Citation

Material Information

Title:
News-herald
Uniform Title:
News-herald (Panama City, Fla. : 1970)
Added title page title:
Panama City News Herald
Place of Publication:
Panama City, FL
Publisher:
Halifax Media Group, Tim Thompson - Publisher, Mike Cazalas - Editor
Publication Date:
Frequency:
Daily
regular
Language:
English

Subjects

Subjects / Keywords:
Newspapers -- Panama City (Fla.) ( lcsh )
Newspapers -- Bay County (Fla.) ( lcsh )
Florida -- Bay County ( fast )
Florida -- Panama City ( fast )
Genre:
Newspapers. ( fast )
newspaper ( sobekcm )
newspaper ( marcgt )
Newspapers ( fast )
Spatial Coverage:
United States -- Florida -- Bay -- Panama City
Coordinates:
30.166847 x -85.665513

Notes

Dates or Sequential Designation:
Vol. 1, no. 1 (May 1, 1970)-

Record Information

Source Institution:
University of Florida
Rights Management:
All applicable rights reserved by the source institution and holding location.
Resource Identifier:
34303828 ( OCLC )
sn 96027210 ( LCCN )
ocm34303828

Related Items

Preceded by:
Panama City news
Preceded by:
Panama City herald (Panama City, Fla. : 1952)

Full Text

PAGE 1

** LOCAL & STATE B1SHEFFIELD PARKLynn Haven park has new grassy area, trees NATION & WORLD A4DEADLY PACKAGE BLASTFear escalates in Texas capital a er fourth bombing SPORTS | C1MARCH MADNESSChipleys Forrest the glue for FSU in Sweet 16 run Business .........................A7 Diversions ......................B6 Local & State ...............B1-5 Obituaries ......................B3 Sports........................C1-4 Viewpoints ....................A6 THURSDAYMostly sunny 66 / 47WEDNESDAYSunny; breezy 67 / 45TODAYSome sun 73 / 49 Panama City News Herald Want to subscribe? Call 850-747-5050 Tuesday, March 20, 2018 PANAMA CITY @The_News_Herald facebook.com/panamacitynewsherald75 ¢ www.newsherald.com By John Henderson522-5108 | @PCNHjohn jhenderson@pcnh.comThe Port Panama City expansion could be the first project funded under the Triumph Gulf Coast program.The port, one of 116 appli-cants vying for the first round of funding, has applied for $10 million from the program to help pay for its East Terminal expansion.At a meeting in Milton on Friday, the Triumph board authorized legal counsel to bring back a term sheetŽ agreement with the port for a vote at the next meeting, which would be a precursor to a formal contract for the award.Through 2033, the eight Panhandle counties are slated to receive $1.2 billion from the program, and these first applicants are competing for the first $300 million that has arrived.The Triumph funds come from a 2010 Deepwater Horizon oil spill settlement designed to help the coun-ties most affected by the spill recover economically.A report by Martinand Associates, maritime econo-mists, determined the first phase of the East Terminal port development would create 111 direct jobs and another 225 induced and indirect jobs. The port jobs on average pay $48,892 annually.Triumph funds headed to portPort Panama City is seen Sept. 29, 2016. [PATTI BLAKE/NEWS HERALD FILE PHOTO] By Jeff MartinThe Associated PressATLANTA „ More than 29 million people face a threat of severe storms Monday that could bring hail the size of tennis balls, damaging winds and strong tornadoes to the southeastern United States, forecasters said.Large parts of Alabama, Georgia and Tennessee and a small portion of northeast Mississippi will be under a tornado threat Monday afternoon and evening, the national Storm Prediction Center said.A strong thunderstorm was dropping hail in northern Mississippi on Monday after-noon, the National Weather Service said.School systems from cen-tral Tennessee as far south as Birmingham, Alabama, said they were dismissing early, hoping students and staff would have time to get home before the storms moved through.The threatened storms come one day before the offi-cial start of spring, and are by far the most impressive setup weve seen so far this year,Ž said Kurt Weber, a meteorologist at the National Weather Service in Hunts-ville, Alabama.We cant rule out a strong tornado east of Inter-state 65 at this point with all the ingredients coming together,Ž Weber added. Hopefully not, but definitely a possibility.ŽBy mid-morning Monday, Damaging storms threaten SoutheastBy Eryn Dion747-5069 | @PCNHErynDion edion@pcnh.comPANAMA CITY „ Decades before the jagged teeth of an excavator tore chunks of brick and concrete from the old Bay High School cafeteria build-ing, Kris Palfrey was doing her first in-service training there.Freshly hired, Palfrey viv-idly remembers being put on the spot and asked to sing the schools alma mater.Remembering the good timesOld Bay High cafeteria demolition brings back memoriesKris Palfrey holds a brick from the Bay High cafeteria. Demolition of the Bay High cafeteria began Monday. [PHOTOS BY PATTI BLAKE/THE NEWS HERALD] A construction worker uses heavy equipment to demolish a brick wall of the Bay High cafeteria. See PORT, A3 See BAY HIGH, A3 See STORMS, A3

PAGE 2

** A2 Tuesday, March 20, 2018 | The News HeraldFrom left, Liam, 6, Aiden, 5, and their father Steven Beyersbergen, of W roxeter, Ontario, Canada, enjoyed a boat ride while visiting their aunt and uncle for Spring Break. [GAIL LENNON/ CONTRIBUTED PHOTO] PICTURE PERFECT We want your photos: Post your photos to the News Herald Facebook page with your name, city of residence and information about the photo. You can email photos to yourpix@pcnh.com. CATCH OF THE DAYWe want to see your catch of the day: Post your photos to the News Herald Facebook page with your name, city of residence and information about the photo. Email photos to yourpix@pcnh.com.READER FEEDBACK TODAY IN HISTORYJudy Pendergrast sent us this photo and said, My grandson Cooper caught this Sheephead with his cousin in the pass this past beautiful Saturday.Ž [CONTRIBUTED PHOTO] GO AND DOHAPPY BIRTHDAY FLORIDA LOTTERY YOUNG ARTIST CELEBRATE COMMUNITY NEWSROOM DIRECTORY Tim Thompson, Publisher .....................................850-747-5001 tthompson@pcnh.com Mike Cazalas, Editor ..............................................850-747-5094 mmcazalas@pcnh.com Shane Spence, Regional Operations Director .....850-747-5078 sspence@pcnh.com Robert Delaney, Regional Controller ....................850-747-5003 rdelaney@pcnh.com Jamie Smith, Human Resources Coordinator .....850-747-5005 jsmith@pcnh.com Michael McCabe, Advertising Sales Manager ....850-747-5082 mmccabe@pcnh.com Kathleen Smith, Advertising Digital Sales Manager ....850-747-5004 krsmith@pcnh.com Roger Underwood, Regional Circulation Director ... 850-747-5049 runderwood@pcnh.com CIRCULATION Missed Delivery: Call The News Herald at 850-747-5050 between 6 a.m. and 10 a.m. Monday Friday and 7 a.m. and 10 a.m. Saturday and Sunday. Make the News Herald a part of your daily life. Home delivery: Subscribe to 7-day delivery and get unlimited access to our website and digital edition of the paper. Customers who use EZ Pay will see, on their monthly credit card or bank statement, the payment has been made to Gatehouse Media. Online delivery: Take The News Herald with you when on the go, or go green by subscribing to an online replica edition of The News Herald and get unlimited access to our website. Go to subscribe.newsherald.com to subscribe to digital only. Print delivery available within the newspaper distribution area only. By submitting your address and/or email, you understand that you may receive promotional offers from GateHouse Media and it related companies. You may opt out of receiving any such offers at any time by calling 850-747-5050. An additional one-time $5.95 activation fee applies. Due to the size and value of premium editions, there will be up to a $5.00 surcharge on each date of publication of any premium edition. However, rather than assess an extra charge for premium editions, we will adjust the length of your subscription, which accelerates the expiration of your subscription, when you received these premium editions. There will be no more than 2 premium editions per month. ADVERTISING To place a display ad, call 850-747-5030 Monday through Friday 8 a.m. to 5 p.m. To place a classi“ ed ad, call 850-747-5020. SINGLE COPIES Daily, 75 cents; Sunday, $1.50. DID WE MISS YOU? If we missed you, we want to correct the oversight. For redelivery: Call The News Herald at 850-747-5050 between 6 a.m. and 10 a.m. Monday through Friday and 7 a.m. and 10 a.m. Saturday and Sunday. COPYRIGHT The entire contents of The News Herald, including its logotype, are fully protected by copyright and registry and cannot be reproduced in any form for any purpose without written permission from The News Herald. Published mornings by The Panama City News Herald (USPS 419-560), 501 W. 11th St., Panama City, FL 32401. Periodicals postage paid at Panama City, FL. Postmaster: Send address changes to The News Herald, P.O. Box 2060, Panama City, FL 32402Setting it straight It is the policy of The News Herald to correct all errors that appear in news stories. If you wish to report an error or clarif y a story, call 747-5070.P.O Box: 1940, Panama City, FL 32402 | Address: 501 W. 11th St. Panama City Fl, 32401 | Phone: 850-747-5000 | WATS: 800-345-8688 | Online: newsherald.com PANAMA CITY While Dominic John Brewer was operating a 2016 Harley-Davidson Street Glide on CR 3280, a buzzard flew into the path of the motorcycle from the south shoulder. Upon the collision, Brewer lost control and was thrown from the Harley after traveling off the roadway. Billy Chambers: While riding my Kawi KLR650 on SR20 (60mph) at night a few years ago, and had a large owl dive straight into my bright headlights. Was wearing a full-face helmet, and hugged my tank before impact. Very scary. Nothing was left of the 40Ž wingspan owl but wing feathers and legs wedged over the front fender. Hosed the bike off later and had no damage. If the owl had hit a foot higher, I may not have survived it.Ž The documents show a Parkland high school resource officer who was also a sheriffs deputy and two school counselors recommended in September 2016 that the school shooter (Cruz) be committed for mental evaluation under Floridas Baker Act. That law allows for involuntary commitment for mental health examination for at least three days. Lisa Shockley: This country needs massive mental health care reform.Ž Trisha Lynn: Well, “ rst we need just plain ole healthcare reform. Then it has to be affordable.Ž J.D. Richards: Three days my butt. They cut them loose within hours sometimes.Ž Mike Elias: Its a matter of when they can do the evaluation. Its not a mandatory 3 day hold, just up to 3 days to do the evaluation.Ž According to Florida Highway Patrol, George Holleran, 61, was driving his Chevy Malibu westbound on Game Farm Road around 12:14 a.m. Saturday morning when he allegedly ran the stop sign at the intersection with N. East Avenue and collided with a PCPD officer. Osiris Ramm: Seriously need a traf“ c light there.Ž Singer Dame Vera Lynn is 101. Producer-director-comedian Carl Reiner is 96. Actor Hal Linden is 87. Former Canadian prime minister Brian Mulroney is 79. Basketball Hall of Fame coach Pat Riley is 73. Country singer-musician Ranger Doug (Riders in the Sky) is 72. Hockey Hall of Famer Bobby Orr is 70. Actor William Hurt is 68. Rock musician Carl Palmer (Emerson, Lake and Palmer) is 68. Movie director Spike Lee is 61. Actress Holly Hunter is 60. Actress-model-designer Kathy Ireland is 55. Actress Jessica Lundy is 52. Actress Paula Garces is 44. Actor Nick Blood (TV: Marvels Agents of S.H.I.E.L.D.Ž) is 36. To submit birthdays, email pcnhnews@pcnh.com with birthdayŽ in the subject line, or drop off a current photo and “ ll out a birthday form at the front desk of The News Herald, 501 W. 11th St. The deadline is noon three business days prior to the birthday. Birthday announcements must include the persons “ rst and last name, city and age. The photo is a mug shot and must be a clear photo.1 THE SOUND OF WIND: 1-3 p.m. at the Native Spirit Museum and Gallery, 1101 Beck Ave., Panama City, as part of Anthropology Week. Join Paul McAuliffe, local ” ute maker, ” ute player and storyteller, for an afternoon of Native American music and storytelling. Details: 890-99052 THE NAPOLEONIC WARS AND HOW THEY CHANGED EUROPE: 2 p.m. at the Bay County Public Library, 898 W. 11th St., Panama City. Rich Filippi will present an overview on Napoleon Bonapartes 15-year rise and fall of power and how it changed Europe and the world. Free; open to the public. Details: NWRLS.com3 TAI CHI „ A BETTER BALANCE: 9 a.m. at the Lynn Haven Senior Center, Lynn Haven. Details: 850-277-27304 THE LIGHT IN HER EYESŽ SCREENING: 5:30 to 8 p.m. at the Bay County Public Library, 898 W. 11th St., Panama City. In partnership with PBS, a screening from award-winning POV documentary series as part of the Beyond the Lens: Book and Film Series. Post “ lm discussion led by Dr. David Fistein and Hiba Rahim. Details: 522-2120 or www.nwrls.com5 JAZZ QUARTET FEATURING ANDREW TINCH: 6:30 p.m. at The Place, 429 Harison Ave., Panama City. Part of monthly series produced by the Gulf Jazz Society. Tickets $10 for GJS members and $12 for the public. Details: 784-2106 or 258-40226 PANAMA CITY WRITERS ASSOCIATION CRITIQUE GROUP: 6:30-8:30 p.m. at St. Andrews Civic Club, 2629 W. 10th St. All genres. Details: www.panamacitywriters.org Today is Tuesday, March 20 the 79th day of 2018. There are 286 days left in the year. Spring arrives at 12:15 p.m. Eastern time.Highlight in history:On March 20, 1854 the Republican Party of the United States was founded by slavery opponents at a schoolhouse in Ripon, Wisconsin.On this date:In 1413 Englands King Henry IV died; he was succeeded by Henry V. In 1760 a 10-hour “ re erupted in Boston, destroying 349 buildings and burning 10 ships, but claiming no lives. In 1815 Napoleon Bonaparte returned to Paris after escaping his exile on Elba, beginning his Hundred DaysŽ rule. In 1852 Harriet Beecher Stowes in” uential novel about slavery, Uncle Toms Cabin,Ž was “ rst published in book form after being serialized. In 1922 the decommissioned USS Jupiter, converted into the “ rst U.S. Navy aircraft carrier, was re-commissioned as the USS Langley. In 1942 U.S. Army Gen. Douglas MacArthur, having evacuated the Philippines at the order of President Franklin D. Roosevelt, told reporters in Terowie, Australia: I came out of Bataan, and I shall return.Ž In 1969 John Lennon married Yoko Ono in Gibraltar. In 1977 voters in Paris chose former French Prime Minister Jacques Chirac to be the French capitals “ rst mayor in more than a century. In 1985 Libby Riddles of Teller, Alaska, became the “ rst woman to win the Iditarod Trail Dog Sled Race. In 1995 in Tokyo, 12 people were killed, more than 5,500 others sickened when packages containing the deadly chemical sarin were leaked on “ ve subway trains by Aum Shinrikyo cult members. These Florida lotteries were drawn Sunday: Fantasy 5: 02-10-11-32-33 Pick 2 Evening: 7-3 Pick 2 Midday: 2-7 Pick 3 Evening: 9-4-2 Pick 3 Midday: 0-0-9 Pick 4 Evening: 9-3-1-1 Pick 4 Midday: 3-3-8-5 Pick 5 Evening: 3-4-9-4-2 Powerball: estimated jackpot $40 million Mega Millions: estimated jackpot $377 million Joselyn Grade 4 Tyndall Elementary School

PAGE 3

** confidence in the possi-bility of tornadoes across northern Alabama had increased.It appears increas-ingly probable the risk for several tornadic super-cells will traverse across northern portions of Ala-bama late this afternoon and through the early evening,Ž the Storm Pre-diction Center said in an update on the situation.An enhanced risk of severe storms covers several large cities across the South, including Nashville and Chatta-nooga in Tennessee; and Birmingham, Huntsville and Tuscaloosa in Ala-bama, forecasters said.In Alabama, any strong tornadoes, golf ball to tennis ball-sized hail and 70-mph winds were most likely in the northern half of Alabama, including all of metro Birmingham. Hail of that size can do serious damage to buildings and cars, Weber said.This is one of those days you want to put the car in the garage if you can,Ž Weber said. The News Herald | Tuesday, March 20, 2018 A3 STORMSContinued from A1Port Director Wayne Stubbs said Monday the Triumph funding would help prevent the port from having to borrow more money for the expansion.This additional help from the Triumph board is very timely, and what it will do for us is allow us to avoid taking on too much debt,Ž Stubbs said. For a port authority our size, if we can avoid having too much debt, then we can continue moving forward and investing in a timely way in improvements.ŽLisa Walters, the chairwoman of the port board, said the project fits in perfectly with the mission outlined in the Triumph legisla-tion, which is to invest in public infrastructure that has a direct eco-nomic benefit to the local economy.ŽShe said the expansion, although it is in Panama City, will have a regional beneficial eco-nomic impact.Rick Harper, a former University of West Florida economics pro-fessor who was hired by Triumph to analyze the applications, told the board on Friday the cost per job of the port project is higher than other state projects. These jobs are highly coveted by states and they do command a higher than average premium for the agencies which are funding them,Ž Harper said.Port infrastructure is expensive, Harper said Monday.In some ways it is a very, very good project because it serves a broad number of poten-tial businesses,Ž he said. It opens up the local economy for additional sorts of businesses, the ones that rely on ocean shipping.ŽAll of the Triumph board members lauded the port application Friday.Ronald Reagan had a great saying when he talked about America being the shining city upon the hill,Ž said Triumph board member Allan Bense. It is a great saying. I can tell you the Port of Panama City is a shining city upon a hill.ŽThe port asked for the $10 million in Triumph funds for the first phase development of the East Terminal. The state has committed $16 million toward the $56 million project. The port has borrowed $12 million for the purchase of the site and committed another $8.7 million from cash reserves.The completion of a new 260,000-squarefoot forest products warehouse, the reinforcement of the bulkhead, the chan-nel deepening and other improvements will require another $15 million, the ports pre-application stated.Bay District Schools has submitted three formal applications to Triumph for workforce programs, including the STEM Workforce Train-ing Center and expansion of its Manufacturing Academy and Haney Industrial Pipefitter program.Harper said Monday the applications are incomplete and need to estimate how many stu-dents would be attending those classes.It helps me get economic contribution of the project,Ž Harper said.Bense said Monday that applicants from many counties are asking for workforce training funds, and a consolidated approach might be in order.I think we need to have an expert in that world come in to look at this from a holistic per-spective,Ž he said. PORTFrom Page A1I didnt know it,Ž she recalled. But I went home and learned it real quick.ŽTwenty years later, clutching a brick and coming to terms with all the memories and emotions suddenly welling to the surface, Palfrey stood by and watched as the building was gutted. A mound of twisted desk chairs,where students once sat for class but now too broken even for donation, stood in the entrance of the gaping maw cut into the buildings wall, ready to be loaded up for disposal.Theres just a lot of memories,Ž Palfrey said. A lot of good memories that happened here, good times in the cafeteria. A lot of memories of people. Remembering the kids that were there. The teachers that are gone. Its sad.ŽPalfrey remembered wrestling matches and the cooks making special fried green tomatoes for the teachers. She remembers the gorgeousŽ terrazzo floors being buffed and waxed before the start of every school year, and watching one class make beautifulŽ prom decora-tions, crafting chandeliers out of the pages of old books.Lavoy Anderson, president of Anderson & Associates, which is acting as contractor for the demolition of the caf-eteria building and the nearby Building 10, said he understands the intense connection many people have to the Bay High campus, as the oldest con-tinuously accredited high school in the state.It was the original school,Ž he said. It came before Rutherford or anywhere else.ŽMuch of the steel from the building will be reused, Anderson said, and the kitchen equipment went to AMIKids Panama City Marine Institute. Anything else usable either went to other local schools or Habitat for Humanity for donation. Theyre even keeping some of the bricks, Anderson said, giving some to local dignitaries and selling some as part of a fundraiser.Originally, the building was scheduled to come down during Spring Break, but Anderson said some delays mean the project wont finish by the time students return next week. Theyll be working all day during vacation, he said, and when school resumes they will switch to an after-school and weekends-only schedule.In the cafeterias place will rise a two-story STEM building, something district officials say is sorely needed if the area is to meet the demands of the current job market. The building started as a half-cent sales tax project, but officials hope Triumph Gulf Coast funding will double the size of the project.In Building 10s place, a new Fine Arts Center will be built, mirroring the new center just finished at Mosley High School.As bittersweet as watching the demolition was, Palfrey said that as a school, they are absolutelyŽ looking forward to the new additions, and the chance to make new memories.Its just part of life,Ž she said. Theres seasons of life and theres seasons to a building. This is its final season.Ž BAY HIGHFrom Page A1A construction worker uses heavy equipment to demolish a brick wall of the Bay High cafeteria. [PHOTOS BY PATTI BLAKE/THE NEWS HERALD] Heavy equipment lifts broken chairs into a dumpster during demolition of the Bay High cafeteria on Monday.

PAGE 4

** A4 Tuesday, March 20, 2018 | The News Herald NATION & WORLD DATELINESHELSINKI MIAMIBEACH,FLA.Nightclubshutdownafter eventwithlivehorsetoreopenAFloridanightclubthatwasshutdownafterascant-ilycladwomanrodebarebackonawhitehorsethrough acrowdwillbeallowedtoreopen.AMiamiBeachcodeofficialruledMondaythecityshouldreinstatetheMokaiLounges b usinesslicenseafterits ownersacknowledgedfive violationsandagreedtopay $12,150infines.Theclub alsowillmakea$10,000 donationtoPeacefulRidge HorseRescueandpromisesnomoreanimalswillbeused intheclub.Thecitysuspendedthe clubslicenseearlierthismonth,adayaftervideowentviralshowingthewoman ridingthehorseinsidetheclub.WILKES-BARRE,PA.Womanpleadsnocontestin poisoningofsonsgirlfriendAwomanaccusedofseriouslysickeninghersons girlfriendbypoisoningher withantifreezehasentered apleaagreementthatavoidstheneedforhertogoontrialforthesecondtime. Eighty-six-year-oldHelenGalliofWyoming,Pennsylva-nia,wasconvictedin2013andsentencedto5to12years. Sheappealedandthenherconvictionwasoverturned.GallipleadednocontestMondayaspartofanagree-mentwithprosecutors,whoarewithdrawingallothercharges.ProsecutorssayGalli spikedaglassofjuicewithantifreezeinMarch2010andpassedittothewoman,whowasleftneardeathandspentmonthsrecovering.MEMPHIS,TENN.FormerNBAplayersex-wife wontfacedeathifconvictedTheex-wifeofformerNBAplayerLorenzenWrightwontfacethedeathpenaltyifconvictedofkillinghim morethansevenyearsago inTennessee,aprosecutorsaidMonday.ShelbyCountyprosecutorPaulHagermantoldajudgeduringahearingthatSherraWrightwontfaceadeath sentenceiffoundguiltyoffirstdegreemurderinherex-husbandsshootingdeath. Sheisbeingheldwithout bondandhaspleadednot guiltyinoneofthemost high-profilemurdercasesinMemphishistory.LorenzenWrights decomposingbodywas foundinaswampyfieldonJuly28,2010„10daysafterhewasreportedmissing.BRUSSELSEUreluctanttoamendIran nuclearpact,seessecurityriskTheEuropeanUnionsfor-eignpolicychiefsaystheEUisreluctanttochangetheland-marknuclearagreementwithIranevenasU.S.President DonaldTrumpthreatenstowalkawayfromthepact.FedericaMogherinisaid MondayafterchairingtalksamongtheforeignministersofEUcountriesthatEuropeans attachstrategicimportance tothefullimplementationoftheagreementbyallparties.ŽMogherinisaid:Itisfor usamatterofsecurity,forEuropeandfortherestoftheworld.ŽTheEUsrepresentative forforeignaffairsandsecuritypolicysaysthepact,if disrupted,wouldcreateanadditionalsecuritythreatandconcernintheregion.ŽJERUSALEMIsraelarrestsFrenchConsulat e driverforgunsmugglingAFrenchemployeeo f FrancesConsulateinJerusalemisunderarrestfo r allegedlysmugglingdozen s ofweaponsfromtheGaz a StriptotheWestBank,Isra-elsdomesticsecurityagenc y saidMonday.TheShinBetsaidth e man,identifiedasRomai n Franck,23,waspartof a broaderPalestiniansmugglingring.Itsaidheuse d hisconsularvehicle,whic h issubjectedtomorelenien t securitychecks,totranspor t theweaponsthroughIsrael s tightlysecuredborderwit h theGazaStrip.Itsaidhetoo k partintheringforfinancia l gainandthathisemploye r wasunawareofhisactions. TheAssociatedPressSeniorCoastGuardmemberKristianRastedt attemptstorescueafawnstrandedontheice SaturdayontheInkooarchipelagoinsouthern Finland.Rastedtpulledthefawnovertheiceback toshorebeforegivingthethumbsupafterthefawn rushedintothewoods.Themotherdeerwasvery happyandgratefultogetherbabyback,ŽSenior CoastGuardof“cerSebastianvonBruunsaid[FINNISH BORDERGUARDSVIATHEASSOCIATEDPRESS]JAKARTA,INDONESIAAmanpusheshismotorbikeatapalmoilplantation inNaganRaya,Acehprovince,Indonesia.Greenpeace saidMondaybrandsincludingPepsiCoandJohnson &Johnsonarerefusingtodisclosewheretheyget theirpalmoilfromdespite vowsto stopbuyingfrom companiesthatcutdowntropicalforeststogrowthe widelyusedcommodity,whichismainlygrownin IndonesiaandMalaysiaandusedinaslewofproducts fromsnackstocosmetics.[DITAALANGKARA/APFILE]FLAGSTAFF,ARIZ.AnUberdriverlesscarheadsoutforatestdrive,Dec. 13inSanFrancisco.PoliceinArizonasayoneofUbers self-drivingvehicleshasstruckandkilledapedestrian. PoliceinthecityofTempesaidMondaythatthe vehiclewasinautonomousmodewithanoperator behindthewheelwhenthewomanwalkingoutsideof acrosswalkwashit.UberhassuspendedallofitsselfdrivingvehicletestinginthePhoenixarea,Pittsburgh, SanFranciscoandToronto.[ERICRISBERG/APFILE]ByPaulJ.Weber andWillWeissertTheAssociatedPressAUSTIN,Texas„The huntfortheserialbomberwhohasbeenleavingdeadlyexplosivesinpackageson Austindoorstepstookan evenmoresinisterturnMondaywheninvestigatorssaidthefourthandlatest b lastwastriggeredalonga streetbyanearlyinvisibletripwire.PoliceandfederalagentssaidthatsuggestsahigherlevelofsophisticationŽthantheyhaveseenbefore,and meansthecarnageisnowrandom,ratherthandirectedatsomeoneinparticular.Thegamewentupalittlebit„well,itwentupalotyesterdaywiththetrip-wire,ŽChristopherCombs, FBIagentinchargeofthe b ureausSanAntoniodivi-sion,saidinaninterview.Twopeoplehavenowbeenkilledandfourwoundedin b ombingsoveraspanoflessthanthreeweeks.ThelatestblasthappenedSundaynightinsouthwestAustinsquietTravisCoun-tryneighborhood,injuring twomenintheir20swho werewalkinginthedark. Theysufferedwhatpolicesaidweresignificantinjuriesandremainedhospitalizedinstablecondition.Thethreeearlierbombingsinvolvedparcelsthatwere leftondoorstepsandblew upwhentheyweremovedoropened.ThetripwiretwistheightenedthefeararoundAustin,atownfamousforitscool,hipsterattitude.Itscreepy,ŽsaidErin Mays,33.Imnotascared person,butthisfeelsvery next-door-neighborkindofstuff.ŽAuthoritiesrepeatedpriorwarningsaboutnottouchingunexpectedpackagesand alsoissuednewonestobewaryofanystrayobjectleftinpublic,especiallyonewithwiresprotruding.Wereveryconcerned thatwithtripwires,achild couldbewalkingdowna sidewalkandhitsome-thing,ŽCombssaid.Authoritiessaidtheyarelookingatarangeofpossiblemotives,includingdomesticterrorismorthatthebombingswerehatecrimes. Localandstatepoliceandhundredsoffederalagents areinvestigating,andtherewardforinformationlead-ingtoanarresthasclimbedto$115,000.Weareclearlydealing withwhatwebelieveto beaserialbomberatthis point,ŽAustinPoliceChief BrianManleysaid,citing similaritiesamongthefour bombs.Hewouldnotelaborate,though,sayinghe didntwanttounderminetheinvestigation.Whilethefirstthree bombingsalloccurredeast ofInterstate35,asectionof townthattendstobemore heavilyminorityandlessaffluent,Sundayswaswestofthehighway.Also,both victimsthistimearewhite,whilethosekilledorwoundedintheearlierattackswereblackorHispanic.Thatmadeithardertodrawconclusionsaboutapossiblepattern,furtherunnervingacityalreadyonedge.ThadHolt,76,saidheisnowwatchinghisstepsashemakeshiswaythroughasec-tionoftownnearthelatest attack.Ithinkeverybodycannowsay,Oh,thatslikemyneighborhood,Žhesaid.FredMilanowski,agentinchargeoftheHoustondivi-sionofthefederalBureauofAlcohol,Tobacco,Firearms andExplosives,saidthe latestbombwasanchoredtoametalyardsignneartheheadofahikingtrail.Itwasathinwireorfilament,kindoflikefishingline,Žhesaid.Itwouldhavebeenverydifficultforsomeonetosee.ŽMilanowskisaidauthoritieshavecheckedover500 leads.Policeaskedanyone withsurveillancecameras attheirhomestocomefor-wardwiththefootageonthechanceitcapturedsuspiciousvehiclesorpeople.SpringbreakendedMondayfortheUniversityofTexasandmanyareaschooldistricts.Universitypolice warnedreturningstudents tobealertandtotelltheirclassmatesaboutthedanger,saying,Wemustlookoutforoneanother.ŽNoneofthefourattackshappenedclosetothecampusneartheheart ofAustin. ThePGAsDellTechnologiesMatchPlaytournamentisscheduledtobeginin AustinonWednesday,and dozensoftheworldstop golfersweretobeginarriving.AndrewZimmerman,a 44-year-oldcoffeeshop worker,saidtheuseofa tripwireaddsanewlevelof suspectedprofessionalismandmakesithardertoguardagainstsuchattacks.Thismakesmesick,Žhesaid. FeargripsAustinasbombingsescalate Suspectedserial bomberusedtripwire, ocialsconrm, suggestingahigher levelofsophisticationAnagenttheBureauofAlcohol,Tobacco,FirearmsandExplosivesworkswithhisdognearthesiteof Sundaysexplosion,MondayinAustin,Texas.[ERICGAY/THEASSOCIATEDPRESS]

