University Press of Florida

A Comprehensive Outline of World History

Buy This Book ( Related URL )

Material Information

A Comprehensive Outline of World History
Physical Description:
Maxfield, Jack E. ( Author, Primary )
Connexions, Rice University
Place of Publication:
Houston, TX
Publication Date:


Subjects / Keywords:
world history, ancient history, modern history, regional history, OGT+ ISBN: 9781616100025
European History, Greek Civilization, History, Medieval History, Middle Eastern History, Non Western Civilization, World History
Social Studies / World history


This free PDF textbook presents Jack E. Maxfield's "A Comprehensive Outline of World History" as originally organized, chronologically by era and across regions within an era. Each chapter covers a period of historical time (e.g. a century). Sections within chapters describe what was going on in every geographical region of the world; each section provides a reference for that region in the subsequent chapter, i.e. in the next time period. The reader can thus get a snapshot of the entire world at a point in time by reading one chapter, or can follow the history of a region through time by linking to sections in successive chapters.
General Note:
General Note:
11, 12, Community College, Higher Education
General Note:
General Note:
Adobe PDF
General Note:
Jack E. Maxfield
General Note:
General Note:
General Note:

Record Information

Source Institution:
University Press of Florida
Holding Location:
University Press of Florida
Rights Management:
Copyright © 2008 Jack E. Maxfield. This selection and arrangement of content is licensed under the Creative Commons Attribution License:
Resource Identifier:
isbn - 9781616100025
System ID:

This item is only available as the following downloads:

Full Text


AComprehensiveOutlineofWorldHistory By: JackE.Maxeld


AComprehensiveOutlineofWorldHistory By: JackE.Maxeld Online: < > CONNEXIONS RiceUniversity,Houston,Texas


JackE.Maxeld ThisselectionandarrangementofcontentislicensedundertheCreativeCommonsAttributionLicense:


TableofContents Foreword ..............................................................................................1 Introduction ...........................................................................................3 TheMechanicsofandSomeProblemsofthePresentation ................................................5 1TheMethodofGeographicalPresentation 1.1 IntroductiontotheMethodofGeographicalPresentation..........................................7 1.2 GeographicalPresentationofAfrica.............................................................7 1.3 GeographicalPresentationofTheNearEast......................................................9 1.4 GeographicalPresentationofEurope...........................................................11 1.5 GeographicalPresentationofCentralandNorthernAsia..........................................14 1.6 GeographicalPresentationofTheIndianSubcontinent...........................................15 1.7 GeographicalPresentationofTheFarEast......................................................18 1.8 GeographicalPresentationofThePacic........................................................19 1.9 GeographicalPresentationofAmerica..........................................................20 Solutions......................................................................................... ?? 2Beginningto8000B.C. 2.1 Beginningto8000B.C........................................................................27 2.2 Africa:Beginningto8000B.C.................................................................35 2.3 TheNearEast:Beginningto8000B.C..........................................................36 2.4 Europe:Beginningto8000B.C................................................................38 2.5 CentralandNorthernAsia:Beginningto8000B.C...............................................39 2.6 TheIndianSubcontinent:Beginningto8,000B.C................................................40 2.7 TheFarEast:Beginningto8000B.C...........................................................40 2.8 ThePacic:Beginningto8000B.C.............................................................41 2.9 America:Beginningto8000B.C...............................................................42 Solutions......................................................................................... ?? 38000to5000B.C. 3.1 8000to5000B.C.............................................................................47 3.2 Africa:8000to5000B.C......................................................................48 3.3 TheNearEast:8000to5000B.C...............................................................48 3.4 Europe:8000to5000B.C.....................................................................49 3.5 CentralandNorthernAsia:8000to5000B.C....................................................52 3.6 TheIndianSubcontinent:8000to5000B.C.....................................................52 3.7 TheFarEast:8000to5000B.C................................................................52 3.8 ThePacic:8000to5000B.C..................................................................53 3.9 America:8000to5000B.C....................................................................53 Solutions......................................................................................... ?? 45000to3000B.C. 4.1 5000to3000B.C.............................................................................57 4.2 Africa:5000to3000B.C......................................................................58 4.3 TheNearEast:5000to3000B.C...............................................................60 4.4 Europe:5000to3000B.C.....................................................................62 4.5 CentralandNorthernAsia:5000to3000B.C....................................................65 4.6 TheIndianSubcontinent:5000to3000B.C.....................................................66 4.7 TheFarEast:5000to3000B.C................................................................66 4.8 ThePacic:5000to3000B.C..................................................................67 4.9 America:5000to3000B.C....................................................................68


iv Solutions......................................................................................... ?? 53000to1500B.C. 5.1 3000to1500B.C.............................................................................71 5.2 Africa:3000to1500B.C......................................................................72 5.3 TheNearEast:3000to1500B.C...............................................................74 5.4 Europe:3000to1500B.C.....................................................................80 5.5 CentralandNorthernAsia:3000to1500B.C....................................................85 5.6 TheIndianSubcontinent:3000to1500B.C.....................................................86 5.7 TheFarEast:3000to1500B.C................................................................88 5.8 ThePacic:3000to1500B.C..................................................................89 5.9 America:3000to1500B.C....................................................................90 Solutions......................................................................................... ?? 61500to1000B.C. 6.1 1500to1000B.C.............................................................................93 6.2 Africa:1500to1000B.C......................................................................94 6.3 TheNearEast:1500to1000B.C...............................................................95 6.4 Europe:1500to1000B.C.....................................................................98 6.5 CentralandNorthernAsia:1500to1000B.C...................................................102 6.6 TheIndianSubcontinent:1500to1000B.C....................................................103 6.7 TheFarEast:1500to1000B.C...............................................................103 6.8 ThePacic:1500to1000B.C.................................................................105 6.9 America:1500to1000B.C...................................................................105 Solutions......................................................................................... ?? 71000to700B.C. 7.1 1000to700B.C.............................................................................111 7.2 Africa:1000to700B.C......................................................................111 7.3 TheNearEast:1000to700B.C...............................................................112 7.4 Europe:1000to700B.C......................................................................116 7.5 CentralandNorthernAsia:1000to700B.C....................................................120 7.6 TheIndianSubcontinent:1000to700B.C......................................................120 7.7 TheFarEast:1000to700B.C.................................................................121 7.8 ThePacic:1000to700B.C..................................................................122 7.9 America:1000to700B.C....................................................................124 Solutions......................................................................................... ?? 8700to601B.C. 8.1 Europe:700to601B.C.......................................................................127 8.2 TheIndianSubcontinent:700to601B.C.......................................................130 8.3 TheNearEast:700to601B.C................................................................130 8.4 TheFarEast:700to601B.C..................................................................132 8.5 ThePacic:700to601B.C...................................................................133 8.6 America:700to601B.C.....................................................................133 8.7 CentralandNorthernAsia:700to601B.C.....................................................134 8.8 Africa:700to601B.C.......................................................................135 Solutions......................................................................................... ?? 9600to501B.C. 9.1 600to501B.C...............................................................................137 9.2 Africa:600to501B.C.......................................................................137 9.3 TheFarEast:600to501B.C..................................................................138 9.4 America:600to501B.C.....................................................................140 9.5 CentralandNorthernAsia:600to501B.C.....................................................141


v 9.6 TheIndianSubcontinent:600to501B.C.......................................................142 9.7 TheNearEast:600to501B.C................................................................142 9.8 ThePacic:600to501B.C...................................................................145 9.9 Europe:600to501B.C.......................................................................146 Solutions......................................................................................... ?? 10500to401B.C. 10.1 500to401B.C.............................................................................151 10.2 Africa:500to401B.C......................................................................151 10.3 TheNearEast:500to401B.C...............................................................153 10.4 Europe:500to401B.C......................................................................155 10.5 CentralandNorthernAsia:500to401B.C....................................................159 10.6 TheIndianSubcontinent:500to401B.C......................................................160 10.7 TheFarEast:500to401B.C.................................................................160 10.8 ThePacic:500to401B.C..................................................................162 10.9 America:500to401B.C....................................................................162 Solutions......................................................................................... ?? 11400to301B.C. 11.1 400to301B.C.............................................................................165 11.2 Africa:400to301B.C......................................................................165 11.3 TheNearEast:400to301B.C...............................................................166 11.4 Europe:400to301B.C......................................................................168 11.5 CentralandNorthernAsia:400to301B.C....................................................172 11.6 TheIndianSubcontinent:400to301B.C......................................................173 11.7 TheFarEast:400to301B.C.................................................................173 11.8 ThePacic:400to301B.C..................................................................175 11.9 America:400to301B.C....................................................................175 Solutions......................................................................................... ?? 12300to201B.C. 12.1 300to201B.C.............................................................................179 12.2 Africa:300to201B.C......................................................................179 12.3 TheNearEast:300to201B.C...............................................................182 12.4 Europe:300to201B.C......................................................................183 12.5 CentralandNorthernAsia:300to201B.C....................................................187 12.6 TheIndianSubcontinent:300to201B.C......................................................187 12.7 TheFarEast:300to201B.C.................................................................188 12.8 ThePacic:300to201B.C..................................................................191 12.9 America:300to201B.C....................................................................191 Solutions......................................................................................... ?? 13200to101B.C. 13.1 200to101B.C.............................................................................195 13.2 Africa:200to101B.C......................................................................195 13.3 TheNearEast:200to101B.C...............................................................197 13.4 Europe:200to101B.C......................................................................198 13.5 CentralandNorthernAsia:200to101B.C....................................................201 13.6 TheIndianSubcontinent:200to101B.C......................................................202 13.7 TheFarEast:200to101B.C.................................................................203 13.8 ThePacic:200to101B.C..................................................................205 13.9 America:200to101B.C....................................................................205 Solutions......................................................................................... ?? 14100B.C.to0


vi 14.1 100B.C.to0...............................................................................209 14.2 Africa:100B.C.to0........................................................................209 14.3 TheNearEast:100B.C.to0................................................................210 14.4 Europe:100B.C.to0.......................................................................213 14.5 CentralandNorthernAsia:100B.C.to0.....................................................218 14.6 TheIndianSubcontinent:100B.C.to0.......................................................218 14.7 TheFarEast:100B.C.to0..................................................................219 14.8 ThePacic:100B.C.to0...................................................................221 14.9 America:100B.C.to0......................................................................221 Solutions......................................................................................... ?? 150toA.D.100 15.1 0toA.D.100..............................................................................225 15.2 Africa:0toA.D.100.......................................................................226 15.3 TheNearEast:0toA.D.100................................................................227 15.4 Europe:0toA.D.100.......................................................................229 15.5 CentralandNorthernAsia:0toA.D.100.....................................................234 15.6 TheIndianSubcontinent:0toA.D.100.......................................................235 15.7 TheFarEast:0toA.D.100..................................................................236 15.8 ThePacic:0toA.D.100...................................................................237 15.9 America:0to100A.D......................................................................238 Solutions......................................................................................... ?? 16A.D.101to200 16.1 A.D.101to200............................................................................241 16.2 Africa:A.D.101to200.....................................................................242 16.3 TheNearEast:A.D.101to200..............................................................243 16.4 Europe:A.D.101to200....................................................................244 16.5 CentralandNorthernAsia:A.D.101to200...................................................248 16.6 TheIndianSubcontinent:101A.D.to200....................................................249 16.7 TheFarEast:A.D.101to200...............................................................250 16.8 ThePacic:A.D.101to200.................................................................251 16.9 America:A.D.101to200...................................................................252 Solutions......................................................................................... ?? 17A.D.201to300 17.1 A.D.201to300............................................................................255 17.2 Africa:A.D.201to300.....................................................................256 17.3 TheNearEast:A.D.201to300..............................................................257 17.4 Europe:A.D.201to300....................................................................258 17.5 CentralandNorthernAsia:A.D.201to300...................................................261 17.6 TheIndianSubcontinent:A.D.201to300....................................................261 17.7 TheFarEast:A.D.201to300...............................................................262 17.8 ThePacic:A.D.201to300.................................................................263 17.9 America:A.D.201to300...................................................................264 Solutions......................................................................................... ?? 18A.D.301to400 18.1 A.D.301to400............................................................................267 18.2 Africa:A.D.301to400.....................................................................268 18.3 TheNearEast:A.D.301to400..............................................................269 18.4 Europe:A.D.301to400....................................................................272 18.5 CentralandNorthernAsia:A.D.301to400...................................................277 18.6 TheIndianSubcontinent:A.D.301to400....................................................277


vii 18.7 TheFarEast:A.D.301to400...............................................................278 18.8 ThePacic:A.D.301to400.................................................................279 18.9 America:A.D.301to400...................................................................281 Solutions......................................................................................... ?? 19A.D.401to500 19.1 A.D.401to500............................................................................283 19.2 Africa:A.D.401to500.....................................................................284 19.3 TheNearEast:A.D.401to500..............................................................285 19.4 Europe:A.D.401to500....................................................................288 19.5 CentralandNorthernAsia:A.D.401to500...................................................295 19.6 TheIndianSubcontinent:A.D.401to500....................................................296 19.7 TheFarEast:A.D.401to500...............................................................296 19.8 ThePacic:A.D.401to500.................................................................298 19.9 America:A.D.401to500...................................................................298 Solutions......................................................................................... ?? 20A.D.501to600 20.1 A.D.501to600............................................................................301 20.2 Africa:A.D.501to600.....................................................................302 20.3 TheNearEast:A.D.501to600..............................................................303 20.4 Europe:A.D.501to600....................................................................305 20.5 CentralandNorthernAsia:A.D.501to600...................................................310 20.6 TheIndianSubcontinent:A.D.501to600....................................................311 20.7 TheFarEast:A.D.501to600...............................................................311 20.8 ThePacic:A.D.501to600.................................................................313 20.9 America:A.D.501to600...................................................................313 Solutions......................................................................................... ?? 21A.D.601to700 21.1 A.D.601to700............................................................................317 21.2 Africa:A.D.601to700.....................................................................318 21.3 TheNearEast:A.D.601to700..............................................................319 21.4 Europe:A.D.601to700....................................................................322 21.5 CentralandNorthernAsia:A.D.601to700...................................................326 21.6 TheIndianSubcontinent:A.D.601to700....................................................327 21.7 TheFarEast:A.D.601to700...............................................................327 21.8 ThePacic:A.D.601to700.................................................................330 21.9 America:A.D.601to700...................................................................330 Solutions......................................................................................... ?? 22A.D.701to800 22.1 A.D.701to800............................................................................333 22.2 Africa:A.D.701to800.....................................................................334 22.3 TheNearEast:A.D.701to800..............................................................335 22.4 Europe:A.D.701to800....................................................................337 22.5 CentralandNorthernAsia:A.D.701to800...................................................342 22.6 TheIndianSubcontinent:A.D.701to800....................................................343 22.7 TheFarEast:A.D.701to800...............................................................343 22.8 ThePacic:A.D.701to800.................................................................345 22.9 America:A.D.701to800...................................................................346 Solutions......................................................................................... ?? 23A.D.801to900


viii 23.1 A.D.801to900............................................................................349 23.2 Africa:A.D.801to900.....................................................................350 23.3 TheNearEast:A.D.801to900..............................................................351 23.4 Europe:A.D.801to900....................................................................353 23.5 CentralandNorthernAsia:A.D.801to900...................................................362 23.6 TheIndianSubcontinent:A.D.801to900....................................................363 23.7 TheFarEast:A.D.801to900...............................................................363 23.8 ThePacic:A.D.801to900.................................................................365 23.9 America:A.D.801to900...................................................................366 Solutions......................................................................................... ?? 24A.D.901to1000 24.1 A.D.901to1000...........................................................................371 24.2 Africa:A.D.901to1000....................................................................372 24.3 TheNearEast:A.D.901to1000.............................................................373 24.4 Europe:A.D.901to1000...................................................................375 24.5 CentralandNorthernAsia:A.D.901to1000..................................................382 24.6 TheIndianSubcontinent:A.D.901to1000...................................................383 24.7 TheFarEast:A.D.901to1000..............................................................383 24.8 ThePacic:A.D.901to1000...............................................................386 24.9 America:A.D.901to1000..................................................................386 Solutions......................................................................................... ?? 25A.D.1001to1100 25.1 A.D.1001to1100..........................................................................391 25.2 Africa:A.D.1001to1100...................................................................392 25.3 TheNearEast:A.D.1001to1100............................................................394 25.4 Europe:A.D.1001to1100..................................................................396 25.5 CentralandNorthernAsia:A.D.1001to1100.................................................406 25.6 TheIndianSubcontinent:A.D.1001to1100..................................................407 25.7 TheFarEast:A.D.1001to1100.............................................................407 25.8 ThePacic:A.D.1001to1100..............................................................410 25.9 America:A.D.1001to1100.................................................................410 Solutions......................................................................................... ?? 26A.D.1101to1200 26.1 A.D.1101to1200..........................................................................415 26.2 Africa:A.D.1101to1200...................................................................416 26.3 TheNearEast:A.D.1101to1200............................................................417 26.4 Europe:A.D.1101to1200..................................................................418 26.5 CentralandNorthernAsia:A.D.1101to1200.................................................427 26.6 TheIndianSubcontinent:A.D.1101to1200..................................................427 26.7 TheFarEast:A.D.1101to1200.............................................................428 26.8 ThePacic:A.D.1101to1200..............................................................429 26.9 America:A.D.1101to1200.................................................................430 Solutions......................................................................................... ?? 27A.D.1201to1300 27.1 A.D.1201to1300..........................................................................433 27.2 Africa:A.D.1201to1300...................................................................435 27.3 America:A.D.1201to1300.................................................................438 27.4 TheNearEast:A.D.1201to1300............................................................440 27.5 Europe:A.D.1201to1300..................................................................443 27.6 CentralandNorthernAsia:A.D.1201to1300.................................................454


