorite lyricist of mine is Yip Harburg, who wrote the words to Somewhere Over the Rainbow. I look for songs that teach me how to have fun, how to be silly, how to be serious, how to be thoughtful, how to talk to my kids, my fellow citizens and so on. Songs that help me get through the moment „ such as this last election.Ž Mr. Patinkin, a staunch Democrat, said that while he was disappointed with the election results, he has decided to let it energize rather than deflate him. This election and our defeat has empowered me and inspired me to raise my voice with greater courage when-ever possible,Ž he said. And to respect my fellow Americans „ many of them my neighbors and friends „ who voted differ-ently from me and wanted a different kind of attention paid. I think it was a wakeup call to all of us to see how polarized some of us are, but we are all Americans „ neighbors and brothers and sisters. And I just beg of all of us as individuals, as families, as communities, to listen to each other and hear each others differences and to move on with the great spirit of a country that leads „ not only ourselves, but the world at large.Ž Mr. Patinkins rsum boasts some of the most remarkable Broadway, film and TV shows in recent memory. The Emmy and Tony award-winning actor is probably best known for his Broadway roles as Che in EvitaŽ and Georges Seurat in Sunday in the Park with George,Ž while his tele-vision credits include Chicago Hope,Ž Criminal MindsŽ and Homeland.Ž And he had the immortal line from the film The Princess BrideŽ in which he says, Hello. My name is Inigo Montoya. You killed my father. Prepare to die.Ž I never dreamed that movie would become what it became,Ž he laughed. There has been generation after genera-tion of kids and parents and grandparents that come up to me, wanting to hear me say those words. I never would have dreamt that in my whole life Id be part of my generations The Wizard of Oz. And now again with Homeland, which critics and audience have responded to so well. Im so thankful for these extraordinary experiences and the gifted artists with whom I have worked.Ž The songs Mr. Patinkin will perform in his solo show at the Kravis Center became classics because they contain simple ideas that resonate with all of us. They contain ideas we all want and need to hear over and over again,Ž he said. Thats why I can sing them for thirty years and not get tired of them. And its never the same material. I never know what Im going to do. I have about 13 hours worth of material and I sometimes choose what Im going to sing, as I go along. I base it on what happens during the show, whats going on in the world or what pops into my head. I liken my show to a sushi restaurant I used to go to, where I would order a dish called Trust Me. The chef would always serve something differ-ent, but great.Ž For Mr. Patinkin, theres nothing like the frisson of a live show. I certainly love that,Ž he said. You cant replace being with an audience, live. Theres nothing that beats it. They inform me. We work together and they are part of the experience.Ž Mr. Patinkin related the experience of connecting with an audience to his title role in the Sondheim musical Sunday in the Park with George.Ž That show really formed and shaped a profound part of my life,Ž he said. The simple words that lyricist James Lapine repeated throughout the show, which are, Connect, George, connect. That word, connect, is a word I want on my tomb-stone: He tried to connect. Thats what I try to do in my work in front of a camera, behind a microphone, on stage.Ž Q PATINKINFrom page 1 Boutique Clearance Sale and Fabulous Vintage Finds Jewelry and Purses Friday, November 18th 9:30 a.m. … 1:30 p.m. and Sunday, November 20th 11:30 a.m. … 2:00 p.m. Royal Poinciana Chapel 60 Cocoanut Row, Palm Beach | 561-655-4212 ROYAL POINCIANA CHAPEL 28th Christmas Boutique COURTESY PHOTOMandy Patinkin says he loves the frisson of a live show. PUZZLE ANSWERS