PAGE 5

** The News Herald | Tuesday, March 20, 2018 A5Democrats reject immigration deal as budget deadline nearsBy Andrew TaylorThe Associated PressWASHINGTON „ Cap-itol Hill Democrats have rejected a White House bid to extend protections for so-called Dreamer immigrants in exchange for $25 billion in funding for President Donald Trumps long-sought border wall as Washington talks on a $1.3 trillion catchall spending bill hit a critical stage on Monday.Disputes remain over immigration enforcement and a smaller infusion of wall funding, as well as a major rail project that pits Trump against his most powerful Democratic adversary, Senate Minor-ity Leader Chuck Schumer, D-N.Y.Mondays developments were described by congres-sional aides in both parties who spoke on condition of anonymity because the talks remain secretive.All sides pressed toward an agreement by Monday night, though aides said it appeared more likely that the measure would be unveiled Tuesday for a House vote Thursday. House and Senate action is needed by midnight Friday to avert another govern-ment shutdown.The bipartisan measure is loaded with political and policy victories for both parties. Republicans and Trump are winning a long-sought budget increase for the Pentagon, while Dem-ocrats obtain funding for infrastructure, the opioid crisis and a wide swath of domestic programs.The bill would implement last months budget agreement, providing 10 percent increases for the Pentagon and domestic agencies. Coupled with last years tax cuts, it heralds the return of trillion-dollar budget deficits as soon as the budget year starting in October.While most of the fund-ing issues in the enormous measure have been sorted out, fights involving a number of policy ridersŽ „ so named because they catch a ride on a difficult-to-stop spending bill „ continued into the weekend.As is typical, many or most of the policy riders were melting away. For instance, an effort to add a plan to revive federal subsidies to stabilize the individual health insurance market and help the poor cover out-of-pocket costs under President Barack Obamas health law appeared to be fail-ing. A complicated dispute involving abortion was at fault.President Donald Trump told two Republican senators on Saturday that he supports adding proposals to a huge spending bill that would provide billions in fed-eral subsidies to insurers to help curb health care premium increases.Sens. Lamar Alexander of Tennessee and Susan Collins of Maine spoke to Trump for an hour on Sat-urday in a call initiated by the two lawmakers, the sources said.Alexander and Collins are among Republicans backing proposals to revive payments to insurers that Trump halted last fall that reimburse the carriers for reducing out-of-pocket costs for many low-earning customers. Those reductions are required by the Obama health law, and insurers have made up for the lost federal payments by boosting premiums.Stuck againBy Mary Clare Jalonick, Zeke Miller and Chad DayThe Associated PressWASHINGTON „ More Republicans are telling President Donald Trump in ever blunter terms to lay off his esca-lating criticism of special counsel Robert Mueller and the Russia probe. But party leaders are taking no action to pro-tect Mueller, embracing a familiar strategy with the president „ simply waiting out the storm.Trump blistered Muel-ler and his investigation all weekend on Twitter and started in again on Monday, questioning the probes legitimacy with language no recent presi-dent has used for a federal inquiry. A total WITCH HUNT with massive con-flicts of interest!Ž Trump tweeted.Mueller is leading a criminal probe into whether Trumps 2016 presidential campaign had ties to Russia and whether there has been obstruction of justice since then.Trump was told to cut it out on Sunday by such notable Republicans as Trey Gowdy, chairman of the House Oversight Committee, and Bob Corker, chairman of the Senate Foreign Relations Committee. Then on Monday he was told that firing Mueller would be the stupidest thing the president could doŽ by Orrin Hatch, chairman of the Senate Finance Committee.But Hatch, on CNN, also said he didnt see any need for legislation to protect Mueller. And that sentiment was widely echoed by GOP leaders.In recent months, bills to protect the special counsel have stalled, and Republi-can leaders have stuck to muted statements endors-ing Mueller or denying he is in trouble. So far, that tactic has worked for them as Trump has lambasted the Russia investigation on Twitter but allowed Mueller to continue his work.Democrats say legisla-tion is needed.Immediately,Ž said Sen. Richard Blumenthal of Connecticut. And Ari-zona Republican Jeff Flake, a frequent Trump critic, said, If you dont pick this fight, then we might as well not be here.ŽBut GOP leaders saw no reason to leap to stop a firing they dont think is in sight.I dont think thats going to happen so I just think its not necessary, and obviously legislation requires a presidential signature,Ž said Texas Sen. John Cornyn, the No. 2 Republican in the Senate. I dont see the necessity of picking that fight right now.ŽRepublicans defend Mueller, take no action Special counsel Robert Mueller departs the Capitol on June 21 after a closed-door meeting with members of the Senate Judiciary Committee about Russian meddling in the election and possible connection to the Trump campaign in Washington. [J. SCOTT APPLEWHITE/ ASSOCIATED PRESS FILE PHOTO] The Associated PressMANCHESTER, N.H. „ Unveiling a longawaited plan to combat the national scourge of opioid drug addiction, President Donald Trump called Monday for stiffer penalties for drug traffick-ers, including embracing a tactic employed by some of the global strongmen he admires: the death penalty.Toughness is the thing that they most fear,Ž Trump said.The president traveled to New Hampshire, a state ravaged by opioids and which is also an early marker for the re-election campaign he has already announced. The presi-dent called for broadening awareness about drug addiction while expanding access to proven treatment and recovery efforts, but the backbone of his plan is to toughen the punishment for those caught trafficking highly addictive drugs.This isnt about nice anymore,Ž Trump said. This is about winning a very, very tough problem and if we dont get very tough on these dealers its not going to happen folks. ... I want to win this battle.ŽThe president formalized what he had long mused about publicly and privately: that if a person in the U.S. can get the death penalty or life in prison for shooting one person, a similar punish-ment should be given to a drug dealer who poten-tially kills thousands.Trump has long spoken approvingly about coun-tries like Singapore that have fewer issues with drug addiction because they harshly punish their dealers. During a trip to Asia last fall, he did not publicly rebuke Philippines President Rodrigo Duterte, who authorized extrajudicial killings of his nations drug dealers.Outside a local firehouse that Trump visited before the speech, someone compared the leaders with a sign that said: Donald J. Duterte.ŽDrug traffickers kill so many thousands of our citizens every year,Ž Trump said. Thats why my Department of Justice will be seeking so many tougher penalties than weve ever had and well be focusing on the penalties that I talked about previously for big pushers, the ones that are killing so many people, and that penalty is going to be the death penalty.ŽHe added: Other countries dont play games. ... But the ultimate penalty has to be the death penalty.ŽThe Justice Department said the federal death pen-alty is available for limited drug-related offenses, including violations of the drug kingpinŽ provisions in federal law.It is not clear if the death penalty, even for traffick-ers whose product causes multiple deaths, would be constitutional. Doug Berman, a law professor at Ohio State University, predicted the issue would be litigated all the way to the U.S. Supreme Court.John Blume, a profes-sor and director of Cornell Law Schools death penalty program, said the Federal Drug Kingpin Act has yielded few kingpinsŽ or major dealers, mostly ensnaring midto low-level minorities involved in the drug trade.Trump calls for death penalty to get tough on drug pushers The U.S. Capitol is shown in the early morning Dec. 22 in Washington. [J. SCOTT APPLEWHITE/ASSOCIATED PRESS FILE PHOTO]

PAGE 6

** A6 Tuesday, March 20, 2018 | The News HeraldWRITE TO US: Letters should not exceed 300 words and include the writers name, address and phone number for veri“ cation. Letters may be edited for clarity and brevity. Guest columns of up to 600 words may be submitted as well. Write: Letters to the editor, The News Herald, 501 W. 11th St., Panama City, FL 32401 Email: pcnhletters@pcnh.com LETTERS TO THE EDITOR ANOTHER VIEW Tim Thompson | Publisher Will Glover | Managing Editor Mike Cazalas | Editor PANAMA CITY VIEWPOINTSDid the Russian government attempt to murder a former spy and his daughter in London? It sure looks that way, and world leaders, including U.S. President Donald Trump, are right to speak out. This tale begins with Sergei Skripal, an officer for Russias Main Intelligence Directorate in the 1990s. Unbeknownst to the Russians, he was also a double agent who worked for the UKs Secret Intelligence Service, or MI6, for about a decade (1995-2004). Russia eventually discovered Mr. Skripals double life and arrested him in Moscow in 2004. He was convicted of high treason in 2006 and received a 13-year jail sentence. Mr. Skripal caught a break when he was included in a massive prisoner/spy exchange between Russia and the United States. This afforded him the opportunity to settle in the UK in 2010 in the city of Salisbury, and hes reportedly become a British citizen. Yulia, his daughter, still lives in Moscow. On March 3, she decided to travel to Londons Heathrow Airport to visit her father. This tale then suddenly took a near-fatal twist. Mr. Skripal and his daughter were both found unconscious in Salisbury on a park bench. Ms. Skripals eyes were reportedly wide open, she was foaming from the mouth and looked as white as a ghost. They were taken to a hospital, where doctors determined they had been poisoned with a nerve agent. British Prime Minister Theresa May told the House of Commons last week the Skripals were poisoned with a militarygrade nerve agent of a type developed by RussiaŽ known as Novichok. Because of Russias long-standing record of state sponsored assassinations,Ž she believes its highly likely that Russia was responsible for the act.Ž Nikki Haley, the U.S. ambassador to the United Nations, went even further. At a Security Council meeting, she said, If we dont take immediate concrete measures to address this now, Salisbury will not be the last place we see chemical weapons used. They could be used here in New York, or in cities of any country that sits on this council. This is a defining moment.Ž She called for immediate concrete measuresŽ by the council to hold Russia accountable.Ž President Trump said it certainly looks like the Russians were behind it, something that should never ever happen and were taking it very seriously.Ž Russia is losing economic power as American technology undermines its dominance in energy, which may explain its increasing desperation to flex its muscles. A united front of international condemnation, combined with economic sanctions that would punish the inner circle of Russian leader Vladimir Putin, might send a message that killing people in other countries with deadly agents is unacceptable. A version of this editorial first appeared in the Providence Journal, a News Herald sister paper with GateHouse Media.Toxic attacks by Putins RussiaIf you care about whats left of the Everglades, heres what passes for a victory these days: The state is moving ahead with plans for a reservoir and a cleansing marsh to handle some of the fertilizertainted, algae-spawning deluge that gets dumped from Lake Okeechobee to both coasts every rainy season. In theory the collected water will be scrubbed and sent south to nourish parched stretches of the Everglades, and ultimately, imperiled Florida Bay. Take a moment to celebrate, but dont go wild. At 10,500 acres, the reservoir will be relatively small and so deep (23 feet) that some scientists dont think it can do the job. The design was chosen over better options by the board of the South Florida Water Management District, which under Gov. Rick Scott functions as a policy arm of Big Sugar. As one example, TCPalm reporters exposed how the water district in 2015 allowed a U.S. Sugar lobbyist named Irene Quincey to editŽ and weaken planned regulations on harmful phosphorous pouring out of Lake O. Among her contributions to the final draft was deleting the word enforceableŽ from three key passages. So its no shock the water district bowed to the corporate cane growers this year, too. The original reservoir proposal by Sen. Joe Negron, a Stuart Republican whose tourism-dependent district gets slimed hard by the green algae blooms, called for a 60,000-acre project. That would have been big and shallow enough to deal with much of the fouled lake discharges. However, sugar producers didnt want a larger reservoir because they opposed taking any cane acreage out of production, even if the state paid them for it. Some of Big Sugars subsidized crop grows on land owned by Florida and leased back to the growers. Yet neither lawmakers nor district officials pushed to end those leases so the tracts could be used for Glades restoration. The Everglades Foundation and some other groups that had blasted the smallreservoir concept backed off after the state Department of Environment Protection (DEP) promised strict terms for maintaining safe water quality. If that sounds encouraging, dont forget were talking about another agency castrated by Scott and the Republican leadership in Tallahassee. The priority of the DEPs shriveled staff is fast-tracking development permits, not cracking down on polluters. But lets say a small reservoir that catches and reroutes Lake Okeechobees marathon toilet flushes is better than nothing. The project still must be approved by the U.S. Army Corps of Engineers, an often sluggish partner, and also by Congress, which is supposed to fund half of the estimated $1.4 billion tab. If all that goes smoothly, the most optimistic prediction for finishing the reservoir and its 6,500-acre treatment marsh is in eight years. Thats a long wait, and its not as if engineers must invent a daring new concept in drainage. Reservoirs were a crucial feature of the landmark Everglades restoration plan approved by Congress (and well-celebrated) back in 2000. Actual progress has occurred. Elevating segments of the Tamiami Trail to free southward water flow was something few of us thought wed see in our lifetimes. Farther north, new filtering marshes are cleaning some fertilizer from farm runoff. All this happened because smart scientists and dogged bureaucrats overcame maddening hurdles. Some of these folks are still around, working behind the scenes with barebones government budgets. Unfortunately, for those whose lives and businesses are upended by seasonal discharges from Lake O, eight years could be a crushing eternity.Nobody ever said saving the Everglades would be easy Carl Hiaasen Can we get Friday Fest back, please? Definition of incompetence: It took government employees eight days to look at ID cards and discover the names of people killed in the bridge collapse. There is no such thing as clean coal. If it were put through an industrial-size washing machine with Tide and it came out as white as snow, then and only then could you call it clean coal. For Gods sake! How hard is it to say PLEASE and THANK YOU? It is not a foreign language you have to learn. Have some blasted manners! The NRA is about responsible gun ownership. SQUALL LINESay no to Section 4012 of HR 2825 On March 9, the Secretary of State Of New Mexico, Maggie Toulouse Oliver, along with18 other secretaries of state,forwarded a signed letter to the Honorable Mitch McConnell, Senate majority leader, and the honorable Chuck Schumer, Senate minority leader, expressing their concerns regarding unprecedented and shocking language currently included in Section 4012 of HR 2825, the reauthorization of the federal Department of Homeland Security (DHS). Section 4012 allows Secret Service personnel unlimited access to polling places pursuant to the presidents direction. This is an alarming proposal which raises the possibility that armed federal agents will be patrolling neighborhood precincts and vote centers.Ž Secretary Of State Oliver cites Title 18 of the U.S. code as part of her argument against the Senate passing the proposed amendments to Section 4012, Secret Service Protection at Polling. Title 18 U.S. Code Statute 592 states that whosoever being an officer of the Army or Navy, or other person in the civil, military or naval service of the United States, orders, brings, keeps or has under his authority or control any troops or armed men at any place where a general or special election is held, unless such force be necessary to repel armed enemies of the United States, shall be fined under this title or imprisoned not more than five years, or both; and be disqualified from holding any office of honor, profit or trust under the United States. It has been suggested that Section 592 of Title 18, United States Code, be amended by adding at the end the following: This section shall not present any officer or agent of the United States Secret Service from providing armed protective services authorized under Section 3056 or pursuant to a presidential memorandum at any place where a general or special election is held.Ž These secretaries of state across the country agreeŽ that there is no discernible need for federal Secret Service agents to intrude, at the discretion of the president, who may also be a candidate in that election, into the thousands of citadels where democracy is enshrined.Ž The president shouldnt have any legislated advantage, written or implied at our voting places. We should speak out against President Trumps attempt at giving himself additional powers over our time honored voting privileges by amending Section 592 of Title 18, United States Code. Contact your congressional representatives and let them know Section 4012 of HR 2825 should be rejected.Pelvo White Jr., Marianna

PAGE 7

** The News Herald | Tuesday, March 20, 2018 A7 BUSINESSTHE DOW 30COMPANY CLOSE CHG. 3M $231.56 -5.66 Am. Express $94.84 -0.77 Apple $175.30 -2.72 Boeing $331.76 +1.29 Caterpillar $152.15 -4.31 Chevron $113.89 -1.51 Cisco $44.27 -0.74 Coca-Cola $43.26 -0.20 DowDupont $66.56 -1.40 Exxon $74.15 -0.97 Gen. Electric $14.07 -0.24 Goldman Sachs $262.53 -5.07 Home Depot $177.10 -1.86 Intel $50.83 -0.34 IBM $157.35 -2.91 J&J $130.24 -3.44 JPMorgan $114.53 -0.91 McDonalds $159.01 -3.35 Merck $54.63 -1.04 Microsoft $92.89 -1.71 Nike $65.71 -0.20 Pfizer $36.33 -0.45 Procter & Gamble $78.66 -0.31 Travelers $140.02 -1.30 United T ech $127.20 -1.13 Verizon $48.31 -0.25 Walmart $87.45 -1.72 Walt Disney $101.48 -1.39 United Health $225.05 -2.81 Visa $123.21 -1.32STOCKS OF LOCAL INTERESTCOMPANY CLOSE CHG. AT&T $36.58 -0.42 DARDEN RESTS $94.37 -0.18 GEN DYNAMICS $223.90 +1.16 HANGER INC $16.00 -0.10 HANCOCK HLDG $54.85 -0.80 HOME BANCS $24.31 -0.21 ITT CORP $51.37 -0.26 THE ST JOE $19.45 -0.15 KBR INC $17.04 +0.47 L-3 COMMS $206.60 +1.24 OCEANEERING $18.77 -0.49 REGIONS $19.55 -0.08 SALLIE MAE $11.38 -0.03 SOUTHERN $44.17 -0.02 SUNTRUST $71.05 -0.48 WESTROCK $64.82 -1.55 INGERSOLL-RAND $88.52 -0.96 ENGILITY HOLDS $24.72 -0.39 Source: Matt Wegner Financial Advisor The Edward Jones Co. Panama City, 769-1278 FOREIGN EXCHANGEU.S. $1.00 = Canadian 1.31 U.S. $1.00 = Euro 0.81 U.S. $1.00 = Mexican Peso 18.71 U.S. $1.00 = British Pound 0.71By Marley JayThe Associated PressNEW YORK „ Facebook plunged to its worst loss in four years Monday and led a rout in technology companies. The social media companys stock fell following reports that a data mining firm working for the Trump campaign improperly obtained data on 50 mil-lion Facebook users. The drop in Facebook stock came after the New York Times and the Guardian reported that the firm, Cambridge Analytica, was able to tap the profiles of more than 50 million Facebook users without their permission. Legislators in the U.S. and Europe criticized Facebook and said they want more information about what happened. Investors wondered if companies like Facebook and Alphabet will face tighter regulation as a result.Daniel Ives, chief strategy officer and head of technology research for GBH Insights, said Facebook is in a crisis, and it will have to work hard to reassure users, investors and governments.This is a defining moment for them,Ž he said. It either becomes a blip on the radar and it helps the platform mature... or it becomes the start of something broader.ŽElsewhere, the British pound rose and European stocks slumped after Britain and the European Union said they are getting closer to a deal that will complete Britains departure from the EU in March 2019.The S&P 500 index sank 39.09 points, or 1.4 percent, to 2,712.92. The benchmark index took its biggest loss since Feb. 8, when it tumbled almost 4 percent as investors worried that rising inflation would slow the progress of the market and the U.S. economy.The Dow Jones indus-trial average fell 335.60 points, or 1.3 percent, to 24,610.91. During the day it fell as much as 493 points. The Nasdaq composite gave up 137.74 points, or 1.8 percent, to 7,344.24. The Russell 2000 index of smaller-company stocks declined 15.49 points, or 1 percent, to 1,570.56. Facebook drags tech down as stocks fallMARKET WATCHDow 24,610.91 335.60 Nasdaq 7,344.24 137.74 S&P 2,712.92 39.09 Russell 1,570.56 15.49 NYSE 12,651.46 132.93COMMODITIES REVIEWGold 1,316.80 5.50 Silver 16.255 .053 Platinum 954.40 4.20 Copper 3.0695 .0235 Oil 62.06 0.21By Matthew LeeThe Associated PressWASHINGTON „ The Trump administration on Monday banned all use by Americans of Venezuelan cryptocurrency, saying that its introduction is intended to skirt U.S. sanctions. In a separate move, the administration also slapped sanctions on four current and former senior Venezuelan offi-cials accused of corruption and mismanagement.In an executive order that took effect immediately upon its issuance, President Donald Trump declared illegal all U.S. transactions related to Venezuelan digital currencies, coins or tokens. The prohibition applies to all people and companies subject to U.S. jurisdiction. The move follows the introduction last month of a Venezuelan cryptocurrency known as the petro,Ž for which the government says it has received investment com-mitments of $5 billion.In the executive order, Trump said it was an attempt to circumvent U.S. sanctionsŽ imposed for democratic backsliding.The Treasury had said in January that the petro appeared to be an exten-sion of credit to Venezuela and warned that transac-tions in it may violate U.S. sanctions.In February, cashstrapped Venezuela became the first country to launch its own version of bitcoin, the petro, in a move that President Nico-las Maduro celebrated as putting his country on the worlds technological forefront.The petro is backed by Venezuelas crude oil reserves, the largest in the world, yet it has arrived on the market as the socialist country sinks deeper into an economic crisis marked by soaring inflation and food shortages that put residents in lines for hours to buy common products.Maduro had announced late last year that he was creat-ing the digital currency to outmaneuver U.S. sanctions preventing Venezuela from issu-ing new debt.Bitcoin and other digital tokens are already widely used in Venezuela as a hedge against hyperinflation and an easy-to-use mechanism for paying for everything from doctor visits to honeymoons in a country where obtaining hard currency requires transactions in the illegal black market.The government has promised that Venezuelans will be able to use the $60 coins to pay taxes and for public services. But with the Venezuelan minimum wage hovering around $3 a month, its unlikely citizens will buy in large amounts.In its own statement on Monday, Treasury said it was hitting the four current and former Venezuelan officials with sanctions that freeze any assets they may have in U.S. jurisdictions and bar Americans from doing business with them.The four include Americo Alex Mata, a director of Venezuelas National Bank of Hous-ing and Habitat and coordinator of Maduros 2013 campaign, Willian Antonio Contreras, the head of the body that oversees price controls in the country, Nelson Reinaldo Lepaje, the head of the Office of the National Treasury, and Carlos Alberto Rotondaro, the former president of the Board of Directors of the Venezuelan Institute of Social Security.Trump bans use of Venezuelan cryptocurrencyIN BRIEFHARRISBURG, PA.Gov. to put $35M toward broadband expansionDemocratic Gov. Tom Wolfs administration said Monday that it will make $35 million available to encourage telecommu-nications companies to extend high-speed internet service to areas of Pennsylvania .Wolfs administration said it hopes to expand broadband internet to every part of Pennsylvania by the end of 2022.The incentives are designed to be available ahead of a $2 billion Federal Communications Commission auction that subsidizes the build-out of broadband internet to unserved areas so that it helps private companies to bid more competitively in the FCCs auction the administration said. The Associated Press Gabriel Jimenez poses for a portrait at his of“ ce in Caracas, Venezuela, on March 7. Jimenez is the chief strategist of Venezuelas government-backed cryptocurrency. He also is a former U.S. congressional intern who organized protests against the same administration he now is helping to circumvent U.S. “ nancial sanctions. [FERNANDO LLANO/AP]

PAGE 8

** A8 Tuesday, March 20, 2018 | The News Herald

PAGE 9

**

PAGE 10

**

PAGE 11

** PAINKILLERS LIMITED | B4DRUG OVERDOSE DEATHSGov. Scott signs bill targeting opioid addiction The News Herald | Tuesday, March 20, 2018 B1 LOCAL & STATE PLEA FOR LENIENCY | B2ROBBERY AND FATALSHOOTINGMan admits to huge mistake inkilling of teen Speeders day goes to potA Bay County Sheriffs Office deputy on patrol recently spotted what he believed to be a speeding vehicle headed the other way.As the above vehicle passed my marked patrol vehicle the driver yelled out obscene language towards me,Ž the deputy wrote. I conducted a traffic stop on the above vehicle at Churchwell Drive and Front Beach Road in ref-erence to a County Ordinance Violation, Disorderly Con-duct 17-4,15-46. The vehicle was occupied by three white males.ŽAll three spoke to the deputy, who could smell a strong odor known to this deputy as burnt marijuana coming from inside the above vehicle.ŽA search ensued, during which the deputy found a marijuana cigarette on top of the center console and all three men admitted to smok-ing the suspected marijuana.ŽAll three men are charged with misdemeanor possession of marijuana. Disorderly golf carter driven to jailA deputy patrolling the area of North Lagoon Drive near Signal Hill Golf Course spots something that would be normal if it wasnt 10:30p.m. and if the road wasnt closed to traffic because of construction.I observed a golf cart being driven in the construction area,Ž the deputy wrote. I made contact with the driver and observed him to be very intoxicated.ŽA deputy specializing in DUI investigations arrives and in the meantme the passenger in the golf cart, continued to taunt myself and the other deputies on scene. He made the statement, Yall think yall the law, but yall aint shit. I returned to the golf cart and handed (the passenger) his I.D. back and told him he was free to go. At which time, he asked if he could cut through the property of Signal Hill Golf Course.ŽThe deputy advised the man he could not give him permission to trespass on someone elses property. As I was walking away he yelled, Youre a Smart Ass at me.ŽThe passenger earned him-self an even longer trip home with that as he was arrested for disorderly conduct, but he wasnt finished.He immediately wrapped his arms around the pole that holds the top on the golf cart,Ž the deputy wrote. While yelling, You are not going to arrest me. Myself and Lt Chad King had to forcefully remove his arms and hands from the golf cart to apply restraints.As I was escorting him to my patrol car, he attempted to pull away from me, causing him to fall to the ground,Ž the report continued. I helped him back to his feet and he was secured in the rear seat of my patrol car.ŽTHE BLOTTER By Collin Breaux747-5081 | @PCNHCollinB CollinB@pcnh.comLYNN HAVEN „ Construction workers were busy Monday at Sheffield Park in Lynn Haven, which has new trees as part of renovations to make the area more enjoyable for residents.The old pine trees were cut down to make way for the upgrades, which caught the attention of some citizens. However, the once-bare park is start-ing to look different since it also has a new grassy area in front of the amphitheater and azaleas planted throughout.The new features are intended to beautify the park along Ohio Avenue and provide a comfortable area for families when they watch upcoming concerts. The playground equipment at Sheffield Park also was upgraded last year.She eld Park has new trees, grassy areaBy Katie Landeck522-5114 | @PCNHKatieL klandeck@pcnh.comPANAMA CITY „ With the bellow of the horn, sail-ors from across the Americas started their journey across St. Andrew Bay and back, set-ting a winding course to take advantage of the southwest-ern winds.It was the second day of racing in the three-day 2018 Masters World Championship in the Sunfish Class sailboat „ the first of two competitions happening this week „ and at stake was a trophy and bragging rights. The competition, where each dingy is exactly the same, is considered a test of skill. And skill was much needed as storms moving through the region continuously changed sailing conditions Sunday and Monday.The conditions were tough,Ž said Donnie Martin-borough, who traveled from Mastering the bayPaul Dierze leaves the shore. More than 30 sailors competed in the 2018 International Masters World Championship in the Sun“ sh Class sailboat at the St. Andrews Bay Yacht Club. Go to newsherald.com for a related video. [PHOTOS BY PATTI BLAKE/THE NEWS HERALD] Sun sh Masters sails out of Panama CitySailors line up their Sun“ sh boats before the start of a race. More than 30 sailors competed in the 2018 International Masters World Championship in the Sun“ sh Class sailboat at the St. Andrews Bay Yacht Club. Sailors compete in a Sun“ sh regatta. More than 30 sailors competed in the 2018 International Masters World Championship in the Sun“ sh Class sailboat at the St. Andrews Bay Yacht Club. Newly laid grass is seen in front of the amphitheater on Monday at Shef“ eld Park. [PATTI BLAKE/THE NEWS HERALD] Park to host Spring Concert Series starting April 6 See BLOTTER, B3 See SUNFISH, B3 See PARK, B3