ix 27.7 TheIndianSubcontinent:A.D.1201to1300..................................................458 27.8 TheFarEast:A.D.1201to1300.............................................................458 27.9 ThePacic:A.D.1201to1300..............................................................461 Solutions......................................................................................... ?? 28A.D.1301to1400 28.1 A.D.1301to1400..........................................................................463 28.2 Africa:A.D.1301to1400...................................................................464 28.3 TheNearEast:A.D.1301to1400............................................................466 28.4 Europe:A.D.1301to1400..................................................................467 28.5 CentralandNorthernAsia:A.D.1301to1400.................................................478 28.6 TheIndianSubcontinent:A.D.1301to1400..................................................480 28.7 TheFarEast:A.D.1301to1400.............................................................480 28.8 ThePacic:A.D.1301to1400..............................................................482 28.9 America:A.D.1301to1400.................................................................482 Solutions......................................................................................... ?? 29A.D.1401to1500 29.1 A.D.1401to1500..........................................................................487 29.2 Africa:A.D.1401to1500...................................................................488 29.3 TheNearEast:A.D.1401to1500............................................................490 29.4 Europe:A.D.1401to1500..................................................................492 29.5 CentralandNorthernAsia:A.D.1401to1500.................................................505 29.6 TheIndianSubcontinent:A.D.1401to1500..................................................506 29.7 TheFarEast:A.D.1401to1500.............................................................507 29.8 ThePacic:A.D.1401to1500..............................................................509 29.9 America:A.D.1401to1500.................................................................509 Solutions......................................................................................... ?? 30A.D.1501to1600 30.1 A.D.1501to1600..........................................................................517 30.2 Africa:A.D.1501to1600...................................................................519 30.3 TheNearEast:A.D.1501to1600............................................................521 30.4 Europe:A.D.1501to1600..................................................................524 30.5 CentralandNorthernAsia:A.D.1501to1600.................................................547 30.6 TheIndianSubcontinent:A.D.1501to1600..................................................548 30.7 TheFarEast:A.D.1501to1600.............................................................549 30.8 ThePacic:A.D.1501to1600..............................................................553 30.9 America:A.D.1501to1600.................................................................554 Solutions......................................................................................... ?? 31A.D.1601to1700 31.1 A.D.1601to1700..........................................................................565 31.2 Africa:A.D.1601to1700...................................................................566 31.3 TheNearEast:A.D.1601to1700............................................................568 31.4 Europe:A.D.1601to1700..................................................................570 31.5 CentralandNorthernAsia:A.D.1601to1700.................................................594 31.6 TheIndianSubcontinent:A.D.1601to1700..................................................595 31.7 TheFarEast:A.D.1601to1700.............................................................597 31.8 ThePacic:A.D.1601to1700..............................................................600 31.9 America:A.D.1601to1700.................................................................601 Solutions......................................................................................... ?? 32A.D.1701to1800


x 32.1 A.D.1701to1800..........................................................................615 32.2 Africa:A.D.1701to1800...................................................................616 32.3 TheNearEast:A.D.1701to1800............................................................618 32.4 Europe:A.D.1701to1800..................................................................620 32.5 CentralandNorthernAsia:A.D.1701to1800.................................................643 32.6 TheIndianSubcontinent:A.D.1701to1800..................................................644 32.7 TheFarEast:A.D.1701to1800.............................................................646 32.8 ThePacic:A.D.1701to1800..............................................................649 32.9 America:A.D.1701to1800.................................................................651 Solutions......................................................................................... ?? 33A.D.1801to1900 33.1 A.D.1801to1900..........................................................................669 33.2 Africa:A.D.1801to1900...................................................................670 33.3 TheNearEast:A.D.1801to1900............................................................676 33.4 Europe:A.D.1801to1900..................................................................679 33.5 CentralandNorthernAsia:A.D.1801to1900.................................................700 33.6 TheIndianSubcontinent:A.D.1801to1900..................................................701 33.7 TheFarEast:A.D.1801to1900.............................................................703 33.8 ThePacic:A.D.1801to1900..............................................................708 33.9 America:A.D.1801to1900.................................................................713 Solutions......................................................................................... ?? 34SpecialSections ...................................................................................739 35Bibliography ......................................................................................741 Bibliography .........................................................................................742 Index ................................................................................................756 Attributions ..........................................................................................760


Foreword 1 AComprehensiveOutlineofWorldHistorywaswrittenandself-publishedbyDr.JackE.Maxeld. Thestructureoftheworkisinnovative.Eachchaptercoversaperiodofhistoricaltimee.g.acentury.Sectionswithin chaptersdescribewhatwasgoingonineverygeographicalregionoftheworld;eachsectionprovidesareferencefor thatregioninthesubsequentchapter,i.e.inthenexttimeperiod.Thereadercanthusgetasnapshotoftheentireworld atapointintimebyreadingonechapter,orcanfollowthehistoryofaregionthroughtimebylinkingtosectionsin successivechapters. Thismodular,linkedstructureisideallysuitedtoweb-basedonlineimplementation,especiallytotheConnexions platform.IampleasedtomakethiscontentavailableonConnexionsfortheenjoymentandenlightenmentofeveryone withaninterestinthehistoryofourworld. RobertMaxeld October2008 MoreDetailsontheOriginofthisMaterial Myfather,Dr.JackEldredMaxeld,wasanorthopedicsurgeonwithadeepinterestinhistory.Heself-published threeeditionsofAComprehensiveOutlineofWorldHistory.The1959rsteditionconsistedof200pageswith8 referencesinthebibliography,andincludedauniquetime-line,hand-drawnandhand-coloredbyhim,showingthe riseandfallofcivilizations.Anoriginalandsixcarboncopiesweretypedfromhishand-writtenmanuscript.Heput thesecopiesintobindersandpresentedthemtomeandmyfriendsashigh-schoolgraduationgifts. Thesecond,hardboundedition,publishedabout1975,wasasinglevolumeof474pages,47bibliographicalreferences, andnumeroushand-drawn,hand-coloredmaps.Idonotknowhowmanycopieswereprinted. Thethirdedition,typedbymyfatheronanelectronictypewriterandpublishedin1984,consistedofthreehardbound volumestotaling1303pagesand322bibliographicreferences.Welloveronehundredcopies,inbatchesof20,were eventuallypublishedasdemandgrew.Thefollowingletterwasincludedwitheachsethegaveaway: Dearfriends: Thesethreevolumesareinnowaytobeconsideredaformalpublication.Theysimplyrepresenttheend resultofsome25yearsofreading,writingandre-writinghistoricalmaterialarrangedinachronological waytosuitmyownfancyandfortheuseofmyfamilyiftheysodesired.Iamhappynowtoincludea fewfriendswhohaveexpressedaninterest. 1 Thiscontentisavailableonlineat. 1


2 Beforeusingthismanuscriptforreferenceorevenforcasualreading,Iwouldsuggestthatyourstperuse thepagesnumberedwithRomannumeralsinVolumeI.Theygivethegeneralplanoftheoutlineand suggestitspurposesaswellasdeningsomeofitslimitations.Pleaseexcuseanyremainingtypographical and/orspellingerrorsandIamsuretherearemany. Bestregards, JackE.Maxeld JackMaxelddiedonSeptember14,2006,atage93.Theoriginal1984typedmanuscriptofAComprehensive OutlineofWorldHistorywasfoundonashelfinhiscloset.In2007,aspecialprinteditionwaspublishedfor hisgrandchildren,futuregenerationsofourfamily,andforspecialfriends.ThankstotheWorldWideWeband Connexionsitisnowavailabletoeveryone.


Introduction 2 BacktoTheForewordSection MyfriendsaskwhyIshouldundertaketowriteaWorldHistory.Aren'ttherealreadyenoughsuchbooksintheEnglish language?Ofcourse.Therearedozens,perhapsscoresofthem,eachwithaparticularpurpose,orscope,orbiasand eachwithsomelimitations.Theveryexcellent TheOutlineofHistory byH.G.Wellswaspublishedsomesixtyplus yearsagoandlacksmuchoftheinformationgainedfromrecentarcheologyandothersciences.Itdevotesonlyabout twopagestotheAztecandIncaempiresandonlyanoccasionalsentenceaboutCentralandSouthAmerica,otherwise. Sub-SaharanAfricaisscarcelymentionedexceptinregardtotheslavetrade.TheDurants'multi-volumework, The StoryofCivilization isabeautifullywrittennarrativewhich,however,getsboggeddowninitslatervolumeswith tiringdetailsoflongagopolitics,royalgenealogiesandreligiousandphilosophicaldialogues.Unfortunately,as withothertexts,italsohassomeinaccuracies.Themorescholarly AStudyofHistory isasomewhatmystical interpretationofArnoldToynbee'spersonalideasofhistory,notinanysenseachronologicalnarrationofhappenings. Ifthereaderisnotalreadywellversedintheessentiallandmarksoftheworld'sfactualhistory,understandingisoften difcult.ThesamemightbesaidofthemorerecentHughThomas' AHistoryoftheWorld ,whichhasnosuggestion ofcontinuityfromthestandpointofdates,butdiscussesonefacetofman'sendeavorsatatime,jumpingfreelyfrom 1,000B.C.toA.D.1,800andbackagain,assumingthatthereaderalreadyknowstheprosaichistoricalfactsto appreciatetheserapidchangesofscenes.Again,inaccuraciesarepresent,someofwhicharementionedlaterinthe text.Whiletheusualhighschoolhistorybookshavebeencutofmostofthegore,tragedyandevenobscenitiesofthe oldworld,someofthecollegeandadulttextssuchas TheColumbiaHistoryoftheWorld andWilliamMcNeill's severaltextsareexcellent,buttheystilldonotreachthefarcornersoftheearthinsomeofthecenturies.The An EncyclopediaofWorldHistory ,compiledandeditedbyWilliamL.Langer,isanexcellentdocumentationofworld history-ancient,medievalandmodern,chronologicallyarrangedandthishasbeenreferredtomanytimesduringthe writingofthismanuscript,particularlyforconrmationofdates,dynasties,claricationofnames,etc.Itisnotabook forleisurelyreadingandenjoyment,however,andisessentiallyalistofyeardateswithshort,concisematerialafter each,purelyforreference.Similar,butlessuseful,isJamesTrager'sveryrecent ThePeoplesChronology ,aseriesof completelyunrelatedandmiscellaneous"facts"somearegrosserrorslistedbyyears.Itisdifculttoseethevalue ofthisexceptperhapsasaparlorgameof"Whatthingshappenedintheworldatlargeinsomespecicyear?"This manuscripthasonepurposeonly-togiveapanoramicpictureoftheentireglobefromthearctictodeepestAfrica andthesouthPacicinspecictime-frames.Theemphasisistogivetheoverallviewoftheworldanditspeoples, withoutdwellingintoomuchdepthonthosefeaturesthatareeasilyavailableineveryschoolandmunicipallibrary andinmanyhomes.IrefertosuchsubjectsasthedetailsofclassicalGreeceandRome,theAmericanColoniesand thevariouswarsandspecicbattles.Forexample,inthistextlessspacemaybegiventheAmericanRevolutionary andCivilwarsthanthepre-IncacivilizationsofSouthAmericaorthelifeoftheMongolsoldiersincentralAsia. Informationontheformersubjectsisavailableeverywhere,whilethatonthelattertwosubjectsislimited. Forwardto: 1.TheMechanicsofandSomeProblemsofthePresentationSection 2.IntroductiontotheMethodofGeographicalPresentationSection1.1 3.IntrotoEraSection2.1 2 Thiscontentisavailableonlineat. 3


4 4.AfricaSection2.2 5.AmericaSection2.9 6.CentralandNorthernAsiaSection2.5 7.EuropeSection2.4 8.TheFarEastSection2.7 9.TheIndianSubcontinentSection2.6 10.TheNearEastSection2.3 11.PacicSection2.8 12.SomeThoughts 3 13.SpecialSectionsChapter34 14.BibliographyChapter35 3 "ImagesofMemorableCases:Case32"


TheMechanicsofandSomeProblemsofthe Presentation 4 Materialisarrangedinonesensechronologicallyandinanothersensegeographicallysothatthereadermayreview historicalsituationseitherina"satellite"cross-sectionalviewoftheentireworldinonetime-frame,ormayfollow eventsinanyonegeographicalareathroughthemanycenturiesinmoreorlessbriefnarrativeformbyfollowingthe simpleContinuedonpagesoandsoaftereachsection.Anattempthasbeenmadetogiveabriefresumeofthe politicalstatus,importantphilosophies,scienticdevelopmentsandreligioustrendswhiledevotingproportionately moretimetoadescriptionofthestatusofthecommonpeopleofanareaatanygivenmoment.Hopefullymostofthe world'soutstandingpersonalitiesinalleldshavebeengivensomespace,butitisadmittedthatmanyaspectsofart, literature,musicandarchitecturemay,insomeopinions,beslighted,asthesearenotthemajoreldsoftheauthor's interests. Thetextualdataispresentedinmultiplechapters,eachrepresentingadeniteperiodoftime.Theearlierchapters spanseveralmillenniaeach,butbeginningwiththe7thcenturyB.C.eachchaptercontainstheeventsofonecentury only.Withineachchapterortime-frameinadditiontosomegeneralremarkspertinenttotheperiodasawhole,the worldsituationwilldiscussedundereightmainheadingsorsections,representingeightgreatareasoftheglobe.These areasandtheirsubdivisionshavebeensomewhatarbitrarilychosen,butseemtolendthemselvessatisfactorilytoan orderlyconsiderationofthevarioussocietiesandcivilizations.Onecannotpreventcertainover-lappingsandcertain difcultieswithsuchaplanduetothechangingpoliticalboundarylinesfromcenturytocentury.Asoneexampleit willberememberedthattheGreatWallofChinaendedatJiayuguaninthewest,markingtheborderoftraditional China,andbeyondthisonwestwardliesCentralAsia.Yettodaymuchofthislandtothewestbelongstothepresent ChinesePeoplesRepublic,eventhoughtheinhabitantsarestillchieyTurkishandMongolianpeoples.So,inspite ofthepoliticalshiftcertainareascurrentlyunderthedomainofChina,suchasSinkiang-Uighurpresentspelling XinjiangUygurandTibet,willbeconsideredinthismanuscriptundertheheadingofCENTRALANDNORTHERN ASIA.Manchuriaisconsideredanentityinitself,aspartoftheFarEastcomplex. Anothermatterwhichmayannoyorconfusethereaderasheprogressesthroughthetextisthespellingvariations.One mustrealizethatlanguageisaspokenphenomenonandthatwhatwecall"writtenlanguage"isreallyonlyanotation systemthatattemptstorecallthespokenwordstotheobserver.Thuswhenanyoneattemptstowritedownanotation thatseemstohimtorecordaspokenforeignwordhisrenditionwilldependonhisownlanguagebackgroundand phonetics.Theresultmaybeonlyaroughapproximationatbest,andthespellingwillvarygreatlywiththenationality ofthetranslator.OneofthemostfascinatingexamplesofthiswouldbeinthespellingvariationsforthegreatMongol leaderwhosenamehasbeenvariouslywrittenas"JenghisKhan","ChingisKhan","GenghisKhan","ChinggisKhan" andperhapsothers.TheMongolsasagrouphavebeennamed"Khalkas","Tatars","Tartars","Cumans","Kipchaks", or"Poloritse"dependingonthewriter,hisnationalityandthelocationoftheparticularMongoltribeatthemoment. ItiswellknownthattheEnglishoftenusea"k"whereAmericansuse"c"asinsuchwordsas"Keltic"-"Celtic"and "Khosru-"Chosroes",etc.Althoughthisauthorhasattemptedtobeasconsistentaspossiblethereareprobablymany exceptionsforwhichapologyisasked. 4 Thiscontentisavailableonlineat. 5


6 Thereisstillanothersourceofconfusionconcerningnames.Whentherstnamesofthemonarchsofmedieval andlaterEuropeareallAnglicizedwegetanamazingsuccessionofCharles,Henrys,Johns,Williams,etc.Inone worldhistoryindexIcountedaboutsixty-verulersnamedCharles.Inthismanuscriptinsofaraspossiblethe monarchs'nameswillbegivenintheirownlanguagesothatdifferentiationmaybeaided.ThusintheScandinavian andGermaniccountriesCharleswillbeKarlandWilliamwillbeWilhelm.SimilarlytheFrenchHenryswillbeHenris andthePortugeseJohnwillbethenativeJoaowhilePeterwillberenderedasPedro.Otherexampleswillbeapparent. Butthatisnotall!TheChineseemperorspresentspecialproblemsinnomenclature,asallChinesehavetraditionally hadseveralkindsofpersonalnames,andspecialnameswereoftenaddedaccordingtointerestsorachievements. Posthumousnameswereoftengivenprominentindividualsalsotofurthercomplicatethesituation.Theoldrulers ofChinawereseldomreferredtobytheirpersonalnamesbutratherbytheepithetsofancestraltempleceremonies, includingtheterms"tsu"grandfather,"tsung"clansmanorancestoror"ti"emperor.Foundersofdynastiesare commonlydesignated"Kao-tsu"exaltedgrandfatheror"T'ai-tsu"grandprogenitor.Inadditiontheemperorsof theMingandCh'ingdynastiescommonlycoinederanamesindicatingwhattheyhopedthefuturewouldbringand subsequentlytheymightbecalledbytheirera-name.Onetroubleisthatsomechangedera-namesseveraltimesduring theirreigns.Huckergivestheexample:"MingT'ai-tsubeganhisreignintraditionalfashionwiththeera-nameHungwuswellingmilitarypower'theHung-wu'emperorisatechnicallycorrectalternativewayofreferringtoMing T'ai-tsu." 5 ButonedoesnotcorrectlysaythathisnamewasHung-wu"! Onelastwarning.AsthiseditionisbeingwrittenalmostalltheChinesecitiesandplacesarebeingspelledanew,in anattempttocomeclosertothetruephoneticrenditionoftheChinesewords.Sinceatthemomentthisonlyseemsto addtotheconfusionandsinceitwillbesomeyearsbeforemostmapsandtextswillchangetothenewformat,theold systemofspellingwillbefollowedinthismanuscript.Pekingwillstillbe"Peking"andnot"Beijing". Thistextwilloccasionallyalsohavespecialsectionsonselectedsubjectsorappropriatesummariesofcertaineras. Terminologywithreferencetodateswillbethetraditional"B.C."referringtoeitheryearsorcenturiesbeforethebirth ofChrist,and"A.D."foraspecicyearafterChrist.Thelatterabbreviation,ofcourse,isfor AnnoDomini ,meaning "inthe year ofourLord"andisthereforenotproperlyusedtorefertoa century Thus,forthosecenturiesafterthebirthofChristweshallusethedesignation"C.E.",indicatingthe"ChristianEra". Footnoteswillbeindicatedbynumberoneachpage,asdemonstratedonthisone.Referencestothebibliographywill bebynumberintheformRef.34[54],102[147]andusuallywillbegroupedattheendofparagraphsorsections tominimizeconfusionduringthereadingofthetext.Some"additionalnotes"willbefoundattheendofthetext, beginningonpage1181.Tripleasterisks-***-inthetextproperindicatethattheseadditionalnotesareappropriate tothatparagraph.Insomeinstancesthepagenumberislistedwiththeasterisks,butotherwisethenotesareeasily foundunderthepropertime-frameandthenthegeographicaldivision,justasinthemainoutline. 5 HuckerRef.101[146],page288n