PAGE 38

B14 ARTS & ENTERTAINMENT WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLYAvenue shops „ now called The Espla-nade „ by Shamin Abas Public Relations. It was designed to bring a new audience into 150 Worth and reignite the interest of those who knew of it but didnt come to shop there often any-more,Ž Ms. Abas said. A new mix of tenants to showcase and a few new res-taurants in the area sparked the idea of food with fashion. Chefs who presented came from the plaza and immediate area, primarily from Palm Beach. Echo and the Palm Beach Grill were first-year participants. David began working on it when it was a year or two in. He did such a good job with it, when my focus was turning to New York and the things we were doing there, I told him he was welcome to take it over and continue to grow it. He had such passion for it, and a very clear vision on its potential.Ž Today, chefs and restaurants from around the state, along with Food Net-work stars, will be involved in either chef collaborative dinners, or at the grand tasting, where the original dine-around is recreated on a much larger scale. We started (in 2006) with 28 restaurants, I think, and for this year, 56 are already confirmed,Ž Mr. Sabin said in an interview weeks prior to the festival. It was a three-hour affair at the start, and now is 16 or 17 events over four days with at least 10 properties involved. The organizer has had his own whirlwind year planning the anniversary event „ along with his own wedding this sum-mer to chef Lindsay Autry, and helping her open The Regional restaurant in City-Place in September. Its been life in the fast lane this year, for sure. But its all good blessings.Ž Hes looking forward to new chefs and events at this years festival meant to attract different age groups. Special for me this year is the opportunity to grow the events. Seeing new faces, like the Okeechobee Steakhouse, and see-ing the old favorites „ Echo, Palm Beach Grill, returning. Were growing both south and north,Ž he said, referring to participat-ing chefs coming from Miami and down from Martin County. Dinners, lunches, and chef parties are planned again, with a couple of chef con-tests thrown in, including the Street Food Battle Royal. Eau Palm Beach will host a breakfast event; the Palm Beach Grill will open one day for a lunch; and a grill competition with top celeb chefs such as Marc Murphy, Ken Oringer, Adam Richman, Anita Lo and oth-ers will be at the Four Seasons Resort. Kids Kitchen a favoriteEvents that stand out for me are the Kids Kitchen,Ž Mr. Sabin said. Seeing the kids put on their chefs hats and shirts „ and learn. And they continue to come back every year: they bring pictures from last year and get them autographed.Ž The teaching chefs include Restaurant ImpossibleŽ star Robert Irvine, a crowd favorite, and Jeremy Ford, who brings his daughter to the class to join in. Its great to see the chefs cook with their own kids,Ž he said. And I think another one „ and Im biased „ but still, lunch at The Regional. Well be open for lunch by then. Lindsay has been such a big part of the event, helping with logistics and planning the culinary. This will be her first opportunity for hosting an event.Ž Newcomers of note bring a varied take on the foods featured at the collaboration dinners, he said, naming several. Brad Kilgore of Alter and Blackbrick in Miami „ hes named one of the top new chefs of 2016 by Food & Wine magazine, and hes nominated for a James Beard Award. Hes phenomenal. Lee Wolin of Boka in Chi-cago „ hes a Rising Star chef. Jonathon Sawyer he has several restaurants „ Tren-tina and the Greenhouse Tavern and some other restaurants in Cleveland „ hes a James Beard chef.Ž Closer to home are chefs from Palm Beach „ Clay Conley of Buccan, Imoto and Grato; Aaron Black of PB Catch; and Julien Gremaud of Avocado Grill; Miamis Richard Hales of Sakaya Kitchen and the upcoming Bird and Bone restaurant, and crowd favorite Michelle Bernstein. Mr. Sabin is expecting chefs to bring more diversity, and fresh foods to the table, especially at the grand tasting. Years ago, you might see some pork belly or steam buns, but not like the international foods today with specialized ingredients and fresh foods, especially.Ž Chefs are better at staging these events off-site, too, he said. They know what its like to prepare 750 bites for taking onsite.Ž Eric Grutka, a three-time winner at the Grand Chef Throwdown at the festi-val, returns to serve his foods from Ians Tropical Grill. Mr. Grutka says he wont be competing in the contest held at The Gardens Mall. They threw me out,Ž he said. I won three times in a row. I guess they wanted to change things out. But well be there Sunday for the grand tasting.Ž Over the years, hes seen the trends at the festival. I remember that year when every chef made beef shortribs. Usually theres a lot more variety. One year, there was a lot of ceviches. Maybe we get hooked on a trend,Ž he said.More fresh; less foamBruce Feingold, chef at Dada in Delray Beach, remembers the shortribs, too. Later, it was foams and bubbles. I think were getting rid of the gastronomy. Sooner or later its overkill. Last year at the mall, I did the brulee water-melon: Sea salt with caramelized sugar, with smoked sheep feta and arugula with pesto. Its a pretty good dish „ Im serving it on the brunch menu. This year, I may do a shrimp dish,Ž he said, musing about a take on a bagel using the shrimp as loxŽ and a schmear of mas-carpone for the cream cheese. Mr. Grutka is going with chicken, with a big twist. This year, Im bringing cracklins. Its an osso buco like bite: a Frenched bone-on chicken thigh. I double-fry it, using egg white and rice flour, then have a soy sauce that we roll it in. We call them crack: cracklins „ because theyre like crack candy they order them over and over.Ž Every year gets better for both chefs and the festivalgoers, though at times, there are growing pains, as Mr. Grutka noted. The chefs and guests approved when judges from the Food Network were brought in for the chef competition, lend-ing it an entertainment flair and drawing Food Network fans. Last year, it was a different environment (at the mall),Ž he said. They out-grew the space on Worth Avenue and I understand the reason for the move. They can accommodate a lot more chefs and people. It was a little bit different for the chef competition. Harder to watch „ at the Worth Avenue place, the chefs were down below in a pit area and you could watch from above. I hope they set up a stage this year „ it was hard to see it.Ž A new format for the Grand Chef competition includes the winner of the Chef vs. Chef contest held by Maxs Harvest in Delray. Chef Clay Carnes won, and will represent the challenger against two chefs who win a social media contest. Winner will have $10,000 donated in their name to the charity they choose. Mr. Sabin explained its a way to work technology-friendly guests into the pro-cess of choosing who competes.Keeping fest smallThe organizer agrees its tough to make changes. We try to improve on it every year, but theres a learning curve with everything.Ž Hes growing the fest sl owly, not really wanting to get so big its no lon-ger the event people remember. He doesnt give hard numbers, but says the fest breaks even, pretty much. It was in the deep red for years, so this is actually good. Its not really a money-making prop-osition. We cant charge what its worth for say, the Kids Kitchen event.Ž Prices range from $75 to $170; many events are already sellouts. As for it growing as big as South Beach Food and Wine Festival, it wont happen, he said, though he admires Lee Schrager, the organizer, as a mentor for success. I dont think Palm Beach lends itself to the SoBe experience.Ž Q FESTFrom page 1 COURTESY PHOTOSChef Daniel Boulud hosted “Daniel & Friends” at Caf Boulud last year. That will return this year on Dec. 11. The Chillin’ N’ Grillin’ event, set for Dec. 10 at the Four Seasons, already is sold out.COURTESY PHOTOThe Palm Beach Food & Wine Festival’s Grand Tasting is set for Dec. 11 at The Gardens Mall.

PAGE 39

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 ARTS & ENTERTAINMENT B15 FRUQHGEHHI‡SDVWUDPL WXUNH\RIIWKHIUDPH EULVNHW‡VPRNHG VK SLWDVZUDSV KRPHPDGHVRXSV EUHDNIDVWRPHOHWV SDQFDNHV‡EOLQW]HV JOXWHQIUHHEUHDGV &(/(%5$7,1*
PAGE 40