PAGE 12

** B2 Tuesday, March 20, 2018 | The News Herald WEATHER 6 a.m Noon6 p.m Low Hazard Medium Hazard High Hazard Water closed to public Dangerous Marine Life High Low 65/46 69/49 69/42 70/48 70/50 71/43 75/45 76/46 79/42 73/40 76/45 74/44 78/44 72/51 73/49 75/48 77/44 73/4967/4566/4769/5573/62Breezy with sunshineSunny to partly cloudyMostly sunny Mostly sunny and pleasant7367736849Winds: WNW 10-20 mph Winds: NNW 8-16 mph Winds: SE 4-8 mph Winds: SSE 7-14 mph Winds: W 12-25 mphBlountstown 8.85 ft. 15 ft. Caryville 6.84 ft. 12 ft. Clairborne 34.96 ft. 42 ft. Century 7.64 ft. 17 ft. Coffeeville, AL 19.49 ft. 29 ft. Through 7 a.m. Mon.Apalachicola 6:56a 12:26a 6:11p 12:28p Destin 12:54p 10:02p ----West Pass 6:29a 12:01p 5:44p --Panama City 2:44a 5:26a 12:41p 9:24p Port St. Joe 3:25a 6:41a 10:11a 12:24p Okaloosa Island 11:27a 9:08p ----Milton 3:07p ------East Bay 2:11p 11:53p ----Pensacola 1:27p 10:36p ----Fishing Bend 2:08p 11:27p ----The Narrows 3:04p 12:00a ----Carrabelle 5:31a 10:15a 4:46p 10:54pForecasts and graphics provided by AccuWeather, Inc. 2018FirstFullLastNew Mar 24Mar 31Apr 8Apr 15Sunrise today ........... 6:46 a.m. Sunset tonight .......... 6:54 p.m. Moonrise today ........ 8:56 a.m. Moonset today ....... 10:11 p.m. Today Wed. Today Wed.Clearwater 76/59/t 67/54/s Daytona Beach 82/49/t 70/42/s Ft. Lauderdale 88/66/s 80/54/s Gainesville 77/47/t 69/40/s Jacksonville 80/47/t 68/40/pc Jupiter 88/60/t 76/51/s Key Largo 83/69/s 77/58/s Key West 83/71/s 76/62/s Lake City 77/46/t 67/40/s Lakeland 81/55/t 69/46/s Melbourne 88/54/t 74/43/s Miami 89/67/s 80/54/s Naples 82/64/t 72/52/s Ocala 76/45/t 69/38/s Okeechobee 87/56/t 74/44/s Orlando 82/55/t 71/46/s Palm Beach 87/62/pc 76/52/s Tampa 78/58/t 68/50/s Today Wed. Today Wed.Baghdad 87/61/s 86/58/pc Berlin 37/22/sf 41/29/pc Bermuda 68/66/pc 71/64/t Hong Kong 73/57/t 73/59/s Jerusalem 72/50/s 75/54/s Kabul 56/44/r 64/41/pc London 47/33/pc 48/41/c Madrid 48/32/pc 52/29/s Mexico City 82/54/pc 78/53/pc Montreal 28/11/s 33/23/c Nassau 85/70/pc 83/65/pc Paris 45/30/pc 45/34/pc Rome 54/41/r 55/38/sh Tokyo 53/43/r 50/47/r Toronto 35/20/pc 38/22/c Vancouver 49/36/c 50/38/r Today Wed. Today Wed.Albuquerque 60/37/s 70/44/pc Anchorage 36/23/pc 34/14/s Atlanta 66/37/pc 55/35/s Baltimore 38/32/sn 38/28/sn Birmingham 57/36/r 58/34/s Boston 38/29/pc 36/32/sn Charlotte 71/39/c 52/32/r Chicago 39/29/pc 41/27/pc Cincinnati 41/28/sn 39/23/sn Cleveland 39/27/pc 37/27/c Dallas 69/46/s 76/54/pc Denver 54/28/pc 63/35/pc Detroit 42/26/pc 42/25/s Honolulu 81/71/pc 81/71/c Houston 73/49/s 78/54/s Indianapolis 41/26/c 41/22/pc Kansas City 47/29/c 57/40/s Las Vegas 68/57/pc 74/60/c Los Angeles 68/58/c 65/61/r Memphis 52/38/sh 57/38/pc Milwaukee 37/28/pc 38/27/pc Minneapolis 35/24/sn 39/28/c Nashville 50/34/c 53/32/s New Orleans 69/51/pc 70/52/s New York City 38/31/c 36/30/sn Oklahoma City 60/37/s 67/48/s Philadelphia 37/30/sn 35/28/sn Phoenix 80/58/s 85/65/pc Pittsburgh 37/28/sn 38/21/sn St. Louis 44/30/c 50/32/pc Salt Lake City 59/43/pc 64/52/c San Antonio 77/51/s 80/58/pc San Diego 70/57/c 74/61/c San Francisco 58/54/r 65/56/r Seattle 56/38/pc 57/43/r Topeka 49/29/c 61/41/pc Tucson 79/52/s 83/58/pc Wash., DC 39/34/sn 40/29/snWednesdayThursdayFridaySaturday Gulf Temperature: 69 Today: Small craft should exercise caution. Wind from the west at 12-25 knots. Seas 4-7 feet. Visibility clear to the horizon. Tomorrow: Wind from the west-northwest at 10-20 knots. Seas 2-4 feet. Visibility generally unrestricted.Breezy and less humid today with clouds and sun. Winds west 12-25 mph. Partly cloudy and breezy tonight. Winds northwest 10-20 mph.High/low ......................... 75/69 Last year's High/low ...... 79/53 Normal high/low ............. 72/52 Record high ............. 86 (1989) Record low ............... 34 (1985)24 hours through 4 p.m. .. 0.63" Month to date ................... 1.91" Normal month to date ...... 3.55" Year to date ..................... 9.93" Normal year to date ....... 13.55" Average humidity .............. 98%through 4 p.m. yesterdayHigh/low ......................... 77/68 Last year's High/low ...... 81/57 Normal high/low ............. 69/54 Record high ............. 86 (1982) Record low ............... 32 (1988)24 hours through 4 p.m. .. 0.52" Month to date .................. 2.63" Normal month to date ...... 3.38" Year to date .................... 17.29" Normal year to date ....... 13.75" Average humidity .............. 87%PANAMA CITY Port St. Joe Apalachicola Tallahassee Perry Quincy Monticello Marianna Chipley DeFuniak Springs Pensacola FORT WALTON BEACH Crestview Destin Carrabelle Mobile Bainbridge ValdostaFLORIDA CITIESCity Hi/Lo/W Hi/Lo/W City Hi/Lo/W Hi/Lo/W WORLD CITIESCity Hi/Lo/W Hi/Lo/W City Hi/Lo/W Hi/Lo/W NATIONAL CITIESCity Hi/Lo/W Hi/Lo/W City Hi/Lo/W Hi/Lo/W TODAY FIVE DAY FORECAST FOR NORTHWEST FLORIDAHigh LowREGIONAL WEATHERWeather(W): ssunny, pcpartly cloudy, ccloudy, shshowers, tthunderstorms, rrain, sfsnow ” urries, snsnow, iice. Shown is todays weather. Temperatures are todays highs and tonights lows.Shown are todays noon postions of weather systems and precipitation. Temperature bands are highs for the day.TIDESMARINE FORECASTBEACH FLAG WARNINGSThe higher the AccuWeather.com UV Index’ number, the greater the need for eye and skin protection.0-2 Low; 3-5 Moderate; 6-7 High; 8-10 Very High; 11+ Extreme10 a.m.Noon2 p.m.4 p.m.UV INDEX TODAYALMANACSUN AND MOON MOON PHASESRIVER LEVELS Offshore Northwest Florida Flood Level StageApalachicola Choctawhatchee Alabama Escambia Tombigbee Temperatures PrecipitationPanama CityTemperatures PrecipitationFort Walton Beach Rodney Jones seeks leniency from court for his role in robbery that led to slayingBy Eryn Dion747-5069 | @PCNHErynDion edion@pcnh.comPANAMA CITY „ The man who last month pleaded guilty to principal to robbery with a deadly weapon in exchange for his testimony against the alleged shooter of 16-yearold Jason Ian Price is asking the court for leniency ahead of his scheduled sentencing hearing.In a letter sent to Judge Michael Overstreet and filed with the Bay County clerk of court on March 8, Rodney Jones, who was 17 at the time of the shooting, called his involvement in the homicide a huge mis-takeŽ and says he wasnt awareŽ the charges he admit-ted to carried so much time.Ž Jones is facing up to 20 years in prison as part of his plea agreement.I have never been in any type of trouble in my entire life,Ž Jones writes in the letter. Judge Overstreet, I am trully (sic) sorry for what happened, what happened was wrong and senseless. That young man didnt deserve to die or get robbed. Those was never my inten-sions (sic).ŽJones asks for mercy several times in the two-page, hand-written letter, saying that, if given the opportunity, he would like to enroll in college or join the military to make a difference in society, possibly by helping establish programs for youth offenders to lead them on a road to success instead, as myself, to regretfullness felt from the heart.ŽIn sworn testimony given to the State Attorneys Office as part of the case, Jones said he, his two co-defendants Demarcus Giddens and Gertavious Canada, and several others made the four-hour drive to Panama City Beach from Auburn, Ala., last August with no particular plan in mind or any hotel room booked. After spending some time at the beach, Jones said the group met a group of Arnold High School students at the Taco Bell on the intersection of U.S. 98 and Thomas Drive. Jones said he asked the group if he could buy some marijuana, and one of them made a call. As the group walked across Wildwood Road to the nearby CVS, Jones said Giddens hatched the plan to rob the students.According to that testimony, Jones was around the side of the CVS scaling upŽ or weighing some marijuana when he heard a scuffle and saw Giddens confront Price „ who had arrived at the CVS moments before „ with a firearm, putting the gun to his chest and pulling the trigger. At the sound of the gunshot, Jones said he panicked and punched the male who delivered the marijuana, stealing his watch and his phone before fleeing with Giddens.Jones also said in his testi-mony that he knew Giddens had the firearm, believed to be a Draco AK-47 pistol, in his backpack during the trip.Jones has a sentencing hearing set for April 2. All three men will be in court for pretrial on May 7.Man involved in fatal shooting admits to huge mistakeMARIANNAVictim in Jackson County wreck dies A Chipley woman involved in a wreck in Marianna on Thursday has died from her injuries, according to the Florida High-way Patrol. Accord-ing to FHP reports, Rachel Walls, 25, was trav-eling north on Pennsylva-nia Avenue in Marianna and attempting to turn left into the Marianna Fire Depart-ment when Madison Chafin, 20, of Cottondale, also trav-eling north on Pennsylvania Avenue, failed to stop or slow down and struck Walls vehicle from behind, sending her vehicle into the path of a truck traveling south on Pennsylvania Avenue driven by John McCoy, 73, of Marianna.The right rear of Walls vehicle collided with the front left side of McCoys truck, sending both vehicles sprawl-ing across the roadway. Walls was transported to Jackson Hospital, where she died from her injuries on Saturday. McCoy was taken to Jackson Hospital with minor injuries, while Chafin was uninjured.FHP reported charges are pending.CHIPLEYChipley man gets 40 years in stabbing deathEight months after he was charged with fatally stabbing Wendell Holmes at an assisted living facility, Chris-topher Kelly on Monday was sentenced to 40 years in prison.The Washington County Sheriffs Office reported Kelly, 34, had been held without bond since his arrest on a charge of second-degree murder.The sheriffs office said in a news release that deputies responded to a 911 call on June 24 at Tropical Paradise Assisted Living Facility and was told one client had physically attacked another client and was bleeding.ŽArriving deputies quickly were approached by a man with blood on his hands and clothing,Ž who immediately told deputies, I killed him,Ž according to the news release. That man, deputies said, was Kelley.The release said Kelley apparently believed Holmes had stolen money from him and confronted him about it.PARKERParker City Council meets todayThe Parker City Council will hold its regular meeting starting at 5:30 p.m. today at City Hall, 1001 W. Park St.The council is expected to appoint several people to the planning commission and city attorney Tim Sloan will discuss a lien settlement at 613 Nicole Drive, according to the agenda.CALLAWAYBoil water notice rescindedA boil water notice issued Friday for the city of Callaway has been rescinded.According to city officials, recent water testing has produced satisfactory bacteri-ological samples and the water is safe for cooking and drinking.Anyone with questions should contact the City of Callaway Public Works Department at 850-871-1033.A previous story on this alert can be found here: http://www.newsherald.com/news/20180316/callaway-under-boil-water-alert-until-further-notice. News Herald staff reportsAREA BRIEFSKelly Walls Jones

PAGE 13

** TodayAARP TAX-AIDE PROGRAM: 9 a.m. to 5 p.m. at Bay County Fairgrounds. IRScerti“ ed aides will provide free income tax preparation. Bring your 2017 tax documents, a picture ID and a Social Security card for each person on the tax return; bring a checkbook to verify the routing and account number for a refund. 2016 tax return also helpful. AARP focuses on lowto moderateincome taxpayers of all ages; you do not have to be an AARP member. No appointments; “ rstcome is “ rst-served. For details, Phil Cunningham, 850-774-7953 or pwcinpc@ gmail.com THE SOUND OF WIND: 1-3 p.m. at the Native Spirit Museum and Gallery, 1101 Beck Ave., Panama City, as part of Anthropology Week. Join Paul McAuliffe, local ” ute maker, ” ute player and storyteller, for an afternoon of Native American music and storytelling. Learn about the role ” ute playing had in Native American culture. Hear stories of a time long ago. For details, 890-9905 THE NAPOLEONIC WARS AND HOW THEY CHANGED EUROPE: 2 p.m. at the Bay County Public Library, 898 W. 11th St., Panama City. Rich Filippi will present an overview on Napoleon Bonapartes 15-year rise and fall of power and how it changed Europe and the world. Free; open to the public. For details, NWRLS. com TAI CHI „ A BETTER BALANCE: 9 a.m. at the Lynn Haven Senior Center, Lynn Haven, facilitated by a certi“ ed instructor. For details, 850-277-2730 THE LIGHT IN HER EYESŽ SCREENING: 5:30 to 8 p.m. at the Bay County Public Library, 898 W. 11th St., Panama City. In partnership with PBS, a screening from award-winning POV documentary series as part of the Beyond the Lens: Book and Film Series. Post “ lm discussion led by Dr. David Fistein (Gulf Coast State College) and Hiba Rahim (CAIR, Council on American-Islamic Relations). For details, 522-2120 or www.nwrls.com JAZZ QUARTET FEATURING ANDREW TINCH: 6:30 p.m. at The Place, 429 Harison Ave., Panama City. Event is part of a monthly series produced by the Gulf Jazz Society. Tickets $10 for GJS members and $12 for the public. For details, 7842106 or 258-4022 PANAMA CITY WRITERS ASSOCIATION CRITIQUE GROUP: 6:30-8:30 p.m. at St. Andrews Civic Club, 2629 W. 10th St. All genres. For details, www.panamacitywriters.orgWednesdayAARP TAX-AIDE PROGRAM: 9 a.m. to 3 p.m. at Panama City Beach Library and 9 a.m. to 5 p.m. at Bay County Fairgrounds. IRScerti“ ed aides will provide free income tax preparation. Bring your 2017 tax documents, a picture ID and a Social Security card for each person on the tax return; bring a checkbook to verify the routing and account number for a refund. 2016 tax return also helpful. AARP focuses on lowto moderateincome taxpayers of all ages; you do not have to be an AARP member. No appointments; “ rstcome is “ rst-served. For details, Phil Cunningham, 850-774-7953 or pwcinpc@ gmail.com CALLAWAY SENIORS PROGRAM: 9 a.m. to noon at the Callaway Fellowship Center, hosted by the Bay County Council on Aging, with exercise classes, tai chi, bingo, line dancing, cards and lunch. Seniors 60 and older. For details, 850-769-3468 AWKWARD OXEN IMPROV HOUR: 10 a.m. at Fonville Press in Alys Beach. Free; suitable for all ages. Seaside Reps improv troupe plays games, makes up scenes and songs on the spot. Audience members can workshop on Wednesday and perform with them on Thursday. For details, LoveTheRep.com ART & FUN: 10:30 a.m. Wednesdays at the Lynn Haven Senior Center, Lynn Haven. For details, 850-277-2730 CONVERSATIONAL SPANISH CLASS: 12:30 p.m. at the Lynn Haven Senior Center, facilitated by retired Spanish teacher. For details, 850-277-2730 CATCH A DREAM: 1-3 p.m. at the Native Spirit Museum and Gallery, 1101 Beck Ave., Panama City, as part of Anthropology Week. Linda Pettersen will demonstrates the art of making dreamcatchers. Learn how they are made, what they are used for, and the legend that surrounds them. For details, 890-9905 CHANTICLEER: 7:30 p.m. at the Marina Civic Center, 8 Harrison Ave., Panama City; wrapping up the Panama City Music Associations 76th season. The 12-man orchestra of voicesŽ presents original interpretations of vocal literature, from Renaissance to jazz and popular genres, as well as contemporary composition. For tickets, MarinaCivicCenter.comThursdayAARP TAX-AIDE PROGRAM: 9 a.m. to 5 p.m. at Bay County Fairgrounds. IRScerti“ ed aides will provide free income tax preparation. Bring your 2017 tax documents, a picture ID and a Social Security card for each person on the tax return; bring a checkbook to verify the routing and account number for a refund. 2016 tax return also helpful. AARP focuses on lowto moderate-income taxpayers of all ages; you do not have to be an AARP member. No appointments; “ rst-come is “ rst-served. For details, Phil Cunningham, 850-774-7953 or pwcinpc@gmail.com AWKWARD OXEN IMPROV HOUR: 10 a.m. at Fonville Press in Alys Beach. Free; suitable for all ages. Seaside Reps improv troupe plays games, makes up scenes and songs on the spot. Audience members can workshop on Wednesday and perform with them on Thursday. For details, LoveTheRep.com FREE HEALTH CLINIC: 1…4 p.m. at the Panama City Rescue Mission Support Center, 515 E. Sixth St., Panama City. Free; registration is in the morning before clinic opens. For details, 850-215-0159 SPEAK ANOTHER TONGUE: 1-3 p.m. at the Native Spirit Museum and Gallery, 1101 Beck Ave., Panama City, as part of Anthropology Week. Ron Scott is Choctaw from Oklahoma who will share the native tongue of his people. Learn about the Choctaw and the language with which they communicated. For details, 890-9905 DENNIS LANDINGHAM EXHIBITION: 5-8 a.m. at The Artist Cove studio.gallery, 36 W. Beach Drive, Panama City. An evening of art and enjoyment with a classical guitarist performing and plenty of refreshments. Open to the public. The News Herald | Tuesday, March 20, 2018 B3Guidelines and deadlinesObituary notices are written by funeral homes and relatives of the deceased. The News Herald reserves the right to edit for AP style and format. Families submitting notices must type them in a typeface and font that can be scanned into a computer. Deadline for obituaries is 3 p.m. daily for the following days newspaper. Obituaries may be e-mailed to pcnhobits@pcnh.com or delivered to The News Herald, 501 W. 11th St., Panama City. View todays obituaries and sign the online guest books of your loved ones at newsherald. com/obituaries. OBITUARIES LOCAL & STATE Memorialization for Bonnie Gale Berndt, 61, of Panama City Beach, Florida, who died March 16, 2018, will be by cremation, and a ceremonial scattering at sea will take place Friday, March 23, 2018. To extend condolences, visit www. heritagefhllc.com.BONNIE GALE BERNDTFuneral services for Joseph Cecil Fountain, 79, of Panama City, Florida, who died March 19, 2018, will begin at 2p.m. Friday, March 23, 2018, at Kent-Forest Lawn Funeral Home. Visitation will be from 6-8p.m. Thursday, March 22, 2018, at the funeral home.JOSEPH CECIL FOUNTAINVisitation for Noel Gray Phillips Jr., 89, of Panama City, Florida, who died March16, 2018, will be from 3-5p.m. Saturday, March 24, 2018, at Southerland Family Funeral Home. NOEL GRAY PHILLIPS JR.Old drama means new windowA deputy responding to a disturbance is told by the complainant that the suspect showed up at her residence in an attempt to start a fight with her husband ... (but) her husband did not go outside and that the two just yelled at each other through the front door.ŽThe wife says her hus-band told the man he just needed to leave,Ž but as he was walking away, their kitchen window broke.Ž The wife says the man got into a vehicle and left with another woman.The wife advised she went outside to see what broke the window and observed her sons Red Huffy tricycle lying up against the apartment wall. She stated that she was approached by her neighbor who stated that she saw the suspect throw the tricycle against the wall but did not see that it broke the window.ŽThe neighbor told the deputy she could hear yelling, which caused her to look up, and she then saw a white male walking away from the apartments, pick up the Red tricycle and throw it at the apartment wall. She stated that the tricycle only hit the stucco wall and was not near the kitchen window. I had her show me where on the apartment wall the tri-cycle hit and it was about two feet to the left of the window and about six inches below the height of the window.ŽThe deputy reported it didnt appear there was criminal intent to break the window, but they still couldnt figure out why it would break, but the wife then remembered that the window already was cracked before the inci-dent began.The deputy then spoke to the husband, as to why (the other man) showed up to try and fight him. He would only state that it was over old drama.Ž Methy businessA deputy on patrol last week spotted a man and a woman sitting in a vehicle behind a closed business.I exited my marked patrol car and observed the white female passenger lift the front of her pants and place a clear baggie with an unknown substance down the front of her pants,Ž the deputy wrote. I asked the female to exit the car and asked her what she put in her pants. The female denied putting anything down her pants. Eventually the female admitted to placing a baggie of methamphetamine down her pants. The female pulled out a clear baggie of methamphetamine.Ž The case is turned over to investigations. News Herald staff reports BLOTTERFrom Page B1WHATS HAPPENING Submit an eventEmail pcnhnews@pcnh. com with Whats HappeningŽ in the subject line. Friday, Saturday, Sunday, Monday and Tuesday events: Due by 5 p.m. Wednesday before Wednesday events: Due by 5 p.m. Monday before Thursday events: Due by 5 p.m. Tuesday beforeI think initially, because the trees were removed in one day, it looked destructive,Ž Mayor Margo Anderson said. One of the reasons the old pine trees were removed was to give more green space and as you can see weve got large green space in front of the concert theater.... There will be elms and live oaks. Weve already started planting those.ŽThere also will be weeping willows for the pond and larger 30-foot trees coming, Anderson said. The miniature azaleas have been put up since azaleas planted by local civic clubs were taken out by a previous city government admin-istration. Sheffield Park also has new pathways accessible for people with disabilities.The amphitheater „ which was moved from the center of the park to the back corner near Pennsylvania Avenue and got a new roof ear-lier this year „ will open April 6 for a concert to kick off the citys Spring Concert Series. The city is keeping a tight lip on who the musical act will be since its a surprise.This green space is going to be great for our Spring Concert Series,Ž Anderson said Monday. It has a sprinkler system. Its golf course-quality grass. Its very soft, so the children can get out here and play volleyball or dodgeball or football. ... Just two days ago it was sand. Youll be able to bring your lawn chairs and spread your blankets on this.ŽThe area in front of City Hall also has been turned into a green space, with ongoing dis-cussions about how the city ultimately wants it to look. The restrooms will be upgraded so they look newŽ and modern,Ž Anderson said.Anderson said she has had a lot of positive feedback. Numerous people on Facebook complimented the changes, including Danielle Mulick, who said the park looks absolutely gorgeousŽ and she cannot wait to take my family and enjoy this beautiful park and space.ŽAnderson said Sheffield Park is pretty much operational right now.Ž The April 6 concert is free and starts at 5:30 p.m.The renovations are part of development in Lynn Haven, including the Rails to Trails project which will turn old rail-road tracks into walking and biking paths and a splash pad coming to Kinsaul Park. PARKFrom Page B1the Bahamas for the competition and was leading the pack before Mondays races began. I was able to be consistent more than anything else. It was just light and the start lines were crowded, difficult to get off.ŽThirty-five sailors, ranging from 40 to 87 years old, were on the water Monday jockeying for best start position based on wind, current and maneuverability, as in some ways the race begins even before the buzzer soundswith captains positioning their vessels. False starts were called on two races as almost half the boats were blown over the start line before the race began, and at one point the line needed to be reset to remain perpen-dicular to the wind.Weather and wind are part of the sport. On Sunday, light winds created a challenge for competitors looking to build speed. On Monday, fog delayed the start, then a lack of wind, then a rainstorm and by the time racing could start in the afternoon, winds had picked up to between 10 and 15 knots.The first buoy almost always is directly into the wind, and you cant sail straight into the wind. You have to sail at about a 45 degree angle and zigzag to get there,Ž said Gail Turluck, who had traveled from Mich-igan. But the wind isnt exactly perfect either, so you try to guess which way it will shift or time it.Ž The one thing you can count on, she said, is that it never will be the same.For most, it was the first time they had sailed in St. Andrew Bay. Mar-tinborough called it a nice spot.ŽThe St. Andrews Bay Yacht Club has hosted several other similar competitions in the past, but this is the first time the Sunfish division, which moves around every year, has come to Panama City. Starting Thursday, the Sunfish Class Associations National Championship at Midwinters will start. Competitors will be looking to secure one of the three qualifying slots for the 2019 Pan Ameri-can Games in Lima, Peru, an event similar to the Olympics.All the racing will take place on the bay and is visible from places with an open view of the bay such as the Panama City Marina and Beach Drive. There also are several social events that are open to the public. For more information, go to panamacityregatta.com. SUNFISHFrom Page B1

PAGE 14

** B4 Tuesday, March 20, 2018 | The News HeraldBy Zac Anderson Gatehouse Media FloridaTALLAHASSEE „ The National Rifle Association is lambasting Florida House Speaker Richard Corcoran, a potential GOP candidate for governor, for supporting legislation that includes gun control measures.Marion Hammer, the NRAs Florida lobbyist and past president of the gun rights group, sent out an email blast to NRA members Monday that accuses Corcoran of treacheryŽ for backing a bill that raises the age for purchasing long guns in Florida to 21, institutes a three-day waiting period for purchasing such guns and bans so-called bump stocksŽ that simulate fully automatic fire.Hammers email states that Corcoran added insult to injuryŽ during an interview last week. During the interview, Corcoran said the gun legislation is a major vic-tory for gun rights supporters because it also includes a pro-vision that creates a pathway for school districts to arm certain employees, including some teachers.Corcoran said the bill ends the insanity of gun free zones on our school campuses.ŽCorcoran tried to justify his treachery by ignoring the damaging gun control he supported and then claimed the effort to arm school employees makes it one of the greatest Second Amend-ment victories weve ever had because it ends gun free zones on school campuses, Ž Hammer wrote, adding: That is complete nonsense.ŽIf Corcoran runs for gover-nor he first must face off in a primary with Commissioner of Agriculture Adam Putnam and U.S. Rep. Ron DeSantis, both of whom have said they do not support the legislation lawmakers passed in response to the shooting deaths of 17 people at Marjory Stoneman Douglas High School last month. The NRA is influential with many GOP primary voters.NRA accuses Corcoran of treachery for supporting gun billBy Jim SaundersThe News Service of FloridaTALLAHASSEE „ Saying it is critical to stop the addiction in the beginning,Ž Gov. Rick Scott on Monday signed a high-profile bill designed to prevent patients from getting hooked on powerful opioids.Flanked by House leaders and law-enforcement officers at the Manatee County Sher-iffs Office, Scott approved the measure as the state continues grappling with drug overdoses that have surged in recent years. The bill is designed, at least in part, to prevent patients from getting addicted to prescription painkillers and then turning to street drugs such as heroin and fentanyl. Ive met a lot of families all across the state who are deal-ing with drug abuse,Ž said Scott, who declared a public-health emergency last year because of the opioid issue. I have a family member thats dealt with both alcoholism and drug abuse, and I can tell you its very difficult for a family.ŽLawmakers unanimously passed the bill (HB 21) on March 9, the final full day of the annual legislative session. Perhaps the highest-profile part of the bill would place limits on prescriptions that doctors can write for treatment of acute pain. Doctors in many cases would be limited to writing prescriptions for three-day supplies, though they could prescribe up to seven-day supplies of controlled substances if medically necessary.Ž Cancer patients, people who are terminally ill, palliative care patients and those who suffer from major trauma would be exempt from the limits.Some physicians objected during the legislative session to such limits. But House Speaker Richard Corcoran, a Land O Lakes Republican who took part in Mondays bill-signing event, defended the approach.It (the bill) also says no longer will we prescribe just blanketly 30-day prescriptions. Now well say its a three-day prescription, and then you have to come back and warrant (it),Ž Corcoran said. Is that an inconvenience? Yes. Is an inconvenience worth saving 50,000 lives nation-wide? Absolutely.ŽAnother high-profile part of the bill will require physicians or their staff members to check with a statewide database before prescribing or dispensing controlled sub-stances. In the past, Florida has not required physicians to use the database, known as the prescription drug monitoring program. The goal of the database is to prevent addicts from visiting multiple doctors or pharmacies to get supplies of drugs.Opioids have caused thousands of deaths in Florida in recent years. In 2016, for example, fentanyl caused 1,390 deaths, heroin caused 952 deaths, oxycodone caused 723 deaths, and hydrocodone caused 245 deaths, according to a House staff analysis.House Commerce Chairman Jim Boyd, a Bradenton Repub-lican who sponsored the bill, described it as another step to curbing this epidemic.ŽI grew passionate about this a couple of years ago because I just saw what it was doing,Ž Boyd said during the billsigning event at the sheriffs office. Theres not a person in this room who doesnt have a family member or a friend of a family that hasnt been affected by this epidemic.ŽScott signs bill targeting opioid addictionOxycodone-acetaminophen pills are pictured. Abuse of painkillers, heroin, fentanyl and other opioids across the country has resulted in tens of thousands of children being taken from their homes and placed in the foster care system. [PATRICK SISON/AP] In this April 2007 photo, National Ri” e Association lobbyist Marion Hammer speaks at a House meeting in Tallahassee. [AP FILE]