Chapter1 TheMethodofGeographicalPresentation 1.1IntroductiontotheMethodofGeographicalPresentation 1 Theeightgeographicalregionsoftheworldreferredtoabovewillnowbepresented,oneregionatatime,with accompanyingsemi-diagrammaticmap-plates.Allofthesearedrawntotheexactsamescaleandoneachtheregion tobediscussedwillbeoutlinedingreen.Subdivisionswillbeindicatedaswellaspossible,andshownindifferent colors.Themap-diagramsarenotdrawnontheclassicalMercatorprojection,butratherwithalllatitudelinesdrawn straight,ratherthanwiththeusualcurve.Thisallowsonetoeasilyappreciateeast-westrelationshipsataglance. Thelatitudelines,drawnat10 intervals,arethusapproximately690statutemilesapartandlongitudelineswhich arealsoat10 intervalswillbethesamedistanceapartneartheequator.Asoneapproacheseitheroftheearth's poles,however,theselinesconvergeandareseparatedbyprogressivelyshorterdistances.Allmapsonaatsurface purportingtorepresentaportionofaspherewillhavedistortionandthesearenoexception,withtheperipheries deformedparticularlybythemethodofconstructingthelongitudelinesasaseriesofstraightsegments.Thesegures arepresentedsothatonecanmakecomparisonsofthevariousgeographicalregionsastosize,latitude,andadjacent relationships. 1.2GeographicalPresentationofAfrica 2 Africaisatremendouscontinent,measuringnearly5,000milesfromnorthtosouthandthesamefromthewestern edgeat20 northlatitudetotheeastern"horn".Itcomprisesover20%oftheearth'slandsurface.Throughoutthe manuscriptweshalldiscussAfricaunderthesubdivisionslistedbelow. 1.2.1NORTHEASTAFRICA ThisareaincludespresentdayEgypt,Sudan,EthiopiaandSomalia.Ithasabout2,000,000squaremilesandisa regionwhereHamiticandSemiticCaucasoidshavemetandmergedwithNegroidstock.ManyoftheNegroidsseem differentthanotherblackAfricansandsomeauthoritiesbelievethemtobeaseparaterace,asforexampletheMasai. Ref.83[123].InancienttimespartofEthiopiaAbyssiniawasknownasAxum,whileportionsoftheSudanhave beenknownasKushandNubia.TheNileRiverrunsthroughallofthesecountrieswiththeexceptionofSomalia. 1.2.2NORTHCENTRALANDNORTHWEST ThisareaincludespresentdayLibya,Tunisia,Algeria,MoroccoandalargepartoftheSaharaDesert.Overallthereare nearly3,000,000squaremilesandthemajorityofthepresentpopulationisdescendantfromtheoriginalinhabitants,as 1 Thiscontentisavailableonlineat. 2 Thiscontentisavailableonlineat. 7


8 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION noinvadereverbroughtmanyindividualstothearea.EventhegreatArabwavesofthe7thand8thcenturiesprobably involvedlessthan200,000people.TheBerbersareaCaucasoidtype,butwithmuchphysicalvariationfromtribeto tribe.Theyinhabitmostofthecoastalregion,muchofthemountainouscountryandtheoases.Thebasicpopulation oftheSaharaproper,particularlyitsmoresouthernportions,wasandistodaybasicallyNegroid,somenativeand somedescendedfromslaves.Ref.83[123]. 1.2.3SUB-SAHARANAFRICA ThisareaextendsfromfarwestAfricaacrosstheSudanicplainasfareastastheLakeChadenvirons,thendownto theequatorialdistrictaswellascentral,eastandsouthAfricaandthemajorislands.Thisverylargespreadofland hasmanyandvariedpeoplesandcultures,buthistoricalmaterialisstillrelativelymeagerformostofitandfromthe standpointofmanuscriptspace,itseemsbesttoconsideritunderonesection. Figure1.1: Africa ChooseDifferentRegion 1.AmericaSection1.9


9 2.CentralandNorthernAsiaSection1.5 3.EuropeSection1.4 4.TheFarEastSection1.7 5.TheIndianSubcontinentSection1.6 6.TheNearEastSection1.3 7.PacicSection1.8 1.3GeographicalPresentationofTheNearEast 3 BacktoIntroductiontotheMethodofGeographicalPresentationSection1.1 Althoughinpresentmediaparlancethe"MiddleEast"includesEgypt,weprefertoconsiderthatcountryasbasicallya partofAfricaandwillusethetermNEAREASTtorefertotheareashownwithintheblackborderonthemapbelow. Inspiteofitsoverallsmallsize,weshalldividethisgeographicalregionintovesubdivisions. 1.3.1THEARABIANPENINSULA ThisincludesallthepresentcountriesoftheArabianPeninsula,includingOman,Yemen,DemocraticYemen,Kuwait andSaudiArabia,aswellassomesmalleremiratesandnations.Jordan,lyingatthebaseofthepeninsulaisincluded also,sinceitspeopleandlandhavehistoricallybeenanintimatepartofthedesertculture. 1.3.2MEDITERRANEANCOASTALAREASOFISRAELANDLEBANON PresentdayLebanonisalmostidenticalgeographicallywithancientPhoeniciabutIsrael'sbordershavevariedgreatly underdifferingnamesthroughouttheages.AlthoughSyriahasalwayshadanarrowopeningonthesea,wepreferto groupthiscountrywithitseasternneighbor,Iraq.TheeasternMediterraneancoastisandalwayshasbeenSemitic, althoughJewandArabalikeseemtowanttodenytheirgeneticrelationshipandtheareahasbeenaconstantbattleeld aswellasacrossroadsbetweenAsia,AfricaandEurope. 1.3.3IRAQANDSYRIA PresentIraqhasnearlythesamebordersasancientMesopotamia.Syriahashadmobilebordersforcenturiesandwe aremaintainingthisdesignationforthatareawedgedbetweenAsiaMinor,IraqandLebanon.Historically,linguistically,politicallyandgeneticallyithasalwayshadcloseassociationwithIraq. 1.3.4IRAN:PERSIA Iranisbasicallyanon-Arabic,non-SemiticcountrywithanIndo-Europeanspeakingpeople.I-historicallyandreligiously,however,ithasbeenapartoftheNearEastforcenturies,atpresentsharingthemajorityMoslemreligion.Its easternportionischieydesert. 1.3.5ASIAMINOR:ANATOLIA TheAnatolianpeninsula,currentlyrepresentedchieybythecountryofTurkey,historicallyhasbeenalandofmany differentnationsandpeoples.Intheeasternend,theancientcountryofArmeniahasbeennowabsorbedmainlyby theSovietUnionbutwearekeepingthisdistrictofancientArmeniaasaseparateentityinthiswork. 3 Thiscontentisavailableonlineat.


10 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION Figure1.2: TheNearEastThismapwasobtainedfrom 4 andisusedwith permissionunderaCreativeCommonsAttribution3.0license 5 ChooseDifferentRegion 1.AfricaSection1.2 4 5


11 2.AmericaSection1.9 3.CentralandNorthernAsiaSection1.5 4.TheFarEastSection1.7 5.EuropeSection1.4 6.TheIndianSubcontinentSection1.6 7.PacicSection1.8 1.4GeographicalPresentationofEurope 6 BacktoIntroductiontotheMethodofGeographicalPresentationSection1.1 Thesemi-diagrammaticmapofEuropebelowdemonstratesthatifoneeliminatesRussia,thelandmassinvolvedis scarcelylargerthantheNEAREAST.WeshouldalsonotethatthebulkofEuropeliesatalatitudenorthofboth theBlackandtheCaspianSeasandthatonlyasmallportionofSiberialiesfarthernorththanEuropeanRussia.As indicatedontheplate,thesetwoportionsoftheSovietUnionhavetraditionallybeenseparatedbytheUralMountain region.ItiseasytoseehowearlymarinersfromNorwayandtheBritishIslescouldsaildirectlywesttoIcelandand thenontoGreenlandandAmerica.Europewillbediscussedinthetextunderseveralsubdivisionswhich,inlater centuries,willbefurtherdivided.Thesesectionswillbenotedbelow. 1.4.1SOUTHERNEUROPE Thisdivisionwillbediscussedwithfoursub-sections.FirstwillbetheeasternMediterraneanislandswhichmodern authoritiesareconsideringasthesiteofthersttrulyEuropeansocietiesincontrasttobeingapartoftheNearEast, TheseincludetheCyclades,Crete,Rhodes,CyprusandevenMalta.ThesecondareawillbeGreeceandthethirdthe upperBalkanswhichincludespresentdayYugoslavia,Bulgaria,RomaniandAlbania.Historicallyothercountries haveoccupiedthisregion,suchasMacedonia,Serbia,Thrace,etc.LastlythedivisionwillhaveItaly,withsome commentsaboutSicily,SardiniaandCorsicafromtimetotime. 1.4.2CENTRALEUROPE Arbitrarilythiswillincludevesub-sections-Germany,Austria,Hungary,CzechoslovakiaandSwitzerland.Although HungaryandCzechoslovakiaarenowusuallyconsideredapartofeasternEuropebecauseofpresentideologies,we haveputtheminCentralEuropebecauseoftheirlongpoliticalassociationswithAustriaandGermany. 1.4.3WESTERNEUROPE ThesearethenationsalongtheAtlanticcoast,thusSpain,Portugal,France,theNetherlandsandBelgiumandnally theBritishIsles.ThelatterwillbefurtherbrokendownattimesintoEngland,Scotland,IrelandandWales. 1.4.4SCANDINAVIA Inadditiontotheexpectedsub-sectionsofNorway,SwedenandDenmark,thisdivisionwillincludeFinland.Although originallygeneticallydifferentfromthetrueScandinaviancountries,FinlandwasapartofSwedenforsome600years andstillhasSwedishasoneofitstwoofciallanguages.OnoccasionstherewillalsobecommentsaboutIceland. 6 Thiscontentisavailableonlineat.


12 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION 1.4.5EASTERNEUROPE ThiswillincludethesouthernBalticcountriessuchasPoland,OldPrussia,Lithuania,LatviaandEstoniaaswellas EuropeanRussia.


13 Figure1.3: EuropeThismapwasobtainedfrom 7 andisusedwithpermission underaCreativeCommonsAttribution3.0license 8


14 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION ChooseDifferentRegion 1.AfricaSection1.2 2.AmericaSection1.9 3.CentralandNorthernAsiaSection1.5 4.TheFarEastSection1.7 5.TheIndianSubcontinentSection1.6 6.TheNearEastSection1.3 7.PacicSection1.8 1.5GeographicalPresentationofCentralandNorthernAsia 9 BacktoIntroductiontotheMethodofGeographicalPresentationSection1.1 ThereaderwillnoteonthemaptofollowthatthisgeographicalregionisofthegeneralmagnitudeofNorthAmerica, butmuchsmallerthanAfrica.ThemapdoesnotincludetheveryfareasterntipofSovietSiberiawiththeMagadan regionandtheKamchatkapeninsula.Thatextendsroughly600milesfarthereastthantheedgeofthediagram,butitis oflittleinterestin-thismanuscript.Althoughthevarioussub-divisionsofcentralandnorthernAsiaarenotdiscussed formally,assuch,inthetextbecauseofconstantchangingofbordersandnamesthroughoutthecenturies,thevarious presentdaycomponentpartswillbediscussedundertheircurrentnames. 1.5.1THECOMPONENTPARTSOFCENTRALANDNORTHERNASIA TheboundariesofthisareahavebeenchosensomewhatarbitrarilysothattheregionisboundedbyEuropeanRussia onthenorthwest,ManchuriaandChinaonthesoutheast,Iran,Pakistan,IndiaandSoutheastAsiaonthesouthand otherwisebytheArcticandPacicoceansandtheCaspianSea.Siberiaisavastlandlyingalmostentirelynorthof the50thparallel.JustbelowitscenterliesMongolia,atroughlythelatitudeofPoland,butaboutaslargeasPoland, GermanyandFrancetogether.InsouthcentralAsiathepresentstatesofKazakh,Turkmen,Usbek,andKirghizall areincorporatedwithintheSovietUnion.TheancientandimportantcityofSamarkandisinUsbekwhileTashkent liesattheeasternedgeofKirghiz.StandingalonesouthofthesecentralstatesisthecountryofAfghanistan,shown inyellow.AllofthesecentralAsianareashaveagreatmixtureofTurkishandMongolianpeoples,withperhapssome remnantsoftheoldIndo-EuropeanspeakingKushans.TheMoslemreligionispredominanttoday. Theareashowninlightredonthediagramdeservesspecialmention.ThisistheZvareaofTibetandSinkiang,both ofwhicharecurrentlyapartofthePeoplesRepublicofChina.Historicallyandgenetically,atleastuntilveryrecent years,however,theseA-werecentralAsianpeoples,not"Han"Chineseandso,ignoringthepresentpoliticalborder wehaveelectedtoincludethislargeareaundertheheadingofCentralAsia.Thusthereisaheavydottedlineborder, ratherthanasolidlineabouttheseregions,asatpresenttheyarenotactuallydenedas"countries". 7 8 9 Thiscontentisavailableonlineat.


15 Figure1.4: CentralandNorthernAsiaThismapwasobtainedfrom 10 andis usedwithpermissionunderaCreativeCommonsAttribution3.0license 11 ChooseDifferentRegion 1.AfricaSection1.2 2.AmericaSection1.9 3.EuropeSection1.4 4.TheFarEastSection1.7 5.TheIndianSubcontinentSection1.6 6.TheNearEastSection1.3 7.PacicSection1.8 1.6GeographicalPresentationofTheIndianSubcontinent 12 BacktoIntroductiontotheMethodofGeographicalPresentationSection1.1 10 11 12 Thiscontentisavailableonlineat.


16 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION AllpartsoftraditionalIndiawillbeincludedunderthisheadingandthismeansthatpresentdayPakistan,Nepal, Bangladesh,BhutanandSriLankawillbeinvolved.Pleasenotethatthisareaisapproximatelythesamesizeas theNearEastandmuchofitliesatthesamelatitude.TheIndusRivervalley,siteofoneoftheworld'searliest civilizations,isnowinPakistan,whilethesecondgreatIndianRiver,theGanges,terminates,inpart,inBangladesh. Asweshallemphasizeinthetext,thissubcontinentcontainsanalmostunbelievablemixtureofpeoples,languages, customsandreligions.


17 Figure1.5: IndianSubcontinentThismapwasobtainedfrom 13 andisusedwith permissionunderaCreativeCommonsAttribution3.0license 14 ChooseDifferentRegion 13 14


18 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION 1.AfricaSection1.2 2.AmericaSection1.9 3.CentralandNorthernAsiaSection1.5 4.TheFarEastSection1.7 5.EuropeSection1.4 6.TheNearEastSection1.3 7.PacicSection1.8 1.7GeographicalPresentationofTheFarEast 15 BacktoIntroductiontotheMethodofGeographicalPresentationSection1.1 IngeneralthisregionconcernsmostofthePaciccoastnationsofAsia.Thenorthernpeopleofthisareatendto betallerandheavierthanthesoutherners.Languageshowsgreaterdiversication,evenwithintheconnesofChina proper,withthenorthernersspeakingMandarinnowtheofciallanguageforallChinese,whilethesouthernChinese primarilyspeakoneofseveralmutuallyunintelligibledialects,includingCantonese,WuandFukien.Chinese,Thai andVietnamesemakeupalanguagefamilywhichinturnisabranchofalanguagestockcalledSino-Tibetan".The "Tibeto-Burman"familyisanotherdivisionofthisstock.Incontrast,theMongoliansandManchurianstothenorth belongtoanentirelydifferent"Altaic"languagestockwhichincludesTurkic,MongolianandTungusicManchu languagefamilies. Inthetextthissixthgeographicalareawillbediscussedunderfourmainsubdivisions. 1.7.1CHINAANDMANCHURIA ThiswillnotincludeChina'smorerecentcentralAsiaticacquisitions,namelySinkiangandTibet,butwillinclude ManchuriaandclassicalChina,whichisaboutone-halfthesizeofthecontinentalUnitedStatesandextendsfromthe greatWallinthenorth,theinnerAsianwastelands,andTibetanhighlandsinthewest,downtothePacicontheeast andsouth.ItisdividedtransverselybytheQinLingmountainchainintothenorthernYellowriverbasic,thesiteof theearliestChinesecivilization,andthemoresouthernYangste,sub-tropicalbasin.Ref.73[112],101[146]. 1.7.2JAPAN ThelandmassofalltheJapaneseislandstogetherissmallerthanthestateofCalifornia.Thequestionoftheoriginof theJapanesepeopleandlanguagewillbedevelopedinthetext. 1.7.3KOREA TheMongoloidKoreanpeoplespeakalanguageofnorthernderivationAltaicratherthanSino-Tibetan,indicating theirgeneticrelationtoManchuria,eventhoughtheirculturehasbeenandisverysimilartothatoftheChinese. 1.7.4SOUTHEWESTASIA Incertaintime-framesinthemanuscriptthisregionwillbefurtherdividedinto[1]MainlandSoutheastAsiaand[2] Indonesiaandadjacentislands.ThelatterclassicationwillincludethePhilippines.Theboundariesandpeoplesof mainlandSoutheastAsiaareandhavealwaysbeenconfusing.Onthemap,thecurrentsituationisindicated.Burmais shownwithobliquelineswhileVietnamhashorizontalstripes.Cambodiaiscross-hatched,whileLaosisessentially black.Othercountriesarequitewelllabeled.ThearealistedasSiamis,ofcourse,currentlycalledThailand. 15 Thiscontentisavailableonlineat.


19 Figure1.6: TheFarEastThismapwasobtainedfrom 16 andisusedwithpermissionunderaCreativeCommonsAttribution3.0license 17 ChooseDifferentRegion 1.AfricaSection1.2 2.AmericaSection1.9 3.CentralandNorthernAsiaSection1.5 4.EuropeSection1.4 5.TheIndianSubcontinentSection1.6 6.TheNearEastSection1.3 7.PacicSection1.8 1.8GeographicalPresentationofThePacic 18 ThePacicOceanmakesupone-halfoftheglobeonwhichweliveandifweexcludeAustralia,thetotalamountof landexistingasislandsinthismassiveamountofwaterisalmostinnitesimal.Yetmanyofthesetinyislandsareof greatinterestbecauseofthecontinuingcontroversiesabouttheoriginoftheirpeopleandmethodofsettlement.Ithas beenimpossibletoshowtheentirePaciconadiagrammaticmaponthescalewehaveselected,sothelargemapon thesecondpageaheadshowsonlyessentiallythesouthPacicandomitsthefareasternandwesternexpanses,even then.Thechiefcomponentsofthisgeographicalareawillbeoutlinedbelow. 16 17 18 Thiscontentisavailableonlineat.