B16 WEEK OF NOVEMBER 17-23, 2016 FLORIDA WEEKLY The Flamingo Park Holiday Historic Home Tour returns for its 24th year Sunday, Dec. 4. Flamingo Park is a neighborhood of historic homes, many in the Spanish Mission and Mediterranean Revival styles, built during the 1920s boom era north of Belvedere Road and east of Parker Avenue. Residents decorate their homes and yards with holiday lights for the night of the tour as judging for the annual Neighborhood Holiday Light-ing Contest also will take place that evening. Visitors can tour 12 historic homes and gardens decorated for the holidays, nine of which have not been featured on the tour before. The homes will be open 5-8 p.m. The tour will include a homemade holiday dessert reception featuring homemade holiday cookies by neighborhood residents and musical entertainment. Tastings from some of the areas finest caterers and restaurants, along with complimentary beverages, will be pro-vided for tour guests. Parking is avail-able throughout the historic Flamingo Park neighborhood. Guests are encour-aged to wear comfortable walking shoes „ no high heels as they mar the hard-wood floors in the homes. The tour is presented by the Flamingo Park Neighborhood Association. The tour is suitable for adults only „ no children allowed. Tour tickets are $50 online at www. flamingopark.org prior to the tour and $60 at the door. Ticketing, check-in and tour map distribution will be at 2420 Florida Ave., West Palm Beach. Tickets also on sale prior to the tour at Dontees Restaurant, 620 Belvedere Road; The Armory Art Center, 1700 Parker Ave.; and Belle & Maxwells, 3700 S. Dixie Highway, all in West Palm Beach. Q Flamingo Park neighborhood plans 24th holiday home tourSPECIAL TO FLORIDA WEEKLY_________________________Ballet Palm Beachs NutcrackerŽinspired luncheon will be held at the Kravis Centers Cohen Pavilion at 11:30 a.m. Dec. 9, The event, Ballet Palm Beachs top fundraiser, includes cocktails, a silent auction, fashion vendors and a perfor-mance by artists of Ballet Palm Beach. Luncheon chairwoman is Joy Miltenberger and honorary chairwomen are Erin McGould and Amy Swan. Event sponsors are Ms. Miltenberger and the Natural Medicine Health Clinic. At 5:30 p.m. Nov. 17, Sequin in Palm Beach will hold a shop for a causeŽ champagne evening, donating 20 per-cent of proceeds to Ballet Palm Beach. Seats to the luncheon are $150. Call 630-8235 or contact Gina Buntz at development@balletpalmbeach.org to reserve seats or for inquiries on spon-sorship. Q Ballet Palm Beach plans luncheonSPECIAL TO FLORIDA WEEKLY_________________________ Choose your seat at the Centers of“cial website kravis.org or call 561.832.7469 or 800.572.8471 Group sales: 561.651 .4438 or 561.651.4304 Rising Stars and Legends at the Kravis Center! Young Artists Series Yo CHELSEA CHEN, ORGAN 7:30 pm at 7: No ve mb er 21 at ay, No Monday 3JOLFS1MBZIPVTFt5JDLFUT dence at n-Resid owned Artist-i n lly renow Globally s v is C en ter s n th e Kr av is ch p la ys on ward church Br owa he gital organ, The tree digi arshall & Ogletre Mars gift a gi Memorial Organ, a ns M George W. Mergen Ge Alex W. Dreyfoos. A to the Center from A to t AlexWDreyfoos A totheCenterfromA to t eries sponsored by Seri Art Fund New Ar iett M. Eckstein Ne Har Har rie rie H ESTAMPAS PORTEAS TANGO DESIRES 5 at 8 pm mber 25 day Novemb Frida %SFZGPPT)BMMt5JDLFUTTUBSUBU ance, dan tive … Passionate d uctiv Rich riveting seduc Ri r s amor eal A rg entinas a ic revea ovocative music pr ov e: nd the Stage Beyond erformance a free pre-p er Join us for a n at 6:45 pm. n Pavilion a aras in the Cohen P Steven Car talk by Ste THE HAVANA CUBA ALL-STARS PERFORMING CUBAN NIGHTS pm 26 at 8 p o ve b mb er 2 2 6 d rd ay, N No S Sa t tu rd %SFZGPPT)BMMt5JDLFUTTUBSUBU dship Tour salutes nd s n U.S.! Asere Frien e in First time een countries betwee w relationship b ge, new heritage s upp ort fr om With s MELISSA ETHERIDGES HOLIDAY TRIO Monday, Novembe ber 28 at 8 p m mbe Mond ay Novemb M M %SFZGPPT)BMMt5JDLFUTTUBSUBU rhouse rocker decks Dreyfoos Hall with h oos Hall with ks Dreyfoo rocker decks rhouse ro Powe r favorites from new Christm tmas album Christm ites from new C favori t festive fa t t from ort With suppor tf t With MANDY PATINKIN IN CONCERT DRESS CASUALWITH ADAM BEN-DAVID ON PIANO m 27 at 8 pm vember 27 nday, Nove Sund %SFZGPPT)BMMt5JDLFUTTUBSUBU tar and st Em my y -winni ng g TV s E E t ara nd st EmmywinningTVs E E s way legend in his ad wa ony-winning Broa Ton ormer concert perfor g role: co st electrifying most

PAGE 41

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 ARTS & ENTERTAINMENT B17 ANDY SPILOS / FLORIDA WEEKLY LikeŽ us on Facebook.com /FloridaWeeklyPalm Beach to see more photos. We take more society and networking photos at area event s than we can “ t in the newspaper. So, if you think we missed you or one of your friends, go to www.” oridaweekly.com and view the photo albums from the many events we cover. Send us your society and networking photos. Include the names of everyone in the picture. Email them to society@” oridaweekly.com. SOCIETY Maltz Jupiter Theatre gala kickoff at The Bears Club in Jupiter 1. David Dowrick and Andy White 2. Debra Barron, Todd Barron and Lyn Ianuzzi 3. Linda Epstein and Stephen Epstein 4. Sally Ann Weger, Carey Finney, Susan Johnson and Donna McKay 5. Kelly Garvis, Mary Ellen Healy, Dermot Healy and Jay Johnson 6. Lorraine Rogers-Bolton, Debra Barron and Lyn Ianuzzi 7. Deb McGinnis and Tess Sina 8. Robert Jacobs, Michele Jacobs and Andrew Kato 9. Kim Reckley, Cressman Bronson and Pam Dyar 4 1 6 7 2 9 3 8 5

PAGE 42

B18 ARTS & ENTERTAINMENT WEEK OF NOVEMBER 17-23, 2016 www.FloridaWeekly.com GARDENS/JUPITER FLORIDA WEEKLY $10OFFWITH PURCHASE OF $50 OR MOREWITH THIS COUPON. DINE IN ONLY. LIMIT ONE COUPON PER TABLE. NOT VALID WITH OTHER OFFERS OR PRIOR PURCHASE. OFFER EXPIRES11-30-2016 HAPPY HOUR DAILY 4PM-7PM *INCLUDES DRAFT BEER, HOUSE WINE & WELL LIQUOR1201 US HIGHWAY 1, SUITE 38 NORTH PALM BEACHCRYSTAL TREE PLAZA (NEXT TO TRUE TREASURES)WWW.PAMBEACHPIZZA.NET|561-408-3295 | OPEN EVERY DAY!MON-THU 11:30AM-9:30PM | FRI 11:30AM-10PM | SAT 4PM-10PM | SUN 4PM-9:30PM Live music Thur, Fri, Sat & Sun. Early Bird Special ArtworksWe Know Framing. Youll Know the Di erence.Printing & Framing for Artists, Interior Designers and All.www.artworksint.com Call 561.833.9165 420 6th Street Downtown West Palm Beach, Fl 33401 WE CAN PRINT & FRAME YOUR DIGITAL IMAGES Lets Create Something Amazing Your Images on MetalŽ SOCIETY Art in the Gardens at Downtown at the GardensLikeŽ us on Facebook.com /FloridaWeeklyPalm Beach to see more photos. We take more society and networking photos at area events than we can “ t in the newspaper. So, if you think we missed you or one of your friends, go to www.” oridaweekly.com and view the photo albums from the many events we cover. Send us your society and networking photos. Include the names of everyone in the picture. Email them to society@” oridaweekly.com.ANDY SPILOS / FLORIDA WEEKLY 1. Delia Vergara, Gustavo Castillo and Maria Lagos 2. Heather Ashley Chase and Ladonna Green 3. Ken Hart and Dolores Levey 4. Melody Goff and Mitch Goff 5. Shawna Scarpitti and Barbara Leggett 6. April Davis 7. Teddy Duarte and Lynda Walker 8. Sheryl Buckingham, Tim Donovan and Mary Lu Workman 1 2 5 3 6 8 4 7