PAGE 15

** The News Herald | Tuesday, March 20, 2018 B5Destin candidates quick to remove campaign signsBy Jim Thompson315-4445 | @Jimtnwfdn jthompson @nwfdailynews.comDESTIN „ Well within a single day after the March 13 city election in Destin, the vast majority of the hundreds of campaign signs placed by the two mayoral candidates and the five candidates vying for three open council seats had been removed from the citys roadsides and neighborhoods.A city ordinance gives candidates 21 days from election day to get their signs down. But candidates, whether by force of tradition or a desire to keep streets as attractive as possible to tourists, routinely have taken far less time to remove them.Its really not a problem here in the city, and we dont expect it to become one,Ž said Doug Rainer, the Destin governments public information manager.This year, victorious mayoral candidate Gary Jarvis, a local restaurateur and charter boat captain, took a novel approach to ensuring that his signs came down quickly.On Facebook, Jarvis announced a contest in which he awarded 1 point for every yard-size sign collected, 5 points for retrieving his 3-by4-foot signs, and 10 points to anyone taking down one of his large 4-by-8-foot signs. The person collecting the most points would get a dinner for two with him and his wife at Brotulas, a Destin restaurant operated by his son.Everybody thought it was a great idea,Ž he said. And as things turned out, two winners had been determined by the end of election night.One of Jarvis own deckhands, A.J. Nemiac, teamed up with local charter captain Scott Burke to collect most of Jarvis campaign signs. Late on election night, Jarvis returned home from a victory party to find his driveway filled with signs, including at least one of his large 4-by-8 signs.Itll be a nice evening,Ž Jarvis said of the upcom-ing dinner.Jarvis is recycling his signs, a strong hint of plans „ or lack thereof „ for his political future.I have no plans to go through this again,Ž he laughed.Incumbent Mayor Scott Fischer, who lost his bid for re-election, was up with some supporters at 8 a.m. on the day after the election to get his signs collected. Based on some interest in his signs by people who wanted to re-use them for various purposes, including their own upcoming campaigns, Fischer left his signs on a Mountain Drive lot and gave people a deadline to come and pick them up.It was the first time hed had anything like that happen, Fischer said.This was all new,Ž he said.Another Destin candidate, victorious city council contender Skip Overdier, got the earliest start in taking down his campaign signs, even before voters headed to the polls last Tuesday. I started Monday,Ž he said. Overdier spent part of the day before the elec-tion taking down signs on the outskirts of the city.Overdier had only about 70 signs spread across Destin.I hate them,Ž he said. I think money could be better spent.ŽPrebble Ramswell, another victorious Destin council candidate, also got an early start with her team in getting her cam-paign signs collected.We started taking them down election night,Ž she said. Within a matter of hours, most of Ramswells signs were gone.The city looks great!Ž Ramswell said Thursday.But Ramswell, like a couple of other Destin candidates, had some pre-election helpŽ in getting rid of the signs.A lot of them disappeared during this campaign,Ž she said. Ramswell placed 300 signs across Destin, and estimated that by elec-tion day, half of them had disappeared. Like Jarvis, Ramswells plans to recycle her signs „ unlike her previous campaign, when she put them in storage „ hints at her political future.Last time, I kept everything,Ž she said. This time, I kept a few as souveniers.ŽThe other victorious city council candidate, Rodney Braden, worked through Friday to get his signs collected and put into storage. Braden had put out 200 yard signs, in addition to eight 4-by-8-foot signs.Teresa Hebert, who came up short in the at-large Destin council balloting, wasted little time in retrieving her 100 or so signs from Destin roadsides. With the elec-tion over, and spring vacationers descending on the town, theres no reason not to get the signs down quickly, she said.Its out of respect to our citizens,Ž Hebert said.Elsewhere in the area, campaign signs also rou-tinely come down soon after election day. In Valparaiso, which also held municipal elections last Tuesday, candidates are required to post a $100 deposit before placing signs. After the election, candidates have a week to collect their signs. If they dont, they forfeit their deposit, City Manager Carl Scott said.Most of our signs are already up and gone,Ž Scott said Friday.Tradition against trashiness By Wendy Victora 315-4478 | @Wendyvnwfdn wvictora@nwfdailynews.comJAY „ A 13-year-old boy faces an attempted premeditated murder charge, as well as arson and burglary charges.Ethan Marsh-Hual was taken to a Florida Department of Juvenile Justice facility following his arrest Sunday by the Santa Rosa Sheriffs Office.According to his report, the seventh-grade boy intentionally set one fire in another familys garage and three other fires on their fence, an electrical box and a screen door. The boys parents told investigators he had told them what he did.Four victims were home at the time of the fire, but were not injured. A child in the house woke up her father, who used a fire extinguisher and then a garden house to put out the garage fire.The boys parents allowed him to be inter-viewed by authorities on video camera. During the interview, Marsh-Hual told them that he and a boy who lived in the house he had attempted to burn had been friends but had gotten in a fight. The fight involved one of the boys vomiting on the other boys mailbox and apparently both boys talking and laughing about the other boy at school, the report said.The boys had hung out the day of the fire, playing video games and riding bikes. Marsh-Hual said he could tell the other boy was getting upset toward the end of the day because his face was getting red. He said he knew a fight was going to pop up.ŽHe said he went home at 7 p.m. for dinner, but set his alarm for midnight. After his alarm went off, he went back to the other boys house and started four fires, includ-ing one in the garage that he fueled by putting a propane tank on it, as well as some lawn chairs.After he was done, he said he took off running and then made his way back to his own home, where he washed his hands and face before going to bed.The investigator asked him if he cared that other people in the house could have died. His answer was redacted from the report.13-year-old faces attempted murder charges Destin Councilman Rodney Braden collects his campaign signs from a lot in Destin. Braden said he will be saving the signs for possible future campaigns. A city ordinance gives candidates 21 days after election day to remove their signs, but candidates traditionally have collected their signs far more quickly. [NICK TOMECEK/DAILY NEWS]

PAGE 16

** B6 Tuesday, March 20, 2018 | The News HeraldARIES (March 21-April 19) „ You are a “ rm believer in fresh starts, and the clean energy of this special day renews you like a trip to the oxygen bar. Your high spirits create distance between you and yesterdays problems. TAURUS (April 20-May 20) „ The key is not to expect people to do things they are incapable of doing. This, of course, requires you to learn the capabilities of others. You can learn something by observing, and more by testing, too. GEMINI (May 21-June 21) „ Your friendships work in the larger context of your friend group, but they must also work in the smaller one-on-one context to satisfy you. Today youll “ nally get the individual attention you need. CANCER (June 22-July 22) „ Middles sag. Thats the very nature of middles. Whether its a story, a body or a project, it takes tremendous effort to create lift in the middle. Put in the work so you can get the satisfaction at the end. LEO (July 23-Aug. 22) „ Youve often felt as though youre doing the right thing with the wrong person, though youve almost never felt the opposite of that. Because when youre with the right person, whatever you do, even nothing at all, feels so right. VIRGO (Aug. 23-Sept. 22) „ Life is zesty for people in love. And even if youre not quite there, a ” ow of positive feelings and thoughts is still creating a bubble of happiness around you. LIBRA (Sept. 23-Oct. 23) „ Mental expansion ignites other parts of your life. It actually doesnt even matter what youre learning. Regardless of the subject matter, going from ignorance to mastery is the thrill that makes you feel most alive. SCORPIO (Oct. 24-Nov. 21) „ You can accomplish quite a mound of work in the span of a few hours. Youll get busy, and you wont stop until the agreed upon time. The end of the day will bring a well-deserved boon. SAGITTARIUS (Nov. 22-Dec. 21) „ You underestimate how others feel about you. While its better to err on the modest side of such matters, you should know that if you dont show up, certain people are going to be very disappointed. CAPRICORN (Dec. 22-Jan. 19) „ Most people you know could use a little help every now and then. Then there are those who are needy on an entirely different level. You may feel ready to help someone like that, and it will be a most rewarding experience. AQUARIUS (Jan. 20-Feb. 18) „ Youll get the chance to “ ne-tune the image you present to the world. Actually, you could do this at any time. But today will give you both the motivation and the necessary tools. PISCES (Feb. 19-March 20) „ After years of tolerating others, youve become spiritually robust. The generosity that used to seem like work to you is now innate. To be the bigger person will require no thought at all.HOROSCOPES BY HOLIDAY MATHIS DIVERSIONSTrivia FunŽ with Wilson Casey, Guinness World Record Holder from Woodruff, S.C., is published in more than 500 newspapers across the country. Comments, questions or suggestions? WC@TriviaGuy. com 1. The average cumulus cloud weighs the equivalent of approximately how many elephants? , 1, 10, 100 2. Who was the first Harvard graduate to become U.S. president? John Adams, James Monroe, Franklin Pierce, Grover Cleveland 3. During the Great Fire of 1871, what city was largely destroyed? New York, St. Louis, Chicago, New Orleans 4. What furniture piece might be referred to as a highboyŽ? Chest of drawers, Sofa, End table, Bed 5. Which Scandinavian capital was formerly called  ChristianiaŽ? Stockholm, Oslo, Helsinki, Copenhagen 6. How many names of U.S. states start with a compass direction (word)? 2, 3, 4, 5 ANSWERS: 1. 100 (1.1 million pounds), 2. John Adams, 3. Chicago, 4. Chest of drawers, 5. Oslo, 6. 5 (North Carolina, North Dakota, South Carolina, South Dakota, West Virginia)TRIVIA BY WILSON CASEY ACES ON BRIDGE: BOBBY WOLFF (Answers tomorrow) TEMPO GLORYVISION PARDON Yesterdays Jumbles: Answer: The high jumper was successful in practice, but his coach worried he was „ OVERDOING IT Now arrange the circled letters to form the surprise answer, as suggested by the above cartoon.THAT SCRAMBLED WORD GAMEby David L. Hoyt and Jeff Knurek Unscramble these four Jumbles, one letter to each square, to form four ordinary words. KAARP KLFEU CLORSL TAPDUE 2018 Tribune Content Agency, LLC All Rights Reserved. Check out the new, free JUSTJUMBLE app SUDOKUAnswer to yesterdays sudokuDEAR ABBYLove is lost in good marriage as abuse increases with timeDEAR ABBY: I have been married 14 years and have two children. The first three years of marriage were great. We both cared for and respected each other. As our children grew older and our jobs have become more demanding, my husband has changed about how he views our sex life. After our third year of marriage, my husband started raping me. No one knows this except an ex-sister-in-law. At first, I didnt understand what was really happening. He was forceful and wouldnt take no for an answer. I went along with it at first, thinking I wasnt giving him enough attention and was doing the wifely duty.Ž But over the years it has become worse „ ripping my clothing off and holding me down. I have told him its not OK, but if I speak up, it leads to a fight. He says I dont show him I care for him and we dont have sex enough, so this is his way of getting it. Abby, I have lost respect for the man I married. I no longer want to be intimate with him, because he doesnt respect me or my body. The only reason I have stayed this long is for my children. Is there hope in him changing? „ SLEEPING ON THE COUCHDEAR SLEEPING ON THE COUCH: Ripping a spouses clothing off and holding her (or him) down is not foreplay; it is spousal rape and a form of domestic abuse. It is a crime in all 50 states. The level of hostility in your home isnt healthy for you or your children, who may grow up thinking it is normal. Because your husband may become violent if you tell him the marriage is over, contact RAINN „ (800) 656-4673; rainn.org „ and let them help you form a safe escape plan. It is not normal for a man to treat a woman the way your husband has. He is unlikely to change, and you need to look out for yourself and the children. Dear Abby is written by Abigail Van Buren, also known as Jeanne Phillips, and was founded by her mother, Pauline Phillips. Contact Dear Abby at www.DearAbby. com or P.O. Box 69440, Los Angeles, CA 90069. Jeanne PhillipsWORD SCRIMMAGE: JUDD HAMBRICK Wilson CaseyLevel of dif“ culty (Bronze easy, Silver medium, Gold -dif“ cult): Monday Bronze; Tuesday Silver; Wednesday Gold; Thursday Bronze; Friday Silver; Saturday and Sunday Gold.

PAGE 17

** The News Herald | Tuesday, March 20, 2018 B7 COMICS & PUZZLES PEANUTS ZITS FRANK & ERNEST WIZARD OF ID THE BORN LOSER BEETLE BAILEY DILBERT BLONDIE PEARLS BEFORE SWINE FOR BETTER OR FOR WORSE PICKLES HAGAR THE HORRIBLE GARFIELD CRANKSHAFT HERMAN PLUGGERS Daily CROSSWORD

PAGE 18

** B8 Tuesday, March 20, 2018 | The News Herald

PAGE 19

** The News Herald | Tuesday, March 20, 2018 C1 SPORTS NCAA WOMEN | C3FSU DOMINATEDBu alo upsets Florida State, shu es o to Sweet 16 MARCH MADNESS | C2MENS BRACKETComplete, updated bracket with eld down to 16 By Garry SmitsGatehouse MediaTALLAHASSEE „ With contributions coming from 10 players in two NCAA tour-nament victories for Florida State, it might be hard to single out one.Some effort, however, reveals the answer: sopho-more guard Trent Forrest.A native of Chipley with strong FSU bloodlines, Forrest was the glue for the Seminoles in their two West Region victories last week that have resulted in a berth in the regional semifinals on Thursday at the Staples Center in Los Angeles against Gonzaga.Ninth-seeded FSU (2211) will play No. 4 Gonzaga (32-4) following the other regional semifinal between Michigan and Texas A&M, which begins at 7:37 p.m. Its the Seminoles first appearance in the Sweet 16 since 2011 and their second since 1993. Forrest came off the bench in both games in Nashville but is second on the team in min-utes played in the tournament with 58.The nephew of former Flor-ida State football star Amp Lee and the cousin of two FSU tennis players, Terrance and Terrell Whitehurst, For-rest is averaging 12.0 points, 5.5 rebounds, 5.5 assists, 3.5 steals and 1.0 blocked shots per game and delivered clutch plays down the stretch in FSUs 67-54 victory over Missouri and the 75-70 upset victory over region top seed Xavier.His contributions have been sorely needed with a groin injury that has limited Terance Mann, the Seminoles leading scorer and rebounder entering the game, to only 40 minutes. And Forrest has filled Manns role as a versa-tile backcourt player who has made contributions to every category on the stat sheet.Forrest had 14 points, five rebounds, three assists and four steals against Xavier; and 10 points, six rebounds, eight assists, three steals and two blocked shots against Missouri. He also has had only three turnovers and has made 10 of 15 free throws.Chipleys Forrest the glue for FSU in Sweet 16 runFlorida States Trent Forrest goes up for a dunk against Missouri in their “ rst round game in the NCAA Tournament on Friday in Nashville, Tenn. [AP FILE PHOTOS] Florida States Trent Forrest defends as Louisvilles Dwayne Sutton drives during their second round game in the Atlantic Coast Conference tournament on March 7 in New York. The News HeraldLUBBOCK, Tex. „ The Gulf Coast womens basket-ball team begins its quest for a third straight national title today when it opens play in the NJCAA Division I Wom-ens National Championship against San Jacinto-North (25-10) at 6 p.m. CDT.The No. 2 seed Lady Com-modores (26-2) have won 11 straight games and are coming off of winning their third consecutive FCSAA Region VIII championship in Ocala. A victory today would the ninth in a row at the national tournament for Gulf Coast. The Lady Commo-dores have won 17 postseason games in a row counting the state tournament over the past three years.This years Gulf Coast squad is comparable on paper to the last two national title teams, outscoring opponents by 25.2 points per game on the season … better than last years point differential (23.3) and slightly below the season before (25.6).Shayla Bennett is leading the Lady Commodores at 21.3 points per game along GC opens national tourney todayGulf Coasts Shay Collins dribbles up the court in a game against Northwest Florida State earlier this season. [JOSHUA BOUCHER/THE NEWS HERALD] Leaders Gulf Coast and Chipola meet this a ernoonBy Pat McCannThe News HeraldPANAMA CITY „ Not even Mondays downpour could put a damper on this Gulf Coast vs. Chipola softball matchup in the Panhandle Conference.The nationally ranked teams, and lone remain-ing conference unbeatens, were scheduled to play Monday afternoon at Joe Tom King Field. The show-down, instead, was postponed to 4 p.m. today at the Lady Commodores new venue that opened earlier this month.The Lady Indians of Chi-pola come in nationally No. 1 ranked and 32-0, 4-0 in the PC. Gulf Coast is No. 4, and in addition to also being 4-0 has a longer win streak at 33 games, the Lady Commodores 33-1 overall.They kept their streak intact with an improbable doubleheader sweep of Northwest Florida State on Saturday in Niceville. The improbable part was linked to a six-run rally in the top of the seventh inning of the opener.The Lady Commodores trailed 7-2 after four innings, and were behind 7-4 entering the seventh. They still trailed 7-6 when down to their last out.Jamilah Johnson responded with a baseloaded triple to give Gulf Coast the lead, and Hayden Lindsay doubled her in to cap a six-run uprising and 10-7 win.The Lady Commodores carried over that momen-tum with six runs in the first inning of the second game and won 9-4.It was quite the game ƒ obviously they just didnt quit,Ž Gulf Coast coach Beth Wade said of the first-game comeback. Theyre down, but never out of it. They just keep fighting, fighting, fighting.In the second game they came out hot, had a couple hits, a double off the wall, then Alexa Shiver had a three-run homer. Hayden Lindsay also had a homer in the second game.ŽWhereas Amie Hutchison and Kaylee Raines had been doing a lot of the damage offensively this season, Wades summation alluded to another of the strengths she has pointed to this spring. Its seemingly a different player stepping forward every week, as underscored by a .379 team batting average and 1.90 ERA.K-Dub (third baseman Kristina Warford) had a big doubleheader (five hits, three runs batted in) and has only made a couple errors on the year,Ž Wade said.Rain delays PC softball showdownSee FSU, C3 See SOFTBALL, C3 See TOURNEY, C3

PAGE 20

** C2 Tuesday, March 20, 2018 | The News Herald March 31San Antonio First RoundSOUTHAtlantaEASTBostonWESTLos AngelesMIDWESTOmaha, Neb.Pittsburgh Detroit San Diego Wichita, Kan. Detroit Dallas San Diego PittsburghMarch 15-16First RoundMarch 15-16Second RoundMarch 17-18Second RoundMarch 17-18Sweet 16March 22-23Sweet 16March 22-23Elite 8March 24-25Elite 8March 24-25 April 2 First FourMarch 13-14 Dayton, OhioCharlotte Boise, Ida. Dallas Nashville, Tenn. Nashville, Tenn. Boise, Ida. Wichita, Kan. Charlotte NATIONAL CHAMPIONSHIP AP 16 9 13 11 14 8 4 12 5 6 3 10 7 15 2 1 16 9 13 11 14 8 4 12 5 6 3 10 7 15 2 1 13 11 14 9 8 4 12 5 6 3 10 7 15 2 1 LIU-Brooklyn 61 Radford 71 Arizona St. 56 Syracuse 60 St. Bonaventure 65 UCLA 58 N.C. Central 46 Texas Southern 64 16 161111 11 16 16 11 16 1 16 9 13 11 14 8 4 12 5 6 3 10 7 15 22018NCAA MENS TOURNAMENTFriday Friday Friday Friday Thursday Saturday Saturday Sunday Sunday Thursday Thursday ThursdayFINAL FOUR Villanova 87 UMBC 74 Creighton 59 Kansas State 69 Kentucky 78 Arizona 68 Buffalo 89 Miami 62 Loyola-Chi. 64 Tennessee 73 Wright State 47 Nevada 87 Texas 83 Cincinnati 68 Georgia State 53 Virginia 54 Radford 61 Virginia Tech 83 Alabama 86 West Virginia 85 Murray State 68 Wichita State 75 Marshall 81 Florida 77 St. Bonaventure 62 Texas Tech 70 SFA 60 Arkansas 62 Butler 79 Purdue 74 Cal St. Fullerton 48 Xavier 102 Missouri 54 Florida State 67 Ohio State 81 South Dakota St. 73 Gonzaga 68 UNC-Green 64 Houston 67 San Diego State 65 Michigan 61 Montana 47 Texas A&M 73 Providence 69 UNC 84 Lipscomb 66 Kansas 76 Penn 60 Seton Hall 94 NC State 83 Clemson 79 New Mexico St. 68 Auburn 62 Charleston 58 TCU 52 Syracuse 57 Michigan State 82 Bucknell 78 Rhode Island 83 Oklahoma 78 Duke 89 Iona 67 Davidson 73 Texas Southern 83 16 UMBC 43 9 Kan. St. 50 9 Kansas St. 5 Kentucky 95 5 Kentucky 13 Buffalo 75 11 Loyola-Chi. 63 11 Loyola-Chi. 3 Tenn. 62 7 Nevada 75 7 Nevada 2 Cincinnati 73 1 Xavier 70 9 Florida St. 75 9 Florida St. 5 Ohio State 84 4 Gonzaga 90 4 Gonzaga 6 Houston 63 3 Michigan 64 3 Michigan 7 Texas A&M 86 7 Texas A&M 7 Texas A&M 2 UNC 651 Villanova 811 Villanova 9 Alabama 58 5 W.Virginia 94 5 W. Virginia 13 Marshall 71 6 Florida 663 Tex. Tech 693 Texas Tech 10 Butler 73 2 Purdue 76 2 Purdue 1 Kansas 83 1 Kansas8 Seton Hall 795 Clemson 84 5 Clemson 4 Auburn 54 11 Syracuse 55 11 Syracuse 3 Mich. St. 53 7 Rhode Island 622 Duke 87 2 Duke

PAGE 21

** The News Herald | Tuesday, March 20, 2018 C3 The Associated PressTALLAHASSEE „ Cierra Dillard scored 22 points and 11th-seeded Buffalo shocked No. 3 seed Florida State 86-65 on Monday night to advance to the Sweet 16 of the womens NCAA Tournament for the first time in school history.The Bulls, who were one of the last four to earn an at-large berth in the 64-team field, shot 47.4 percent from the field and went 24 of 26 from the foul line. They also held the Seminoles to 3 of 25 on 3-pointers and 33.8 percent from the field.Buffalo (29-5) wont have far to go for the regional semifinal as it will face defending cham-pion and second-seeded South Carolina on Saturday in Albany, New York.It is the first time in eight games that Florida State (26-7) has dropped an NCAA Tourna-ment contest when it has been the host.Buffalo seized control late in the first half. The game was tied at 28 with 2:05 remaining when the Bulls closed the half with a 10-2 run, including eight straight points by Dillard, to take a 39-30 lead at halftime.The Bulls would extend the lead to 14 with a 7-2 run to start the third quarter. They would lead by as many as 14 early in the fourth quarter.Stephanie Reid scored 18 points and Summer Hemphill added 17 for Buffalo, which is unbeaten this season in the 25 games it has led at halftime.Shakayla Thomas led Florida State with 25 points in her final game and Nausia Woolfolk added 12. Big pictureBuffalo: Two days after getting its first NCAA Tourna-ment win over South Florida, the Bulls are the first MAC team since Bowling Green in 2007 to advance to the Sweet 16. They were joined moments later by MAC rival Central Michigan which knocked off Ohio State also as an 11-seed.Florida State: The Seminoles were hoping to make their fourth straight Sweet 16 per-formance but were unable to control the pace of the game. Imani Wright, who came into the game with 103 3-pointers this season, was 0 of 10 from beyond the arc.Bu alo in Womens Sweet 16 after FSU upsetFlorida States Imani Wright attempts a shot over the defense of Buffalos Summer Hemphill, center, and Stephanie Reid in their second round game Monday in Tallahassee. [STEVE CANNON/AP] with four rebounds and three assists per game while shoot-ing 42.5 percent from the field, 39.6 percent from the 3-point line, and 77.1 per-cent from the free throw line. Jhileiya Dunlap is also putting in 13.5 points, 8.1 rebounds, and 3.1 blocks per contest while shooting 53 percent from the field. With a win, Gulf Coast will play again Thursday in the quarterfinals, with the semifinals to follow on Friday and the championship game on Saturday.Panhandle Conference squads Northwest Florida State and Tallahassee will also be in action today, with the No. 14 seed Lady Raiders (22-6) to take on No. 19 seed Panola (Tex.) (25-6) at 10 a.m., and the No. 11 seed Lady Eagles (24-6) to play No. 22 seed Western Nebraska (29-4) at noon. If Northwest Florida State wins, it would advance to Wednesdays second round to take on Moberly Area (Mo.), while Tallahassee with a win would take on Wabash Valley (Ill.) on Wednesday at 7 p.m. TOURNEYFrom Page C1Kristina (Manthei) came in and shut them down, and Alex Watson pitched really well. She shut them down in the seventh inning of Game 1 and threw three good innings in Game 2.ŽWhich brings Gulf Coast to top-ranked Chipola, whose statistical dominance this season brings to mind UConn in womens basketball, or perhaps closer to home, the Gulf Coast program reined by Roonie Scovel.The Lady Indians swept Pensacola 8-0, 9-0 on Satur-day and yielded only one hit in 11 innings. Both games were halted by the run rule, the opener after five innings and the nightcap after six.The shutouts were the 17th and 18th on the season as Chi-pola lowered its team ERA to 0.46. Both Krystal Goodman and Morgan Goree are 13-0 in the circle, Goodman with 122 strikeouts in 88 innings. Goree averages one per inning.The Lady Indians also run at will with 198 stolen bases thus far. Thats an average of six per game, and 80 more than speedy Gulf Coast in two fewer games.Chipola hits .364 as a team with much more weighty power numbers than Gulf Coast. Most impressive, how-ever, are the shutouts and the fact Chipola had six in succes-sion at one stage and currently has three straight. No team has scored more than three runs on the Lady Indians all season, and opponents have reached that total just three times.Obviously there could be a danger of both teams wanting to go all-in with the largest share of the conference sched-ule yet to play.I keep telling them that there are 20 conference games and none counts more than the others,Ž Wade said. You cant put too much importance on one game.Its hard to tell that to an 18-year-old kid, but you try to get them to look at the big picture. Itll probably be the team that controls their emo-tions the best; handles pressure the best. It (doubleheader) is important, yes, but its not the be-all, end-all.Ž SOFTBALLFrom Page C1Forrest doesnt make most of his hay from the outside. Hes adept at slashing to the basket and drawing fouls and leaves the 3-point shooting to other players, attempting only 13 this season.Forrest said it begins with defense. Hamilton has praised Forrest for being among the most savvy defen-sive players among his deep group of guards and he played a key role in limiting Xaviers Trevon Blueitt, who had 29 points in last years 91-66 NCAA tournament rout of FSU, to only eight points on 2 of 8 shooting.We just kind of credited the defense, really, being able to get stops and being able to get out,Ž he said. I feel like that just transitioned right into our offense being able to get stops.ŽHamilton said Forrests main contribution goes beyond statistics.Theres no question that Trent does a very good job of distributing the ball and making good decisions,Ž he said. Trent does a great job defensively, does a great job seeing the whole floor. He makes a tremendous differ-ence when hes on the floor.ŽForrest made some of his biggest plays at the most important times last week.After Missouri cut a 22-point halftime deficit to 50-44 with 9:53 left in the game, Forrest assisted on P.J. Savoys 3-point shot. A few minutes later, he grabbed a defensive rebound, raced down the court and grabbed an offensive rebound off a miss by Mfiondu Kabengele, and was fouled, making both shots to give FSU a 65-44 lead.Xavier held a 66-57 lead with 5:37 left but the Seminoles went on an 18-4 run to close the game. During one sequence, Forrest made a layup with 5:04 left to cut the lead to 66-61, then made a steal and went coast-tocoast for another layup. He was fouled and completed the 3-point play to make it 66-64 with 4:21 left.Then, with 1:12 remaining, Forrest made the assist on another 3-point by Savoy that put FSU ahead for good, 71-70.Forrest began getting more playing time in February and made key contributions in one of the most significant regular-season victories for FSU, 80-76 at Louisville. He had 10 points, nine rebounds and five assists.Forrest continued his knack for producing in FSUs biggest games as he had 16 points and four assists in an 81-79 over-time victory over Clemson. He scored six points in over-time, including the basket that put the Noles ahead for good, and then scored twice to put FSU ahead by three in the closing minute.He had 16 points, nine rebounds and seven assists in a loss to N.C. State, then scored a career-high 21 points, with 10 rebounds and five assists in a must-win situation against Boston Col-lege to close out the regular season.In his last 11 games, Forrest is averaging 10.1 points, 5.4 rebounds, 4.5 assists, 1.9 steals, only 1.7 turnovers and is shooting .545 from the floor. FSUFrom Page C1 Gulf Coasts Alexus Dye makes a layup during a game against Chipola earlier this season. [JOSHUA BOUCHER/THE NEWS HERALD] The Associated PressDUKE 66, GEORGIA 40: Leaonna Odom scored 16 points and “ fth seed Dukes defense was dominant, holding fourth seed Georgia to two second-quarter points in a womens NCAA Tournament second-round win. Lexie Brown and Erin Mathias each had 14 points for Duke (24-8), which will play UConn in the Albany Regional on Saturday. Georgia (26-7) made only 1 of 19 shots in the second period. The Lady Bulldogs set season lows for fewest points in a period and game and lowest “ eld-goal percentage (24.0) in a game. The Lady Bulldogs missed their “ rst 13 3-pointers before Simone Costa sank a 3 midway through the “ nal period. UCONN 71 QUINNIPIAC 46: Napheesa Collier scored 23 points and top-seeded UConn beat in-state neighbor Quinnipiac to advance to a 25th straight Sweet 16. Azura Stevens added 14 points and Kia Nurse chipped in with 13 for the Huskies (34-0), who found themselves in a much slower-paced game than their 140-52 “ rst-round rout of Saint Francis (Pa.). But Connecticut was not threatened in this one either. They opened with a 9-2 run and never trailed. Jen Fay had 12 points to lead the ninth-seeded Bobcats (28-6), who saw their school-record 23-game winning streak snapped. CENTRAL MICHIGAN 95, OHIO STATE 78: Presley Hudson scored 28 points and No. 11 seed Central Michigan stunned No. 3 Ohio State to earn the schools “ rst ever trip to the Sweet 16. Cassie Breen threw the ball high in the air as the clock wound down and the joyous Central Michigan players jumped, screamed and hugged as they celebrated the biggest win in school history. The Chippewas had won their “ rst tournament game ever in Saturdays “ rst-round upset of No. 6 Louisiana State. With the upset of Ohio State, they advance to face No. 2 Oregon in Spokane, Washington, on Saturday. Central Michigan (30-4) out-rebounded and out-hustled Ohio State, played taut defense, hit a seasonhigh 14 3-pointers and kept the Buckeyes at bay late in the game. MISSISSIPPI STATE 71, OKLAHOMA STATE 56: Victoria Vivians scored 23 points, Teaira McCowan added 21 points and 18 rebounds and Mississippi State earned a hard-fought win over Oklahoma State in the second round of the womens NCAA Tournament. Top-seeded Mississippi State (34-1) also got 17 points from Morgan William, who hit several crucial baskets throughout the game. McCowan scored 17 of her 21 points in the second half and shot 8 of 12 from the “ eld. Oklahoma State (21-11) was hurt when starting guard Loryn Goodwin picked up her fourth foul with 4:39 remaining in the third quarter. She stayed in the game, but her defensive presence was limited and that was around the time that Mississippi State went on a 10-2 lead to open up a 51-43 advantage. William made a jumper a few seconds before the third-quarter buzzer to give the Bulldogs their biggest lead in the game at 55-45 and they slowly pulled away. STANFORD 90, FLORIDA GULF COAST 70: Alanna Smith scored 28 points with four 3-pointers, Brittany McPhee added 17 points and nine rebounds and No. 4 seed Stanford is headed back to the Lexington Regional for a third straight March after beating scrappy 12th-seeded Florida Gulf Coast. Freshman Kiana Williams shined on the big stage for the second time in three days with 12 points and six assists for the Cardinal (2410), on to the Sweet 16 for the 11th straight season. Florida Gulf Coast (31-5) set the single-season 3-point record with 431, breaking Sacramento States mark of 424 from 201415, but didnt have the depth or talent to keep up against a taller Stanford team that made it hard for the Eagles to do their signature move: drive and dish. Stanford will take on No. 1 Louisville „ the “ rst matchup between the power programs „ on Friday in the regional semi“ nals. Playing previously in Lexington, the Cardinal lost to Washington in the 2016 Elite Eight then advanced to the Final Four from that regional last season.WOMENS NCAA ROUNDUP