20 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION 1.8.1AUSTRALIAANDTHEPACIFICISLANDS Becauseofthelackofspaceonthenextpagemap,anadditional,samescaledrawingofAustraliaisshownbelow. Afteronerecordswhatlittleisknownaboutthepre-historyofthiscontinent,aswillbenotedinthetext,nomore informationisavailableuntilthe16thcenturyC.E.whenEuropeansrstvisitedtheland. TheislandsofthePacicareusuallydividedintothreegroups.Inthewesternsideoftheocean,butnorthofthe equatorarethevariousgroupsoftinyislands,chieyofcoralorigin,whichareknowncollectivelyas Micronesia WakeIsland,theMarianasandtheCarolineareexamplesofthisgroup.StillinthewesternPacicbutsouthof theequatoris Melanesia ,socalledbecauseofthedarkskinsandNegroidfeaturesoftheinhabitants.TheSolomons, HebridesandNewCaledoniaareexamplesofthesebasicallyvolcanicislands.Finally,intheeasternhalfofthePacic thereistheso-calledPolynesiantrianglewiththeHawaiianIslandsattheapex,NewZealandinthesouthwestcorner andEasterIslandatthesoutheastpoint.Onemustrealizethat,excludingNewZealand,makinganydotvisibletothe nakedeyeonanylargescalemap,makesthelandfaroutofproportion.Incorrectperspective,theyshouldbeonly microscopicpoints. Figure1.7: Australia Figure1.8: ThePacic ChooseDifferentRegion 1.AfricaSection1.2 2.AmericaSection1.9 3.CentralandNorthernAsiaSection1.5 4.TheFarEastSection1.7 5.EuropeSection1.4 6.TheIndianSubcontinentSection1.6 7.TheNearEastSection1.3 1.9GeographicalPresentationofAmerica 19 BacktoIntroductiontotheMethodofGeographicalPresentationSection1.1 Thelastgeographicalareawhichwillbediscussedundereachtime-framewillbethewholeoftheNewWorld, America.Sincethisconsistsoftwomajorcontinentswithanintermediateconnectingregion,theareawillbedivided intothreesubdivisions. 19 Thiscontentisavailableonlineat.


21 1.9.1NORTHAMERICA Thisgeographicalareaisshownonthemap-diagramopposite.Inthetextthehistoricalmaterialwilloftenbefurther dividedinto[1]TheFarNorthandCanadaand[2]TheUnitedStates.Sinceweareinterestedinageographical area,notnecessarilypoliticalboundaries,therstcategoryof"TheFarNorthandCanada",willincludeAlaskaand Greenland,eventhoughtheformer,ofcourse,isapartoftheUnitedStatesandthelatterbelongstoDenmark.The secondportionwillactuallybelimitedtothe continental UnitedStates.Itwillbeofinteresttocomparelatitudeson thisdiagramwiththoseofEuropeandtheFarEast.Forexample,wewillberemindedthattheBritishIsleslieatabout thesameparallelasthesouthernpartofHudsonBayinCanadaandthatthecenteroftheUnitedStatesisonthesame latitudeas north ChinaandtheTarimBasininCentralAsia.TheBeringStrait,themiddleofHudsonBayandthe southerntipofGreenlandareallonapproximatelythesamelatitudeasLeningradinRussia.


22 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION Figure1.9: NorthAmericaThismapwasobtainedfrom 20 andisusedwith permissionunderaCreativeCommonsAttribution3.0license 21


23 1.9.2MEXICO,CENTRALAMERICAANDTHECARIBBEAN Themap-diagramshowingthisandthenextsubdivisionisonthesecond-pageahead.Mexicoisshowninvioletcolor, whileCentralAmericaandtheCaribbeanislandsareinyellow.TheCanaryandsouthernequatorialcurrents,which havebeenimportantinthediscoveryoftheNewWorld,areshown.ThepresentpoliticallinesinCentralAmerica areshown,markingGuatemala,Belize,SanSalvador,Honduras,Nicaragua,CostaRicaandPanama,goingfrom northwesttosoutheast. 1.9.3SOUTHAMERICA OntheSouthAmericanmaptheroughcourseofthemainriversandthegeneralextentandlocationofthecordillera areshown.Noattempthasbeenmadetooutlinethecurrentbordersbetweenthevariouscountries,butthegeneral areasofthemostimportantareindicated.Inthemainbodyofthemanuscriptinsometime-framesthiscontinentis dividedinto[1]WesternandNorthernCoastalAreasand[2]EasternandCentralAreas. 20 21


24 CHAPTER1.THEMETHODOFGEOGRAPHICALPRESENTATION Figure1.10: Mexico,CentralAmerica,theCaribbean,andSouthAmericaThismapwasobtainedfrom 22 andisusedwithpermissionunderaCreativeCommonsAttribution3.0license 23


25 ChooseDifferentRegion 1.AfricaSection1.2 2.CentralandNorthernAsiaSection1.5 3.EuropeSection1.4 4.TheFarEastSection1.7 5.TheIndianSubcontinentSection1.6 6.TheNearEastSection1.3 7.PacicSection1.8 22 23




Chapter2 Beginningto8000B.C. 2.1Beginningto8000B.C. 1 Ourearthisestimatedtohaveoriginated,bywhatevermeans,about4,600,000,000yearsagoandtheeonssincehave beenvariouslydescribedandclassiedbygeologists,paleontologistsandarchaeologistsintoerasandperiodsand epochs.Unfortunatelyeachdisciplinehastendedtouseitsownclassicationandattimesthismotleyoftermshas beenquiteconfusing.Onthenextpages,tableshavebeenconstructedinanattemptatsomeclarication.Inthestory ofmanweareconcernedonlywiththegeologicalepochslabeled"Pleistocene"and"Holocene"oftheCenozoic,or recentera.Thearchaeologicalagesofmancanbeonlyroughlytintothegeologicalschemaandwehaveattempted topresentthisrelationshiponthesecondofthecharts. Thepositionsandrelationshipsoflandmassesandseashavechangedmarkedlythroughoutthetimeoftheearth's existence.SometwohundredmillionyearsagotheEurasiancontinentwasseparatedfromacombinedlandmass called"Gondwanaland"whichconsistedofthepresentSouthAmerica,Antarctica,AustraliaandIndia,byagreat oceanjoiningtheAtlantictotheIndianOceanandrunningthroughtheareawhichisnowtheMediterraneanBasin. Thisgreatseaiscalled"Tethys"andithadanorthernarmParatethyswhichranthroughthepresentBlack,Caspian andAralseasareas.ThestoryofIndia'slatercollisionwiththeAsiancontinentisinthesectiononCentraland NorthernAsiaSection2.5.RecentstudyofcoresfromtheoorsoftheMediterraneanandBlackseashasgiven cluesastothecourseofeventsthere.WhenAfricacollidedwithEurasia,theTethyswasclosedatGibralterandthe NearEastareasothatatrstalargeinlandseawasproduced,coveringtheMediterraneanBasinandmuchofEastern Europe.Then,withsevereclimaticchangesofsixmillionyearsagotheMediterraneanareabecamedry,actually desert,foramillionyears,whiletheBlack-Caspian-Aralregionsbecameastagnant,shallowbutgigantictypeof swamp.Thenwhenthenorthernstreamsbecamere-activatedtheParatethysdrainedintotheMediterraneanBasin andbothareaswereconvertedtoanetworkoffresh-waterlakesatsomethinglikeveandone-halfmillionyearsago. About600,000yearsago,agreatlakeintheCarpathianMountainssiltedupandtheDanubespilledoverintotheBlack Sea.Asthelastglaciersrecededabout89000B.C.theMediterranean,whichhadapparentlybeenslowlyrellingas theAtlanticpouredoverGibralterStraits,nowbrokeovertheBosporusagaintoaddsaltwatertotheBlackSea.This gaverisetoananoxicstratumofstagnant,brackishwaterbelowthesurfacewhichremainstothisdayandprecludes marinelifeinthelowerlevels.Ref.100[145] Withreferencetothechartsonthenextpagesweshouldpointoutthattheyareinpartinaccuratefortheworldas awhole.WhilebronzeworkingwaspresentalloverthecontinentofEuropeproperby1,600B.C.thenorthernhalf ofBritainandallofScandinaviaaswellaswesternIberiaandNorthAfricaremainedneolithicorchalcolithic.More remotepartsoftheglobeundoubtedlystillhadanearlyStoneAgeculture.TheHittitesinAsiaMinorhadironas earlyas1,300B.C.butitwasworthfortytimesitsweightinsilveranditsusespreadveryslowlyfromthiscenter. TheAssyriansbroughttheIronAgetoEgyptonlyinthe7thcenturyB.C.anditwasnotusedincentralandsouthern 1 Thiscontentisavailableonlineat. 27


28 CHAPTER2.BEGINNINGTO8000B.C. AfricauntilonetothreecenturiesafterthebirthofChrist.ChinahadtheShangBronzeAgeCultureabout1,600B.C. butdidnothaveironworksuntilthe6thcenturyB.C.


29 GeologicalAges ERA SUB-ERA YRS.BEFORE PRESENT PERIOD EPOCH CHARACTERIZED BY Pre-Cambrian Archeozoic 5,000,000,000 to 1,000,000,000 Earth'scrust. Unicellular organisms Pre-Cambrian Proterozoic 1,000,000,000 to600,000,000 Bacteria,algae, fungiandsimplemulticellular organisms Phanerozoic** Paleozoic 600,000,000to 220,000,000 FromCambrian thruCaroniferous&Permian Development ofanimals frommarine invertebratesup throughinsects andreptiles. Phanerozoic Mesozoic Warm&rather uniformglobal climate 220,000,000to 65,000,000 Triassic Volcanicactivity,marine reptiles,dinosaurs.As periodstarted allcontinents weremoreor lesslocked togetherina supercontinent Pangaea_.A greatbight Tethysextended betweenAsia andAfricaand perhapsbetweenOldand newWorlds. Numberof marinespecies droppedby nearly60% ,but40%of presentland areabecame ooded.In No.Amer.sea overentiremidcontinentregion fromGulfdeep intoCanada& fromRockiesto Appalachians. Africasplitinto largeislands. Phanerozoic Mesozoic Warm&rather uniformglobal climate 220,000,000to 65,000,000 Jurassic Dinosaurs, conifers. continuedonnextpage


30 CHAPTER2.BEGINNINGTO8000B.C. Phanerozoic Mesozoic Warm&rather uniformglobal climate 220,000,000to 65,000,000 Cretaceous Extinctionofgiantreptiles.Insectsandowers. Phanerozoic Cenozoic 65,000,000to 38,000,000 Tertiary Paleocene Eocene Birds&Mammals. Phanerozoic Cenozoic 38,000,000 Tertiary Oligocene Saber-tooth cats.Continents assumedapprox.present position& acoldcurrentcircled Antarcticawith relativelylittle waterdiverted northward,so temperature gradientfrom equatortoSo. Poleincreased. Phanerozoic Cenozoic 26to7,000,000 Tertiary Miocene Grazingmammals.First majorAntarctic glaciations. Phanerozoic Cenozoic 7to2,000,000 Tertiary Pliocene Mountains; climatecooling; increaseinsize andnumbers ofmammals. Man? Phanerozoic Cenozoic 2,000,000to 10,000 Quaternary PLEISTOCENE -ICEAGES. DEFINITE APPEARANCE OFMAN continuedonnextpage


31 Phanerozoic Cenozoic 10,000to present Quaternary HOLOCENE DEVELOPMENT OFMAN,THE SOCIALANIMAL. Table2.1 :**65millionyearsagoattheboundarybetweenthegeologicmesozoicandcenozoicperiods,lifeinthe oceanschangeddramatically,withmassiveextinctionofearlierlifeformsandexplosiveevolutionofnewones. Tablereferences:8[14],202[275],224[299] ArcheologicalAgesinRelationtoGeologicalAgesSeeespeciallyPLEISTOCENEandHOLOCENE EPOCHSinprevioustable EPOCH YEARSB.C. ARCHEOLOGICAL AGE SYNONYMS ARCHEOLOGICAL FINDSOR HISTORICAL EVENTS PLEISTOCENE 2,000,000TO 1,000,000 EarliestIceAges Ape-likeHominids. Astralopithecus Otherswouldput stillearlier. PLEISTOCENE 1,000,000to 500,000 EarlyIceAge Simplestonetools. Majorglacial phases. PLEISTOCENE 500,000to8,000 PaleolithicLower OldStoneAge Javaman.Peking man-atetiger,buffalo.Standardtool forms.Useofre. PLEISTOCENE 500,000to8,000 PaleolithicMiddle Neanderthalman about75,000B.C. Bladetools,re, burials. PLEISTOCENE 500,000to8,000 PaleolithicUpper Paleo-Indianin America Modernman35,000 to40,000B.C.Ate rhinoceros,wild sheepandboar, but70%venison. Probablydidnot cook,buthadre. Splitbonesfor marrow.Possibly cannibalistic.Use ofboneandantler. continuedonnextpage


32 CHAPTER2.BEGINNINGTO8000B.C. HOLOCENE 8,000TO5,000 MesolithicMesoIndian MiddleStoneAge. Domesticationof plantsandanimals. Earliesttowns, woodensawswith rowsofchipped intforteeth.More advancedtools. HOLOCENE 5,000to2,500 NeolithicArchaicIndian NeworLateStone Age Polishedstonetools, redpottery,cultivatedwheatandbarley.Post-glacialrise insealevels. HOLOCENE 5,000to2,500 Chalcolithic Copper-stoneAge Insomeareasonly, particularlyinNear East.Copperinuse withstone. HOLOCENE 2,500to1,000 BronzeAge Alloyoftinwith copper.Stronger, moreadaptable metal.Bronzewas usedinThailandas earlyas3,500B.C. HOLOCENE 1,000toPresent IronAge TheHittiteshadiron asearlyas1,300 B.C.butEgyptdid notuntil7thcentury B.C.andChinain 6thcenturyB.C. Table2.2 :Tablereferences:215[290],211[284],130[180],226[302] Wemustdiscussnowthemysteryofwhereandwhenmodernmanappearedontheworldscene.Althoughanupright, walkingmancalled Homoerectus waswidespreadinAsia,AfricaandEuropesomeone-halfmillionyearsago, usingreandsimplehand-axesandtools,therstfossilswhichappeartobethoseofaracemorecloselyrelated toourmodernraces Homosapiens havebeenfoundatSwanscombeinEnglandandSteinheiminGermany.An apparentclose"cousin"ofthesemenandavariantof Homosapiens ,theNeandertahaler,livedduringthelastIce AgesthroughoutEurope,NorthAfrica,theMid-eastandapparentlyafeweveninAsia,butthisparticularracefor somereasondidnotsurvive.Nevertheless,theNeanderthalmanwasaskilledhunter,usedre,cookedfoodand buriedhisdead.Only50%survivedtoagetwentyandnineoutoftenofthoseremainingdiedbeforetheirfortieth birthday.Theyweresubjecttorickets,somethingthatmayhaveresembledcongenitalsyphilisandwereprobably cannibalistic.ThereissomeevidenceinthefossilsoftheNearEastthatsomeauthoritiesinterpretasindicatingthat modernman,inthesenseofourownsub-species, Homosapienssapiens ,evolvedfromoroutofNeanderthalman around35,000to40,000yearsago,butthisisnottheconsensus.Mostanthropologistsassumethatoverseveraleons anewbreedofman,whichmightbecalledthe"Ur-race",spreadouttopopulatetheEurasianlandmass,replacing orextinguishinganypre-existinghominoids.Afurtherdevelopmentofthistheorynecessitatestheassumptionofthe isolationofvariousgroupsbehindgeologicalbarriers,eachadoptingandadaptingtotheirseparateenvironmentsand graduallydifferentiatingintopresentdayraces.Thus,thestay-at-homesbecametheCaucasoids,thosemovinginto CentralAsiaandnorthernChinabecametheMongoloidsthroughadaptationtoseverecold,whilethegroupsmoving intohotAfricabecameNegroids.Buttheseareonlytheoriesandafewauthoritieswoulddisagree.Chiefamongthese, perhaps,isDr.CarletonCoonofHarvardwhobelievesinthemultipleoriginsofthevariousraces.


33 ModernmaninEuropewasinitiallyrepresentedbytheCro-Magnons-withlargebones,highbrowsandpowerful physiques,standingashighassixfeetfourinches,similartosomeEuropeansoftoday.Otherrepresentativesofmodern Homosapienssapiens werealsopresentataboutthistime,includingonesmallerandalmostfrailincomparison. ThiswasCombeCapelleman,apparentlyrelatedtotheMediterraneanpeoplesoftoday. Althoughthesenewmen,identiedinEuropebyabout37,000yearsago,carriedanumberofnewtypesoftools, moreimportantly,accordingtorecentextensivestudiesofthesetoolsandremainingimplements,thismanhadthe brainwhichmanhastoday,abraincapableofart,imageryandnotationandofseeingtheworldinatime-factoredand time-factoringway.Weshallhearmoreaboutthesefeatureslater.Ref.130[180] After10,000B.C.withtheretreatoftheice,vegetationpatternsbegantoalter.Reindeerfollowedmossesandferns attheiceedgeandpeopledependentonthemfollowed.Withwarmwinds,greateldsofwildgrainappearedin variousareasoftheNearEast.Eventuallythepeoplebegandeliberatecultivationanddomesticationoflivestock,but theoriginalpracticessoonturnedfertilelandintodesertandacontrolledirrigationsystemhadtobediscovered.Raw grainandthehumandigestivesystemarenotcompatiblesoonemightaskhowgraincouldbecookedinthedays beforepottery.Onoccasionslargeshells,stomachsofanimals,pitstones,etc.wereinlimiteduse,butprobablythe chiefmethodwastoheatthethreshingoortoahighenoughtemperaturetoroastthegrainatthesametimethatthe chaffwassplintered.Theresultwouldbeacoarsegroat,needingnofurthercookingbuttoodrytoswallow.Addwater andkneadtoastiffpasteandonehassomethingcomparabletotheGreek maza ,Roman puls ,theMexican tortilla Scotsoatcake,EastIndian chapate ,Chinese pao-ping ,Ethiopian injera andtheAmericanIndianJohnnycake'allof thesewereprobablydescendantsofNeolithicbread,justwithdifferingbasicgrains.Ref.211[284] Theoriginsanddifferentiationfactorsintheracesofmancontinuetoraiseunsolvedquestionsandcontinualnew concepts.Certainfeatures,suchasskincolor,whichwesuperciallytendtousetocategorizeracialgroupsmaybe simplyenvironmentallyadaptivetraitscorrelatedwithclimaticconditions.Skincolorvaries,evenwithineachrace, withthelatitudeofthehabitat.TheMongoloidpeoplesofSoutheastAsiaaremuchdarkerthanthoseofnorthern China;CaucasoidsofsouthernIndiaandsouthernArabiaarequiteblack;centralAmericanIndiansaredarkerthan thosefarthernorth.Similarly,fairskin,blueeyesandblondhairareclimaticadaptationsbynaturalselectiontoa cloudy,dimlylitnorthernenvironment,whereeverybitofVitaminDfromsunlightisneededandmustnotbeltered outbymelaninintheskin,iftheindividualistosurvive. Therearetraits,however,whicharenon-adaptiveandareknownas"racemarkers".Amongtheseare[1]distinctive teethshovel-shapedincisorsoccurwith80%frequencyamongMongoloidsandAmericanIndiansand[2]hairform, withcoarse,straighthairoflargediameterinMongoloidsandAmericanIndians,smalldiameterhairinCausasoids andatcross-sectionhairproducingthe"woolly"appearanceinAfricansandMelanesians. InadditiononlytheCaucasoidandtheAustralianaboriginehasmuchbodyhairandprematurebalding.Ofcourse thenaldifferentiationistobefoundinbloodgrouptraitsandfactorswhichweshallexaminealittlelaterinmore detail.Thegreatestdifferencesintheseblood-groupsandtraitslienotbetweenracesassuch,butbetweenthepeople livingeastandwestofthegreatAsianmountain-desertbarrier.Thusithasbeensuggestedthattheearliestdivisionof Homosapiens wasadifferentiationintoEasternandWesternraces.Certainlyastheprecursorofmodernmanspread acrossAfricaandthenEurasia,notonlyhisbodychanged,buthismethodofdoingthings,histoolkitandhisfood supply.Ref.215[290],130[180] Wecomenowtothequestionoftheoriginsanddivisionsofthepresent-dayracesofmanandasmightbeanticipated, thereisnocompleteuniformityofthoughtonthissubject.Thereisprobablynopointindiscussinganyconceptsat thistimethatarenotbasedonbloodgenestudies.AclassicationdevelopedbyWilliamC.BoydRef.16[27]is asfollows: 1. EUROPEANGROUP -OverallthisgrouphasthehighestincidenceoftheRhnegativegeneandarelatively highR',withnoFy,Vor"Diego".Itcanbefurthersubdivided. a EarlyEuropeanHypothetical. -TodaythisisrepresentedbytheBasquesandpossiblytheBerbers. ThisgrouphasthehighestpercentageofRhnegativeintheworldalongwithhighR'andA2andnoB,