PAGE 43

GARDENS/JUPITER FLORIDA WEEKLY www.FloridaWeekly.com WEEK OF NOVEMBER 17-23, 2016 ARTS & ENTERTAINMENT B19The Dish: Pesto-crusted chicken breast salad The Place: Avocado Grill, 125 Datura St., downtown West Palm Beach; 623-0822 or www.avocadogrillwpb.com. The Price: $14 The Details: I always contend that when it comes to food, simpler can be better. After all, who needs the fuss of tons of ingredients when two or three well chosen ones will do? Thats what I love about the pestocrusted chicken salad at Avocado Grill. The basil of the pesto plays off the balsamic vinegar dressing, which adds a grace note of sorts to the spinach. As always, chef/owner Julien Grimaud nicely balances flavors and portions. The chicken breast was tender and had absorbed a bit of the pesto during grilling, and the chicken paillard salad, with its marriage of arugula, artichokes and heirloom tomatoes, also was satisfy-ing. Q „ Sc ott Simmons J ames Strine, executive chef at Grato, is known by his peers as a visionary chef with an in-depth knowledge of the marketplace. The Maryland native has come a long way since he worked as a dishwasher when he was 17. By the end of the first night on the job „ and devouring one of his first chef-made meals „ he had found a career. It was so good,Ž Chef Strine remembered. I loved it and I still remember how good it tasted „ sauerbraten with potato dumplings and braised red cab-bage.Ž After telling the chef how much he enjoyed the meal, the chef asked him if he wanted to learn how to cook. Chef Strine said yes and he launched his culinary career in that very restaurant. In 1996, after working at the Maryland restaurant for two years, Chef Strine moved to Florida, where he advanced through The Breakers Resort Palm Beachs restaurants, learn-ing about diverse culinary styles along the way. After his stint at The Breakers, he returned to Maryland to become the chef/operator of his award-winning, family-run restaurant, Micks New American Bistro. From there, Chef Strine returned to Florida and spent nine years at Caf Boulud in Palm Beach, most recent-ly as executive sous chef. At Boulud, he honed classic French technique, and excelled in creating beautiful, bold dishes with a focus on seasonality. When Clay Conley, chef/owner of the Italian restaurant Grato and a long-time friend, talked to Chef Strine about an opening at Grato, earlier this year, Chef Strine took the job. He became executive chef at Grato in mid-August. We work well together,Ž Chef Strine said of Chef Conley, I love playing around with different pastas and grains,Ž he said. I havent picked out a favorite dish (at Grato) yet,Ž he said. We change the menu often. I recommend custom-ers keep coming back so they can try everything. Whatever mood youre in, we can accommodate it. If you are in the mood for (brick iron) pizza, ours is the best around. If you want handmade pasta, youve got to try ours.Ž Chef Strine and his wife, Brandy, and daughter, Lilly, 8, live in West Palm Beach. Mrs. Strine is no slouch in the kitchen either, he said. In fact, if he had to pick his last supper it would be sloppy Joes, mac n cheese and his wifes carrot cake, which he says is the best around.Ž He doesnt worry about packing on the pounds. I dont overdo with food and Im on my feet all day,Ž he said. In his spare time, Chef Strine supports several local charities including the Share Our Strengths No Kid Hun-gry campaign and Jeremiah Bullfrogs annual P.I.G. (Pork is Good) and Duck, Duck, Goose events. He has competed in and judged Cochon 555, competed in the Palm Beach Food & Wine Fes-tivals 2015 Grand Chef Throwdown and won Maxs Harvest 2015 Chef vs. Chef series competition. James StrineAge: 40 Original hometown: Woodsboro, Md. Restaurant: Grato, 1901 S. Dixie Highway, West Palm Beach; 404-1334; www.gratowpb.com. Mission: To maintain a casual, approachable, neighborhood restau-rant with offerings you dont find in any in any other Italian restaurant. Cuisine: Modern Italian Footwear of choice: Balu from Bragard. The blue ones. I bought the last three pair in the world. Training: American Culinary Federation apprenticeship and chef Zach Bell. Advice: Before diving head first, make sure this is what you want to do. Be a stagier at a reputable restaurant for a while and dont commit to school right off the bat. This is a life choice, not just a job. Q In the kitchen with...JAMES STRINE, Grato, West Palm Beach THE DISH: Highlights from local menus SCOTT SIMMONS/FLORIDA WEEKLY COURTESY PHOTOJames Strine worked at The Breakers and at Cafe Boulud and owned his own restau-rant before coming to Grato. FLORIDA WEEKLY CUISINE jan NORRISjan@jannorris.com Its all turkey talk this week as many restaurants „ most of those in hotels and several stand-alones „ get ready to offer up a Thanksgiving Day special. PGA Nationals Ironwood Steak and Seafood hosts a buffet that has all the traditional fixing s: butt er-basted turkey, smoked ham, stuffing, mashed potatoes, mac n cheese, pumpkin pie and more. This year, theres a special kids buffet, too, with favorites for the nonturkey set, such as chicken fingers. Cost is $78 for adults, and $30 for kids 6-12. Their dinner is served from 1 to 7 p.m. Make reservations by calling 627-4852, or visit opentable.com. Spotos Oyster Bar is offering a special ala carte menu from noon to 7 p.m. A variety of popular seafood items, including dozens of oysters on the half-shell, is joined by traditional turkey and its trimmings. Priority seating is avail-able. Call 776-9448. At Bistro Ten Zero One in the West Palm Beach Marriott Chef Christian Quinones is putting out quite a buffet spread with seatings at noon and 2 p.m. Roast turkey, pineap-ple glazed ham, pork loin with quince chutney, and mahi with braised fennel and orange are some of the items featured. At 5 p.m., a special three-course menu is served. The buffet is 5-9 p.m., and is $55 for adults, and $27 for kids 12 and under. The prix-fixe din-ner price varies. Reservations through opentable.com or by calling 833-1234, Ext. 1908. Chef Rick Mace at Caf Boulud in Palm Beach will serve a gourmet Thanksgiving threecourse prix-fixe dinner from 1 to 9 p.m. Dishes include pumpkin veloute, pheasant and foie gras terrine, wood-roasted turkey breast with country boudin, yams, and cornbread dressing, or bacon-wrapped trout with cornbread dressing and dandelion greens. Apple tarte tatin, pecan trifle, and pumpkin pie are among the des-serts. Cost is $99 per person. Make reservations at cafeboulud.com/palm-beach/reservations/ or call 655-6060. Pelican Caf will host a Thanksgiving dinner from 3 to 9:30 p.m. in its newly renovated space in Lake Park; 842-7272 or www.thepelicancafe.com. Also serving: Testas which recently began its 96th season in Palm Beach; 832-0992 or www.testasrestaurants.com. Speaking of longtime establish-ments, Worth Avenues Ta-boo also will serve on Thanksgiving; 835-3500 or www.taboorestaurant.com.Pop-up wine dinner series starts Dec. 7Back from a summer trip to several wineries, German chef Michael Ober and spouse Melanie Robertson-Ober of Cordon Bleu Catering kick off their South Florida season with a pop-up wine dinner series at Serenity Garden Tea House The initial one, at 7 p.m. Dec. 7, will pair wines from the Rhone to a four-course dinner of brie and baguettes with an onion and herb jam; pike quenelles in creamy crayfish sauce; grilled beefsteak and bone marrow with green beans and gratin potatoes; and a chocolate tart with blueberry espuma. Cost for this dinner is $69 per person; monthly dinners through May are offered at a special membership price. For details, and reservations, call 3392444. Serenity Gardens Tea House is at 316 Vallette Way, West Palm Beach. Q „ Scotts Three for 3 will return.Talking turkey as restaurant menus turn to ThanksgivingBY MARY THURWACHTERmthurwachter@” oridaweekly.com COURTESY PHOTOMelanie Robertson-Ober and her husband, chef Michael Ober, will host a pop-up wine dinner series at Serenity Garden Tea House.QUIONES MACE