PAGE 22

** C4 Tuesday, March 20, 2018 | The News Herald EBRO SCHEDULEMondayMatinee: Thoroughbred simulcast: Parx 11:55 a.m. Greyhound simulcast: Sarasota 11:30 a.m., Derby Lane 11:30 a.m., Palm Beach noon. Evening: Greyhound simulcast: Jacksonville 6:45 p.m.TuesdayMatinee: Thoroughbred simulcast: Parx 11:55 a.m. Greyhound simulcast: Sarasota 11:30 a.m.WednesdayMatinee: Thoroughbred simulcast: Tampa Bay 11:25 a.m., Gulfstream 11:35 a.m. Greyhound simulcast: Derby Lane 11:30 a.m., Sarasota 11:30, Jacksonville 11:35 a.m., Palm Beach noon. Evening: Dania Jai Alai 5:30 p.m. Greyhound simulcast: Derby Lane 6:30 p.m., Jacksonville 6:45 p.m.ThursdayMatinee: Thoroughbred simulcast: Gulfstream 11:35 a.m, Santa Anita 3 p.m. Greyhound simulcast: Derby Lane 11:30 a.m., Sarasota 11:30 a.m., Palm Beach noon. Evening: Dania Jai Alai 6 p.m. Greyhound simulcast: Jacksonville 6:35 p.m.FridayMatinee: Thoroughbred simulcast: Aqueduct 12:20 p.m., Tampa Bay 11:25 a.m., Gulfstream 11:35 a.m., Santa Anita 3 p.m. Greyhound simulcast: Sarasota 11:30 a.m., Derby Lane 11:30 p.m., Palm Beach noon. Evening: Dania Jai Alai 6 p.m. Greyhound simulcast: Palm Beach 6 p.m., Sarasota 6:30 p.m., Derby Lane 6:30 p.m., Jacksonville 6:35 p.m.SaturdayMatinee: Thoroughbred simulcast:Aqueduct 12:20 p.m., Tampa Bay 11:25 a.m., Gulfstream 11 a.m., Santa Anita 2:30 p.m. Greyhound simulcast: Derby Lane 11:30 a.m., Sarasota 11:30 a.m., Jacksonville 11:35 a.m., Palm Beach noon. Evening: Dania Jai Alai 6 p.m. Greyhound simulcast: Palm Beach 6 p.m., Derby Lane 6:30 p.m., Sarasota 6:30 p.m., Jacksonville 6:45 p.m.SundayMatinee: Thoroughbred simulcast: Gulfstream 11 a.m., Tampa Bay 11:25 a.m., Aqueduct 12:20 p.m., Santa Anita 2:30 p.m. Greyhound simulcast: Palm Beach noon, Jacksonville 12:30 p.m. POKER ROOM … (Ext. 180) Open 9 a.m. to 3 a.m. Monday through Friday and 24 hours on weekends and holidays. LOCATION … Intersection of State 79 and State 20. INFORMATION … 234-3943. ODDS PREGAME.COM LINENATIONAL BASKETBALL ASSOCIATIONTodayFAVORITE LINE O/U UNDERDOG Toronto 10 214 at Orlando At New Orleans Off Off Dallas at Minnesota 3 227 LA Clippers at Boston Off Off Okla. City at Utah 13 209 Atlanta at Phoenix Off Off Detroit Houston 4 214 at PortlandCOLLEGE BASKETBALLTodayFAVORITE LINE UNDERDOG at Marquette Pk Penn State at LOUISVILLE 5 Mississippi StateWednesdayat Austin Peay 4 Ill.-Chicago at San Diego 2 N. ColoradoThursdayKentucky 6 Kansas State Nevada 2 Loyola of Chicago Michigan 3 Texas A&M Gonzaga 5 Florida StateFridayVillanova 5 West Virginia Purdue 1 Texas Tech Duke 11 Syracuse Kansas 4 ClemsonNATIONAL HOCKEY LEAGUE TodayFAVORITE LINE UNDERDOG LINE at Washington -145 Dallas +135 at NY Rangers Off Columbus Off at Carolina -148 Edmonton +138 at NY Islanders Off Pittsburgh Off Philadelphia -139 at Detroit +129 at Tampa Bay Off Toronto Off Florida -130 at Ottawa +120 at Winnipeg Off Los Angeles Off at Chicago -105 Colorado -105 at Vegas Off Vancouver Off at San Jose Off New Jersey Off Updated odds available at Pregame.com PRO BASKETBALL NBAAll times CentralEASTERN CONFERENCEAtlantic Division W L PCT. GBx-Toronto 52 18 .743 „ x-Boston 47 23 .671 5 Philadelphia 39 30 .565 12 New York 26 45 .366 26 Brooklyn 23 48 .324 29Southeast Division W L Pct GBWashington 40 30 .571 „ Miami 38 33 .535 2 Charlotte 30 41 .423 10 Orlando 21 49 .300 19 Atlanta 20 50 .286 20Central Division W L Pct GBCleveland 41 29 .586 „ Indiana 41 30 .577 Milwaukee 37 33 .529 4 Detroit 30 39 .435 10 Chicago 24 46 .343 17 WESTERN CONFERENCESouthwest Division W L Pct GBy-Houston 56 14 .800 „ San Antonio 40 30 .571 16 New Orleans 40 30 .571 16 Dallas 22 48 .314 34 Memphis 19 51 .271 37Northwest Division W L Pct GBPortland 44 26 .629 „ Oklahoma City 43 29 .597 2 Utah 40 30 .571 4 Minnesota 40 31 .563 4 Denver 38 33 .535 6Paci“ c Division W L Pct GBy-Golden State 53 17 .757 „ L.A. Clippers 37 32 .536 15 L.A. Lakers 31 39 .443 22 Sacramento 23 48 .324 30 Phoenix 19 52 .268 34 x-clinched playoff berth; y-won divisionSaturdays GamesMilwaukee 122, Atlanta 117 Houston 107, New Orleans 101 Washington 109, Indiana 102 Brooklyn 114, Dallas 106 New York 124, Charlotte 101 Cleveland 114, Chicago 109 Memphis 101, Denver 94 San Antonio 117, Minnesota 101 Utah 103, Sacramento 97 Golden State 124, Phoenix 109 Portland 100, Detroit 87Sundays GamesOklahoma City 132, Toronto 125 New Orleans 108, Boston 89 Houston 129, Minnesota 120 Portland 122, L.A. Clippers 109Mondays GamesCleveland 124, Milwaukee 117 Indiana 110, L.A. Lakers 100 Philadelphia 108, Charlotte 94 New York 110, Chicago 92 Brooklyn 118, Memphis 115 Miami 149, Denver 141, 3OT Golden State at San Antonio, late Detroit at Sacramento, lateTodays GamesToronto at Orlando, 6 p.m. Dallas at New Orleans, 7 p.m. L.A. Clippers at Minnesota, 7 p.m. Oklahoma City at Boston, 7 p.m. Atlanta at Utah, 8 p.m. Detroit at Phoenix, 9 p.m. Houston at Portland, 9:30 p.m. COLLEGE BASKETBALL MENS BASKETBALL NCAA TOURNAMENTAll times Central EAST REGIONAL Regional Semi“ nals March 23Villanova (32-4) vs. West Virginia (26-10), 6:27 p.m. Purdue (30-6) vs. Texas Tech (26-9), 8:57 p.m.Regional Championship March 25Semi“ nal winnersSOUTH REGIONAL Regional Semi“ nals ThursdayNevada (29-7) vs. Loyola of Chicago (30-5), 6:07 p.m. Kansas State (24-11) vs. Kentucky (26-10), 8:37 p.m.Regional Championship March 24Semi“ nal winnersMIDWEST REGIONAL Regional Semi“ nals FridayKansas (29-7) vs. Clemson (25-9), 6:07 p.m. Duke (28-7) vs. Syracuse (23-13), 8:37 p.m.Regional Championship March 25Semi“ nal winnersWEST REGIONAL Regional Semi“ nals ThursdayTexas A&M (22-12) vs. Michigan (30-7), 6:37 p.m. Florida State (22-11) vs. Gonzaga (32-4), 9:07 p.m.Regional Championship March 24Semi“ nal winnersFINAL FOUR At The Alamodome, San Antonio National Semi“ nals March 31South champion vs. West champion East champion vs. Midwest championNational Championship April 2Semi“ nal winners NCAA DIV. II TOURNAMENTAt Sioux Falls, S.D. Quarter“ nals TodayWest Texas A&M (31-3) vs. Le Moyne (27-6), 1 p.m. Ferris State (35-1) vs. Barry (23-8), 4:30 p.m. Queens (NC) (31-3) vs. California Baptist (28-5), 7 p.m. Northern State (34-3) vs. East Stroudsburg (27-5), 9:30 p.m. NCAA WOMENS TOURNAMENT All times Central ALBANY REGIONAL First Round March 16 At Columbia, S.C. Virginia 68, California 62 South Carolina 63, N.C. A&T 52 Saturday At Storrs, Conn. UConn 140, Saint Francis (Pa.) 52 Quinnipiac 86, Miami 72 At Athens, Ga. Duke 72, Belmont 58 Georgia 68, Mercer 63 At Tallahassee, Fla. Florida State 91, Little Rock 49 Buffalo 102, South Florida 79Second Round Sunday At Columbia, S.C.South Carolina 66, Virginia 56Monday At Storrs, Conn.UConn 71, Quinnipiac 46At Athens, Ga.Duke 66, Georgia 40At Tallahassee, Fla.Buffalo 86, Florida State 65Regional Semi“ nals March 24 At Albany, N.Y.South Carolina (28-6) vs. Buffalo (29-5), 11:30 a.m. or 1 p.m. UConn (34-0) vs. Duke (24-8), 11:30 a.m. or 1 p.m.Regional Championship March 26Semi“ nal winners, 6 p.m. SPOKANE REGIONAL First Round March 16 At Notre Dame, Ind. Notre Dame 99, Cal State Northridge 81 Villanova 81, South Dakota State 74, OT At College Station, Texas DePaul 90, Oklahoma 79 Texas A&M 89, Drake 76 At Eugene, Ore. Minnesota 89, Green Bay 77 Oregon 88, Seattle 45 Saturday At Columbus, Ohio Central Michigan 78, LSU 69 Ohio State 87, George Washington 45Second Round Sunday At Notre Dame, Ind.Notre Dame 98, Villanova 72At College Station, TexasTexas A&M 80, DePaul 79At Eugene, Ore.Oregon 101, Minnesota 73Monday At Columbus, OhioCentral Michigan 95, Ohio State 78Regional Semi“ nals March 24 At Spokane, Wash.Notre Dame (31-3) vs. Texas A&M (26-9), 4 or 5:30 p.m. Oregon (32-4) vs. Central Michigan (30-4), 4 or 5:30 p.m.Regional Championship March 26Semi“ nal winners, 8 p.m. KANSAS CITY REGIONAL First Round March 16 At Raleigh, N.C. Maryland 77, Princeton 57 NC State 62, Elon 34 Saturday At Starkville, Miss. Oklahoma State 84, Syracuse 57 Mississippi State 95, Nicholls 50 At Los Angeles UCLA 71, American 60 Creighton 76, Iowa 70 At Austin, Texas Arizona State 73, Nebraska 62 Texas 83, Maine 54Second Round Sunday At Raleigh, N.C.North Carolina State 74, Maryland 60Monday At Starkville, Miss.Mississippi State 71, Oklahoma State 56At Los AngelesUCLA 86, Creighton 64At Austin, TexasTexas 85, Arizona State 65Regional Semi“ nals Friday At Kansas City, Mo.N.C. State (26-8) vs. Mississippi State (34-1), 6 or 8:30 p.m. UCLA (26-7) vs. Texas (28-6), 7 or 9:30 p.m.Regional Championship March 25Semi“ nal winners, 6:30 p.m. LEXINGTON REGIONAL First Round March 16 At Louisville, Ky. Louisville 74, Boise State 42 Marquette 84, Dayton 65 At Knoxville, Tenn. Oregon State 82, Western Kentucky 58 Tennessee 100, Liberty 60 At Waco, Texas Michigan 75, Northern Colorado 61 Baylor 96, Grambling State 46 Saturday At Stanford, Calif. Florida Gulf Coast 80, Missouri 70 Stanford 82, Gonzaga 68Second Round Sunday At Louisville, Ky.Louisville 90, Marquette 72At Knoxville, Tenn.Oregon State 66, Tennessee 59At Waco, TexasBaylor 80, Michigan 58Monday At Stanford, Calif.Stanford 90, Florida Gulf Coast 70Regional Semi“ nals Friday At Lexington, Ky.Oregon State (25-7) vs. Baylor (33-1), 6 or 8:30 p.m. Louisville (34-2) vs. Stanford (24-10), 6 or 8:30 p.m.Regional Championship March 25Semi“ nal winners, 11 a.m.WOMENS NATIONAL INVITATION TOURNAMENT Second Round March 17TCU 86, Missouri State 51 James Madison 62, Radford 35Sunday, March 18Indiana 74, Milwaukee 54 Purdue 77, Ball State 72 Virginia Tech 78, George Mason 69 South Dakota 74, Colorado State 49 Georgia Tech 91, UAB 47 West Virginia 79, Saint Josephs 51 Alabama 80, UCF 61 UC Davis 74, Wyoming 64 Fordham 63, Drexel 60 Kansas State 74, Utah 57MondayMichigan State 68, Toledo 66 Duquesne 69, Georgetown 66 St. Johns 53, Penn 48TodayRice (23-9) at New Mexico (24-10), 8 p.m.WOMENS BASKETBALL INVITATIONALFirst Round March 14Binghamton 70, Youngstown State 59 Fresno State 77, CSU Bakers“ eld 66March 15Furman 65, UNC Asheville 64 Yale 68, Northeastern 58 South Alabama 49, Stetson 33 Weber State 66, Texas Southern 56 Central Arkansas 51, SIU-Edwardsville 39 Nevada 70, UC Irvine 60Quarter“ nals MondaySouth Alabama 54, Furman 53 Central Arkansas 82, Weber State 67 Nevada (18-16) at Fresno State (17-14), lateTodayYale (16-13) at Binghamton (20-11), 6 p.m. PRO HOCKEY NHLEASTERN CONFERENCEAtlantic Division GP W L OT PTS GF GA Tampa Bay 72 49 19 4 102 260 202 Boston 71 45 17 9 99 239 184 Toronto 72 43 22 7 93 243 204 Florida 70 36 27 7 79 212 216 Montreal 73 26 35 12 64 182 232 Ottawa 71 26 34 11 63 197 244 Detroit 72 26 35 11 63 184 224 Buffalo 72 23 37 12 58 172 236Metropolitan Division GP W L OT PTS GF GA Washington 72 41 24 7 89 225 214 Pittsburgh 72 41 26 5 87 237 218 Columbus 73 40 28 5 85 205 203 Philadelphia 73 37 25 11 85 218 215 New Jersey 72 37 27 8 82 217 215 Carolina 72 31 30 11 73 194 225 N.Y. Rangers 72 32 32 8 72 208 231 N.Y. Islanders 72 30 32 10 70 231 262WESTERN CONFERENCE Central Division GP W L OT PTS GF GA Nashville 72 48 14 10 106 236 178 Winnipeg 72 43 19 10 96 240 189 Minnesota 73 41 24 8 90 227 210 Colorado 72 39 25 8 86 231 209 Dallas 73 38 27 8 84 209 197 St. Louis 72 39 28 5 83 201 193 Chicago 73 30 34 9 69 208 223Paci“ c Division GP W L OT PTS GF GA Vegas 72 46 21 5 97 244 199 San Jose 72 40 23 9 89 219 199 Los Angeles 73 40 27 6 86 211 184 Anaheim 73 37 24 12 86 206 197 Calgary 73 35 28 10 80 202 217 Edmonton 72 31 36 5 67 201 231 Vancouver 72 25 38 9 59 186 236 Arizona 71 23 37 11 57 170 228 2 points for a win, 1 for OT loss. Top three teams in each division and two wild cards per conference advance to playoffsSaturdays GamesBuffalo 5, Chicago 3 Edmonton 4, Florida 2 New Jersey 3, Los Angeles 0 Toronto 4, Montreal 0 Philadelphia 4, Carolina 2 Columbus 2, Ottawa 1 Boston 3, Tampa Bay 0 St. Louis 4, N.Y. Rangers 3, OT Minnesota 3, Arizona 1 San Jose 5, Vancouver 3Sundays GamesColorado 5, Detroit 1 Vegas 4, Calgary 0 Tampa Bay 3, Edmonton 1 Carolina 4, N.Y. Islanders 3 Philadelphia 6, Washington 3 Winnipeg 4, Dallas 2 St. Louis 5, Chicago 4, OT Anaheim 4, New Jersey 2Mondays GamesColumbus 5, Boston 4, OT Nashville 4, Buffalo 0 Florida 2, Montreal 0 Los Angeles 4, Minnesota 3, OT Calgary at Arizona, lateTodays GamesColumbus at N.Y. Rangers, 6 p.m. Dallas at Washington, 6 p.m. Pittsburgh at N.Y. Islanders, 6 p.m. Edmonton at Carolina, 6 p.m. Florida at Ottawa, 6:30 p.m. Philadelphia at Detroit, 6:30 p.m. Toronto at Tampa Bay, 6:30 p.m. Los Angeles at Winnipeg, 7 p.m. Colorado at Chicago, 7:30 p.m. Vancouver at Vegas, 9 p.m. New Jersey at San Jose, 9:30 p.m. PRO BASEBALL SPRING TRAININGAll times EasternAMERICAN LEAGUE W L Pct. Houston 16 7 .696 Boston 15 8 .652 Cleveland 16 10 .615 Baltimore 14 10 .583 Oakland 12 9 .571 Kansas City 13 10 .565 New York 13 10 .565 Chicago 12 11 .522 Toronto 12 12 .500 Minnesota 11 12 .478 Tampa Bay 11 12 .478 Seattle 11 13 .458 Los Angeles 11 15 .423 Detroit 8 13 .381 Texas 7 15 .318NATIONAL LEAGUE W L Pct. Milwaukee 16 7 .696 Miami 13 8 .619 Chicago 14 10 .583 San Diego 11 9 .550 St. Louis 12 10 .545 Arizona 12 11 .522 Atlanta 12 13 .480 San Francisco 11 13 .458 Los Angeles 11 13 .458 Washington 10 12 .455 Colorado 9 14 .391 Pittsburgh 9 14 .391 Philadelphia 9 15 .375 Cincinnati 9 15 .375 New York 7 16 .304(ss)-split squad games count in the standings, ties and games against non-MLB teams do not countSaturdays GamesPhiladelphia 10, Atlanta (ss) 6 Houston 6, Miami 6 Pittsburgh 13, Minnesota 5 N.Y. Mets 9, Washington 7 Detroit 9, N.Y. Yankees 3 Boston 4, Tampa Bay 3 Toronto (ss) 5, Baltimore 2 St. Louis 3, Atlanta (ss) 0 Toronto (ss) 11, Canada Jr. 3 Kansas City 7, Texas (ss) 6 Cleveland (ss) 5, Chicago Cubs 1 Milwaukee 4, Colorado 3 Chicago White Sox 5, L.A. Dodgers 2 Cincinnati 5, San Francisco (ss) 4 Seattle (ss) 4, Oakland 1 San Diego 3, Arizona 3 Seattle (ss) 7, L.A. Angels 0 Chicago Cubs 11, Cleveland (ss) 4 Oakland (ss) 8, San Francisco 3 Kansas City (ss) 5, Texas 5Sundays GamesAtlanta 6, Houston 3 Boston 2, Pittsburgh (ss) 1 Tampa Bay 10, Detroit 5 N.Y. Yankees 8, Miami 5 N.Y. Mets 5, Baltimore 4 Minnesota 4, Philadelphia 3 St. Louis 10, Washington 0 Toronto 5, Pittsburgh (ss) 2 Cleveland (ss) 11, Chicago Cubs (ss) 4 Cincinnati 6, Arizona 3 Oakland 14, Chicago White Sox 0 L.A. Angels 4, Texas 2 Milwaukee 7, L.A. Dodgers (ss) 3 Kansas City 11, Chicago Cubs (ss) 9 San Diego 2, L.A. Dodgers (ss) 1 San Francisco 13, Colorado 0 Cleveland (ss) 16, Seattle 3Mondays GamesBaltimore 4, Detroit 2 Pittsburgh 11, Minnesota 8 Houston 2, N.Y. Mets 0 Boston 6, Philadelphia 5 Atlanta 6, Toronto 0 Miami 9, Washington 1 Cleveland 5, San Francisco 4 Chicago White Sox 15, Arizona 2 Tampa Bay 4, N.Y. Yankees 2 Chicago Cubs vs. Cincinnati at Goodyear, Ariz., late Colorado vs. Texas at Surprise, Ariz., late Seattle vs. L.A. Angels at Tempe, Ariz., late Oakland vs. L.A. Dodgers at Glendale, Ariz., lateTodays GamesMiami vs. Washington at West Palm Beach, Fla., 1:05 p.m. N.Y. Mets vs. St. Louis at Jupiter, Fla., 12:05 p.m. N.Y. Yankees vs. Detroit at Lakeland, Fla., 12:05 p.m. Pittsburgh vs. Boston at Fort Myers, Fla., 12:05 p.m. Toronto vs. Philadelphia at Clearwater, Fla., 12:05 p.m. L.A. Dodgers vs. Oakland at Mesa, Ariz., 3:05 p.m. Texas vs. Chicago White Sox at Glendale, Ariz., 3:05 p.m. Arizona vs. L.A. Angels at Tempe, Ariz., 3:10 p.m. Milwaukee vs. Colorado at Scottsdale, Ariz., 2:10 p.m. Tampa Bay vs. Baltimore at Sarasota, Fla.,5:05 p.m. San Francisco vs. Kansas City at Surprise, Ariz., 8:05 p.m. Cincinnati vs. San Diego at Peoria, Ariz., 8:40 p.m.Wednesdays GamesBoston vs. Tampa Bay at Port Charlotte, Fla., 12:05 p.m. Houston vs. Washington at West Palm Beach, Fla., 12:05 p.m. St. Louis vs. Miami at Jupiter, Fla., 12:05 p.m. Philadelphia vs. Toronto at Dunedin, Fla., 12:07 p.m. Chicago Cubs vs. Texas at Surprise, Ariz., 3:05 p.m. Oakland vs. Milwaukee (ss) at Phoenix, 3:05 p.m. San Diego vs. Chicago White Sox at Glendale, Ariz., 3:05 p.m. Detroit vs. Atlanta at Kissimmee, Fla., 5:05 p.m. Pittsburgh vs. Minnesota at Fort Myers, Fla., 5:05 p.m. Baltimore vs. N.Y. Yankees at Tampa, Fla., 5:35 p.m. Kansas City vs. Cleveland at Goodyear, Ariz., 8:05 p.m. San Francisco vs. Arizona at Scottsdale, Ariz., 8:40 p.m. Milwaukee (ss) vs. Seattle at Peoria, Ariz., 8:40 p.m. GOLF PGA TOURARNOLD PALMER INVITATIONALSundays leaders at Bay Hill Club & Lodge, Orlando, Fla.; Purse: $8.9 million. Yardage: 7,419; Par: 72 (36-36)FinalRory McIlroy (500), $1,602,000 69-70-67-64„270 Bryson DeChambeau (300), $961,200 67-66-72-68„273 Justin Rose (190), $605,200 69-71-67-67„274 Henrik Stenson (135), $427,200 64-69-71-71„275 Ryan Moore (105), $338,200 71-67-69-71„278 Tiger Woods (105), $338,200 68-72-69-69„278 Kevin Chappell (78), $249,942 70-70-73-67„280 Marc Leishman (78), $249,942 70-70-73-67„280 Luke List (78), $249,942 71-67-74-68„280 Sean OHair (78), $249,942 72-71-69-68„280 Patrick Reed (78), $249,942 68-70-71-71„280 Patrick Rodgers (78), $249,942 72-71-68-69„280 Chris Kirk (60), $186,900 71-69-70-71„281 Byeong Hun An (50), $137,950 68-68-72-74„282 Bud Cauley (50), $137,950 72-67-70-73„282 Rickie Fowler (50), $137,950 67-71-70-74„282 Charley Hoffman (50), $137,950 71-66-71-74„282 Sam Hors“ eld, $137,950 70-73-68-71„282 Charles Howell III (50), $137,950 72-70-70-70„282 Grayson Murray (50), $137,950 71-69-69-73„282 Kyle Stanley (50), $137,950 71-71-71-69„282 Jason Day (38), $89,000 73-71-67-72„283 Harris English (38), $89,000 72-71-70-70„283 Brian Gay (38), $89,000 73-71-70-69„283 Graeme McDowell (38), $89,000 69-72-69-73„283 Keegan Bradley (27), $59,319 72-72-68-72„284 Tommy Fleetwood (27), $59,319 69-76-69-70„284 Talor Gooch (27), $59,319 65-70-73-76„284 Emiliano Grillo (27), $59,319 69-75-71-69„284 Tom Hoge (27), $59,319 71-70-74-69„284 John Huh (27), $59,319 72-73-66-73„284 Zach Johnson (27), $59,319 69-71-71-73„284 Martin Laird (27), $59,319 72-70-73-69„284 William McGirt (27), $59,319 70-71-70-73„284 Francesco Molinari (27), $59,319 72-71-69-72„284 Austin Cook (18), $41,919 72-73-66-74„285 Brandon Harkins (18), $41,919 69-74-71-71„285 Kevin Na (18), $41,919 71-70-76-68„285 Alex Noren (18), $41,919 71-72-75-67„285 Brian Stuard (18), $41,919 74-69-68-74„285 J.B. Holmes (12), $30,305 68-71-73-74„286 Jamie Lovemark (12), $30,305 73-68-70-75„286 C.T. Pan (12), $30,305 74-71-71-70„286 Ian Poulter (12), $30,305 73-70-73-70„286 Ollie Schniederjans (12), $30,305 71-71-68-76„286 Adam Scott (12), $30,305 73-70-72-71„286 Kevin Streelman (12), $30,305 73-72-68-73„286 Aaron Wise (12), $30,305 65-76-72-73„286 Sam Burns, $21,965 69-70-71-77„287 Ernie Els (8), $21,965 69-70-75-73„287 Lucas Glover (8), $21,965 72-71-72-72„287 Chesson Hadley (8), $21,965 74-70-69-74„287 Hideki Matsuyama (8), $21,965 70-72-71-74„287 Brian Harman (6), $20,381 68-75-71-74„288 Billy Horschel (6), $20,381 68-70-73-77„288 Mackenzie Hughes (6), $20,381 74-69-72-73„288 HaoTong Li, $20,381 73-70-74-71„288 Stewart Cink (5), $19,491 72-70-72-75„289 James Hahn (5), $19,491 71-71-75-72„289 Sung Kang (5), $19,491 78-67-69-75„289 Davis Love III (5), $19,491 73-71-72-73„289 Curtis Luck, $19,491 71-68-74-76„289 SCOREBOARD TODAYCOLLEGE BASKETBALL 6 p.m. ESPN [--] NIT Tournament, “ rst quarter“ nal, Penn St. at Marquette 8 p.m. ESPN [--] NIT Tournament, second quarter“ nal, Mississippi St. at Louisville MLB Noon MLB [--] Toronto vs. Philadelphia, at Clearwater, Fla. 3 p.m. MLB [--] Texas vs. Chicago White Sox, at Glendale, Ariz. NBA 7 p.m. TNT [--] Oklahoma City at Boston 9:30 p.m. TNT [--] Houston at Portland NHL 6:30 p.m. NBCSN [--] Philadelphia at DetroitON AIRCollege women's basketball Gulf Coast vs. San Jacinto North-Hutchinson winner, TBA Baseball Bozeman at Providence tournament Panama City Invitational at Bay College baseball Gulf Coast at Northwest Florida 5 p.m.AREA EVENTS The Associated PressLeBron James scored 40 points as part of his third triple-double in four games and the Cleveland Cavaliers beat the Milwaukee Bucks 124-117 on Monday night as coach Tyronn Lue began his leave of absence to address health issues.Lue said Monday in a statement he been dealing with chest pains and loss of sleep, and that tests have offered no conclusion about what the issue is. Associate head coach Larry Drew will run the team in Lues absence.James scored 17 points in the third quarter and finished with 12 rebounds and 10 assists for his 16th triple-double this season and 71st of his career.The four-time MVP took over in the third beginning with back-to-back 3-pointers. After not getting a foul called on a third attempt, he finished Clevelands next posses-sion with a massive dunk. He was fouled attempting another dunk and made both free throws the fol-lowing time down.Milwaukee cut a 17-point lead to 117-109, but James drove the length of the floor for a dunk with just over a minute left. Cavaliers All-Star for-ward Kevin Love returned after missing six weeks because of a broken left hand and scored 18 points in 25 minutes. He sparked a 10-0 run in the second quarter with two 3-pointersLeBron gets tripledouble, Cavs beat Bucks without LueThe Associated PressPekka Rinne stopped 35 shots for his eighth shutout of the season and the Nashville Pred-ators set a franchise record by earning a point in their 15th consecutive game with a 4-0 win over the Buffalo Sabres on Monday night. Mike Fisher and Ryan Johansen scored goals 4:34 apart in the second period, and Filip Fors-berg and Ryan Hartman sealed the victory by scoring in the final four minutes.The NHL-leading Predators improved to 14-0-1 in their past 15, and also extended their team-best road winning streak to nine straight.Rinne won his 11th straight to match his personal best in a stretch in which hes allowed just 18 goals. The shutout was the 51st of his 12-year career and third in nine games.And Rinne also improved to 40-9-4 in becoming the NHLs seventh goalie to win 40 games in a season three or more times.The Predators havent lost in regulation since a 3-1 defeat to Detroit at home on Feb. 17. And they improved to 12-0-3 in their past 15 road games since a 3-0 loss at Vegas on Jan. 2.The Sabres were unable to build off a 5-3 win over Chicago on Saturday and lost in rookie coach Phil Housleys first meeting against his former team. The Hockey Hall of Fame defenseman spent the previous four seasons as a Predators assistant coach.Buffalo ranks last in the Eastern Conference and had its NHL-worst home record drop to 11-21-5.Rinne stops 35 in Predators victoryNashville Predators goalie Pekka Rinne (35) makes a save during the third period against the Buffalo Sabres on Monday in Buffalo, N.Y. [JEFFREY T. BARNES/THE ASSOCIATED PRESS]