34 CHAPTER2.BEGINNINGTO8000B.C. b Lapps. -ThesepeoplearenotMongoloidsbutareEuropeans,havingdevelopedtheirdistinctiverace in situ .ThisclasshasthehighestfrequencyofN,isveryhighinA2,moderatelyhighinFyaandaverylow B. c NorthwestEuropeans. -WeassumethatBoydmeansScandinavians,northernGermans,French,English,etc..ThesearenexttotheLappsinhighestA2frequency,ahighRhnegativegenedistributionnext totheBasques,afairlyhighA,normalMNfrequenciesandlowB1. d EasternandCentralEuropeans. -WeassumethiswouldincludesouthernGermansandmostofthe Slavs.InthesethereishigherMthanincaboveandalowerRhnegative.Bishigher. e Mediterraneans. -IncludessouthernEurope,theMiddleEast,andmuchofnorthAfrica.Thisgroup hasahigherBandalowerRhnegativethanthenorthwestEuropeansbuttheyhaveagreaterRo[cDe], suggestingsomerelationshipwithAfricans.NorthAfricansandEgyptiansarepredominantinthisgroup. 2. AFRICANRACE -AfricanshaveaveryhighRo,ahighVandfrequenciesofFyabove0.8.R1islow,butthe frequencyofPfactoristhehighestknown.Somehavehighsickle-cellgenelevels. 3. ASIANRACE -AsianshavehighAlandB,withlittleA2.ThereisalowpercentageofRhnegativeandthe predominantRhgeneisR.Sisrelativerare.MishighinsouthernAsiawhileitisnormalinnorthernAsia. 4. INDO-DRAVIDIANRACE -ThisisasomewhatvariedgrouplyingsomewherebetweentheEuropeansand theAsiaticsandmayeventuallyhavetobesubdivided.TheyhavethehighestBofanyplaceintheworldandM ishigherthaninEurope.TheRhnegativefactorislessthaninEuropeandalthoughA2ispresentitaccountsfor lessoftheAthanintheEuropeangroup.IncidentallythesestudiesshowdenitelythatGypsiesareofIndian origin. 5. AMERICANINDIANRACE -Duetogeneticdrift,BbloodisalmostcompletelyabsentinAmericanIndians, althoughverycommontodayinEastAsia.Ref.215[290]Eskimosareplacedinthisgroupalthoughsome denitelypossessB,whichdoesnotcomefromanyEuropeanmixture.IntheIndiantheRhnegativegeneis completelyabsent,RislowbutR2isthehighestintheworld.InsomeAmericanIndiansthereisasubstantial "Diego"factorDiawhichisnearlyorcompletelyabsentinEuropeans.Thefactorsinthisgroupwillbeseen tobeveryclosetothatofthePolynesians,asshownbelow.Ref.also95[140] NOTE :BoydcautionsthatthePacicGroupabouttobedescribedunder,andneedmore investigation.IngeneralallofthesehaveahighMandalowNfactor. 6. INDONESIANRACE -IngeneralAandBarebothfairlyhigh,althoughnotinSumatra,andA2isabsent.S ispresentandtheyhaveonlyfourRhgenes[1,2,6andz]withRpredominating. 7. MELANESIANRACEMICRONESIAISSIMILAR -A2isabsentasinbutAandBarehigher.The frequencyofJKaishighwhileKandLuaareabsentandMislow. 8. POLYNESIAN -AlishighbutBisalmostnegligible.MishighwhileSispresentandmostlyattachedtoN. TheyhaveonlythreeRhgenes-Rl,R2andRowiththelatterlow.KandLuaaremissing.HeyerdahlRef.95 [140]pointsoutthatwiththeessentiallyabsentBandthehighM,thesePolynesianscanhavenorelationship totheMelanesiansorMicronesians. 9. AUSTRALIANABORIGINAL -TheseprimitivepeoplehaveahighAl,alowMandnoB.Theyalsohave noS,thusvaryingfromtheIndonesiansabove.WhileRhnegativeisabsent,RZhasitshighestknownfrequency here. AnotherclassicationofraceoccursintheveryrecentpublicationofHughThomasRef.213[288]althoughitis basedonCoon'sdifferentiationof1968.Coonfeltthateachoftheracialgroupstobelisteddevelopedfromentirely separatestemsontheprimatetree. 1. CAUCASOIDS -,includingEuropeans,WhiteAmericans,Middle-Easternwhites,Arabs,Jews,Persians,east IndiansandtheAinus. 2. MONGOLOIDS -,includingChinese,mostEastAsiatics,Polynesians,Eskimos,AmericanIndiansandIndonesians. 3. CONGOLOIDS -,includingblacksofbothAfricaandAmericaandpygmies. 4. AUSTRALOIDS -,theAustralianaboriginesandsometribesofIndiaandthenegritosofsouthernAsia. 5. CAPOIDS -,theSanBushmenandHottentots.


35 RobinHallettRef.83[123]oftheUniversityofMichigan,anauthorityofAfricanhistory,wouldclassifynumber3 and5abovesomewhatdifferently,distinguishingthreeseparatenon-Caucasoid,non-MongoloidracesinAfrica.There areaNegroid,bBushmanoidtheCapoidsofThomasandCoon,describedasshortwithyellowishbrowncolor, thinlips,atnosesandhighcheek-bones,andcPygmoid,peoplewhoareveryshort,withyellow-brownskincolor anddownybodyhair,livingintheequatorialrainforests.HalletsaysthatatthetimeofChristtheBushmanoidswere thedominanttypeincentral,eastandSouthAfrica.TodaytheyarerepresentedonlybythepeopleoftheKalahari desert.TheHottentots,whichwereasubgroup,havedisappeared.ThetrueNegroids,ofcourse,arecharacterizedby darkbrownskin,broadnoses,thicklipsandkinkyhair,originallylivinginthesavannahtothenorthandwestofthe equatorialforests. Inthenextportionofthischapterweshallexaminesomeoftheprehistoricfeaturesmentionedintheearlyparagraphs moreindetailandfromthestandpointofthevariousgeographicalareas. InthegeographicalareasinhabitedchieybytheCaucasiansitwillclarifymatterssometofurtherdifferentiatethis raceaccordingtosomeoftheolderclassications.H.G.WellsRef.229[307]describedthreemainsubdivisions ofthewhiterace-thenorthern"blonds"Nordic,theMediterraneanandnorthAfrican"darkwhites"andasomewhat disputedintermediateAlpine,brachycephalicrace.McEvedyRef.136[187]saystheimportantsubdivisionsare SemitesArabianpeninsula,HamitesAfricanorthandeastoftheSahara,Indo-EuropeansandFinns 2 ofthefar north.Thesignicanceoftheterm"Indo-European"andafurtherbreakdownwithinthegroupwillbediscussedlater inthetext. Forwardto8000to5000B.C.Section3.1 ChooseDifferentRegion 1.AfricaSection2.2 2.AmericaSection2.9 3.CentralandNorthernAsiaSection2.5 4.EuropeSection2.4 5.TheFarEastSection2.7 6.TheIndianSubcontinentSection2.6 7.TheNearEastSection2.3 8.PacicSection2.8 2.2Africa:Beginningto8000B.C. 3 2.2.1AFRICA BeforetheIceAge,inthePlioceneEra,therewereape-likehominoidsusingweaponstokillpreyinAfrica.Itisinthe anthropologicaldigsinTanganyika'sOlduvaiGorgethatonendsthepossibleoriginofmanamillionormoreyears ago.Somecuttingtoolstherearedatedat3,000,000B.C.HumanhabitationinEgyptgoesbackatleast200,000years andtherearestonetoolsinZambiadatingto700,000to500,000B.C.About110,000yearsagotherewasamajor changeinworldclimateprobablyfromeccentricityintheearth'sorbitwhichgaverisetotheIceAgeinnorthern latitudesandtomarkedprecipitationchanges,bothofdistributionandamount,ontheAfricancontinent.Homoerectus disappearedandHomosapiens,withmiddleStoneAgetooltechnology,appeared.ThosemeninAfricaweresimilar oridenticaltoNeanderthalmaninEuropeandAsia. About20,000B.C.duringtheMagdalenianperiod,therewasahuntingcultureinNorthAfricasimilartothatof SpainandFrance,andthepeopleleftremarkablerockengravingsofwild,largeanimalsinsomeareas.Laterpost-ice 2 McEvedy'stextwouldsuggestthatthepeoplehedescribesas"Finns"arewhatmostcall"Lapps"andpresent-dayFinnsoriginatedfartothe east. 3 Thiscontentisavailableonlineat.


36 CHAPTER2.BEGINNINGTO8000B.C. ageMesolithicpaintingshadlostthenaturalismofearlieronesandmayhavebeenchieyrememberedsymbolism withinthetribes,afterthelargeanimalshaddisappeared.AteriaanbowandarrowmakersinMaighrebandStillbayin MagosiansettlementsinsouthandeastAfricaaredatedto185000B.C.Atthattimetherewasalandbridgefromnear thehornofAfricatotheArabianPeninsula.Thelargegameanimals-mastodonsandmammothsbegantodisappear fromAfricasome50,000to40,000yearsagoandthenumberofhumanhuntersprobablydecreasedsecondarily.Rock arthasbeenfounddatingbackto25,000B.C.inNambia;to11,000B.C.insouthernMorocco;andto7,000B.C. inCapeProvince,SouthAfrica.TherstknownNegroskeletoncomesfromIwoIleruinNigeriaanddatestoabout 9,000B.C. Stoneartifactsshowthesameradio-carbondating.Flintblades,adaptedfromancientweapons,wereusednearthe Nileforreapingwildwheatby12,000B.C.Ref.18[31],28[48],140[190],66[97],45[66],130[180], 226[302],88[131],83[123],213[288]AdditionalNotes NOTE :WildcamelswerepresentinnorthwesternAfricafromthemiddlePleistocenedowntotheearlyPostglacialperiod.Ref.313[249]EmmanuelAnatiRef.299[5]datestheNamibiarockarttoaboutthe sameperiodasgiveninthetext,000to28,000yearsBeforePresentanddescribespolychromepainted slabswithanimalgurines ForwardtoAfrica:8000to5000B.C.Section3.2 ChooseDifferentRegion 1.IntrotoEraSection2.1 2.AmericaSection2.9 3.CentralandNorthernAsiaSection2.5 4.EuropeSection2.4 5.TheFarEastSection2.7 6.TheIndianSubcontinentSection2.6 7.TheNearEastSection2.3 8.PacicSection2.8 2.3TheNearEast:Beginningto8000B.C. 4 2.3.1THENEAREAST Ithasbeenmentionedearlierinthechapterthatbefore13,000B.C.theareanowcoveredbytheMediterraneanSea wasinpartalandmasswithonlyconnectedfreshwaterlakes,fedbytheNileandAdriaticriversanddrainagefrom theBlackSeaarea.AstheglacierscontinuedtomelttheAtlanticOceanlevelroseandspilledovertheGibralter barrierintotheMediterraneanbasin.Itispossiblethatagreataccumulationofmenofthedark-whiteIberianracehad occupiedthislushbasinandnowhadtospreadnorth,southandeast.IntheNearEast,asweknowittoday,there werepeopleat20,000B.C.eatingsnails,rivercrabs,freshwatermussels,turtlesandvariousnuts.Cookingbyboiling couldnotbewelldevelopedbeforetheuseofpottery,asonemusthavereproofcontainersforthewater.Someother previousmethodsmayhavebeenusedinlocalizedareasandonasmallscale,suchastheuseofalargemolluscor reptileshell,animalstomachs,etc. TheeasternMediterraneanshorehasbeenwarmandwetenoughforhumanhabitationforatleast20,000yearsand remainsoftheclassicalNeanderthalmanhavebeenfoundtherepredatingthatperiod,particularlyinIsrael,Lebanon andIraq,wheretypicalMousterianCulturetoolshavebeenfoundinbothcavesandopensites.Atabout10,000B.C. theNatuansarchaeologisttermforaparticulargroupstudiedindigsweretakingtheirrststepstowardbuilding permanentsettlements,storingfoodandsimilarbasicactivities.ThisMesolithiccultureofabout10,000to8,500B.C. wascenteredinPalestine,butextendednorthintoSyriaandLebanonandwestintoEgyptandsurroundingAfrica. 4 Thiscontentisavailableonlineat.


37 Quernsforgrindingandsickleswereusedandthepeopleapparentlyhuntedgazelles.Agriculturalcommunities appearedwhererainfallpermitted.AdditionalNotes UpperPaleolithicculturesourishedincavesinAnatoliafrom13,000B.C.onwardsandtherearecavesitesatthe southeastcorneroftheCaspianSeafrom10,500B.C.on.Seasonalsettlementswithmudbrickcubiclesandplastered oorsinthecentralZagrosMountainsdatetothe9thmillenniumB.C.TannahillRef.211[284]saysthatevenback at40,000B.C.therewasonepersonforeverythirty-onesquaremilesinIran,andthebonesfoundtherearechiey ofwildgoatsandreddeer,althoughthoseofhare,fox,leopardandwildcattlehavealsobeenfound.AstheIceAge endedandtheglaciersreceded,theseasroserapidly,particularlywheretherewerewidecontinentalshelves. TheoodinginthePersianGulfareabetweensevenandtenthousandyearsagomusthavebeenspectacular,andbefore theTigrisandEuphratesriverslledthevalleywithsilt,theseareachedinlandoverhundredsofmiles,undoubtedly givingrisetotheoodstoriessocommoninallheritagesoftheoldcivilizationsoftheNearEast.Somefeelthata sinkingofthebedrockundertheMesopotamianplainsmayhaveoutstrippedtheoppositeeffectofsilting,andthus contributedtotheooding.Ref.211[284],68[106],8[14],158[215],224[299],45[66],130[180], 226[302] AtEridu,southofUr,theIraqgovernmenthasunearthedruinsoffourteentemples,oneabovetheother,allbelonging tothe"rstAl'Ubaidperiod",whichwasbeforeatremendousoodingofthisentirevalleyoccurred,llingtheland betweentheSyriandesertplateauonthewestandthePersianmountainsontheeast,representingsometremendous catastropheofnatureandrememberedthereafterinthepeoples'legendsas"TheFlood"-arecurringstorythroughout MesopotamianandNearEasternhistory.Intheexcavationsofthestratabelowtheoodsilttherewaspottery,evidence alreadyoffarungtrade,andatUr,Woollyevenfoundtwobeadsmadeofamazonite,astoneofwhichthenearest knownsourceistheNighirihillsofcentralIndia'Whetherthepre-oodpeopleshouldproperlybecalledSumerians isdisputed.ThefamousSumerianKinglists,foundlateronvarioustablets,showlegendarykingsbeforetheood andthelengthofeachreignwasdescribedfrom18,000yearsback.Then,saythetablets,theoodcame.Thelistsof kingsaftertheoodagainarealllegendarydownto"TheFirstDynastyofUr"whichweshalldiscusslater.Theood plainhadelevenfeetofsiltwhichhasbeenestimatedtomeanaoodnotlessthantwenty-vefeetdeepovertheat, low-lyinglandofMesopotamia.Ur,today,is200milesfromthesea,butonlyfourteenfeetabovesealevel.Ref.238 [318] SheepweredomesticatedinnorthernIraqabout9,000B.C.,certainlyby8,900B.C.,butitispossiblethattheywere broughtfromtheeastaroundtheCaspianSeabynomadswhohaddomesticatedthemevenearlier. NOTE :StoneAgehunter-gatherersleftstonetools,handaxes,borers,scrapers,knivesandarrowheadsfrom oneendofthepeninsulatotheother.Thenowdrywadismusthavegushedwithwateratthattime,although theyapparentlydriedupabout15,000yearsago.Ref.315[125] ForwardtoTheNearEast:8000to5000B.C.Section3.3 ChooseDifferentRegion 1.IntrotoEraSection2.1 2.AfricaSection2.2 3.AmericaSection2.9 4.CentralandNorthernAsiaSection2.5 5.EuropeSection2.4 6.TheFarEastSection2.7 7.TheIndianSubcontinentSection2.6 8.PacicSection2.8