PAGE 44

%" "" #&# "! "" #&# '& $ / + ;7 4 8. 4 1 + = r rn = r = r (6-+78 43*4:(/1/3934+(). = r = r r 9784244142+25()8 1(77 = = n n = 846<;441 = 91 *+ !() = r = = nr 846<(0+,6438$/11 ( = = n = n (8+* 42293/8< = = n = 4 1, 4 967 + % (8+ 6$/ + ; 7 = = r = rr(6488( +(18<)42 r n n n nn 4251+8+1< +24*+1+ = n n = = (6-+7848438.+.(25/437./541,4967+ = ) 6 + 7 = r 438/-9497)6+487438.+41,4967+ 55 55 = = 642nr = = n 4251+8+1< +34:(8+ = n n = =

PAGE 45

ADVERTISING SUPPLEMENT TO FLORIDA WEEKLYREACHING PALM BEACH COUNTY’S MOST AFFLUENT READERS Florida Weekly’s monthly guide to Looking, Feeling and Living Better living living healthyNOVEMBER 2016Change your smile, change your life | 2 Is your weight getting in the way? | 3 Keep holidays stress-free for seniors | 7JUST A DECADE AGO, MOST SURGERIES WERE OPEN,Ž or invasive, procedures in which a surgeon made a large incision. In the case of lung cancer, the cut could be several inches long as a surgeon maneuvered between the ribs to remove a tumor. Today, minimally inva-sive techniques have changed the standard of care for virtually all types of surgery. Surgery for lung cancer at Jupiter Medical Center combines the best of everything, including thoracic surgeons, like myself, experienced in the latest minimally invasive techniques, cutting-edge robotic technology and multidisciplinary collabo-Minimally invasiveJupiter Medical Center’s robotic system pioneering cancer surgery through tiny incisionsSEE SURGERY, 5 X K. Adam Lee, M.D. Medical Director, Thoracic Surgery & Lung Center of Excellence at Jupiter Medical Center and Chief of Surgical Oncology During robotic surgery, the surgeon sits at the system console next to the patient, and has a 3D view inside the patient’s body while controlling the robot’s four arms in real time. The system translates hand, wrist and finger actions into precise movements with the da Vinci’s miniaturized instruments.

PAGE 46

2 healthy living NOVEMBER 2016 www.FloridaWeekly.com ADVERTISING SUPPLEMENT TO FLORIDA WEEKLY € BACK & SPINE SURGERY€ TOTAL JOINT SURGERY€ SPORTS MEDICINE€ ORTHOPEDIC REHAB Palm Beach Gardens Medical Center ORTHOPEDIC CAREPalm Beach Gardens Medical Center wants you to enjoy the course, the game, and be the healthiest you can be. Our team of ORTHOPEDIC SPECIALISTS has trained at some of the most prestigious medical schools in the nation. If you take care of your game on the course, we will take care of your orthopedic needs o the course.Call 561-625-5070 to register to attend one of our FREE Bone Density Screenings or for a complimentary physician referral. Setting the Gold Standard in Orthopedic Care 3360 Burns Road € Palm Beach Gardens € pbgmc.com Change your smile, change your life A re you are suffering from miss-ing teeth, damaged teeth, fail-ing dental work or ill-fitting dentures? Does your poor dental health keep you from smiling, social-izing and enjoying the foods you love? Have you undergone dental work that you keep having to redo every few years or are experiencing ongoing dental issues? Stop suffering from the endless cycle of root canals, gum surgery, dental infections, toothless smiles and embar-rassment. Teeth Next Day is a solu-tion designed to give you a brand new smile that looks, feels and functions like your natural teeth in just ONE DAY. Imagine com-ing into our state of the art facility designed for Teeth Next Day proce-dures and leaving the very next day with a brand new smile. Teeth Next Day is a life chang-ing treatment that gives you a perma-nent and natural smile in just ONE DAY. Dr. Jay Ajmo is a certified implant dentist with over 25 years of experience in cosmetic and restorative dentistry. He is one of only 400 dentists worldwide to hold a Diplomate Certification with the American Board of Oral Implan-tologists and is the exclusive South Florida provider of Teeth Next Day. All procedures are performed utilizing the most advanced tools and techniques in modern den-tistry including 3D CT Scans for precision implant placement. Dr. Ajmo is supported by his dedicated team in his state of the art facility, designed for the utmost in patient comfort along with optimum cosmetic and functional results for the restoration of your smile.How it worksThe Teeth Next Day solution is a zirconia implant bridge as the final product attached to five or six den-tal implants. These implants act like the roots of natural teeth and permanently anchor the bridge to the jaw bone. The permanent implant bridge used in the Teeth Next Day solution is made from zirconia, the most durable and longest lasting dental material available. Unlike acrylic options that are offered in most dental implant centers, zirconia will NEVER chip, crack or stain. Teeth Next Day replicates the look, feel and function of natural teeth mak-ing it the strongest and most naturally beautiful implant supported smile treat-ment available in modern dentistry.The latest technologyNot only is the Teeth Next Day solution made from one of the most advanced dental materials available, the procedure utilizes the latest tech-nologies for precision fit and optimum design. Dr. Ajmos team uses 3D CT scans to precisely place your dental implants below the gum line. Each zirconia implant bridge is created using comput-er-aided design and CAD/CAM milling for a precise fit. Every Teeth Next Day implant bridge is hand-stained to pro-vide the most natural-looking color pos-sible. Each of these innovations makes Teeth Next Day the most state-of-the-art option for the replacement of miss-ing teeth, damaged teeth, failing dental work or ill-fitting dentures. Patients who have undergone Teeth Next Day have transformed their appearance and their quality of life. No longer do they hide their toothless smile or struggle to chew a meal. Now, they have regained confidence to smile and eat the foods they love. Are you ready for a comfortable, healthy smile? Change your smile and change your life. Call today to schedule your complimen-tary consultation: 627-8666. Q Jay L. Ajmo D.D.S., P.A. PGA Center for Advanced Dentistry 7100 Fairway Dr. Suite 59 Palm Beach Gardens561-627-8666PGAdentistry.com