PAGE 23

** The News Herald | Tuesday, March 20, 2018 C5 SPORTS TICKER AUSTIN, TEXASSpieth, Reed drawn same group at Match PlayJordan Spieth and Pat-rick Reed go from being teammates to opponents in match play.Spieth and Reed have a 7-2-2 record as partners in two Ryder Cups and last years Presidents Cup. They were drawn in the same four-man group for the Dell Tech-nologies Match Play, which starts Wednesday at Austin Country Club. Spieth knows the course well from his days playing for the Texas Longhorns.The format at this World Golf Champion-ship is round-robin play through Friday, with the winners of each 16 groups advancing to a weekend of single elimination.Dustin Johnson is the No. 1 seed. Also in his group is Kevin Kisner, one of his best friends from junior golf in South Carolina. The Associated PressThe Associated PressCLEVELAND „ Cav-aliers coach Tyronn Lue is taking a leave of absence from the team to address health issues that have included chest pains and loss of sleep.Lue said Monday in statement that tests have offered no conclusion about what the issue is and offered no timetable for his return. The coach said he feels he needs to step away and focus on trying to establish a stronger and healthier foundationŽ from which to coach the rest of the season.While I have tried to work through it, the last thing I want is for it to affect the team. I am going to use this time to focus on a prescribed routine and medication, which has previously been difficult to start in the midst of a season,Ž Lue said. My goal is to come out of it a stronger and healthier version of myself so I can continue to lead this team to the championship we are all working towards.ŽAssociate head coach Larry Drew will run the team in Lues absence starting with Mondays home game against Milwaukee. Drew said he received a text mes-sage from Lue at 1:30 a.m. saying, Its your show.ŽLeBron James said he was informed of Lues decision at morning shootaround, saying it was probably well overdue.ŽI knew he was strug-gling, but he was never not himself. He was just dealing with it the best way he could,Ž James said. Once he leaves the gym and goes home, theres things we dont know, but he was the same every single day even though he was going through what he was going through.Ž A stress-filled season for the Cavs has taken a toll on the 40-year-old Lue, who led them to the 2016 NBA champi-onship after taking over for David Blatt midway through that season. They are 40-29, third in the Eastern Conference, and have endured roster shake-ups, injuries and other distractions as they try to return to the NBA Finals.Now they will play without their coach.We all want great players, we all want the best teams, but with that comes a lot of pressure as well. And what Ty Lue has had to go through this year with that team, with the trades and the injuries and the pressure, its unrelenting,Ž Denver coach Michael Malone said. So I hope that he gets healthy and is able to get back in time for the playoffs and help that team win as many games as possible.ŽLue spent the second half of Clevelands victory in Chicago on Saturday in the locker room because of an illness.Lue taking leave from Cavs due to health issuesVillanova head coach Jay Wright, left, talks with Eric Paschall during the second half of Saturdays second-round tournament game against Alabama in Pittsburgh. Villanova won 81-58. [KEITH SRAKOCIC/THE ASSOCIATED PRESS] NCAA Sweet 16 has unexpected eld a er favorites oustedBy Aaron BeardThe Associated PressCHARLOTTE, N.C. „ After little went according to plan in the opening weekend of the NCAA Tournament, the bracket has a wildly different look for the Sweet 16 than many expected.Out: Two 1-seeds (Vir-ginia and Xavier) and a pair of 2-seeds (North Carolina and Cincinnati).In: Two No. 11 seeds (Syracuse and Loyola-Chicago).There are only seven of the top 16 seeds still alive for the regional roundsThe Cavaliers historic loss to 16-seed UMBC took out the top overall seed and thrust Villanova into the role of favorite, while preseason No. 1 Duke was dominant in its two tour-nament wins.Despite all the bracket turmoil, the power conferences managed to get 12 teams into the Sweet 16, with four coming from both the Atlantic Coast Confer-ence and the Big 12.Heres a look at the updated Final Four paths for the top remaining seeds:EastThis is the region that came closest to following the script.Four of the top five seeds survived: No. 1 Villanova, No. 2 Purdue, No. 3 Texas Tech and No. 5 West Virginia. And the Wildcats (32-4) will have the shortest travel (about 315 miles) by heading to Boston as they pursue a second national title in three seasons.My good vibes are coming from how this teams playing, how unselfishly they play,Ž Vil-lanova coach Jay Wright said after Saturdays win against Alabama .Honestly, we dont care where we play. Boston is a great town, old Big East town like Pittsburgh. We stir up old Big East feelings. We like that.ŽVillanova meets the Mountaineers (26-10) in one semifinal Friday, while the Boilermakers (30-6) face the Red Raiders (26-9) in the other.One storyline to watch: the status of 7-foot-2 Purdue center Isaac Haas, who broke his elbow in the first-round win against Cal State Fullerton. Haas warmed up before Sundays win against Butler but an official said shortly before tipoff that the big mans brace hadnt been approved for competition. MidwestConsider this one an ACC Invitational.Three of the four teams to advance to Omaha, Nebraska, are from the ACC: No. 2 Duke, No. 5 Clemson and No. 11 Syracuse. Theyll join top-seeded Kansas with regional semifinals set for Friday. The Jayhawks (29-7) are trying to return to the Final Four for the first time since 2012 after two straight regional-final losses. Theyll face the Tigers (25-9), who are in their first NCAA Tournament since 2011 and their first Sweet 16 since 1997.The Blue Devils (28-7) meet the Orange (23-13), who took out third-seeded Michigan State on Sunday.Duke and Syracuse met in Cameron Indoor Stadium on Feb. 24, with the Blue Devils holding the Orange to 32 percent shooting in a 60-44 win The rematch will mark the second NCAA Tournament matchup between Hall of Famers Mike Krzyzewski and Jim Boeheim, with Coach Ks Blue Devils win-ning one in the Sweet 16 in 1998. WestThings were set to go to form Sunday, only to see top-seeded Xavier and No. 2 North Carolina lose. Now Big Ten champion Michigan headlines the quartet in Los Angeles.The third-seeded Wol-verines (30-7) „ who beat Houston on a last-second 3-pointer „ will meet seventh-seeded Texas A&M (22-12) after the Aggies blew out the reign-ing champion Tar Heels in their home state. Fourth-seeded Gonzaga (32-4) will face ninth-seeded Florida State (22-11) after the Seminoles upset of the Musketeers .I think what you see happening in college basketball, its almost like a revolution,Ž FSU coach Leonard Hamilton said. And what happens is you start categorizing people by the reputation that their players get going into college.But in reality, kids are playing basketball all over the country and teams are getting better.Ž SouthThis is where there was the most March Madness.None of the top-four seeds advanced, the first time in tournament history that has happened in a region. So the games in Atlanta will now be headlined by 5-seed Kentucky (26-10).The Wildcats (26-10) followed their run to the Southeastern Conference Tournament title by surviving an upset bid from Davidson then beating Buffalo „ which had upset fourth-seeded Arizona Theyll face another set of Wildcats on Thursday in ninth-seeded Kansas State (24-11), which ended UMBCs historic weekend in Charlotte.The other game features 7-seed Nevada (29-7), which tied the tour-naments second-biggest comeback by rallying from 22 down to beat No. 2 seed Cincinnati. The Wolf Pack faces No. 11 seed LoyolaChicago (30-5), which advanced against No. 6 seed Miami and No. 3 seed Tennessee on final-sec-onds shots.We told the guys before, look at today alone: Michi-gan State, North Carolina, basically at home losing today,Ž Kansas State coach Bruce Weber said.Its what makes March Madness special and it kills the coaches because its so hard and you think you have a great team. Match-ups are important. Making the plays, having the right mojo at the right time.ŽMarch MadnessSyracuse guard Tyus Battle (25) heads to the other end after a 3-point basket during the closing minutes of Sundays second-round tournament game against Michigan State in Detroit. [CARLOS OSORIO/THE ASSOCIATED PRESS] IN BRIEF

PAGE 24

** C6 Tuesday, March 20, 2018 | The News Herald TV LISTINGS TUESDAY MORNING C COMCAST W WOW! S1 DISH NETWORK S2 DIRECTV MARCH 20 C W S1 S27 AM7:308 AM8:309 AM9:3010 AM10:3011 AM11:3012 PM12:30 WJHG (7) 3 3 7 7 Today Drew Barrymore; Liv Hewson. (N) Megyn Kelly Today (N) Today With Kathie Lee & HodaNewsChannel 7 at 11am (N) Days of our Lives (N) CW (7.2) 99 9 8 8 Maury The Steve Wilkos Show The Steve Wilkos Show (N) Jerry Springer Jerry Springer Paid ProgramPaid Program WMBB (13) 2 2 13 13 Good Morning America (N) Live with Kelly and Ryan (N) The View WMBB Midday News (N) The Chew METV (13.2) 209 133 2 BeaverBeaverPerry MasonMatlock The FoursomeŽ Diagnosis Murder The Big ValleyGunsmoke Snow TrainŽ WECP (18) 4 4 4 18 CBS This Morning (N) Lets Make a Deal (N) The Price Is Right (N) The Young and the RestlessNews at NoonBold/Beautiful MNT (18.2) 227 13 Extra (N) Forensic FilesJerry Springer The Real (N) The Wendy Williams Show (N) Paternity CourtCouples CourtJudge FaithJudge Faith WPGX (28) 8 8 28 28 Paid ProgramEarth 2050Paid ProgramPaid ProgramJudge Mathis (N) The Peoples Court The Peoples Court CityLine WFSG (56) 11 11 56 56 Nature CatCurious George Swings-SpringDaniel TigerDaniel TigerSplashSesame StreetSuper Why!Dinosaur TrainPeg Plus CatSesame Str eetSplash A&E 34 43 118 265 Bounty HunterBounty HunterBounty HunterBounty HunterDog the Bounty Hunter Dog the Bounty Hunter Undercover High Undercover High BustedŽ AMC 30 62 131 254 Cue VaporLifeLock ‰‰‰ Insidious (10) Patrick Wilson, Rose Byrne, Lin Shaye. ‰‰‰ X-Men 2 (03) Patrick Stewart, Hugh Jackman, Ian McKellen. ANPL 46 69 184 282 Too Cute! My Cat From Hell The Vet Life Animal Cops Houston Animal Cops Houston Pit Bulls and Parolees BET 53 46 124 329 House/PayneHouse/PayneHouse/PayneHouse/PayneHouse/PayneHouse/PayneMeet, BrownsMeet, BrownsMeet, BrownsTyler Perrys Meet the Br ownsMeet, Browns COM 64 53 107 249 Scrubs Scrubs 70s Show70s Show70s Show70s Show70s Show70s Show (:15) That 70s Show 70s Show70s Show DISC 36 39 182 278 I (Almost) Got Away With It I (Almost) Got Away With It I (Almost) Got Away With It I (Almost) Got Away With It I (Almost) Got Away With It I (Almost) Got Away With It E! 63 57 114 236 The KardashiansThe KardashiansThe KardashiansThe KardashiansE! News: Daily Pop (N) The Kardashians ESPN 9 23 140 206 SportsCenter (N) (L) SportsCenter (N) (L) First Take (N) (L) SportsCenter (N) (L) Outside LinesNFL Live (N) ESPN2 47 24 144 209 (5:00) Golic & Wingo (N) (L) SportsCenter (N) (L) SportsCenter (N) (L) SportsCenter (N) (L) FOOD 38 45 110 231 Gotham Grill!PiYo Workout!Paid ProgramPioneer Wo.Trishas Sou.Trishas Sou.Trishas Sou.Trishas Sou.Trishas Sou.Trishas Sou. Pioneer Wo.Pioneer Wo. FREE 59 65 180 311 Last-StandingLast-StandingLast-Standing700/InteractiveThe 700 Club Gilmore Girls Gilmore Girls Reba Reba FS1 24 27 150 219 First Things FirstSkip and Shannon: Undisputed (N) (L) The Herd with Colin Cowherd (N) (L) FX 45 51 136 248 (6:00) ‰‰‚ 2 Guns (13) Denzel Washington. ‰‚ Fantastic Four (15) Miles Teller, Michael B. Jordan. How I MetHow I MetHow I MetHow I MetMike & Molly HALL 23 59 185 312 Golden GirlsGolden GirlsGolden GirlsGolden GirlsHome & Family 6133Ž (N) Home & Family 6132Ž HGTV 32 38 112 229 Dream HomeDream HomeDream HomeDream HomeDream HomeDream HomeFlip/Flop Veg.Flip/Flop Veg.Fixer UpperFixer Upper HIST 35 42 120 269 You Dont Know Dixie Insight on Southern culture. Appalachian Outlaws Appalachian Outlaws Appalachian Outlaws Appalachian Outlaws LIFE 56 56 108 252 Unsolved MysteriesUnsolved MysteriesUnsolved MysteriesThe First 48The First 48The First 48 One HeartŽ PARMT 28 48 241 241 Paid ProgramPaid Program ‰ Jack and Jill (11) Adam Sandler, Katie Holmes. ‰‚ I Now Pronounce You Chuck and Larry (07) Adam Sandler, Kevin James, Jessica Biel. SUN 49 422 656 FiTVFlip My YardPostgamePostgameNBA Basketball Denver Nuggets at Miami Heat. Lunch with the Heat SYFY 70 52 122 244 Twilight ZoneTwilight Zone ‰‚ The Legend of Hercules (14) Kellan Lutz, Scott Adkins. Superman: Unbound (13) Stana Katic (:45) ‰‰‚ Blade (98) Wesley Snipes. TBS 31 15 139 247 MarriedKingKingKingSeinfeld Seinfeld Seinfeld Friends Friends Friends Friends Friends TCM 25 70 132 256 (6:30) An Ideal Husband (48) (:15) ‰‰‰‚ The Gazebo (59) Glenn Ford, Debbie Reynolds.(:15) ‰‰‰‚ The Big Sleep (46) Humphrey Bogart.(:15) ‰‰‰ Victim (61) TLC 37 40 183 280 Say Yes to the Dress Four Weddings Four Weddings Separation AnxietyHoarding: Buried Alive Hoarding: Buried Alive TNT 29 54 138 245 Charmed I Dream of PhoebeŽ Charmed Supernatural Like a VirginŽ Supernatural UnforgivenŽ Supernatural Supernatural USA 62 55 105 242 CSI: Crime Scene InvestigationCSI: Crime Scene InvestigationLaw & Order: SVULaw & Order: SVULaw & Order: SVULaw & Order: SVU WGN-A 13 239 307 Creflo DollarLifeLockMurder, She Wrote Murder, She Wrote Murder, She Wrote In the Heat of the Night In the Heat of the Night TUESDAY LATE NIGHT C COMCAST W WOW! S1 DISH NETWORK S2 DIRECTV MARCH 20 C W S1 S21 AM1:302 AM2:303 AM3:304 AM4:305 AM5:306 AM6:30 WJHG (7) 3 3 7 7 (:07) HarryThe Bankruptcy HourShepherds ChapelEarly TodayEarly TodayNewsChannel 7 Today (N) CW (7.2) 99 9 8 8 Top 30 (N) ION FlexSex PillsPaid ProgramION FlexION FlexPaid ProgramPaid ProgramTone&LiftPaid ProgramPage Six TVCops WMBB (13) 2 2 13 13 Judge Karen (:37) ABC World News Now (Joined in Progress) (N) MorningMorningNews 13 This Morning (N) METV (13.2) 209 133 2 Mannix The Open WebŽ Cannon77 Sunset StripPeter GunnNight GalleryFacts of LifeDiffrent StrokeBev. HillbilliesMy Three Sons WECP (18) 4 4 4 18 (:07) AccessCelebrity Page (:07) CBS Overnight News (N) Paid ProgramPaid ProgramBusiness FirstMorning News MNT (18.2) 227 13 Forensic FilesUnexplainedJewelry TelevisionJewelry TelevisionPaid ProgramPaid ProgramPaid ProgramAgDay WPGX (28) 8 8 28 28 Imp. JokersImp. JokersStevePaid ProgramPaid ProgramPaid ProgramPaid ProgramPaid ProgramOutdoor ShowAsk-Tech.Paid Program WFSG (56) 11 11 56 56 Jackie Robinson Robinson speaks out against injustice. Jackie Robinson Part OneŽ Baseball player Jackie Robinson. Wild Kratts (EI) Wild Kratts (EI) Ready Jet Go!Cat in the Hat A&E 34 43 118 265 (:03) Undercover High (:04) The First 48 ChopperŽ Celeb BeautyPhilips!Rehab?Cue VaporCredit?Rehab?Parking WarsParking Wars AMC 30 62 131 254 Cult of Chucky ‰‰‚ Insidious: Chapter 3 (15) Dermot Mulroney. Comic MenThree StoogesThree StoogesPeter PopoffPaid ProgramPaid ProgramPaid Program ANPL 46 69 184 282 River MonstersRiver MonstersRiver MonstersRiver Monsters: UnderwaterThe GuardiansDogs 101 BET 53 46 124 329 (12:44) Martin (:18) Martin (1:52) Martin (:26) MartinJamie FoxxJamie FoxxJamie FoxxJamie FoxxShowdown of FaithJamie FoxxJamie Foxx COM 64 53 107 249 OppositionSouth ParkSouth ParkSouth ParkWorkaholicsWorkaholicsSex ToysPiYo Workout!Organic FoodBoostingScrubsScrubs DISC 36 39 182 278 (:03) Moonshiners Last CallŽ Biker Build-OffBiker Build-OffBiker Build-OffBiker Build-OffFast N Loud E! 63 57 114 236 ‰‰‰ The Rundown (03) The Rock, Seann William Scott. Parks/RecreatParks/RecreatParks/RecreatParks/RecreatParks/RecreatParks/RecreatHollywood Medium ESPN 9 23 140 206 SportsCenter (N) (L) SportsCenterSportsCenterSportsCenterSportsCenter W/Van PeltSportsCenter (N) (L) ESPN2 47 24 144 209 (12:30) First Take30 for 3030 for 30Golic & Wingo (N) (L) FOOD 38 45 110 231 Chopped Grill GameŽ ChoppedCooks vs. ConsGotham Grill!Medical Disc.Larry KingMyPillowPiYo Workout!Paid Program FREE 59 65 180 311 Paid ProgramPaid ProgramThe 700 ClubOmegaPaid ProgramJoseph PrinceRobisonJoyce MeyerJohn HageeLast-StandingLast-Standing FS1 24 27 150 219 UndisputedUFCs FightsUFC 25 Greatest Fights TMZ SportsFirst Things First FX 45 51 136 248 How I MetFXM PresentsPhilips!Paid ProgramPaid ProgramLifeLockAirfryer OvenPaid ProgramPaid ProgramMillion Ways HALL 23 59 185 312 FrasierFrasierFrasierFrasierCheersCheersI Love LucyI Love LucyI Love LucyI Love LucyI Love LucyI Love Lucy HGTV 32 38 112 229 House HuntersHunters IntlFixer UpperLarry KingAge SpotsMyPillowCeleb BeautyPaid ProgramAmazingLiving Big SkyLiving Big Sky HIST 35 42 120 269 The Curse of Civil War Gold (:04) Forged in FireEat & RunDr. Ho Reliev.More SexCredit?Paid ProgramGotham Grill!Modern Marvels Ax history. LIFE 56 56 108 252 (:03) Love at First FlightLove at FirstLifeLockLuminess AirHot BootyLifeLockPaid ProgramRobisonJoyce MeyerAccess Health PARMT 28 48 241 241 (12:30) ‰ Jack and Jill (11) Adam Sandler, Katie Holmes. Paid ProgramSex PillsMedical Disc.Gotham SteelPaid ProgramCue VaporPiYo Workout!Balance SUN 49 422 656 Foot PainEverstrongSex PillsPoop SayProstateEverstrongProstateSex Pillsto Do FloridaSport FishingPaid ProgramPaid Program SYFY 70 52 122 244 FuturamaFuturamaFuturama ‰‰‚ The Wolfman (10) Benicio Del Toro, Anthony Hopkins. KryptonTwilight Zone ‰‰‚ Blade (98) Wesley Snipes. TBS 31 15 139 247 Brooklyn NineBrooklyn NineBrooklyn Nine2 Broke Girls2 Broke Girls2 Broke GirlsMarriedMarriedMarriedMarriedMarriedMarried TCM 25 70 132 256 2001: Odyssey ‰‰‰‰ The Searchers (56) John Wayne, Jeffrey Hunter.(:45) ‰‰‚ Cash McCall (60) James Garner, Natalie Wood.(:45) ‰‰‰ Three Men on a Horse (36) TLC 37 40 183 280 (:08) My Big Fat Fabulous LifeExtreme Weight Loss A 39-year-old woman works to get fit. What Not to WearWhat Not to Wear AziŽ Say YesSay Yes TNT 29 54 138 245 NBA Basketball Oklahoma City Thunder at Boston Celtics. Jokers WildLaw & Order UndercoveredŽ Law & Order DR 1-102Ž Charmed USA 62 55 105 242 Law & Order: SVULaw & Order: SVU (:02) Dateline The PromiseŽ(:01) Dateline The PromiseŽ NCIS A Marine on life support. NCIS Grace PeriodŽ WGN-A 13 239 307 How I MetHow I MetHow I MetHow I MetPerson of InterestPaid ProgramAge SpotsGotham Grill!Joseph PrinceLes FeldickJoyce Meyer TUESDAY AFTERNOON C COMCAST W WOW! S1 DISH NETWORK S2 DIRECTV MARCH 20 C W S1 S21 PM1:302 PM2:303 PM3:304 PM4:305 PM5:306 PM6:30 WJHG (7) 3 3 7 7 Rachael Ray (N) The Doctors (N) Harry Family FeudJeopardy! (N) NewsNightly NewsNewsWheel Fortune CW (7.2) 99 9 8 8 Paid ProgramPaid ProgramMaury The Robert Irvine Show The GoldbergsThe GoldbergsAmerican DadAmerican DadFamily Guy Family Guy WMBB (13) 2 2 13 13 General Hospital (N) Hot Bench Hot Bench The Dr. Oz Show (N) Dr. Phil (N) NewsWorld NewsNews 13 at 6Ent. Tonight METV (13.2) 209 133 2 Bonanza The Other SonŽ The RiflemanThe RiflemanWagon TrainThe Wild, Wild WestHawaii Five-0M*A*S*HM*A*S*H WECP (18) 4 4 4 18 The Talk MillionaireMillionaireFamily FeudFamily FeudThe Ellen DeGeneres Show (N) Day JeopardyLocal 18 NewsEvening NewsInside Edition MNT (18.2) 227 13 Divorce CourtDivorce CourtAndy GriffithAndy GriffithDateline DailyMailTV DailyMailTV Last-StandingLast-StandingMike & MollyMike & Molly WPGX (28) 8 8 28 28 Maury (N) Crime Watch DailySteve (N) ThisMinuteThisMinuteJudge Judy (N) Judge Judy Big BangBig Bang WFSG (56) 11 11 56 56 Curious George Swings-SpringNature CatWild KrattsWild KrattsOdd SquadOdd SquadArthur (EI) PBS NewsHour (N) World NewsRick Steves A&E 34 43 118 265 Undercover High The First 48 The First 48 The First 48 The First 48 The First 48 Cold BetrayalŽ AMC 30 62 131 254 X-Men 2 (03) ‰‰‰ Independence Day (96) Will Smith. Earthlings vs. evil aliens in 15-mile-wide ships. ‰‰‰ Signs (02) Mel Gibson, Joaquin Phoenix, Cherry Jones. ANPL 46 69 184 282 Pit Bulls and Parolees Treehouse Masters Treehouse Masters River Monsters Specials River Monsters Living with Man Eaters BET 53 46 124 329 Meet, BrownsMeet, BrownsFresh PrinceFresh PrinceFresh PrinceFresh Prince ‰‰‰ Barbershop 2: Back in Business (04) Ice Cube, Cedric the Entertainer. The Cookout COM 64 53 107 249 70s Show70s Show70s Show70s Show70s Show (:40) The Office (:15) The Office After HoursŽ(:15) The Office The Office (:25) The Office DISC 36 39 182 278 Pot Cops Buried in WeedŽ Pot Cops End of HarvestŽ Moonshiners Moonshiners Moonshiners High and DryŽ Moonshiners Lighted UpŽ E! 63 57 114 236 The KardashiansThe KardashiansThe Kardashians ‰‰‰ The Rundown (03) The Rock, Seann William Scott. E! News (N) ESPN 9 23 140 206 (12:30) NFL Live (N) (L) NBA: The Jump (N) (L) SportsNationQuestionableAround/HornInterruptionSportsCenter (N) (L) College Basketball ESPN2 47 24 144 209 JalenOutside LinesNFL LiveIntentional Talk (N) (L) SportsNationQuestionableAround/HornInterruptionWorld/Poker FOOD 38 45 110 231 Chopped Junior Curry HurryŽ Chopped Pigging OutŽ ChoppedChopped A Guts ReactionŽ Chopped Bacon Baskets!Ž Chopped Hoofin It!Ž FREE 59 65 180 311 Reba Reba ‰‰‰ The Incredible Hulk (08) Edward Norton, Liv Tyler, Tim Roth. ‰‰‰ Captain America: Return of the First Avenger (14) Chris Evans. FS1 24 27 150 219 The Herd with Colin CowherdFirst Things First with Cris Carter and Nick WrightSpeak for YourselfNASCAR Race Hub (N) (L) UFC Top TenUFC Top Ten FX 45 51 136 248 Mike & MollyMike & MollyMike & Molly ‰‰ A Million Ways to Die in the West (14) Seth MacFarlane. ‰‚ Grown Ups (10) Adam Sandler, Kevin James. HALL 23 59 185 312Stop the Wedding (16) Rachel Boston, Niall Matter. Appetite for Love (16) Taylor Cole, Andrew Walker, Alley Mills. Full House Full House Full House Full House HGTV 32 38 112 229 Fixer UpperFixer UpperFixer UpperFixer UpperFixer UpperFixer Upper HIST 35 42 120 269 Appalachian Outlaws HuntedŽ Appalachian Outlaws Forged in Fire Forged in Fire Viking EditionŽ Forged in Fire Forged in Fire MakrakaŽ LIFE 56 56 108 252 The First 48Greys Anatomy Greys Anatomy Greys Anatomy Greys Anatomy Married at First Sight PARMT 28 48 241 241 Two/Half MenTwo/Half MenTwo/Half MenTwo/Half MenTwo/Half MenTwo/Half MenTwo/Half MenTwo/Half MenFriends Friends Friends Friends SUN 49 422 656 Inside HEATInside HEATSpotlightFocusedSpecial OlymSports Mag.Power of Forbes SportsIns. LightningIns. LightningLightning Pre.NH L Hockey SYFY 70 52 122 244 (11:45) ‰‰‚ Blade (98)(:15) ‰‰ Lara Croft: Tomb Raider (01) Angelina Jolie.(:15) ‰‰‚ Tomorrowland (15) George Clooney, Hugh Laurie, Britt Robertson. TBS 31 15 139 247 Friends Friends Friends Friends American DadAmerican DadAmerican DadAmerican DadFamily Guy Family Guy Big BangBig Bang TCM 25 70 132 256 (12:15) ‰‰‰ Victim (61) ‰‰‚ Blackmail (39) Edward G. Robinson. ‰‰‰‚ The Woman in White (48) Eleanor Parker. ‰‰‰ Blackmail (29) Anny Ondra. TLC 37 40 183 280 My 600-Lb. Life An obese woman is nearly immobile. Say YesSay YesSay Yes to the Dress Trading Spaces My Big Fat Fabulous Life (N) TNT 29 54 138 245 Supernatural ‰‰‚ Red 2 (13) Bruce Willis, John Malkovich.(:15) ‰‰‚ Real Steel (11) Hugh Jackman. A boxing promoter and his son build a robot fighter. USA 62 55 105 242 Law & Order: SVULaw & Order: SVULaw & Order: SVULaw & Order: SVUModern FamilyModern FamilyModern FamilyModern Family WGN-A 13 239 307 In the Heat of the NightIn the Heat of the NightBlue Bloods Blue Bloods Custody BattleŽ Blue Bloods ‰‰‰ Edge of Tomorrow (14) TUESDAY EVENING C COMCAST W WOW! S1 DISH NETWORK S2 DIRECTV MARCH 20 C W S1 S27 PM7:308 PM8:309 PM9:3010 PM10:3011 PM11:3012 AM12:30 WJHG (7) 3 3 7 7 The Voice (N)(:01) Rise (N) Chicago Med Born This WayŽ NewsTonight Show-J. FallonLate Night With Seth MeyersLast Call/Daly CW (7.2) 99 9 8 8 The Flash Subject 9Ž Black Lightning (N) Page Six TVSeinfeldSeinfeldEngagementEngagementKingKing of the HillCops WMBB (13) 2 2 13 13 The Middle (N) Fresh Off-Boatblackish (N) Modern FamilyFor the People RahowaŽ (N) News 13 at 10 (:35) Jimmy Kimmel Live (:37) Nightline (12:07) Mom (:37) Mom METV (13.2) 209 133 2 Andy GriffithAndy GriffithGomer PyleMamas FamilyHogan HeroesHogan HeroesCarol BurnettPerry MasonTwilight ZoneAlf. HitchcockAlf Hitchcock WECP (18) 4 4 4 18 NCIS Dark SecretsŽ NCIS High TideŽ Bull Survival InstinctsŽ Modern FamilyLate Show-ColbertLate Late Show/James CordenModern Family MNT (18.2) 227 13 The X-Files Redux IIŽ The X-Files2 Broke Girls2 Broke GirlsAnger MgtAnger MgtThe GameThe GameCorrupt CrimesKiller WPGX (28) 8 8 28 28 Lethal WeaponLA to VegasThe Mick (N) Two/Half MenTMZ (N) Crime Watch DailyPawn StarsPawn StarsTwo/Half MenHow I Met WFSG (56) 11 11 56 56 Al Capone: IconJackie Robinson Robinson speaks out against injustice. Amanpour-PBSBeyond 100 PBS NewsHourAl Capone: Icon A&E 34 43 118 265 The First 48 Broken HomeŽ The First 48Undercover High (:03) The First 48 ChopperŽ(:03) The First 48 (12:03) The First 48 AMC 30 62 131 254 ‰‰‰ Contagion (11) Marion Cotillard, Matt Damon, Laurence Fishburne. Curse of Chucky (13) Fiona Dourif, A Martinez, Danielle Bisutti. Cult of Chucky (17) Fiona Dourif, Jennifer Tilly. ANPL 46 69 184 282 (6:00) Living with Man EatersKiller Whales: The Mega HuntExtinct or Alive: Taz TigerMadagascar Madagascar was left untouched by man. BET 53 46 124 329 (6:30) ‰‚ The Cookout (04) Ja Rule, Tim Meadows. The Quad (N)(:03) The Quad(:05) Martin (:38) Martin (12:11) Martin (:44) Martin COM 64 53 107 249 Tosh.0Tosh.0Tosh.0Tosh.0Another PeriodAnother PeriodDaily ShowOppositionSouth ParkSouth ParkSouth ParkDaily Show DISC 36 39 182 278 Moonshiners: Outlaw Cuts (N) Moonshiners (N)(:01) Moonshiners (N)(:02) Moonshiners (:03) Moonshiners (12:03) Moonshiners E! 63 57 114 236 ‰‰‰ The Other Guys (10) Will Ferrell, Mark Wahlberg, Eva Mendes. E! News ‰‰‰ The Other Guys (10) Will Ferrell, Mark Wahlberg, Eva Mendes. ESPN 9 23 140 206 College BasketballCollege BasketballSportsCenter (N) (L) SportsCenter W/Van PeltSportsCenter (N) (L) ESPN2 47 24 144 209 World/PokerWorld/PokerWorld/PokerWorld/PokerNFL LiveFirst Take FOOD 38 45 110 231 ChoppedChopped Bacon BoysŽ Chopped Pork on the BrainŽ Chopped Grill GameŽ Chopped Bacon BoysŽ Chopped Pork on the BrainŽ FREE 59 65 180 311 Shadowhunters (:01) ‰‰‰ Mulan (98) Voices of Ming-Na Wen, Eddie Murphy. The 700 Club ‰‰ A Walk to Remember (02) Shane West, Mandy Moore. FS1 24 27 150 219 UFC 25 Greatest Fights (N) Speak for YourselfTMZ SportsSkip and Shannon: Undisputed FX 45 51 136 248 ‰ Grown Ups 2 (13) Adam Sandler, Kevin James, Chris Rock. Baskets (N)(:32) Baskets (:02) Baskets (:34) ‰‚ Grown Ups (10) Adam Sandler, Kevin James. (:34) Baskets HALL 23 59 185 312 Full HouseFull HouseThe MiddleThe MiddleThe MiddleThe MiddleGolden GirlsGolden GirlsGolden GirlsGolden GirlsFrasierFrasier HGTV 32 38 112 229 Fixer UpperFixer Upper (N) House HuntersHunters IntlHouse HuntersHunters IntlFixer UpperHouse HuntersHunters Intl HIST 35 42 120 269 Forged in Fire: Cutting DeeperForged in Fire (N) The Curse of Civil War Gold (:03) Forged in FireForged in Fire: Cutting Deeper (12:03) Forged in Fire LIFE 56 56 108 252 Married at First Sight (N) Married at First Sight (N)(:02) Love at First Flight (Series Premiere) (N) Love at First (:01) Married at First Sight(12:01) Married at First Sight PARMT 28 48 241 241 FriendsFriendsFriendsFriendsInk Master Quit Buggin MeŽ ‰‚ I Now Pronounce You Chuck and Larry (07) Adam Sandler, Kevin James. Jack and Jill SUN 49 422 656 NHL Hockey Toronto Maple Leafs at Tampa Bay Lightning. (N) Lightning Post.Ins. LightningIns. LightningInside RaysAfter Midnight With the Lightning SYFY 70 52 122 244 ‰‚ Gods of Egypt (16) Nikolaj Coster-Waldau, Brenton Thwaites. (:45) All-Star Superman (11) Voices of James Denton. FuturamaFuturamaFuturama TBS 31 15 139 247 Big BangBig BangBig BangBig BangBig BangThe Detour (N) Conan (N) The DetourConanBrooklyn Nine TCM 25 70 132 256 ‰‰‰‰ The Graduate (67) Dustin Hoffman, Anne Bancroft. ‰‰‰‰ Modern Times (36) Charlie Chaplin.(:45) ‰‰‰‰ 2001: A Space Odyssey (68) Keir Dullea, Gary Lockwood. TLC 37 40 183 280 My Big Fat Fabulous Life (N)(:02) Counting On (:09) The 685-Lb. Teen (:09) My Big Fat Fabulous Life (:09) Counting On A New Bundle of JoyŽ 685-Lb. Teen TNT 29 54 138 245 NBA Basketball Oklahoma City Thunder at Boston Celtics. (L) NBA Basketball Houston Rockets at Portland Trail Blazers. (L) Players Only Postgame (N) USA 62 55 105 242 WWE SmackDown! (N) (L) Unsolved: Tupac and BIGLaw & Order: SVULaw & Order: SVUUnsolved: Tupac and BIG WGN-A 13 239 307 (6:00) ‰‰‰ Edge of Tomorrow (14) ‰‰‰ Edge of Tomorrow (14) Tom Cruise, Emily Blunt, Brendan Gleeson. CopsCopsEngagementEngagement