38 CHAPTER2.BEGINNINGTO8000B.C. 2.4Europe:Beginningto8000B.C. 5 2.4.1EUROPE Wehavementionedearlierthatoneoftheoldestskeletonsof homoerectus isonefromSwanscombe,England,found withsimpletoolsmadeofintpebblesandassociatedwithelephants'vertebrae.Continentalexamplesofasomewhat similarmanhavebeenfoundatHeidelbergandrecentlynotfarfromBudapest.Attheearlystateofthenalglaciation Wurmglacier,perhaps50,000to60,000yearsago,therewerewedge-shapedstones,axesandspearsmadeincentral Europe.ThiswasthetimeofNeanderthalman,whoapparentlyhasnodirectdescendantstodayandwhorepresented anevolutionarydevelopmentofprimitivemanwhichforsomeunknownreasoncametoadeadendanddisappeared. Heusedpointedscrapers,triangularknifeblades,ceremonialburialsandheatedsheltersaswellasboneneedles. Europeseemedtobethehomeofthesemen,althoughsomehavebeenidentiedinotherareas.Thearchaeologists calltheirculturethe"Mousterian"afterMousteir,France,thelocationoftheoriginalnds.Theirswasareindeerdependentculture,inwhichmenused"kits"ofsomesixty-threedifferenttools.Theywerebasicallycavedwellers, particularlyinSpainandFrance.AtthistimetherewasalandbridgefromEnglandtoFranceandtheglaciercovered thenorthernhalfoftheBritishIslesandallScandinavia,northerncontinentalEuropeandpartsofRussia.TheBlack Sea,asmentionedearlier,wassmallandafreshwaterlakethatatsometimewasconnectedtothegreatseaextending throughtheCaspiantotheAral.H.G.WellsRef.229[307]thoughtthatthisgreatseamighthavebeenconnected totheArctic,butmodernthoughtmakesitanorthernarmofTethys.Ref.229[307],100[145] IntheLowerPaleolithicAgebackasfaras100,000yearsagotherewereaketoolsoftheClactonianCultureand latertheAcheulianCultureinBritain.TherewassomeoccupationintheUpperPaleolithicinperhapsabout12,000 B.C.andthis homosapiens culturewhichfollowedtheNeanderthalMousterian,showedanincreasedtool"kit"with ninety-threetypesofchippedstonetools,besidesalargegroupofbonetools.Between30,000and10,000B.C.mostof centralandwesternEuropewasprobablyuninhabitablebecauseofcoldandice,exceptinthesummer,butthewaters oftheAtlanticanditsmoresouthernlatitudegavesouthwesternFrancerespitefromthecoldandthuswasafavorite placeforthePaleolithichunter.Earlymanherewasakillerofgameandpart-timecannibal.Inthe"shgorge"ofthe DordogneregionofFrancethereappeared,about25,000B.C.,short,baitedtoggleswithtinesattached,-therstsh hooks. About15,000yearsagohugeherdsofruminantanimalsroamedtheplainsofcentralandWesternEuropeandthey weremostusefultoearlymanassourcesofmeat,clothes,tentfabricsandframesandevenasfuelanimalfat. ThemammothwashuntedparticularlyinsouthernRussiaandCzechoslovakia.Earlymanwasalreadydividedinto subculturesintheUpperPaleolithiclevelwithaPerigordianChatelperronianlevelappearingastheearliestinwestern Europeabout35,000B.C.;aGravettianinCzechoslovakiaabout27,000B.C.extendingintosouthernRussia;and theAurignaciancultureoftheCro-Magnonmanat32,000B.C.inEuropeproper.Thelattermay,however,have originatedintheNearEast.Strangelymarkedbonesandstonesfoundalloverintheseperiodsandextendinguptothe Mesolithicperiodofthepost-iceagehaverecentlybeeninterpretedasnotational,probablyrelatedtotabulationofthe lunarperiodicity,andindicatingskillandintelligenceandsophistication,aswehavepreviouslymentioned. ItwasafterNeanderthalman,whichisafter35,000yearsago,thatclothingandornamentationcanbeidentied.The bestexampleoftheuseofbeadssewnonclothingcomesfromRussia,whereaskeletonwasaccompaniedbyshells aboutthehead,chestandonthelegs,suggestingtrousers.Onthesteppes,wherewoodwasinshortsupply,manyhuts weremadefromthetusksandbonesofmammoth,whichalsoformedthemajormeatsupplyinEasternEurope25,000 yearsago. TwocategoriesofEuropeanartarerecognized,amobileorhomeartdecoratedtools,smallcarvings,etc.andthen thexedworksofcavesandrockpaintings,engravingsandsculptures.TheearliestartdatestotheupperPaleolithic, betweentenandthirtythousandyearsago.Themostdevelopedartwasintheso-calledMagdalenianera,withthe famouscavepaintingsofSpainandFrance,ofwhichmorethanahundredhavebeenfound,perhapsrepresentinga periodofover20,000years.Thepigmentsusedappeartoberedandyellowochre,manganeseorcarbonforblack 5 Thiscontentisavailableonlineat.


39 andchinaclayforwhite.Someofthecolormayhavebeenmixedwithfatandthepaintwasappliedbynger,chewed sticksorfurforbrushes.Thehighqualityofthisart,ofessentiallythesamedegreeofexcellenceasthatoftoday 6 is furtherevidencethatmanofthatdayhadthesamebrainandintellectualpotentialastoday. Ashortglacialperiodbetween9,000and8,000B.C.reacheditspeakinlessthanacenturyanddisappearedrapidly, butforseveralhundredyearstheforestsofEngland,WestGermanyandtheLowCountrieshadaclimatewithtundras, howlingwindsanddriftingsnow.Byabout8,000B.C.shingnetsfromtwistedbersorthongshadbeeninvented. Turnips,onionsandlargeradishesdatebacktoprehistorictimes.Irelandwasprobablyuninhabiteduntilabout8,000 B.C.TheearliestinhabitantsofsouthernScandinaviaenteredbetween12,000and8,000B.C.followingafterthe retreatingice,andformingprimitivehuntingcommunities.Ref.8[14],226[302],211[284],45[66],130 [180],136[187],88[131] ForwardtoEurope:8000to5000B.C.Section3.4 ChooseDifferentRegion 1.IntrotoEraSection2.1 2.AfricaSection2.2 3.AmericaSection2.9 4.CentralandNorthernAsiaSection2.5 5.TheFarEastSection2.7 6.TheIndianSubcontinentSection2.6 7.TheNearEastSection2.3 8.PacicSection2.8 2.5CentralandNorthernAsia:Beginningto8000B.C. 7 2.5.1CENTRALANDNORTHERNASIA ItisofinterestthatsomegeologistshavewrittenthatduringmuchoftheTriassicandJurassicperiodssome200million yearsago,southernTibetwaslargelysubmergedbelowthetropicalseaofTethys-waterseparatingthecontinentsof EurasiaandGondwanaland.DuringtheCretaceousperiod65millionyearsago,theIndiansubcontinentseparated, movedacrosstheTethysandcollidedwithEurasiawithaterricimpactwhichformedtheHimalayanrangeandthe Tibetanplateau.Thecollisionzonefoldedtheearth'scruststoalmostarightangle.Thenonlyafewmillionyearsago furtherupliftoftheHimalayansoccurred,incidenttoglaciationandotherfactors,andthesemountainsarestillrising attherateof1/2centimeterayear.Ref.182[250],100[145] SkeletalremainshavebeenfoundofthecavedwellingNeanderthalhuntersallabouttheareafromtheCaspianto theAralseas.AsthelastIceAgeretreated,Siberianreindeerhuntersprogressivelyworkednorthward.Menoftruly moderntypewerepressingintothisfarnorthlandsome35,000yearsago,wheretheyhuntedmammothswithina hundredmilesoftheArcticCircle,alongthePechoraRiver.AnearlywaveofmenspreadfromtheUralMountains acrosscentralAsiatosouthernSiberiaandMongoliaandtheirrelicshavecometobeknownastheMal'ta-Afontova Culture.AsecondwavepenetratedeasternSiberiaalongtheAldanRiverandSovietexcavationstherehaveshown thesepeopleoftheDiuktaiCulturetohavehuntedmammoths,muskoxen,bisonandgiantwoollyrhinocerosesabout 35,000yearsago.ThesepeoplemayhavebeensomeoftherstadventurersacrossthelandbridgeintoAlaska.Certain SiberiantribesexistingtodayNganasans,Eutsis,DoganChukchi,etc.haveacomplextime-factoredmythologyand ceremonials,includinglunarcalendarnotations,bearandreindeerceremonies,etc.thatarerelatedtoUpperPaleolithic culturesof15,000to35,000yearsago. AroundLakeBaikalandtheupperYenisseiRiverwellpreservedartifactsdatingto20,000yearsagohavebeen excavated.Theseincludehutsandsmallartobjects,suchascarvedgeesegurinesandtinyfemalestatuettes.From 6 ThisisArnoldToynbee'sopinion.Ref.220[294] 7 Thiscontentisavailableonlineat.


40 CHAPTER2.BEGINNINGTO8000B.C. thelatteritisapparentthattheseMongoloidpeopleworeskinsuits,parkahoodsandmoccasinssewedontrousers.The bowandarrowmayhavebeeninventedincentralAsiaby13,000B.C.About11,000B.C.theAsiaticwolfprobably wasunderhumancontrol,butonlybygettinganimalsundersixweeksofage.Thiswasnottruedogdomestication. Ref.211[284],45[66],226[302],182[250],130[180] Dr.AlesHrdlickahasfoundonthesouthernslopesoftheHimalayasamongtheTibetantribesayellow-brownstock which"inphysique,inbehavior,indress,andeveninintonationsoflanguage" [ ? ]appearidenticalwithAmerican Indians.Couldthisbetheiroriginalhomeland? ForwardtoCentralandNorthernAsia:8000to5000B.C.Section3.5 2.6TheIndianSubcontinent:Beginningto8,000B.C. 8 2.6.1THEINDIANSUBCONTINENT TheIndiansubcontinenthasproducedalmostnofossilmenwiththeexceptionofRamapithecusfromtheSiwalikbeds andasimilarjawfromGandakasinPakistan.Thesehavejustrecentlybeenputintothehuman"line".Butmenhave livedinIndiasincethesecondinterglacialperiod,from400,000to200,000B.C.Thehand-axes,choppingtoolsand akesoftheearlyStoneAgearefoundinthePunjabfoothills,theSoanandBeasvalleys,Rajasthan,Malwaandas farsouthasMadras.SomeofthesearereminiscentoftheClactonianofEuropeandtheOlduvanofAfrica.Atthe closeofthePaleolithic,tinybladelettoolslikethoseoftheEuropeanMesolithicAgewerebeingused.Fromthenuntil about10,000B.C.therewasamixtureofarchaicandgraduallymoremodernsocieties,oftensidebyside. After10,000B.C.,exceptforthehighmountains,Indiawascoveredbywoodlandandthemodernbarrenlandscapeis man-made,duetomillenniaofwoodlandclearanceforvariousreasons.Ref.8[14],38[59],88[131],45[66] Continueonpage36 2.7TheFarEast:Beginningto8000B.C. 9 2.7.1THEFAREAST Thefamous"PekingMan",unearthedinnorthernChina,livedsome500,000yearsagoandhisuseofreallowed himtolivenorthofthefrostline.Heappearedtohaveabraincapableofspeech,anerectpostureandwasahunter andnut-gatherer.Hewasanintermediarystageofearlyman,evolvedbeyond Homohabilis whohadspreadacross EurasiaandAfrica,andwasdenitelyrelatedtotheJavaman Pithecanthropusrobustus .Bothhaveshovel-shaped incisors,acharacteristicofthemodernMongoloidrace.Afterthisearlyinterglacialperiod,northChinahadaseriesof evolutionarychangeswithNeanderthal-liketypesandthefullymaturedMongoloidHomosapiensappearingperhaps 20,000yearsago.Inthelatterpartofthisperiod,partsofsouthChinawereoccupiedbypro-humanswithsome Negroidracialcharacteristics.AllEastAsianstoneagepeopleusedadistinctivechop-pingtoolthatdifferedfromthe technologyofprehistoricEuropeandAfrica.Doesthismeanamultipleoriginofpresentdaymankind? About12,000yearsagoChinaprogressedtoceramicsandthebeginningsofagriculture.ThisYang-shaoCultureis representedinmorethan1,000excavatedsitesinHonanandKansuprovinces,withhand-moldedred,blackandgray potterypaintedwithpigments.AhuntingcultureexistedincentralChinaatthattime. At20,000B.C.therewerelandbridgesfromChinatoKoreaandfromKoreatothesoutherntipofJapanandpeople couldgofreelyacrosstheseareas.TherstpeopletoarriveinJapan,however,didsosome100,000yearsagoand werepre-MongolianAsiatics,similartotheaboriginesofAustraliatoday.Theywerewanderinghunterswithpale complexionsandheavybeardsofvaryingcolorsanddegreesofcurliness.Forthenext90,000years,duringthelastof theIceAges,JapanwasusuallylinkedtotheAsiaticmainlandbythelandbridgesandislandchains,sothatHokkaido 8 Thiscontentisavailableonlineat. 9 Thiscontentisavailableonlineat.


41 wasaccessibletoSiberiaandKyushuwasaccessibletoTaiwanandSoutheastAsia.Withthemeltingoftheglaciers some10,000yearsago,Japanwascutofffromthemainlandandthereweretwosurvivingcultures,eachwithits ownlanguage-aSiberianoneinthenorth,survivingtodayasAinu,adistantrelativeofsometongueoftheSiberian tundra,andthesouthernlanguage,whichhasdevelopedintomodernJapanese.Inthelatter,someofthemoreancient andbasicwordssuchasthosefor"mother","father",etc.,bearsomeslightresemblancetosomePolynesiandialects andtosomewordsofcertainhilltribesofMalaya. PotteryfoundinFukinCave,Kyushu,Japanhasaradio-carbondatingofabout129700B.C.andisconsideredtobe theearliestintheworld.TheJomonPeriodofJapan,withahunting,shingandgatheringeconomyandtheuseof potterybutnotmetal,startedabout12,000B.C.andcontinuedforthenext8,000years.InthiseraJapanseemsto havebeenisolatedfromChinaandhadmoreincommonwiththePacicIslands. Javaman,whoseremainswerefoundintheBrantasValleyofJavabyEugeneDubois,aDutchdoctor,in1891,hasbeen datedto400,000B.C.,andappearstoberelatedtoPekingmaninChinaandhasthesameMongoloid,shovel-shaped incisorteeth.Some20,000yearsagotherewerelandbridgesallabouttheMalayanpeninsula,throughSumatra,Java andBorneoandconnectingalltotheregionsofpresentCambodiaandVietnam,makingthehugesubcontinentcalled theSundaShelf.Thepeoplemayhavebeentheancestorsofpresent-dayNegritosstilloccupyingsomeremoteregions ofthisarea.Mostwerehunters,somelivedincaves,andtherewerecultivatedfoodsinThailandasearlyas10,000 B.C.Therehavebeencarbondatingsof9,750B.C.ofseedsofpeas,beans,cucumbersandwaterchestnutsofthesize andshapesuggestingactualcultivation.Iftrue,thiswassome2,000yearsbeforetrueagriculturecanbeprovedinthe NearEastorCentralAmerica.About250,000yearsagopeoplemayhavewalkedacrossthethenexistinglandbridge fromtheMalaysianpeninsulaandtheAsianmainlandtothePhilippineIslands.Thementheremayhavebeenakin totheJavaandPekingmen.CavendswestofMindanaoshowcrudetoolsof50,000B.C.andinsomeareasthere arebettertoolsdatingto20,000B.C.Ref.101[146],12[21],45[66],8[14],175[241],211[284],215 [290] AdditionalNotesp.41 NOTE :Upto10,000yearsagosmallbandsofhunter-gathererswerewidelyscatterednorthtosouthfrom VietnamtoSumatraandeast-westfromBurmatotheGulfofTonkin.SpiritCaveexcavationshaveshowna varietyofgame-deer,pigs,monkeys,bamboorats,otters,yingsquirrelsandfromthesea-carpandcrabs. Nuts,beansandmelonswerealsoavailable.Ref.297[232] ForwardtoTheFarEast:8000to5000B.C.Section3.7 ChooseDifferentRegion 1.IntrotoEraSection2.1 2.AfricaSection2.2 3.AmericaSection2.9 4.CentralandNorthernAsiaSection2.5 5.EuropeSection2.4 6.TheIndianSubcontinentSection2.6 7.TheNearEastSection2.3 8.PacicSection2.8 2.8ThePacic:Beginningto8000B.C. 10 2.8.1THEPACIFIC Itispossiblethatbetween50,000and70,000yearsagomanventuredontothecontinentofAustraliaandsettled chieyalongthecoastalareaswhicharenowsubmergedandnotaccessibletoexcavation.Atthattimetherewere 10 Thiscontentisavailableonlineat.


42 CHAPTER2.BEGINNINGTO8000B.C. landbridgesfromNewGuineatoAustraliaandontoTasmania.OthersbelievethatAustraliawascolonizedonly some30,000yearsagowiththemencomingbyboatorraft.TragerRef.222[296]saysthattheserstsea-going peopleoftheworldpopulatedAustraliaat42,000B.C.Inanyevent,edge-groundaxesdatingto22,000yearsago havebeenfoundinArnheimLandonthenorthcoast,anditisthoughtthattheentirecontinent,alongwithTasmania andNewGuineawereprobablywidelysettledby18,000B.C.Thepeoplewereearlyhunterscontemporarywithgiant marsupialswhichtheymayhavehelpedtoexterminate.ThelandbridgesprobablycontinuedoutintoMelanesiaand thesamepeoplesoonoccupiedthosecontinentalextensionsintothesouthPacic.Wehavenoinformationabout humansintheotherfar-spacedislandsofthePacicatthatveryearlytime.Ref.45[66],176[242],8[14],215 [290]AdditionalNotesp.42 NOTE :RockartappearedinSouthAustraliabefore20,000B.C.andhumanboneshavebeenfoundincaves inTasmaniaof20,000yearsago,thustwotimesolderthananyothersfoundthisfarsouth.Ref.299[5], 312[227] ForwardtoThePacic:8000to5000B.C.Section3.8 ChooseDifferentRegion 1.IntrotoEraSection2.1 2.AfricaSection2.2 3.AmericaSection2.9 4.CentralandNorthernAsiaSection2.5 5.EuropeSection2.4 6.TheFarEastSection2.7 7.TheIndianSubcontinentSection2.6 8.TheNearEastSection2.3 2.9America:Beginningto8000B.C. 11 2.9.1NORTHAMERICA Atsometimebetween40,000and10,000B.C.humanhuntinggroupsoccupiedallthemainlandmassesofearthexcept Antarctica.MenreachedAmericaabout20,000B.C.perhapsearlierfromAsiaoveralandbridgebetweenAsiaand Alaska,varyingfromthreehundredtoonethousandmileswideandapparentlyincludingtheAleutianIslandswhere bladesandburins,perhapsdatingbackto10,000B.C.havebeenfound.Otherwisetheearliestknownculturesofthe Americanfarnorthhavenotbeenwelldated 12 .Theso-calledBritishMountainCultureneartheYukonArcticcoastis probablytheoldest,withartifactsofeasternSiberia,includingcrudeinstrumentsandshapingtools.There,intheOld CrowBasin,therstknownoccupationsiteintheNewWorldhasbeententativelycarbon-datedto25,000B.C.The inhabitantswereskilledusersofbone,usingmammothandhorsebone,thelatteranimalsranginginsizefromponies toPercherons.Jawsofdomesticateddogsappeartobe30,000yearsold.Atanyrate,thepeoplewhocameoverthe landbridgeapparentlysimplyfollowedtheirpreyanimalsandwereofabasic,generalMongoloidstockwithskulls notmuchdifferentfromCaucasiansandtheirdescendantsbecametheAmericanIndians.Thetoolsandskillsspread fromAsiatoAmericawiththemandincludedthestoneadze,spoons,combsofboneorhorn,thetoggleharpoonand eventuallythebowandarrow.MarshackRef.130[180]saystheAmericanIndianscameinwavesfromAsiaover aperiodofperhaps20,000yearswithsomeaslateas2,000B.C.Thelattergureisnotfurtherexplained.Weknow thatthelandbridgewaspresentoffandonoverseveralmillennia,butneveraslateas2,000B.C.Itisinterestingthat aslateas1962thistheoryoftheAsiaticoriginoftheAmericanaborigineswasnotuniversallyaccepted.Greeman Ref.78[118]wascommittedtodiffusionacrossthenorthAtlanticinskin-coveredboatsintheUpperPaleolithic 11 Thiscontentisavailableonlineat. 12 TragerRef.222[296]evenstatesthatracemizationtestsonbonesuggestthatNeanderthalmanmayhavebeenonthewestcoastofthe westernhemisphereat50,000B.C.,butwehavenotseenconrmationfromanyotherauthorandTragerdoesnotrevealhissourcematerial.