PAGE 47

ADVERTISING SUPPLEMENT TO FLORIDA WEEKLY www.FloridaWeekly.com NOVEMBER 2016 healthy living 3 Peace of mind for you and your family! Let our Angels assist with: t Bathing, Dressing, Grooming, Daily Hygeine t Fall Risk & Wandering Prevention t Medication Reminders t Shopping, Errands, Doctor Visits t Meal Preparation t Hourly thru 24 Hour Care: CNAs, HHAs t Respite Care & Post Surgical Care t Alzheimers & Parkinsons Plan of CareFL Lic #3021152799.2% Client Satisfaction 561-328-7611VisitingAngels.com/PalmBeaches (Jupiter) Monday Friday 9am 8pm 6DWDPSP‡Closed Sunday(Boca Raton) Monday Friday 11am 8pm 6DWDPSP‡Closed SundayAbacoa Plaza NW Corner of Donald Ross & Military 5440 Military Trail Suite #1 Jupiter, FL 33458 Boca Raton SE Corner of Palmetto and Dixie Hwy10 E. Palmetto Park Rd., Boca Raton, FL 33432 95% Or ganic, 100% Gluten Free, Ho r m o r n e F r ee, An ti-bio tic Fr ee, GM O Free, MSG Free, N o P reserva tives, N o D yes 6 6 ZZZWERG\ELVWURFRP Is your weight getting in the way? W eight gain is a frequent complaint from patients and is an ongoing lifetime struggle. Obesity is a rising epidemic in our country. In the United States, it is estimat-ed that 93 million Americans are affected by obesity and almost 112,000 annual deaths are attributable to obesity. Indi-viduals affected by obesity are at a higher risk for impaired mobility and experience a negative social stigma commonly asso-ciated with obesity. Being affected by excess weight, obesity or morbid obesity significantly increases the risk of developing many other diseases, such as type 2 diabetes, hypertension, heart disease, stroke, osteoarthritis and much more. Unlike diabetes and hyper-tension, obesity can-not hide from those around you. Weight management is a partner-ship between the patient, their family and the healthcare team. This partnership is one that is developed on an individual basis with each patient. Management of obesity includes diet, exercise, behavior modi-fication and nutritional counseling. In most cases, medications for weight-loss (pharmacotherapy), supervised very-low calorie diets, structured meal plans and injectable vitamins like B12 are pre-scribed. Most people have little or no side effects. Getting a handle on eating behaviors is key to making a significant long-term change. While no one likes to keep food logs that require writing down all food eaten, this exercise has been shown to be important for long-term success. With all the variation in serving sizes, most individuals do not have a good under-standing of how many calories are actu-ally consumed in one day. Therefore, it is recommended that individuals keep a complete food log. This will also help the providers to get a better handle on areas of the diet to focus on at follow-up visits. The current weight-loss model as patients and providers know it, needs to be reversed. With pharmacotherapy as the core and foundation, then diet, exer-cise and behavioral modification as essen-tial adjuncts. Once a desirable weight is achieved, a maintenance program needs to be continued using pharmacotherapy, diet, exercise and behavior modification. The medications suppress appetite, con-trol cravings, improve insulin sensitivity and lower the metabolic set point. One particular method of weight loss using medications is with the use of prescription hCG. This also can be com-bined with lipotropic (fat burning) and B12 injections. Patients can lose up to 20 pounds in 20 days or 40 pounds in 40 days. Many studies have shown that accountability is one of the major factors influencing the ability of individuals to maintain long-term weight loss. Obesity is not a disease thats conquered in a day, month or year. It is a disease that must be fought every day for the rest of ones life. Weekly weigh-ins are a useful tool to hold individuals accountable. Just knowing there will be a weekly weigh-in decreases caloric consumption. Other options for weight loss under the supervision of a health care pro-vider is The Ideal Protein Weight Loss Method. It is a medically designed pro-tocol containing two key components „ weight loss and a healthier lifestyle education to assist you in maintaining your results after dieting. The Ideal Protein Weight Loss Method is learning to live off of the bodys own fat reserves. First the body depletes its simple and complex carbohydrate reserves and then turns simultaneously to its protein and fat reserves for energy. Do you think you have a slow metabolism? Do you have trouble losing weight no matter what you do? Do you feel like your weight is getting in the way of your relationship, job and quality of life? Medically supervised weight loss is easier, faster and safer than standard diets because you are under the care of a physician throughout the course of your treatment. At Youthful Balance Medical Center, we can use medications and diet tools not available in commercial or self-directed diets. Call Youthful Balance Medical Center today and let us come up with a weight-loss plan together! Q Jennifer Nicholson Nurse Practitioner Youthful Balance 10887 N. Military Trail, No. 7, Palm Beach Gardens(561) 537-0537youthfulbalance.net