PAGE 25

CLASSIFIEDSThe News Herald | Tuesday, March 20, 2018 D D 1 1 19728 IN THE CIRCUIT COURT OF THE 14TH JUDICIAL CIRCUIT, IN AND FOR BAY COUNTY, FLORIDA GENERAL JURISDICTION DIVISION CASE NO, 17000996CA PENNYMAC LOAN SERVICES, LLC Plaintiff, vs DAVID A. HERST, DECEASED; AMALIA COLLINSWORTH; ANY AND ALL UNKNOWN PARTIES CLAIMING BY, THROUGH, UNDER AND AGAINST THE HEREIN NAMED INDIVIDUAL DEFENDANT(S) WHO ARE NOT KNOWN TO BE DEAD OR ALIVE, WHETHER SAID UNKNOWN PARTIES MAY CLAIM AN INTEREST AS SPOUSES, HEIRS, DEVISEES, GRANTEES, OR OTHER CLAIMANTS; UNKNOWN SPOUSE OF AMILIA COLLINSWORTH; UNKNOWN TENANT # 1 IN POSSESSION OF THE PROPERTY; UNKNOWN TENANT # 2 IN POSSESSION OF THE PROPERTY; Defendants NOTICE OF SALE NOTICE IS GIVEN that, in accordance with the Final Judgment of Foreclosure dated February 23, 2018, in the above-styled cause I will sell to the highest and best bidder for cash at http://www bay .realforeclose.com at 11:00AM on April 9, 2018 the following described property; THE LAND REFERRED TO HEREIN BELOW IS SITUATED IN THE COUNTY OF BAY, STATE OF FLORIDA, AND IS DESCRIBED AS FOLLOWS; LOTS 58 AND 59, BLOCK 2, VENETIAN VILA, ACCORDING TO THE PLAT OF VENETIAN VILLA, AS RECODED IN PLAT BOOK 1, PAGE 38-A & 38-B, IN THE OFFICE OF THE PUBLIC CIRCUIT OF BAY COUNTY, FLORIDA. PROPERTY ADDRESS: 4007 MILANO RD, PANAMA CITY, FL 32405 ANY PERSON CLAIMING AN INTEREST IN THE SURPLUS FROM THE SALE, IF ANY, OTHER THAN THE PROPERTY OWNER AS OF THE DATE OF THE LIS PENDENS MUST FILE A CLAIN WITHIN 60 DAYS AFTER THE SALE Dated: 02-26-2018 IF YOU ARE A PERSON WITH A DISABILITY WHO NEEDS ANY ACCOMMODATION IN ORDER TO PARTICIPATE IN THIS PROCEEDING, YOU ARE ENTITLED, AT NO COST TO YOU, TO THE PROVISION OF CERTAIN ASSISTANCE. pLEASE CONATCT THE ADA COORDINATOR BY MAIL AT P.O. BOX 1089, PANAMA CITY, FL 32402 OR BY PHONE AT (850)7475338 AT LEAST SEVEN (7) DAYS BEFORE YOUR SCHEDULED COURT APPEARANCE, OR IMMEDIATELY UPON RECEIVING THIS NOTIFICATION IF THE TIME BEFORE THE SCHEDULED APPEARANCE IS LESS THAN SEVEN (7) DAYS. IF YOU ARE HEARING IMPAIRED, PLEASE CALL 711. BILL KINSAUL Clerk By: Jennifer Estrada Deputy Clerk Marinosci Law Group, P.C. Attorney for the Plaintiff 100 W. Cypress Creek Rd., Ste 1045 Fort Lauderdale, FL 33309 Phone: (954)644-8704 Fax (954)772-9601 ServiceFL@mlg default law .com ServiceFL2@mlg defau ltlaw .com MLG No.: 17-12014 March 20, 27, 2018 19712 IN THE CIRCUIT COURT IN AND FOR BAY COUNTY, FLORIDA Case No. 2017-000015-CA TYNDALL FEDERAL CREDIT UNION, Plaintiff, vs. DALE E. PATTON; ANGELA M. PATTON; KEEP SANDY CREEK BEAUTIFUL, INC.; BAY MEDICAL CENTER; and UNKNOWN TENANT, Defendants. NOTICE OF SALE NOTICE IS GIVEN pursuant to a Final Judgment dated March 7, 2018, entered in Case No. 2017-000015-CA, of the Circuit Court in and for Bay County, Florida, wherein DALE E. PATTON; ANGELA M. PATTON; KEEP SANDY CREEK BEAUTIFUL, INC.; BAY MEDICAL CENTER; and UNKNOWN TENANT, are the Defendants, that the Clerk of this Court will sell at public sale to the highest bidder for cash online at www .bay .realfore close.c om on April 20, 2018 at 11:00 a.m. Central Standart Time, the following described real property as set forth in the Final Judgment: Legal Description: LOT 2006 OF SANDY CREEK RANCH AND COUNTRY CLUB PHASE TWO, ACCORDING TO THE PLAT THEREOF AS RECORDED IN PLAT BOOK 14, PAGES 35-38, OF THE PUBLIC RECORDS OF BAY COUNTY, FLORIDA. a/k/a 12027-B Raintree Drive, Panama City, Florida 324042761 NOTICE ANY PERSON CLAIMING AN INTEREST IN THE SURPLUS FROM THE SALE, IF ANY, OTHER THAN THE PROPERTY OWNER AS OF THE DATE OF THE LIS PENDENS MUST FILE A CLAIM WITHIN 60 DAYS AFTER THE SALE. Dated this 9th day of March, 2018. BILL KINSAUL Clerk of the Circuit Court By: Jennifer Estrada As Deputy Clerk NOTICE If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact Court Administration at 300 East 4th Street, Panama City, Florida 32401, 850-7639061, within two working days of your receipt of this notice; if you are hearing impared, call 1-800-955-8771; if you are voice impaired, call 1-800-955-8770. March 20, 27, 2018 19732 IN THE CIRCUIT COURT OF THE FOURTEENTH JUDICIAL CIRCUIT IN AND FOR BAY COUNTY, FLORIDA. CASE NO. 17000859CA DITECH FINANCIAL LLC FKA GREEN TREE SERVICING LLC, Plaintiff, vs WILLIAM M. WILLIAMS; SANDRA J. WILLIAMS; UNKNOWN SPOUSE OF WILLIAM M. WILLIAMS; UNKNOWN SPOUSE OF SANDRA J. WILLIAMS; CACH, LLC, UNKNOWN TENANT 1; UNKNOWN TENANT 2; UNKNOWN TENANT 1; UNKNOWN TENANT 2, Defendant(s) NOTICE OF FORECLOSURE SALE PURSUANT TO CHAPTER 45 NOTICE IS HEREBY GIVEN that sale will be made pursuant to an Order of Final Judgment. Final Judgment was awarded on January 19, 2018 in Civil Case No. 17000859CA, of the Circuit Court of the FOURTEENTH Judicial Circuit in and for Bay County, Florida, wherein, DITECH FINANCIAL LLC FKA GREEN TREE SERVICING LC is the Plaintiff, and WILLIAM M. WILLIAMS; CASH, LLC are Defendants. The Clerk of Court, Bill Kinsaul will sell to the highest bidder for cash at www .bay .real foreclose.com on April 16, 2018 at 11:00AM the following described real property as set forth in said Final Judgment, to wit: LOTS 9, 10, 11 AND 12, BLOCK 132, LYNN HAVEN PLAT, ACCORDING TO THE MAP OR PLAT THEREOF, AS RECODED IN PLAT BOOK 5, PAGES 9 AND 10, OF THE PUBLIC RECORDS OF BAY COUNTY, FLORIDA. ANY PERSON CLAIMING AN INTEREST IN THE SURPLUS FROM THE SALE, IF ANY, OTHER THAN THE PROPERTY OWNER AS OF THE DATE OF THE LIS PENDENS MUST FILE A CLAIM WITHIN 60 DAYS AFTER THE SALE. WITNESS my hand and the seal of the court on January 19, 2018 BILL KINSAUL CLERK OF THE COURT By: Jennifer Estrada Deputy Clerk Aldridge | Pite, LLP Attorney for Plaintiff(s) 1615 S. Congress Ave. Suite 200 Delray Beach, FL 33445 Phone: 561-392-6391 Fax: 561-392-6965 File No.: 1382-1749B IMPORT ANT AMERICANS WITH DISABILITES ACT: If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact the ADA Coordinator by mail at P.O. Box 1089, Panama City, FL 32402 or by phone at (850) 747-5338 at least seven (7) days before your scheduled court appearance, or immediately upon receiving this notification if the time before the scheduled appearance is less than seven (7) days. If you are hearing impaired, please call 711 or email AD ARequest @jud14.flcourts.org March 20, 27, 2018 19792 BOARD OF COUNTY COMMISSIONERS BAY COUNTY, FLORIDA NOTICE OF CALL FOR BID The Bay County Board of County Commissioners (County) seeks bids from qualified contractors to construct a 3,440 square foot dormitory addition onto the Bay County Jail Annex located at 5700 Star Lane, Panama City, FL 32404. SEALED BIDS for ITB NO: 18-21 Bay County SheriffÂ’s Office Jail Annex Dormitory Addition Re-Bid will be received by the BOARD OF COUNTY COMMISSIONERS OF BAY COUNTY, FLORIDA at the Purchasing Department 840 W. 11th Street, Suite 2500, Panama City, FL 32401 up until 2:00 pm (central time) Friday, April 20, 2018. Bids will be publicly opened immediately following the deadline. The ITB package is available from the Purchasing DepartmentÂ’s Web Page http://co.bay .fl. us/169/P urchasing Contractors shall be Florida Licensed General Contractors. SubContractors shall be Florida licensed in their trade. A Pre-Bid Meeting will be held at 10:00 am on Wednesday, March 28, 2018 in the Purchasing Conference Room, 840 W. 11th Street, Suite 2500, Panama City, FL 32401. The Bay County Board of County Commissioners reserves the right to accept or reject any and/or all proposals in the best interest of Bay County. Submitted by Karen Grindle Contract Coordinator Pub: March 20, 2018 19784 IN THE CIRCUIT COURT OF THE FOURTEENTH JUDICIAL CIRCUIT IN AND FOR BAY COUTY, FLORIDA GENERAL JURISDICTION DIVISION CASE NO. 17001070CA CIT BANK, N.A., Plaintiff, vs. JEANETTE R. HARBIN; UNKNOWN SPOUSE OF JEANETTE R. HARBIN, et al. Defendant(s). NOTICE OF FORECLOSURE SALE NOTICE IS HEREBY GIVEN pursuant to a Final Judgement of Foreclosure dated February 19, 2018, and entered in 17001070CA of the Circuit Court of the FOURTEENTH Judicial Circuit in and for BAY County, Florida, wherein CIT BANK N.A. is the Plaintiff and JEANETTE R. HARBIN; UNKNOWN SPOUSE OF JEANETTE R. HARBIN are the Defendant(s). Bill Kinsaul as the Clerk of the Circuit Court will sell to the highest and best bidder for cash at www bay .realforeclose.com at 11:00 AM, on June 19, 2018 the following described property as set forth in said Final Judgment, to wit: LOT 3, BLOCK 5B, ACCORDING TO THE PLAT OF SECOND ADDITION TO LAGUNA BEACH ESTATES, ACCORDING TO THE PLAT THEREOF, AS RECORDED IN PLAT BOOK 7, PAGE 33, OF THE PUBLIC RECORD OF BAY COUNTY, FLORIDA Property Address: 129 15th STREET PANAMA CITY, FL 32413 Any person claiming an interest in the surplus from the sale, if any, other than the property owner as of the date of the lis pendens must file a claim within 60 days after the sale. Dated this 19th day of February, 2018. Bill Kinsaul As Clerk of the Court By:Ladyne Swearingen As Deputy Clerk IMPORT ANT AMERICANS WITH DISABILITIES ACT. If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision o fcertain Panama City, FL 32402 or by phone at (850)747-5338 at least seven (7) days before your scheduled court appearance, or immediately upon recieving this notification if the time before the scheduled appearance is less than seven (7) days. If you are hearing impaired, please call 711 or email AD ARequest@ jud14.flcourts.org Submitted by: Robertson, Anschutz & Schneid, P.L. Attorneys for Plaintiff 6409 Congress Ave. Ste 100 Boca Raton, FL 33487 Phone: 561-241-6901 Fax: 561-997-6909 File No.: 17-077762 March 20, 27, 2018 19794 IN THE CIRCUIT COURT, FOURTEENTH JUDICIAL CIRCUITIN AND FOR BAYCOUNTY, FLORIDA Case Number: 18-0262 DR Division: N In Re: The Termination of Parental Rights for the Proposed Adoption of Ahmeera Nicole Boyd, Minor Child NOTICE OF ACTION FOR PETITION TO TERMINATE PARENTALRIGHTS TO: Putative Father with the given name of Tyrone. Further description: black male, average build, brown eyes and black hair. Address is unknown. YOU ARE NOTIFIED that an action for Termination of Parental Rights has been filed against you and that you are required to serve a copy of your written defenses, if any, to it on Michael Hunter Esq., Attorney for Peti tioners, whose address is 29 East 5th S treet, Panama City FL 32401 on or before May 10, 2018 and file the original with the clerk of this Court at the Bay County Courthouse, 533 E. 11t1 Street, Panama City, FL32401, before service on Petitioner or immediately thereafter. If you fail to do so, a default may be entered against you for the relief demanded in the petition. Copies of all court documents in this case, including orders, are available at the Clerk of the CourtÂ’s office. You may review these documents upon request. You must keep the Clerk of the Circuit CourtÂ’s office notified of your current address. (You may file Notice of Current Address, Florida Supreme Court Approved Family Law Form 12.915.). Future papers in this lawsuit will be mailed to the address on record at the clerkÂ’s office. WARNING: Rule 12.285, Florida Family Law Rules of Procedure, requires certain automatic disclosure of documents and information. Failure to comply can result in sanctions, including dismissal or striking of pleadings. DATED: March 14, 2018 BILLKINSAUL Clerk of the Circuit Court By: G. Gladden Deputy Clerk Pub: March 20, 27, April 3, 10, 2018 19798 PUBLIC NOTICE OF INTENT TO ISSUE AIR PERMITS Florida Department of Environmental Protection District/Local Office Draft/Proposed Title V Air Operation Permit No. 0050001-028-AV Draft Air Construction Permit No. 0050001-029-AC Kraton Chemical, LLC, Panama City Facility Bay County, Florida Applicant: The applicant for this project is Kraton Chemical, LLC. The applicantÂ’s responsible official and mailing address are: Mr. Mason Faggert, Plant Manager, Kraton Chemical, LLC, Panama City Facility, 2 South Everitt Avenue in Panama City, Florida 32401-4989. Facility Location: The applicant operates the existing Panama City Facility, which is located in Bay County at 2 South Everitt Avenue in Panama City, Florida. Project: The applicant applied on January 10, 2018 to the Department for a renewed Title V air operation permit. The renewal permit renews Title V Air Operation Permit No. 0050001022-AV, and incorporates the terms and conditions of air construction permit No. 0050001-029-AC, which is being processed concurrently with the renewal permit. Details of the renewal project are provided in the application and the enclosed Statement of Basis. The air construction permit makes changes to the Title V permit text, individual permit conditions, and appendices to address corrections, clarifications, and rule updates to be consistent with current operation. Other minor changes were made as described in the projectÂ’s Technical Evaluation and Preliminary Determination document. The existing facility consists of a crude tall oil plant, tall oil refinery, rosin operations, terpene/resin operations, pinene process area, raw materials and product storage area, and a utilities plant. This facility manufactures products that are made from by-products purchased from Kraft pulp mills. The facility manufactures chemical intermediates and resins which are sold into commerce and used as ingredients in the production of adhesives, plastics, inks, paints, rubber products, roofing material, chewing gum, fragrances, household cleaners, and soap. Emissions of sulfur and volatile organic compounds from the manufacturing processes are controlled by a thermal oxidizer. Emissions of sulfur dioxide and particulate matter from the boiler are controlled by using a low-sulfur, ashless fuel. Nitrogen dioxide emissions are controlled by low-NOx burners. Permitting Authority: Applications for air construction permits are subject to review in accordance with the provisions of Chapter 403, Florida Statutes (F.S.) and Chapters 62-4, 62-210 and 62-212 of the Florida Administrative Code (F.A.C.). The proposed project is not exempt from air permitting requirements and an air permit is required to perform the proposed work. Applications for Title V air operation permits are subject to review in accordance with the provisions of Chapter 403, Florida Statutes (F.S.) and Chapters 62-4, 62-210 and 62-213 of the Florida Administrative Code (F.A.C.). The proposed project is not exempt from air permitting requirements and a Title V air operation permit is required to operate the facility. The Northwest District is the Permitting Authority responsible for making a permit determination for this project. The Permitting AuthorityÂ’s physical and mailing address is: 160 W Government Street, Suite 308, Pensacola, Florida 325025740. The Permitting AuthorityÂ’s telephone number is 850.595. 8300. Project File: A complete project file is available for public inspection during the normal business hours of 8:00 a.m. to 5:00 p.m., Monday through Friday (except legal holidays), at the address indicated above for the Permitting Authority. The complete project file includes the draft air construction permit/revision, the draft/proposed Title V air operation permit, the Statement of Basis, the application, and the information submitted by the applicant, exclusive of confidential records under Section 403.111, F.S. Interested persons may view the draft/proposed permits by visiting the following website: https://fldep.dep.state.fl .us/air/emission/apds/default. asp and entering the permit number shown above. Interested persons may contact the Permitting AuthorityÂ’s project review engineer for additional information at the address or phone number listed above. Notice of Intent to Issue Air Permit: The Permitting Authority gives notice of its intent to issue an air construction permit to the applicant for the project described above. The applicant has provided reasonable assurance that operation of proposed equipment will not adversely impact air quality and that the project will comply with all appropriate provisions of Chapters 62-4, 62-204, 62-210, 62-212, 62-296 and 62-297, F.A.C. The Permitting Authority will issue a final permit in accordance with the conditions of the proposed draft air construction permit unless a timely petition for an administrative hearing is filed under Sections 120.569 and 120.57, F.S. or unless public comment received in accordance with this notice results in a different decision or a significant change of terms or conditions. The Permitting Authority gives notice of its intent to issue a Title V air operation permit to the applicant for the project described above. The applicant has provided reasonable assurance that continued operation of existing equipment will not adversely impact air quality and that the project will comply with all appropriate provisions of Chapters 62-4, 62-204, 62-210, 62-212, 62-213, 62-296 and 62-297, F.A.C. The Permitting Authority will issue a final Title V air operation permit in accordance with the conditions of the draft/proposed Title V air operation permit unless a timely petition for an administrative hearing is filed under Sections 120.569 and 120.57, F.S. or unless public comment received in accordance with this notice results in a different decision or a significant change of terms or conditions. Comments: The Permitting Authority will accept written comments concerning the draft air construction permit for a period of 14 days from the date of publication of the Public Notice. Written comments must be received by the Permitting Authority by close of business (5:00 p.m.) on or before the end of this 14-day period. If written comments received result in a significant change to the draft air construction permit, the Permitting Authority shall revise the draft air construction permit and require, if applicable, another Public Notice. All comments filed will be made available for public inspection. The Permitting Authority will accept written comments concerning the draft/proposed Title V air operation permit for a period of 30 days from the date of publication of the Public Notice. Written comments must be received by the close of business (5:00 p.m.), on or before the end of this 30-day period by the Permitting Authority at the above address. As part of his or her comments, any person may also request that the Permitting Authority hold a public meeting on this permitting action. If the Permitting Authority determines there is sufficient interest for a public meeting, it will publish notice of the time, date, and location in the Florida Administrative Register (FAR). If a public meeting is requested within the 30-day comment period and conducted by the Permitting Authority, any oral and written comments received during the public meeting will also be considered by the Permitting Authority. If timely received written comments or comments received at a public meeting result in a significant change to the draft/proposed Title V air operation permit, the Permitting Authority shall issue a revised draft/proposed Title V air operation permit and require, if applicable, another Public Notice. All comments filed will be made available for public inspection. For additional information, contact the Permitting Authority at the above address or phone number. Petitions: A person whose substantial interests are affected by the proposed permitting decision may petition for an administrative hearing in accordance with Sections 120.569 and 120.57, F.S. Petitions filed by any persons other than those entitled to written notice under Section 120.60(3), F.S., must be filed within 14 days of publication of the Public Notice or receipt of a written notice, whichever occurs first. Under Section 120.60(3), F.S., however, any person who asked the Permitting Authority for notice of agency action may file a petition within 14 days of receipt of that notice, regardless of the date of publication. A petitioner shall mail a copy of the petition to the applicant at the address indicated above, at the time of filing. A petition for administrative hearing must contain the information set forth below and must be filed (received) with the Agency Clerk in the Office of General Counsel, 3900 Commonwealth Boulevard, MS 35, Tallahassee, Florida 32399-3000, Agency_Clerk@dep.sta te.fl.us before the deadline. The failure of any person to file a petition within the appropriate time period shall constitute a waiver of that personÂ’s right to request an administrative determination (hearing) under Sections 120.569 and 120.57, F.S., or to intervene in this proceeding and participate as a party to it. Any subsequent intervention (in a proceeding initiated by another party) will be only at the approval of the presiding officer upon the filing of a motion in compliance with Rule 28-106.205, F.A.C. A petition that disputes the material facts on which the Permitting AuthorityÂ’s action is based must contain the following information: (a) The name and address of each agency affected and each agencyÂ’s file or identification number, if known; (b) The name, address, any email address, telephone number and any facsimile number of the petitioner; the name, address, any email address, telephone number, and any facsimile number of the petitionerÂ’s representative, if any, which shall be the address for service purposes during the course of the proceeding; and an explanation of how the petitionerÂ’s substantial interests will be affected by the agency determination; (c) A statement of when and how each petitioner received notice of the agency action or proposed decision; (d) A statement of all disputed issues of material fact. If there are none, the petition must so indicate; (e) A concise statement of the ultimate facts alleged, including the specific facts the petitioner contends warrant reversal or modification of the agencyÂ’s proposed action; (f) A statement of the specific rules or statutes the petitioner contends require reversal or modification of the agencyÂ’s proposed action including an explanation of how the alleged facts relate to the specific rules or statutes; and, (g) A statement of the relief sought by the petitioner, stating precisely the action the petitioner wishes the agency to take with respect to the agencyÂ’s proposed action. A petition that does not dispute the material facts upon which the Permitting AuthorityÂ’s action is based shall state that no such facts are in dispute and otherwise shall contain the same information as set forth above, as required by Rule 28-106.301, F.A.C. Because the administrative hearing process is designed to formulate final agency action, the filing of a petition means that the Permitt19796 NOTICE OF PUBLIC SALE Coastal Towing and Roadside Service Inc., Gives notice of lien and intent to sell these vehicles on MARCH 26, 2018 @ 9:00am ET at 4610 County Rd 386, Port St Joe, FL 32456 pursuant to subsection 713.78 of the Florida Statutes. Coastal Towing and Roadside Service, Inc. reserves the right to accept or reject any or all bids. 2006 Kia KNAGE123265024905 2008 Chevy KL1TD56628B157630 Pub: March 20, 2018