43 times.HefeltthatSandiaCulturematerialinAmericawasthesameastheSolutreanoftheMontautsiteinsouthwest France.BloodtypingstudiesbeginningwithBoydRef.17[30]in1963probablylaidthistheorytorest. ThegreatbulkofthepeoplecomingovertheBeringlandbridgemaynothavebeenabletomigratedownintothe regionoftheUnitedStatesandfarthersouthuntilabout12,000yearsagowhentheicethathadpreviouslyalmost coveredCanadanallymeltedenoughtoopenacorridoreastoftheRockies,atwhichtimetheMongoloidhunters pouredthroughtothegamelandsoftheAmericanplains.Dr.KnutFladmarkasquotedbyCanby[Ref.22[38]]of BritishColumbiaarguesthatsomemencouldhavecomesouthwhenthecorridorwasclosedbyleapfroggingdown thecoastwherethereweremanyice-freepockets,byboat.Furthermore,recentworkshowspositivelythatmuchof thecoastlineandislandarchipelagooffthecoastofsouthernAlaskawasnevercoveredbyglaciersatanytime.Ref. 239[320] AslightlydifferentviewisgivenbySwansonetalRef.209[282]whostatesthattherstcrossingoftheBering Straitoccurredfrom26,000to28,000yearsagoandthatthesepeoplebecametheAmericanIndianswithbloodtypes chieyO,withsomeAandnoB.Thenasecondmigrationtookplacebetween10,000and20,000yearsagowhich perhapsincludedtheEskimoswhohaveABand0bloodtypes.Theymayhavecomebykayakfromoneshoreto anotherasEskimostodaystillliveonbothsidesoftheBeringStrait.By10,000B.C.prehistorichunterswerein allpartsoftheNewWorld,evenatTierradelFuego.Someshingandgatheringpopulationswereverylarge.The highestaveragepopulationdensitynorthofMexicowasinCaliforniawherethereweretheacorngatherers,agroup whichwassosuccessfulthattheywerenotapttoexperimentwithnewtechniques.Themostrecentglaciationperiod inNorthAmericareacheditsmaximumbetween18,000and22,000yearsagoandextendeddowntoNewYorkState andcentralOhio,coveringMinnesota,Wisconsin,Iowa,IllinoisandpartsofKansasandMissouri.After12,000B.C. thisretreatedrapidly,sometimesseveralmilesinasingleyear. At9,000B.C.theAmericanplainsstillteemedwithgiantbison,camels,stagmoose,musk-oxen,largecats,mastodons andthreekindsofmammoths.Mostoftheseweregonewithin1,000yearsofman'sarrival.Thedatingoftheint spearheadsoftheSandiaCulturewhichhavebeenfoundinOregon,OntarioandNewMexicohavebeenvariously datedfrom23,000to6,000B.C.Atanyrateitwasalongtheretreatingiceedge,wherethespruceforestandpines migratednorthandwestfromtheAppalachiansandtheoakmovednorthfromtheGulf,thattheincreasedparkland andgrassallowedthehumanpopulation,nowwitharadicalnewstonetechnology,togreatlyincrease.Thiswasthe timeoftheGreatHuntingCulture,associatedwiththeClovispointsoftheSandiaCulturementionedabove.These ClovispointssonamedbecauserstidentiednearClovis,NewMexicowerelarge,heavyintpointsdesignedfor huntinglargeanimals,andbutcheredelephantshavebeenexcavateddatingtotheperiod9,500to9,000B.C.Insome areasthisculture,alsosometimescalledLlano,hasbeendatedfrom11,000to15,000yearsago.TheFolsomspear pointswhichdevelopedfromtheClovisweresmallerandmoredelicatelymade,foreffectiveusebythebisonhunters. Astemperaturesroseandthecloudcoverdiminished,therewasanincreasedevaporationrate,theplantcoverthinned andthegreatherdsdeclinedrapidly.Somefeelthatpriortothetemperaturerisethenorth-southcorridoropenedup intheglaciersallowingarcticwindstodescendontheplains,andthesuddendropintemperaturewasafactorinthe dyingoffofthegiantbisonandmastodons.TheDesertTraditionofwesternNorthAmerica,datingfromabout9,000 B.C.wascenteredintheGreatBasinofNevadabetweenthetwogreatmountainchainsandoccupyingportionsof sixpresentstates-Nevada,Wyoming,Idaho,OregonandCalifornia.Basketsandmillingstonesweremadeandthe subsistencebaseincludedsmallseeds,berries,bulrushrhizomesandnuts. IneasternUnitedStates,somefortymilessouthofPittsburgistheMeadowcroftrockshelterwhereremainsofIce AgemanincludesabifacialprojectilepointwhichmaybeancestraltotheClovispoint.Thecarbon-14datingofthe hearthis14,000B.C.butsomedoubtifthisdateiscorrect.Ref.211[284],209[282],210[283],8[14],22 [38],64[94],224[299],45[66],21[34] Concerningbloodtypes,mostNorthAmericanIndiansareexclusivelytypeObutafew,suchastheSioux,Chippewa andPueblohave10to15%GroupAwhiletherestareO.Thesemayrepresentseparateandlatermigrationgroups overtheBeringlandbridge,or,asshallbediscussedlater,possiblymixtureswithEuropeansorlaterAsiatics.Ref. 21[34],155[214]


44 CHAPTER2.BEGINNINGTO8000B.C. AdditionalNotesp.44 2.9.2MEXICO,CENTRALAMERICA,ANDTHECARIBBEAN TheNationalGeographicSocietyRef.155[214]saysthatartefactssuggestman'spresenceatPuebla,Mexico by20,000B.C.althoughsuchearlydatesarenotuniversallyaccepted.TherocksheltersnearTehuacanhavebeen continuouslyoccupiedsince10,000B.C.InCentralAmericagourdandsquashdatetoprehistoryalongwithvarious wildformsofbeans,lentilsandchickpeas.Ref.211[284] 2.9.3SOUTHAMERICA ThetoolsofPleistocenemenwhohuntedcamelids,slothsandperhapshorseshavebeenunearthedatthebottomof arockshelteronthewesternslopeoftheAndescordillera.Thepresenceofhumanshasbeenattested13,000years agoinVenezuela,ArgentinaandPeru.DuringthelastphaseoftheIceAgetheWisconsininNorthAmericathe Andeanglacierswereaslowas11,000feetandtheirmeltinglatermayaccountfortherarityofhumansitesduring thatchaoticperiodofterricgorgeooding.Afterthat,however,theAndeswerecertainlyinhabitedbynumerous bandscorrespondingtothearchaicsocietiesofNorthAmerica.IncentralPeru,atChilca,whereat12,000to13,000 feetaltitudeonlyeightinchesofrainfallinayear,caveswithasmanyasfourteenarcheologicalstratahavebeen excavated.Perfectlypreservedcorpsesofseveralpeoplehavebeenfoundindicatingastoutbuttallphysique,varying from65.2to69.2inchesinheightaccordingtosex,withlongheads,protuberantjawsandstrongbones.Theyhad clothesmadeofcactusplantbersorofreeds.Somehadcloaksofvicunaskin,paintedandsewnwiththehelpof cactusspines.Weaponswereslingsandspearthrowerswithjavelinpointsmadefromobsidian,basaltorquartz.Hand axesandscraperswereverysimilartotheEuropeanMousterians',althoughseparatedintimebysome20,000years. Atabout13,000B.C.thewatersofthePacicweresomethreehundredfeetbelowpresentlevel,andattimessince thentheyhavebeensixteenfeetabovethepresentlevelandhaveoscillatedthroughtheages.Thismayhavegreatly disturbedthelivesoftheearlydwellersbyvirtueofchangesinthefreshwaterlevelsofthebeachesofarid,western Peru. Humanlivingsitesalongwithbonesofsloths,horses,camelidsandmastodonshavealsobeenfoundinthesierra regiontheAtlanticAndesofColumbiaandVenezuela.MenmayhavereachedtheextremetipofSouthAmericaat Falls'Caveby9,000B.C.orshortlythereafter,buttheremaybesomedisagreementastotheirorigin.Inthisarea PatagoniancaveswereinhabitedduringthehighHoloceneandimmigrantsfromAustraliaorSoutheastAsia may haveenteredthecontinentviaAntarcticaandtheislandofTierradelFuego.Stilllaterothersettlerscamefromthe easternAndes.OnTierradelFuegothechiefpeoplewereOnas-big,handsomemendressedinvicunaskins.They haddomesticateddogsandpoisonarrowsandremovedtheirbodyhairwithshellsusedaspincers. TheLagoaSantacavesinBrazilshowcharcoaldatingtobetween18,000and20,000B.C.andtoolsalongwith mastodonbonesdatingto9,400B.C.havebeenfoundincentralChile.ElIngoisapre-ceramicsiteatanaltitudeof 9,100feetinEcuador,datingbacktoabout10,000B.C.showinganobsidianworkshopandhuntingcampsite.The toolsshowsimilaritytoFolsomandClovispointsofNorthAmerica.Ref.45[66],22[38],62[91]Additional Notesp.45 IthasbeenthebeliefofauthoritiesinthepastthatallCentralandSouthAmericanIndianshadthebloodtype0 exclusively.VeryrecentABOblood-groupantigenandHL-Awhitecellstudiesindicatethatthiswasnottrueof PeruvianandChileancoastalpeoplesevenat3,000B.C.BothAandBwerefoundinmummiesofParacas,Huariand IcawhileABwasfoundintheseareasplusthoseoftheHuachoandNazca.OnlytheIncamummieswere100%0 andonlyveofthesewerestudied.OfonlyfourChileAtacamenasmummiestyped,allweretypeA.Wedonotknow whatthismeans,butitispossiblethatthesestudiesarecompatiblewithideasofpre-ColumbiandiffusionfromEurope orAsia,afeatureweshalldiscusslater.Ref.3[4]ProfessorFredericAndreEngelRef.62[91]whohasspent mostofhisadultlifeasanarcheologistinSouthAmericare-emphasizesthatalthoughonemustacceptanAsiatic foundation,evidencesofstrongforeigninuencesappearalmosteverywhereintheAmericas,eveninpre-Columbian times.


45 NOTE :Paleo-IndianskeletonshavebeenfoundnearWaco.Texasradio-carbondatedto10,000yearsago. Artifactsburiedwiththemindicatetrade,withseashellpendants,redintsfromtheTexasPanhandle, projectilepointsfromtheplainsandsometools.Someburialobjectsindicateadeathritual,perhapsrelated toareligion.Bonesofcookedrabbits,turtles,raccoonsandsnakeswerepresent.Ref.298[128] NOTE :RockarthasbeenfoundinBrazildatedto17,000B.C.andatthetipofSouthAmericadatingto 10,000B.C.Ref.260[29] ForwardtoAmerica:8000to5000B.C.Section3.9 ChooseDifferentRegion 1.IntrotoEraSection2.1 2.AfricaSection2.2 3.CentralandNorthernAsiaSection2.5 4.EuropeSection2.4 5.TheFarEastSection2.7 6.TheIndianSubcontinentSection2.6 7.TheNearEastSection2.3 8.PacicSection2.8




Chapter3 8000to5000B.C. 3.18000to5000B.C. 1 3.1.1CHAPTER2:8TH,7TH,&6THMILLENNIAB.C. BackwardtoBeginningto8000B.C.Section2.1,000TO5,000B.C.-FROMHUNTINGTOAGRICULTURE Althoughtechnicallythisperiodtobediscussedisstillprehistoricalfromthestandpointofitsprecedingman'sability towriteandthereforenarratehisexploits,archaeologicalexcavationsandotherstudieshavepin-pointedsomany activitiesthatitseemsworthwhiletogiveaseparatechaptertothesethreemillennia.Inthisperiodtherewere weatheroscillationswithrapidchangesinclimateandcorrespondingchangesinoraandfaunabutoveralltherewas improvementtowardamoretemperatesituation.Domesticationofsomeanimalsoccurredandtherewasearlyplant cultivation.Domesticationinvolvesselectivebreedingandgeneticchangesothatsomespeciesbecomecompletely dependentonman'sinterventionforsurvival.Theyieldfromcultivatedcerealsmadepossiblehumancommunitiesof alargersizethaneverbefore,andthusforthersttimetherearosesettlementswhichcanbedescribedasvillagesor eventowns.Theearth'spopulationat8,000B.C.hasbeenestimatedat5.3millionRef.222[296].Thechanged distributionofrainfallandthechangesinseaandlakelevelsafterthatdatenecessitatedagreateruseofthegrasses whichaboundedinthemountainfoothillsandtheselectionofcertainformswhichcouldbegrowninlowlandhabitats aspotentialcrops.Asmankindbegantoleavefood-gatheringforanagriculturalwayoflife,99%ofthetimeduring whichmankindhasexistedhadalreadypassed.Ref.8[14],215[290],221[295] Forwardto5000to3000B.C.Section4.1 ChooseDifferentRegion 1.AfricaSection3.2 2.AmericaSection3.9 3.CentralandNorthernAsiaSection3.5 4.EuropeSection3.4 5.TheFarEastSection3.7 6.TheIndianSubcontinentSection3.6 7.TheNearEastSection3.3 8.PacicSection3.8 1 Thiscontentisavailableonlineat. 47


48 CHAPTER3.8000TO5000B.C. 3.2Africa:8000to5000B.C. 2 3.2.1AFRICA BacktoAfrica:Beginningto8000B.C.Section2.2 About7,000B.C.atwo-manploughwasusedinEgypt,onemanaheadpullingonaropeandtheotherpressingdown thepoint.Ref.213[288]ItisassumedthathuntersandpastoralpeopleslivedingreatpartsofAfrica,particularly thenorthandeastatthistime,butthereislittleornoevidenceoftheircultureexceptintheSahara,itself.Someof theTassilipastoralrockpaintingsofthatareamaydatebackto6,000B.C.Duringtheclimaticoptimumfromabout 7,000to3,000B.C.theSaharawasbushcountry,wellstockedwithgame.Itwellcouldhavebeenazoneofhuman interbreedingofraces,inthattodaythereareanumberofSaharanandSudanesetribeswhichappeartobeintermediate betweenCaucasoidsandAfricanNegroes.Mediterraneandark-whiteHamiticCaucasoidsappeartohavecomefrom Asia,bringingCushiticlanguagesabout8,000B.C.andspreadingsouthalongtheRiftValleyofAfricatosettleby thelakesinKenya.Theywereshermen,usingstoneinstrumentsandmakingpottery.Ref.83[123]Buttoreturn totheareaoftheSahara,certainlybefore6,000B.C.thiswasaregionoflushvalleys,woodedhillsandfertilerolling plains,andtherockdrawingsofthisearlyperiodsuggestthatthepeoplewerelikethepresentdayBushmen,now foundonlyintheSouthAfricandesert.Butwiththedisappearanceofthebiggame,particularlythebuffalo,these peoplewereapparentlyreplacedbyherdsmenfromtheeast,perhapstheancestorsofthepresentdaynomadicFulani peoplesRef.215[290],176[242]ElsewhereinAfricafromabout6,000B.C.on,somegroupslivingnearlakes orriversadoptedamoresettledwayoflife,usingboneharpoonsforshing.Remainsofthesehavebeenfoundnear LakeChad,LakeEdwardandKhartoumontheNile.Ref.88[131] ForwardtoAfrica:5000to3000B.C.Section4.2 3.3TheNearEast:8000to5000B.C. 3 3.3.1THENEAREAST BacktoTheNearEast:Beginningto8000B.C.Section2.3 Theearlyagricultureofthenaturallygrowingwildwheatandbarleyinpartsofthisareaallowedthedevelopmentof communitiespermanentenoughtodevelopbrickandstoneforbothprivateandpublicbuildings.Theearliestsites werenotfarfromthemountainrangeswhichhadbeentheoriginalhomeofthecerealsjustmentionedandallwere withinabeltof300millimetersinchesrainfallayear,orinaoodplain.SuchwereTelles-SultanatJericho andCatalHuyukincentralTurkey.Thelattercoveredthirty-twoacreswithperhaps6,000to10,000people,with evidenceoflongdistancetrade,volcanicglassfortoolsandblueapatiteforornamentation.Thiscentercametoanend about5,000B.C.,apparentlysimplyabandoned.Buttherstknownpotteryandwoolentextileswerefoundthere 4 Jericho,inJudea,isthoughttobetheworld'soldestcity,datingback9,000yearsago,some4,000yearsbeforethe rstSumeriancity.SittingbesideaspringneartheDeadSea,ithadstonewallsandatowerthirtyfeethighanda populationofperhaps2,500,allliving800feetbelowsealevel,whereasitscounter-partCatalHuyukwasatanaltitude ofmorethan3,000feet.Inbothitappearsthatwomencultivatedthecropsandlookedaftercattlewhilethemenwent huntingwiththeirnewlydomesticateddogs.AdditionalNotesp.49 Althoughnotyetatthestageofcitybuilding,SumeriansinMesopotamiaarethoughttohaveinventedthewheel sometimebetween65500and6,300B.C.Ref.222[296]WheatandbarleywerebothgrowninsouthernIraqby 79000B.C.ExcavationsatTelles-Sawwan,seventymilesnorthwestofBaghdadindicateahighlevelofcivilization therearound6,000B.C.,withbuildingsbuiltfromunbaked,mortaredbricksandhouseswithaccessthroughtheroofs 2 Thiscontentisavailableonlineat. 3 Thiscontentisavailableonlineat. 4 HughThomasRef.213[288]saysthattheworld'srstpotterywasamonochrometypemadeinIraqabout7,000B.C.withpaintedpottery appearingabout6,500B.C.