PAGE 48

4 healthy living NOVEMBER 2016 www.FloridaWeekly.com ADVERTISING SUPPLEMENT TO FLORIDA WEEKLY Avoiding Thanksgiving weight gain PALM BEACH GARDENS MEDICAL CENTER D o you ever wish that every day could be Thanksgiving? All the delicious turkey, creamy mashed potatoes, tasty green bean casserole, and mouth-watering pecan pie. While your mouth may be saying, Yes,Ž your waistline is calling out, Whoa!Ž „ and for good reason. Thanksgiving can be a real challenge if you are watching your weight, but you dont have to sabotage your diet. Palm Beach Gardens Medical Center is here with some tips to help you navigate the buffet table without depriv-ing yourself. Eat before you eat. This may sound counterproductive, but if you eat a whole-some breakfast and lunch you can avoid overeating at Thanksgiving dinner later. That way youll have more control over your appetite because we tend to eat too much when hungry. Go light on the calories. Many Thanksgiving goodies are loaded with extra fat and sugar, including mashed potatoes with all the b utter and sweet potatoes covered in marshmallows. Recipes can be healthier by making a few substitutions, such as fat-free chicken broth to make gravy or plain yogurt in casseroles. One size doesnt fit all. Just because certain dishes are offered doesnt mean you have to sample every one. Avoid the all-you-can-eat mentality and limit yourself to smaller portions if you cannot control the ingredients used in a dish. Dont cover your whole plate. Theres no need to pile your plate high with every food that is offered. Look over the buffet table first and then make your selections. Opt for reasonably-sized portions of holiday favorites that are served only once a year. Save room for dessert by skipping seconds. Eat s-l-o-w-l-y. By savoring and chewing every bite thoroughly and putting your eating utensil down between bites you can enjoy your meal and be satisfied with one plate of food. Leftovers are often better the next day anyway. Pace yourself and eat only until you feel full. Drink plenty of water and try to keep alcohol down to a minimum since calories from alcoholic drinks can add up quickly. Put down your fork and go for some fresh air. Spread out the food and fun by going for a walk after your main meal and then having dessert later. Its a great way to get in some exercise and spend quality time with your family. If you are eating out for your Thanksgiving meal, ask for food that is steamed, grilled or broiled rather than fried or sauted. Request that sauces and dressing be served on the side, and watch out for super-sized portions that tempt you to eat too much. By making small adjustments to your holiday meal, you can enjoy Thanksgiv-ing without the guilt. Learning how to prepare healthy meals can significantly improve your health year-round. Palm Beach Gardens Medical Center is host-ing a free heart-healthy, diabetic-friendly cooking demonstration on Dec.15. To register, please visit www.pbgmc.com/events or call (561) 625-5070. Q

PAGE 49

ADVERTISING SUPPLEMENT TO FLORIDA WEEKLY www.FloridaWeekly.com NOVEMBER 2016 healthy living 5 Learn more at jupitermedscreenings.com 1240 S. Old Dixie Hwy. l Jupiter, FL 33458Lung cancer is the leading cause of cancer death, with approximately 90% of cases related to the use of tobacco. This puts smokers at the highest risk. Fortunately, more than 80% of lung cancers can be beaten if detected early using a CT screening. $99 Could Save Your Life If youre a current or former smoker, or have a family history of lung cancer, low-dose CT lung screening at Jupiter Medical Center could help save your life. Some insurance plans now cover the cost. Our health navigator can help you understand your risk and your coverage. If you do not have coverage for screening, Jupiter Medical Center offers a self-pay price of $99.Please call 561-263-4437 for information and appointment availability.**Doctors order is required to schedule an appointment. Choose a screening center thats accredited and backed by a comprehensive thoracic and lung program. 5 MinutesThe time it takes to smoke a cigarette.15 MinutesThe time it takes to get a CT scan that could save your life. ration across disciplines and fields of study. Our thoracic surgery program uses the latest advances such as elec-tromagnetic navigational bronchoscopy and stereotactic body radiation, as well as robotic-assisted thoracic surgery (RATS) and video-assisted thorascopic surgery (VATS). Traditionally, a thoracotomy surgery was used to biopsy or remove tissue from the lungs. This open chest procedure has a higher risk of infection and complica-tions, as well as a longer recovery time for patients. Through the minimally invasive RATS approach, risk is reduced and blood loss is decreased. RATS requires only small incisions in the chest, rather than one large incision. By looking at a magnified 3D image of the patients lungs and chest, we use the robotic technology to translate hand movements into precise actions. Patients experience less pain, scarring and since the RATS procedure causes less trauma to the body, recovery time also is reduced. Another refinement of standard lung cancer surgery with similar patient ben-efits, VATS allows surgeons to operate through two to four openings between the ribs while viewing the patients internal organs on a video monitor. Each opening is less than two inches in diam-eter, rather than the 6to 10-inch incisions common in open thoracic surgery. The Frank E. & Mary D. Walsh Robotic Surgery Program at Jupiter Medical Center is one of the most comprehen-sive programs in the area and offers the leading technology of the da Vinci Xi’ and Si’ Surgical Systems. The recent introduction of the Xi’ system established Jupiter Medical Cen-ter as one of the first facilities in the world to possess this technology. And more than a decade ago, my thoracic team set the standard of innovations in lung cancer surgery by pioneering the first four-arm robotic thoracic surgery for lung cancer in the nation. If your physician recommends surgery to treat lung cancer or another thoracic condition, you may be a can-didate for minimally invasive da Vinci surgery. The da Vinci Xi’ and Si’ Surgical Systems are sophisticated robotic platforms designed to enable complex surgery using a minimally invasive approach. I have performed more than 1,300 of these minimally invasive robotic sur-geries. We have helped patients realize tremendous benefits including fewer complications, less blood loss, lower risk of infection, shorter hospital stay, less pain, and faster return to normal quality of life. Our investment in the most technologically advanced surgical equipment available, the da Vinci Xi’ and Si’ Surgical Systems, and our years of expe-rience and expertise speaks to our com-mitment to transform patient care and our desire to build a hopeful future for cancer care in South Florida. Q SURGERYFrom page 1

PAGE 50

“ I’ve always been unhappy with my smile, but I was too nervous to have the work done. With the IV sedation, I never felt a thing and the results are amazing.” – Tim Tim Before Tim After The patient and any other person responsible for payment has a right to refuse to pay, cancel payment, or be reimbursed for any other service, examination, or treatment that is performed as a re sult of, and within 72 hours of, responding to the advertisement for the free, di scounted fee, or reduced fee service, examination, or treatment. Comprehensive Examination (D0150) Full-Mouth Digital X-ray (D0330) Teeth Next Day, offered exclusively at PGA Advanced Dentistry, is a leading-edge dental implant solution designed to give you a brand-new smile that looks, feels, and functions like your natural teeth – in just one day. View our videos on our website to see how PGA Advanced Dentistry is improving lives, one smile at a time. PGA dentistry.comAre You Embarrassed to Smile? Are You Suffering from Failing or Missing Teeth? Trust Your Smile to an Expert! Dr. Jay Ajmo, D.D.S., DABOI is one of South Florida’s leading dentists, treating patients with the highest level of care since 1987. He holds internationally recognized credentials in cosmetic and implant dentistry, and is certified in IV sedation. Dr. Ajmo is one of only 400 dentists worldwide to hold a Diplomate Certification with the American Board of Oral Implantology. Now you can receive all your care with total comfort in one state-of-the-art facility.For your Complimentary Consultation or 2nd Opinion, ca ll 561.627.8666.(Includes No-Charge, Full-Mouth X-ray)7100 Fairway Drive, Suite 59 | Palm Beach Gardens, FL 33418 I can eat anything and they feel so QDWXUDO,WVUHDOO\LPSURYHGP\DSSHDUDQFHDQGERRVWHGP\FRQGHQFH7KDQN\RX'U$MPR -Denise Before After