PAGE 26

CLASSIFIEDSD D 2 2 Tuesday, March 20, 2018| The News Herald Join our Team Apply in person:275 South Highway 79 Panama City Beach, FLWeb ID#:34381001850-249-7200www.sandbarpcb.com Working The Sandbar Life! Experience Preferredas a hostess line cook server bartenders, and bussers. Are the positions available for hire NF-1178710 Elite HousekeeperHiring Elite Housekeeper, full-time, Destin, M-F. We are seeking a domestic assistant to help the House and Kitchen Manager. Must be able to perform heavy cleaning with a great attitude. Some produce prep included. Are you helpful and willing? Pet friendly? This is a happy work environment, please only individuals with high energy apply! Possible salary with benefits for the right candidate. Send resume to: asterling2017@yahoo.com NOW HIRING!Alice’s on Bayview is looking for experienced staff for full service casual restaurant in Historic St. Andrews! Come join our team and work with great staff and serve awesome guests in a beautiful location. Qualities we are looking for include:  2 Years full service restaurant experience preferred. Positive attitude Well groomed Dependability Team player Apply in person from 2:00pm until 4:00pm at 1000 Bayview Avenue Office ManagerAn established flooring company, 20 plus successful years, located in Panama City Beach is seeking to add a motivated Office Manager to our team. Pay is depending on experience. Bachelor Degree in Accounting / Business required. 3-5 Years of Management experience. Position will handle some HR tasks. Please send resumes to erin@classiccarpetspcb.com No phone calls please. Sales PersonAn established flooring company, 20 plus successful years, located in Panama City Beach is seeking to add a motivated sales person to our team. Prior flooring/construction/Designer/Retail experience is preferred Professional appearance and demeanor Self-motivated team player w/strong work ethic Ability to read blueprints, field measure and calculate measurements, for design and job processing Working independently as well w/other team members Interior design skills in coordinating tile, wood, carpet, and other flooring within the setting. RFMS software knowledge This position is a high potential commission job w/draw to get you started. We request candidates submit their resume Bill@classiccarpetspcb.com No phone calls please. Seasonal Laborers Needed!Now hiring full-time, seasonal roadside weed-eating and litter removal laborers. Starting rate $11.00/hour. M-F with some Saturdays possible. Work performed in Bay and Calhoun counties. Please contact AARK Enterprises at 850 532 7645 or info@aarkenterprises.com using subject heading JOB. ing Authority’s final action may be different from the position taken by it in this written notice of Intent to Issue Air Permit. Persons whose substantial interests will be affected by any such final decision of the Permitting Authority on the application have the right to petition to become a party to the proceeding, in accordance with the requirements set forth above. Mediation: Mediation is not available for this proceeding. EPA Review: EPA has agreed to treat the draft/proposed Title V air operation permit as a proposed Title V air operation permit and to perform its 45-day review provided by the law and regulations concurrently with the public comment period, provided that the applicant also transmits an electronic copy of the required proof of publication directly to EPA at the following email addresses: R4TitleVFL@epa.gov. Although EPA’s 45-day review period will be performed concurrently with the public comment period, the deadline for submitting a citizen petition to object to the EPA Administrator will be determined as if EPA’s 45-day review period is performed after the public comment period has ended. The final Title V air operation permit will be issued after the conclusion of the 45-day EPA review period so long as no adverse comments are received that result in a different decision or significant change of terms or conditions. The status regarding EPA’s 45-day review of this project and the deadline for submitting a citizen petition can be found at the following website address: http://www2. epa.gov/caa permit ting/florida proposed tit le v permits Objections: Finally, pursuant to 42 United States Code (U.S.C.) Section 7661d(b)(2), any person may petition the Administrator of the EPA within 60 days of the expiration of the Administrator’s 45-day review period as established at 42 U.S.C. Section 7661d(b)(1), to object to the issuance of any Title V air operation permit. Any petition shall be based only on objections to the permit that were raised with reasonable specificity during the 30-day public comment period provided in the Public Notice, unless the petitioner demonstrates to the Administrator of the EPA that it was impracticable to raise such objections within the comment period or unless the grounds for such objection arose after the comment period. Filing of a petition with the Administrator of the EPA does not stay the effective date of any permit properly issued pursuant to the provisions of Chapter 62-213, F.A.C. Petitions filed with the Administrator of EPA must meet the requirements of 42 U.S.C. Section 7661d(b)(2) and must be filed with the Administrator of the EPA at: U.S. Environmental Protection Agency, Office of the Administrator, 1200 Pennsylvania Avenue, N.W., Mail Code: 1101A, Washington, DC 20460. For more information regarding EPA review and objections, visit EPA’s Region 4 web site at http://www2. epa.gov/caa permit ting/florida proposed tit le v permits Pub: March 20, 2018 19780 IN THE CIRCUIT COURT OF THE FOURTEENTH JUDICIAL CIRCUIT IN AND FOR BAY COUNTY, FLORIDA GENERAL JURISDICTION DIVISION CASE NO. 17000911CA WELLS FARGO BANK, N.A., AS TRUSTEE FOR THE POOLING AND SERVICING AGREEMENT DATED AS OF AUGUST 1, 2005 PARK PLACE SECURITIES, INC. ASSET-BACKED PASSTHROUGH CERTIFICATES SERIES 2005WHQ4, Plaintiff, vs. KATHY L. OVERMAN; UNKNOWN SPOUSE OF KATHY L. OVERMAN; BAY MEDICAL CENTER, et al. Defendant(s). NOTICE OF FORECLOSURE SALE NOTICE IS HEREBY GIVEN pursuant to a Final Judgment of Foreclosure dated February 1, 2018, and entered in 17000911CA of the Circuit Court of the FOURTEENTH Judicial Circuit in and for Bay County, Florida, wherein WELLS FARGO BANK, N.A., AS TRUSTEE FOR THE POOLING AND SERVICING AGREEMENT DATED AS OF AUGUST 1, 2005 PARK PLACE SECURITIES, INC. ASSET-BACKED PASSTHROUGH CERTIFICATES SERIES 2005WHQ4 is the Plaintiff and KATHY L. OVERMAN; UNKNOWN SPOUSE OF KATHY L. OVERMAN; BAY MEDICAL CENTER are the Defendant(s). Bill Kinsaul as the Clerk of the Circuit Court will sell to the highest and best bidder for cash at www .bay .realfore close.c om at 11:00 AM, on May 2, 2018 the following described property as set forth in said Final Judgment, to wit: LOT 35, BLOCK A, FOREST HILLS UNIT THREE, AS PER PLAT RECORDED IN PLAT BOOK 12, PAGE 38 OF THE PUBLIC RECORDS ON FILE WITH THE CLERK OF THE CIRCUIT COURT OF BAY COUNTY, FLORIDA. Property Address: 937 AGNES SCOTT CIR, PANAMA CITY, FL 32405 Any person claiming an interest in the surplus from the sale, if any, other than the property owner as of the date of the lis pendens must file a claim within 60 days after the sale. Dated this 2nd day of February, 2018. Bill Kinsaul As Clerk of the Court By: Sharon Chambers As Deputy Clerk IMPORT ANT AMERICANS WITH DISABILITIES ACT. If you are a person with a disability who needs any accommodation in order to participate in this proceeding, you are entitled, at no cost to you, to the provision of certain assistance. Please contact the ADA Coordinator by mail at P.O. Box 1089, Panama City, FL 32402 or by phone at (850)7475338 at least seven (7) days before your scheduled court appearance, or immediately upon receiviong this notification if the time before the scheduled appearance is less than seven (7) days. If you are hearing impaired, please call 711 or email AD ARequest@ jud14.flcourts.org Submitted by: Robertson, Anschutz & Schneid, P.L. Attorneys for Plaintiff 6409 Congress Ave. Ste 100 Boca Raton, FL 33487 Phone: 561-241-6901 Fax: 561-997-6909 File No.: 17-073703 March 20, 27, 2018 19808 IN THE FOURTEENTH JUDICIAL CIRCUIT COURT FOR BAY COUNTY CASE NO: 18-177 CP IN RE: ESTATE OF DEAN PAUL HIGHFIELD NOTICE TO CREDITORS The Administration of the Estate of Dean Paul Highfield deceased, Case Number 18-177 CP is pending in the Circuit Court for Bay County, Florida, 300 E. 4th Street, Panama City, Florida 32401. The name and addresses of the Personal Representative and her attorney are set forth below. All creditors of the decedent and other persons having claims or demands against decedent’s estate including unmatured, contingent or unliquidated claims on whom a copy of this notice is serviced must file their claims with this Court WITHIN THE LATER OF 3 MONTHS AFTER THE DATE OF OF THE FIRST PUBLICATION OF THIS NOTICE OR 30 DAYS AFTER THE DATE OF SERVICE OF A COPY OF THIS NOTICE ON THEM. All other creditors of the decedent and other persons having claims or demands against decedent’s estate, in cluding unmatured contingent or unliquidated claims must file their claims with this Court WITHIN 3 MONTHS AFTER THE DATE OF THE FIRST PUBLICATION OF THIS NOTICE. ALL CLAIMS, DEMANDS AND OBJECTIONS NOT SO FILED WILL BE FOREVER BARRED. The date of the first publication of this notice is March 20, 2018. Personal Representative: Shirley J. Graf 5623 Bermuda Dunes Lake Worth, FL 33463 Attorney for Personal Representative: Russell R. Stewart FL Bar 106064 900 E. 4th Street Panama City, FL 32401 Phone: 850-769-1682 Fax: 850-763-0929 email: rrsfl@comcast. net March 20, 27, 2018 19800 REQUEST FOR PROPOSALS EXECUTIVE SEARCH FIRM SERVICES The City of Panama City is seeking proposals from qualified individuals or firms to conduct professional services to complete an executive search for the recruitment of a City Manager. Proposals may be submitted in person at the Purchasing Department, or via U. S. mail or courier service. Sealed packages must be plainly marked, “RFP PC 18-023 ~ EXECUTIVE SEARCH FIRM SERVICES ~ APRIL 11, 2018” along with the firm’s name and address. Please review all documents pertaining to this request before submitting requested information. Proposals will be accepted until 2:00 p.m., CDT, on Wednesday, April 11, 2018. Specifications may be obtained at the Purchasing Department, 519 East 7th Street, Panama City, Florida, telephone (850) 872-3070, or our website www pcgov .org The City of Panama City reserves the right to reject any one or all proposals, or any part of any proposal, to waive any informality in any proposal, and to award a contract deemed to be in the best interest of the City. CITY OF PANAMA CITY BECKY BARNES PURCHASING AGENT Pub: March 20, 2018 Grey Short Hair Mittenpawwith white feet. Male. Fixed. Purple collar and gold flea collar. Missing since Feb. Last seen in Lagoona Beach Area, off of Vespavia Street, by the Sun and Sand motel. Answers to Fuffums. 850-533-5857 We Buy Anything OldItems we buy include: Signs (Gas and Oil, Soda, Tobacco, etc.) Images (Time Types, Ambrotypes, CDVs, etc) Antique Weaponry, Primitives, Antique Furniture, Clocks, Country Store Items, Jewelry. Taxisdermy, Oddities, Pottery, Architectural Items, Militaria, Folk Art, Lamps and a whole lot more! We pay cash! Contact Kris Clark 706 474 3443 Appliances for SaleWasher and Dryer, Whirlpool brand washer, like new $200.00 Frigid Air brand Dyer, works like new $75.00 Contact: 850-890-8202 Cemetery SpaceAt Evergreen Memorial Cemetery Garden of The Last Supper. $2,100 Call 850-527-5574 txt FL90145 to 56654 FREON R12 WANTED Certified buyer will pickup, pay cash for R12 cylinders, and cases of cans. 312-291-9169 www .Refrigerant Finders.com Rachel’s Dress ShopEquipment for sale, Clothing store racks, Double, round and spiral racks available. All chrome equipment Asking $40.00 each. Call: 850-763-8483 Accounts Receivable RepresentativeFull time. Computer & communication skills needed. Please email resumes to: chaversstorage2@ gmail.com Local Company Needs A & B CDL Drivers and Truck Mechanics 850-769-8031 Anytime Tree Removal LLCis now hiring Class A & B CDL Drivers. Experienced Tree Climber Experienced Bucket Truck Operator Top Pay. Call 850-628-0211 CDL DriverContainer drayage. Good pay/benefits. Dispatched to & from Panama City, FL. No more than 2 nights away at a time. 1 year OTR exp. required. Send resume to Bienville.trucking@ gmail.com Emerald Falls 8602 Thomas Dr. Cobra Adventure Park 9323 Front Bch Rd.Now Hiring18 and older Ride Attendants Cashiers Multiple PositionsPick up applications at Emerald Falls or Cobra Adventure Park Experienced Cabinet PersonPanama Cabinet Company is currently accepting applications. Please send or bring your resume to: 3637 N. Highway 231 Panama City Fl 32404. 850-769-3518 Experienced• Managers •Asst Managers •Sales PersonelHeatwave & Purple Haze Now Hiring FT/PT -year round. Great pay. Great work environment. Apply at 10015 Front Beach Rd. Or fax to 850-234-9911 HVAC HelperWith benefits. 3 years documented exper. in the field. To apply, go to: www .bay .k12.fl.us Employment Opportunities, Support. For additional assistance call 850-767-4231 Deadline to apply is: 4:30pm on 03/26/2018 HVAC Service TechPd vacation & holidays. Med Ins, Retirement. DFWP. EOE. Tarpon Dock Air Conditioning (850) 785-9568 LandscapingHiring for all positions in landscape construction and lawn maitenance. Good pay. Benefits. Year round employment. Apply at Noles Scapes 1812 West 27th Street Panama City, FL 850-248-0973 No drug users, please. Stock Clerk/ Sales ClerkPT/ FT. All shifts. Apply between 9am-12 7 days per week. Shell Port 9949 Thomas Dr. PCB. Retirees welcome $2999-NEW METAL ROOF for the Doublewide!! (up to 28x60) Licensed & Insured. Guyson Construction & Roofing (850) 258-5856 CALLTODAY ActionTree.NetBest Prices in Town Lic/Insured, Firewood, Call/Text 850-527-7017 Anytime Tree Removal!850-265-9794Text FL81660 to 56654 Creamer’s Tree ServiceCall Jason @ (850)832-9343 COLE’S PAINTINGPressure Washing. Insured850-774-1291 $2999-NEW METAL ROOF for the Doublewide!! (up to 28x60) Licensed & Insured. Guyson Construction & Roofing (850) 258-5856 CALLTODAY $2999-NEW METAL ROOF for the Doublewide!! (up to 28x60) Guyson Construction & Roofing Lic # CCC1330599 (850) 258-5856 CALLTODAY BJs Lawn & Tree Service! Offering 25% off tree removal! Licensed & Insured. Free Estimates! Accepting all major credit cards! (850) 596-4642 J3’s Lawn and Palm, LLCRetired Military looking to maintain your Lawn, we also Pressure Wash, and trim Palm Trees. Call or text Kay or James at 850-768-4589 or 850-703-1706. Discount for more than one customer in your general area. Steve Hauling and Land ClearingLand clearing, fill dirt, rock and clay. Free estimates. 850-896-4237 Home Repairs Any Job, Large Or Small. New Installs, Kitchens, Baths Paint, Tile, Wood rot, Electric, Plumb. Robert 850-832-7972 Int/ext painting, Clean-ups/sod, pressure washing, rock/flower beds, lawns.Save 20% Call Roy 850-303-8526 Able Lawn ServiceWe Show Up! Weekly & Bi-Weekly services starting from $35-PCB 596-4383/258-5072 Total Care Of Your Loved OnesIn Your Home, Refs, 20 Years Exp,Day or Night!850-960-1917 Alonzo Caudill Painting, Drywall, Yard Clean-Up, Carpenter Repairs & Pressure Cleaning Licensed & Insured. 850-303-9669 Don’s Home RepairPainting, Tile, Windows, Doors, General Carpentry, Metal Roofs, Kitchen/Bath, Pressure Washing, Plumbing Demo/Junk. Insured. 850-630-9690 ACLASSIC TOUCH An Honest Person To Clean Your Home, Office Or Condo, Lic/Ins, 18yrs exp, Free Est Call Lauri 774-3977 txt FL88189 to56654 Duncan Concrete Exp. & Ins. Driveway & Patio Specialist 850-896-1574 WHITE’S CONCRETESpring Special Lic. Ins.& 40yrs.exp. 874-1515 / 896-6864 Private Home Health Care24 Years of Experience. Referrences Available. Call: (850) 630-5451 If you didn’t advertise here, you’re missing out on potential customers. If you didn’t advertise here, you’re missing out on potential customers. SELL ALL YOUR ITEMSthrough classified.CALL 747-5020 Call To Place An Ad In Classifieds. 747-5020 Spot Advertising works!

PAGE 27

CLASSIFIEDSThe News Herald | Tuesday, March 20, 2018 D D 3 3 NF-1179074 2007 Toyota TundraNice Truck, Clean, #973 Sale Price: $19,992 BillCramerGM.comOver 200 UsedPartial List Below Plus tax, title, license, $95 electronic 2251 West 23rd St. Panama City, FL850-250-5489877-361-1815 BillCramerGM.com 2002 Nissan Frontier King Cab, XE, #753 Sale Price: $5,993 2012 Mazda CX-9 Auto, V6, Leather, #138 Sale Price: $10,9912013 Cadillac XTSAuto, V6, FWD, #105 Sale Price: $19,5932017 RAMT Promaster 1500AM/FM/MP3, V6, #018 Sale Price: $19,994 2017 Chevy Silverado 2500 4WD, High Country, #283 Sale Price: $62,491 2013 Nissan 370Z Manual, Touring, #189 Sale Price: $19,495 Nice Truck, Cl l Cl Cl Cl Cl Cl Cl Cl Cl Cl C ea ea ea ea ea ea ea ea ea ea ea ea ea n, n n n n n n n n n #97 3 Sale Pr Pr Pr Pr Pr Pr Pr Pr Pr Pr Pr Pr Pr ic ic ic ic ic ic ic ic ic ic ic ic ic e: $ $ $ 19 19 19 19 19 19 19 19 9 19 19 19 19 19 19 19 19 19 19 19 19 9 9 9 9 9 9 9 9 9 9 9 ,9 ,9 ,9 9 9 9 9 ,9 ,9 9 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 ShopHERE2017 Chevy Malibu Auto, Turbo 4 Cylinder, #291 Sale Price: $27,992 2013 Chevy Suburban 4 Wheel Drive, LTZ, #969 Sale Price: $29,995 2004 Chevy Corvette Auto, Convertible, #765 Sale Price: $17,994 2014 Toyota Camry Auto, V6, LS, #608 Sale Price: $10,995 2018 Chevy Colorado Crew Cab, 4WD, #084 Sale Price: $32,991 2012 Chevy Camaro 6 Speed, ZL1, #041 Sale Price: $36,991 2017 Chevy Equinox Auto, Cloth Seats, LT, #023 Sale Price: $20,994 2017 Jeep Compass Manual, Sport, #885 Sale Price: $15,9942016 Mercedes GLE 350Auto, V6, #910 Sale Price: $39,995 NF-1179072 NF-1179075 NF-1179076 CITY OF PANAMA CITY CITY MANAGERThe City of Panama City, Florida, seeks a City Manager. The City of Panama City, the county seat for Bay County, is located in the Florida “panhandle”, is approximately 35 square miles with a population of 37,000+.Panama City is a community with historical charm, southern values, and is still growing. City Manager. Salary commensurate with training and experience, plus generous benefits.A five member commission (Mayor and four commissioners) elected for four year, nonpartisan staggered terms. $100M operating budget; 524 employees.A bachelor’s degree in public/business/administration/finance/economic/related field and a minimum three years’ experience in local government management or other equivalent experience is required;a master’s degree in public administration or business administration is preferred. Ideal candidate should have experience in dealing with a variety of economic .development issues, financial management, community re-development and considerable skills in leadership, inclusive of the ability to motivate and foster a team-oriented atmosphere.Must be self-motivated, enthusiastic and have an ability to build trust.Also needs to be a visionary for short and long-range planning and interface well with personnel and the community.Work in a first-class employment environment that takes pride in enhancing quality of life for citizens and employees. Resumes and Applications will be accepted until March 30th 2018 Please apply on city website: PCGO V .ORG Countertop InstallerEstablished countertop business seeks granite/stone countertop installer or install helper. Experience preferred. Will train motivated person. Hours of work are M-F, with each work day starting at 7am. Benefits available: 401K, health insurance, and more! Family-oriented team. Pay based on experience, and is renegotiable after a brief period. Come grow with us! Apply through this ad anytime. Apply on-site M-F, 10am-4pm: 635 Briggs Ln, Southport, FL 32409. HELP WANTEDLOOKING FOR MAINTENANCE ASSISTANT, BEACH ATTENDANTS, AND BANANABOAT OPERATOR. ALLPOSITIONS GUARANTEE SALARY. INQUIRE AT: ED’S SHEDS 8224 PANAMACITYBCH PKWY, PCB, FL MON -FRI 8:30 -12 AND 1-4:30 NO PHONE CALLS PLEASE. Medical ReceptionistFull Time Position Monday thru Friday Busy Medical Practice looking for anExperienced Insurance Verification/ New Patient Coordinator.Required Qualifications:  Must have a medical background, and able to work well with others and alone. Ability to multi-task and possess excellent organizational skills.  Ability to efficiently handle heavy patient volumes.  Good communication skills and ability to present themselves in a professional manner at all times, by being compassionate and courteous.  Ability to type and experience with electronic medical records.  Willing to learn new skills. Be professional, and willing to follow clinic dress code. Have reliable transportation. Be team oriented and work well with others.Email resume to: neuroclinicspec@gmail.com Lynn Haven Water FrontBeautiful lot for sale by owner, located off 9th street on Iowa ave. in Lynn Haven. Lot has appx. 84 feet of water front on Anderson Bayou; deep water with easy access to bay and gulf. Appx.250 feet deep and cleared. Lot is high and dry and will not require flood insurance. Priced at $255,000 for quick sale; call 850-814-9577 or 850-258-9053 Plumber ServiceExperience. Salary DOE. Established company F/T. Please call Franklin Plumbing at 850-234-2168 Tow Truck DriverApplicant needs to be 25 years or older, experienced preferred, Apply at 2798 East 5th Street Panama City, FL 32401 Callaway Village Square221-B N. Tyndall Parkway; General Retail Space; 1700 sq. ft; Available Immediately; Contact (850) 814-2998 L ynn Haven Comfortable, clean, furn, 1 br., 1 person APT, no pets. w/s/g incl. $650/mo. 850-265-4535 Publisher’s NoticeAll real estate advertising in this newspaper is subject to the Fair Housing Act which makes it illegal to advertise “any preference, limitation or discrimination based on race, color, religion, sex, handicap, familial status or national origin, or an intention, to make any such preference, limitation or discrimination” Familial status includes children under the age of 18 living with parents or legal custodians, pregnant women and people securing custody of children under 18. This newspaper will not knowingly accept any advertising for real estate which is in violation of the law. Our readers are hereby informed that all dwellings advertised in this newspaper are available on a equal opportunity basis. To complain of discrimination call HUD toll-free at 1-800-669-9777. The toll-free number for the hearing impaired is 1-800-927-9275. St. Andrews 2br/ 1ba, s mall pets ok. W/D hookups, 850-527-6879 Text FL90709 to 56654 Callaway, FL 6509 Pridgen StreetHOUSE FOR RENTVery close to town 2br, 1.5 baths Includes W/D. Asking $810 monthly Security deposit $850 Available in March! Call: 850-358-8297 Callaway: 2br 1ba, $550 +dep. No pets. Call (850)785-7341 or (850)814-3211 Text FL90515 to 56654 ! ! ! Sell It Today!I BUYHOUSESPretty or Ugly763-7355ibuyhousesprettyorugly.comText FL75823 to 56654 $80,900!GRAND LAGOON COVE 6903 North Lagoon #21, PCB, FL 32408 1BR/1B UPDATED! Comm Pool & Docks.Cynthia Luster Coastal Property Services 850-691-7927 3712 E Third StPanama City, FL 3800 Sqft whse space w/ 3 offices! $135,500 Cynthia LusterCoastal Property Services850-691-7927 395 Wahoo Rd. Dock your yacht behind your house in this 3bd/2ba.Bay Point Canal Home! $379,000Bay Point Real EstateCall Ray Young (850) 832-9999 3102 Preserve Rookery Blvd. Fabulous 4bd/5ba executive home in the gated Preserve community. $659,900Bay Point Real EstateCall Ray Young (850) 832-9999 Pirate’s Cove at 204 Cain Road Lake Powell 1bd/1ba Condo approx. 800 sq.ft. furnished, pools, private boat ramp, covered parking. $150K Call (850) 832-2782 or (850) 819-6929 t xt FL87402 to 56654 99 Acre Farm for Sale4500 River Road Sneads, FL 32460 Jackson County, FL Hwy 271615ft of highway frontage, Two barns, House (Needs Renovating), Two 4” water wells, One 8” water well, totally fenced/cross fenced, gates, perm pastures, holding pens/carral, pond, aprox 10 acres of hardwood/pines. Located 1 1/2 miles from Public boat ramps, to Lake Seminole and the Chattahoochee River. Asking price $310,000. Contact: 850-557-2209 2007 Acura TL Navigation4 door, 3.2L V6, Automatic, AC, XM/Sirus Radio w/Bluetooth. All power options, leather, factory powered sunroof. Carfax, 1 owner, no accidents, only 88,326 miles. Carfax Retail -$10,090 Sale Price -$6,995. Call Bay Auto Outlet 850-265-3535 Cadillac XTS, ’13, auto, v6, xle, #105, $19,593! Bill Cramer GM, Panama City 850-2505981. Chevy Camaro, ’15, auto, ss, #323, $26,994! Bill Cramer GM, Panama City 850-250-5981. Chevy Cruze, ’11, auto, turbo 4 cylinder, #034, $13,992! Bill Cramer GM, Panama City 850-250-5981. Chevy Spark, ’13, hatchback, 1lt, #013, $7,992! Bill Cramer GM, Panama City850-250-5981. Ford Fiesta, ’15, am/fm/cd, manual, #089, $9,991! Bill Cramer GM, Panama City 850-250-5981. Kia Optima, ’14, am/fm/cd/mp3, #004, $11,900! Bill Cramer GM, Panama City 850-250-5981. Nissan 370z, ’13, manual, touring, #189, $19,495! Bill Cramer GM, Panama City 850-250-5981. Subaru Impreza, ’12, auto, leather, #929, $11,992! Bill Cramer GM, Panama City 850-250-5981. Toyota Camry, ’14, auto, 4 door, $10,995! #608, Bill Cramer GM, Panama City 850-2505981. 2006 GMC Envoy, 1 owner, low miles, LTRH, sunroof, all service records $7,495, call Jack 850-307-3476 2009 Mercedes E-350, 75K miles, NAV, sunroof, immaculate, value price $11,995, call Jack 850-307-3476 2010 Chevy Camaro, 1 owner, 46K miles, AT, excellent cond., value price $12,995, call Jack 850-307-3476 2010 Toyota Venza, 1 owner, 69K miles, sunroof, beautiful offer, value price $11,995, call Jack 850-307-3476 2013 Cadillac SRX, 44K miles, LTHR, NAV, blindside alert, new tires, hurry for this one, $23,995, call Jack 850-307-3476 2016 Buick Lacrosse, Premium, 1 owner, 8K miles, over 42K new, value price $25,995, call Jack 850-307-3476 2016 Buick Lacrosse, Premium, 1 owner, 8K miles, over 42K new, value price $25,995, call Jack 850-307-3476 Cadillac Escalade, ’16, auto, leather, #317, $58,994! Bill Cramer GM, Panama City 850-250-5981. Chevy Suburban, ’13, 4wd, ltz, $29,995! #969 Bill Cramer GM, Panama City 850-2505981. Chevy Tahoe, ’13, auto, v8, lt, #202, $26,991! Bill Cramer GM, Panama City 850-250-5981. Chevy Trax, ’15, siriusxm, lt, #056, $15,992! Bill Cramer GM, Panama City 850-250-5981 Ford Edge, ’14, auto, v6, limited, #361, $22,893! Bill Cramer GM, Panama City 850-250-5981. Jeep Compass, ’17, manual, sport, #885, $15,994! Bill Cramer GM, Panama City 850-250-5981. Toyota Rav4, ’10, auto, 4wd, #429, $12,493! Bill Cramer GM, Panama City 850-2505981. 1999 Dodge Ram V6Very good condition, $3500 or best offer. Call: 330-310-3072 2006 Dodge Dakota TruckSLT package, automatic, 49179 miles, original owner, asking $11000. Call: 850-441-3634 2011 Ford Ranger Sport 4x4Extended, 5-speed, 30k miles. 4.0 motor, tow package, news tires, toolsbox and brush guard included. Good condition, runs great, $11,000, Call 850-230-3420 2013 Hyundai Santa Fe, 37K miles, super cond., value price $14,995, call Jack 850-307-3476 2015 Cadillac ATS, 1 owner, 36K miles, new tires, LTHR, value price $21,995, call Jack 850-307-3476 2016 GMC Canyon, 1 owner, V6, 16K miles, warranty, value price $27,995, call Jack 850-307-3476 Chevy Silverado 2500, ’17, 4wd, high country, #283, $62,491! Bill Cramer GM, Panama City 850-250-5981. Ford F-150, ’10, supercrew, platinum, #397, $18,791! Bill Cramer GM, Panama City 850-250-5981 GMC Canyon, ’15, certified, 2wd, slt, #453, $27,991! Bill Cramer GM, Panama City 850-250-5981. Nissan Frontier, ’02, king cab, xe, #753, $5,993 Bill Cramer GM, Panama City 850-2505981. Toyota Tundra, ’13, 4wd, crewmax, #909, $27,994! Bill Cramer GM, Panama City 850-250-5981. WANTED: LOOKING TO BUY JON BOATApprox 12-14” feet long. With electric motor and trailer. All in Like new condition. Contact: 850-238-0446 2010 Tioga SLFleetwood manufactor Class C, two slides, 32 feet long, 29k miles. $39,500 asking price. Good condition. Call: 850-871-3071 or 850-832-3325 If you didn’t advertise here, you’re missing out on potential customers. Buy it! Classified. Make your move to the medium that’s your number one source of information about homes for sale! For all your housing needs consult Classified when it’s time to buy, it’s the resource on which to rely.

PAGE 28

CLASSIFIEDSD D 4 4 Tuesday, March 20, 2018| The News Herald NF-1179013

PAGE 29

** Tuesday, March 20, 2018 PANAMA CITY www.newsherald.com

PAGE 30

**