PAGE 51

FLORIDA WEEKLY NOVEMBER 2016 7 WEIGHT LOSS Made Easy! Now Introducing K y b e l l a. 561-612-4824 www.youthfulbalance.net10887 N Military Trail, Suite 7, Palm Beach Gardens BIOIDENTICAL HORMONE Therapy Feel Younger...Live Bettert*NQSPWFT&OFSHZ-FWFMt*NQSPWFT-JCJEPt*NQSPWFT'BU-PTTr.VTDMF5POF.VDI.PSF !Ideal ProteinWeight Loss Method"%PDUPSTVQFSWJTFEXFJHIUMPTTQSPHSBNt4USVDUVSFEXFJHIUMPTTXIJMFTVQQPSUJOHNVTDMF masst8FFLMZPOFPOPOFDPBDIJOHrMJGFTUZMFFEVDBUJPOBOEHVJEBODFt1FSTPOBMJ[FEBQQSPBDIUPTFUUJOHXFJHIUMPTTHPBMTCBTFEPOZPVSIFBMUIQSP MF $500 TUUJNFPOMZ4ZSJOHF.VTUQSFTFOU'-8$PVQPO&YQ3FH Juvederm$10 1FS6OJUGPS/FX1BUJFOUT(with ad) Botox HCG Diet Plan Only $65/Weekt'SFF$POTVMUBUJPOBOE&YBNJOBUJPOt'SFF-JGFUJNF/VUSJUJPOBM(VJEBODFt)$(*OKFDUJPOTBOE%JFU "NJOP"DJETBOE4VQQMFNFOUT"EEJUJPOBM.VTU1SFTFOU'-8$PVQPO-JNJUFEUJNFP FS $BMMGPSEFUBJMT No More Double Chin No Surgery No Downtime! Introductory rate of only$650 per vial! Normally $1,000 per vial )03.03/&4]8&*()5-044]#0509+67&%&3.]#]7*5". */44611-&.&/54]1-"5&-&53*$)1-"4."].*$30/&&%-*/(Keep the holiday season safe and stress-free for seniors T he holidays are a time when families gather together to cel-ebrate the traditions of the sea-son, but when senior loved ones are frail or suffer from chronic illnesses, the holidays can be challenging. Here are some helpful guidelines to ensure the holiday season is fun and festive for the entire family including senior parents, grandparents and older loved ones! Food and drink „ Moderation is best! If older family members can man-age their dietary restrictions and alcohol intake, as well as their medi-cations, everyone will manage to have a good time! Alcohol can be hazardous for seniors, bring on depression and con-fusion, cause inter-actions with pre-scriptions, trigger falls and irregular heartbeat. Dont let seniors overindulge, and know the warning signs of a heart attack and stroke. Remind diabetics to check their blood sugar more often if changing their routine over the holidays, and provide healthyŽ snacks in addition to holiday favorites. Activities „ Schedule the important activities earlier in the day to avoid fatigue, and stick to a routine for both meals and medications as much as possible. Non-stop holiday shopping and celebrating can exhaust the elderly and disorient seniors, especially if they are cognitively or physically impaired. Do not try to force anyone into an activity beyond his or her capacity. Even well orchestrated holiday plans can be ruined by an emotional or medical emergency, so be prepared and leave extra time to handle contingencies. Health and medical issues „ Senior family members traveling to spend the holidays with you should make you aware ahead of time about any health issues or illnesses they may have, or recent medi-cal procedures. Be sure to remind them to pack their prescriptions and medical supplies, and bring a contact list of their doctors along just in case something hap-pens during their holiday visit. Safety „ Physical limitations, including poor eyesight and hearing, can lead to impaired mobility, which creates safety issues. Be sure to remove poten-tial trip and fall hazards, and dangerous decorations in advance of the festivities. Remember those with Parkinsons strug-gle with balance and those with dementia or Alzheimers are in danger of wander-ing.Ž Older adults move at a slower pace „ be patient and do not rush them. Manage meltdowns „ Take depression seriously in seniors, especially around the holidays, when they are feeling emotional and facing physical challenges or the loss of a loved one. Avoid sensitive subjects like selling the house.Ž Dont demand decisions about doctors, or argue with siblings about whats best for Mom, Dad or Grandpa and Grandma. Holiday commotion and conflict can cause seniors stress and agitation, especially later in the day. Should a family member become agitated, escort them to a quiet room for a break from all the chaos. Then take a break yourself, the holidays are stressful for caregivers, too! Give the gift of time „ It is important to pace yourself and help your parents and grandparents to do so as well. The best gift you can give an older loved one is the gift of your time „ be a good lis-tener, share memories and photographs, watch movies together, bake something, sing songs, read the paper or do puzzles together. Thanksgiving is next week and kicks off the holiday season, so be sure ALL your loved ones are focusing on their health and wellness now so they can enjoy themselves during the festivities ahead. Happy Holidays! Q „ Visiting Angels of the Palm Beaches has a refreshing approach to homecare relationships. Let our angelsŽ help you or a loved one recover from illness, accident or surgery, or assist with the care and companionship needed to remain comfortably and safely at home while aging in place or dealing with the daily demands of living with Alzheimers or Parkinsons diseases. Call (561) 328-7611 or visit www. VisitingAngels.com/PalmBeaches. Irv SeldinPresident and OwnerVisiting Angels of the Palm Beaches561-328-7611VisitingAngels.com/ PalmBeaches.

PAGE 52

We heal for them. WE HEAL THE BRAVE. When the bumps and bruises of childhood reach beyond the family “rst aid kit, our award-winning Pediatric Emergency Room stands ready to serve the children of Palm Beach County and beyond. As the largest dedicated Childrens Hospital in Palm Beach County, we provide advanced care for everything from broken bones to pediatric oncology services. When it comes to your childs health, choose the hospital thats created just for them. *South Florida Parenting Magazine 2016 Voted Best Pediatric ER and Best Pediatric Hospital in Palm Beach County!* Join our Kids Club for Kids Activities and Healthy Events. ,*%4t1BMN#FBDI$IJMESFOT)PTQJUBMDPN