49 andcoatedwithplaster,thenbitumenandnallyfacingsofgypsum.Thissitewasoccupiedfor1,000yearsandhas similaritytoCatalHuyukalthoughoccurringmuchlaterintime.ItllsinagapbetweenthenewStoneAgeand recordedhistory.Thustheso-called"NeolithicRevolution"appearstohavetakenplacebetween7,000and6,500B.C. Someinstrumentsinsteadofbeingchippedwerenowhighlypolished.Therstfarmanimaltamedwasprobablythe goat,whichlivesoffwildgrass.Sheep,pigsandnallycattlefollowed.Thepigisnotaruminantandpig-rearing couldnotoccuruntilnuts,acorns,meatscrapsandcookedgrainwereavailable.Cattle,domesticatedeitherinTurkey orMacedoniabetween6,000and5,800B.C.,offeredadifculttaskastheoriginalswereeryandagile,butthiswas amostimportantstepinman'sexploitationoftheanimalworld.Theywerebroughtundercontrolbypoorfeeding, closepenning,hobblingandcastrationofthebulls.Thebarnyardanimalbecameman'srstpowertool,butcattle werenotusedinanyotherareaoftheworldinthismilleniumtime-frame.EveninthisNearEastregiondesertstill predominatedandmanandanimalswereactuallycrowdedinoases.Eriduwasanagriculturalsettlementof5,000 B.C.Ref.68[106],8[14],213[288],222[296] Woolengarmentswerewovenandthereisevidenceofearlytradeinobsidianwhichwasidealfortools.Thiscame fromtheareaofLakeVanandwasexportedtoMesopotamiaasearlyas7,000B.C.Basketsandwoodenaswellas stonevesselshadbeeninventedbeforethe6thmillennium.AtHacilarinAsiaMinor,beginningabout5,500B.C.there isevidenceofaChalcolithicCulturewhichinvolvestheuseofpurecopperalongwithstone.Elam,insouthernIran wassettledbythe8thmillenniumandinthemiddleofthe6thIranhadfarmingvillageswithirrigationagriculture, supplementedbyhunting.Animalpaintingsandimportedcoppertoolshavebeenfound. Aswehavenotedinthelastchapter,theBlackSea,uptothistime,hadbeenafreshwaterlake,connectedinturnto theCaspian-Aralsystem.Now,astheicecapmeltedandthesealevelrose,saltwaterintheMediterraneaneventually wentovertheBosporanshelfintotheBlackSea,killingthefresh-waterlifeitcontained.Thedecomposedremainsof thisice-agepopulationstillpoisonsthelowerlevelsofthestagnantBlackSea,whichisstilldevoidoflifebelow250 feet.Ref.176[242],60[89],28[48],45[66],215[290],88[131],158[215] ForwardtoTheNearEast:5000to3000B.C.Section4.3 ChooseDifferentRegion 1.IntrotoEraSection3.1 2.AfricaSection3.2 3.AmericaSection3.9 4.CentralandNorthernAsiaSection3.5 5.EuropeSection3.4 6.TheFarEastSection3.7 7.TheIndianSubcontinentSection3.6 8.PacicSection3.8 NOTE :PeoplelivinginreedhutsalongthePersianGulfontheArabianpeninsulahadsomekindofcommercewithMesopotamiaby5000B.C.Ref.315[125] 3.4Europe:8000to5000B.C. 5 3.4.1SOUTHERNEUROPE CreteandtheAegeanIslandsweresitesofagriculturalsettlementsspreadingoverfromAsiaMinorbetween7,000 and6,000B.C.Alittledifferentviewissuggestedinthenextchapter.Amysteriouspeoplewhoseplacenames andthereforelanguagewasnotGreek,spreadovertheeasternMediterraneanperhapsasearlyas6,000B.C.Linguist LeonardPalmerbelievesthereisadeniteMiddleEasternavortothewordsleftbehind,andtracesthemtothe 5 Thiscontentisavailableonlineat.


50 CHAPTER3.8000TO5000B.C. Luvians,apeoplefromthehillsofTurkey."Corinth","Olympus"and"Knossos"areamongthosenamesthatare notGreek.TheoldesthousesbelowKnossosonCrete,inaneolithiclayerdatedat6,000B.C.,weremadeofmud brickshardenedinre,amid-easterntechniqueneverseenlaterontheisland.TherstsettlersofCrete,whoeverthey were,foundaheavilyforestedlandwithvaststandsofcypress,oak,chestnutandpine,unlikemodern,denudedCrete. CyprushadaNeolithicpopulationbythe4thmillenniumB.C.Ref.109[155],215[290],88[131],41[62] ThecentralmountainsofGreeceareaseriesoflimestoneridgesrunningsoutheastintotheAegeanSeawherepeaks formaseriesofislands.Thecultivablevalleysonthecoastaremoreaccessiblefromtheseathanfromeachother ortherestofEurope.ThereforetheeastcoastofGreeceparticipatedintheagriculturalsettlementoftheAegeanvia theseafromtheeast.DomesticatedsheepwereinGreeceby7,200B.C.TheBalkanshadagriculturalsettlements andpaintedandimpressed-wareculturesfrom6,000to5,000B.C.spreadingupfromGreece.Theeconomywas basedonsheep,wheatandlegumes.Karanovo,Bulgaria,isanexample,withmoundsettlementdebrisfortyfeethigh. SimilarculturespreadallalongthecoastsoftheAdriatic,SicilyandsouthernFrance.ExcavationsintheMaritsa ValleyValleyoftheRosesincentralBulgariaindicateplasteredmud-housesoverwoodframeworkpresentby6,000 B.C.Eachgenerationofpeople,however,woulddemolishtheiroldhouseandbuildanewoneonthesite,sothatafter severalthousandyears,someoftheresultingmoundsroseashighasftyfeet.Thesepeopleat6,000B.C.hadovens tobakebread,graphitedecoratedpotteryandby5,000B.C.hadearlysmeltingandcastingofcopper,perhapsentirely independentlyofsimilardevelopmentsintheNearEast.LepenskiVir,ontherightbankoftheDanubeinpresentday Yugoslavia,wasanancientcitysitedatingbefore5,000B.C.Itischaracteristicoftheworkofhuntersandshermen ofapureOldStoneAgetraditionbeforehousestookonapermanentform. GeneticstudiesofEuropeanpeopleshaveindicatedthatfarmingadvancedfromtheMiddleEastintoEurope,starting atabout7,000B.C.witharadialrateofadvanceofaboutonekilometerayear,andthisadvanceoccurredbydiffusion ofthefarmersthemselvesdemicdiffusionratherthanbythesimplespreadoftechnologyfromonepopulationto anotherculturaldiffusion.Thisisevidencedbythefanningoutofcertainallelesingenefrequencies,spreadingin EuropefromsoutheasttonorthwestandalsofromtheNearEasttoNorthAfrica,ArabiaandEastAfrica-andfrom SouthwestAsiatotheIndusValley. ArcheologicalevidenceisalsoplentifulontheEuropeancontinent,butnotsointheotherareas.Sardiniaandnorthern AlgeriaaremorenearlysimilartotheNearEastthantherestoftheCentralMediterranean,andSardiniahasverylow Rhnegativefrequencyandotherfrequenciesthataremostunusual.Thearcheologythereshowsrstthattheearliest occupationwasNeolithic-withnoPaleolithicantecedentandsecondlythattherewassubstantialcolonizationbyboth PhoeniciansandCarthaginians.Therstfarmers,however,probablycamefromsouthernItaly.TheislandMelos,in theAegean,hasadistinctivevarietyofobsidian,andthereisevidencethatGreekandCretansailorsexploiteditand broughtittotheirowncountriesasearlyas6,000B.C.Ref.222[296],215[290],136[187],211[284],170 [234],176[242],143[196]AdditionalNotesp.51 3.4.2CENTRALEUROPE ThemajorityofmiddleEuropeanspassedintotheMesolithicAgeinthisperiod.Therewerenolongerlargeanimals tohunt,perhapsonlydeer,andmanaugmentedhisdietwithnutsandberries.Thedogwaspresentinthehuman encampmentsandboatswereused.Farming,whichappearedintheDanubebasinabout6,000B.C.spreadtothe NorthEuropeanplainabout5,000B.C.Theyusedwoodensawsttedwithchippedintteeth.Neolithicpottery called"Bandkeramik",whichwascharacterizedbyincisedparallellinesabovetheneck,appearedinareasofsouth andnorthcentralEuropeandaccompaniedthegenegradientwhichwedescribedabove.Suchfarmermigrations involvedmorepeopleandhaveabetterpotentialforincreaseinpopulationthan"barbarian"invasionswhichhave onlylimitednumbersandnotenoughpeopletoeffectgenefrequenciesstriking1y.Thisfarmingandtheassociated potteryspreadrapidlyalongthemainrivervalleys,especiallytheDanubeandtheRhine,attheendofthisperiodabout 5,000B.C.Althoughmuchcontroversystillexists,thereismuchevidencetosuggestthattheIndo-Europeanspeaking peoplewereactuallyasinglegrouporpeopleatthistime,livingintheDanubeValley.Weshallexaminesomeother ideasaboutthislater.Ref.136[187],215[290],143[196]


51 Swisslakedwellerswithdomesticateddogsandplowoxencollectedorgrewaxforuseinmakingshlinesand netsandgeneralutilityropesbyabout6,000B.C.Theyalsomadeabreadfromcrushedgrainandhadtruepottery. Continueonpage50 3.4.3WESTERNEUROPE CentralFranceandmostofSpainhadMesolithiccultureswhilesouthernSpainhadcoastalagriculturalsettlements thatwereextensionsofAdriaticandsouthernFrancecultures.TheverysouthernpartofEnglandwasnotcoveredby thelastglacier,andrecentdiscoveriesanddatingtechniquessuggestaveryearlyinhabitationofthatarea.Dogswere domesticatedbytribesintheBritishIslesby7,300B.C.ChurchillRef.29[50]saysthatat7,000B.C.therewas stillnoEnglishchannelandBritainwasapromontoryofEurope.TherewaslandinwhatistodaytheNorthSea,also, andmenlivedthereat6,000B.C.whentherewascontinuoustundrafromJutlandacrosstoEng1and.Thesemenof thenorthwerereindeerhunters,comingupfromcentralEurope.Astheglaciersretreatedtheanimalsdependingon snowwaterhadtohavesalt.Wherehumanbeingsaccumulated,thereindeerswouldaccepthumanurineasasourceof saltandsosemi-domesticationbecamepossible,althoughtheseanimalsneverbecamesubjecttotruedomestication. Britainmayhavebecomeseparatefromthecontinentbyabout5,900B.C.InIrelandwattlehutsdatebackasfaras 7,000B.C.alongthecoastalroutesandinlandwaterways.MostoftheIrish,particularlyinthenorthandwesthave bloodtypeO,pointingtoastrongpre-CelticphysicalinheritancewhichisbelievedtohavecomeviatheAtlantic fromtheMediterraneanarea.Hunter-gathersofWesternEuropeandprobablytheBritishIsleshavecloseto100% Rhnegativegenes,withlaterpositivegenesarrivingfromtheeastandsoutheastofEurope.Ref.143[196],215 [290],117[164],29[50]Continueonpage51 3.4.4SCANDINAVIA Evenat8,000B.C.thelastglacierhadretreatedsufcientlytoleaveallofDenmarkandsouthernSwedenfreeofice andthereweremenlivingthere,eatingoysters,shandsealmeat.Denmarkandallislandsguardingtheapproaches totheBalticweresettledbyLappsandFinns.ThesepeoplewereprobablyofEuropeanoriginalthoughbothspokea relatedFinno-Ugrictongue,originatingintheUralsfartotheeast.Denmarkwasthenonecontinuousstretchofland, notmultipleislandsandpeninsulasastoday,andtherewasonelargewaterchannelacrossSwedenviathegreatlakes totheKattegat.TheBalticSeaandtheSoundmaynothaveexistedassuch.ANeolithicratherthanaMesolithic cultureexistedinthisportionoftheworld.Continueonpage53 3.4.5EASTERNEUROPE ThereweregoodsuppliesofintineasternPoland,andthemilesofrivers,lakesandtimberaffordedresourcesfor earlyman.ThegreatwatersystemincludingtheBlackandCaspianSeasalongwiththeUralMountainsactedas abarrierbetweentheAsiaticpeoplesandtheIndo-Europeans.SomewouldlocatetheoriginoftheIndo-European speakingpeoplesatthistimejustnorthoftheBlackSea,andcertainlythereweresparselyscatteredpeoplethroughout allofnorthernEuropeanRussiauptotheedgeoftheretreatingglacier.McEvedyRef.136[187]callsallofthese northernStoneAgepeople"Finns",butmostwouldprobablyprefertheterm"Arcticpeoples"or"Lapps".Certain scholarsincludetheforefathersofpresentdayLappsamongthePaleo-arcticgroups,whileothersmaintainthatthey areAlpineandcamefromcentralEuropeandwerepushednorth.Theydonotallbelongtoasinglephysicaltypeand donotbelongtoasinglebloodgroup.TheirFinno-UgriclanguageisclosetoFinnishbutthetwoarenotmutually intelligibleandtherearethreemutuallyunintelligibleLappishdialects.TodaypracticallyallLappsarebilingual.Ref. 229[307],61[90],88[131]Continueonpage53 NOTE :InItalynearFoppedeNadrotherearemanyrockartgures,includingascenedepictingapraying humanguresurroundedbydogs.Thiswassupposedlycreatedbythe"DogCult"peopleabout5000B.C. Ref.299[5]


52 CHAPTER3.8000TO5000B.C. 3.5CentralandNorthernAsia:8000to5000B.C. 6 3.5.1THEINDIANSUBCONTINENT BacktoCentralandNorthernAsia:Beginningto8000B.C.Section2.5 MiddleStoneAgesiteswiththeirdelicateake-shapedtoolsoccurredmainlyinIndiainthecentralandpeninsular areas,butalsointheSoanValleyandatSanghaoinnortheastIndia.MicrolithsandMesolithsoftheLateStoneAge aredistributedalmostthroughoutthesubcontinent,exceptinPakistan.Interestinglyenough,scatteredinremoteareas throughouttherearestilltodayabouttwentymillionaboriginalpeoplessuchastheGonds,Bondos,Kani,Todasand Magas,ofuncertainracialancestry.AfewseemtoberelatedtotheAustraloidsofAustralia.Pollenanalysissuggests forestclearanceandcerealcultureinRajasthanasearlyasthe8thmillenniumB.C.Ref.33[55],88[131],8 [14] ForwardtoCentralandNorthernAsia:5000to3000B.C.Section4.5 3.6TheIndianSubcontinent:8000to5000B.C. 7 3.6.1THEINDIANSUBCONTINENT MiddleStoneAgesiteswiththeirdelicateake-shapedtoolsoccurredmainlyinIndiainthecentralandpeninsular areas,butalsointheSoanValleyandatSanghaoinnortheastIndia.MicrolithsandMesolithsoftheLateStoneAge aredistributedalmostthroughoutthesubcontinent,exceptinPakistan.Interestinglyenough,scatteredinremoteareas throughouttherearestilltodayabouttwentymillionaboriginalpeoplessuchastheGonds,Bondos,Kani,Todasand Magas,ofuncertainracialancestry.AfewseemtoberelatedtotheAustraloidsofAustralia.Pollenanalysissuggests forestclearanceandcerealcultureinRajasthanasearlyasthe8thmillenniumB.C.Ref.33[55],88[131],8 [14]Continueonpage54 3.7TheFarEast:8000to5000B.C. 8 3.7.1THEFAREAST BacktoTheFarEast:Beginningto8000B.C.Section2.7 WhiletherewereprobablymanypeopleintheFarEastatthisperiod,mostremainedintheMesolithicstage.The Yang-shaopaintedpotteryculturepeopleofChinalivedinsmallvillagesofperhapsonehundredcottages,growing millet,keepingdogsandpigsandhuntingwithbowsandarrows.Theyburiedtheirdeadandpracticedfertilityrites. JapanhadtheJomonCulture,dateoforiginuncertain.TheBritishMuseumGuidelistsitfrom7,000B.C.onbut othersbelieveitexistedevenat8,000B.C.orbefore.Itwasadistincthunting,gatheringandshingsocietywith alow-redhandmadepotterysometimesimpressedwithpatternsmadebytwistedrope.Theword"Jomon"means "ropepatterns".Thereissomeevidencethatthepeopleofthissocietywerenottheancestorsofthepresentday Japanese,butratherthoseoftheAinu,nowpushedintothenorthernfringesoftheislandsbythelaterimmigrants. TheJomonCulturewasrelatedtothesoutheastChinatraditionsandtothoseoftheSovietMaritimeProvinceand Kamchataka,butisnotrelatedtotheYang-shaoRef.101[146],19[32],8[14],215[290],45[66],88 [131]AdditionalNotesp.53 InSoutheastAsiapeoplecultivatedriceasearlyas6,000B.C.withevidencefoundinSpiritCaveinnorthernSiam. MesolithiccultureshavebeenidentiedinVietnam,SiamandMalaya,withearlycavesitesexcavatedinSumatra, BorneoandCambodia.InThailand,by6,000B.C.,peopleusedawidevarietyoffoods,withmanyoftheplants 6 Thiscontentisavailableonlineat. 7 Thiscontentisavailableonlineat. 8 Thiscontentisavailableonlineat.


53 domesticated.Theseincludedalmonds,broadbeans,betelnuts,cucumbers,peas,waterchestnutsandgourds,aswell asrice.TherewaswidespreaddistributionofmankindinNewGuineaby8,000B.C.withaaketool-chopperstone industry.Althoughsomewerealreadythereby6,000B.C.morepeoplebeganarrivinginthePhilippinesbyseafrom Indonesia,Malaysia,IndochinaandtheArabworld.Ref.8[14],175[241] ForwardtoTheFarEast:5000to3000B.C.Section4.7 ChooseDifferentRegion 1.IntrotoEraSection3.1 2.AfricaSection3.2 3.AmericaSection3.9 4.CentralandNorthernAsiaSection3.5 5.EuropeSection3.4 6.TheIndianSubcontinentSection3.6 7.TheNearEastSection3.3 8.PacicSection3.8 NOTE :TheearliestclearevidenceforricecultivationhasbeenfoundnearHangchowandisdatedatabout 50008.C.Ref.297[232] 3.8ThePacic:8000to5000B.C. 9 3.8.1THEPACIFIC BacktoThePacic:Beginningto8000B.C.Section2.8 AustraliahadmanyofthesametoolsthatwerefoundinNewGuinea,suchastheedge-groundaxeandwaistedblades. MicronesiaandmostofPolynesiaappeartohavebeenuninhabitedthroughoutallthesemillenniaunderreview. ForwardtoThePacic:5000to3000B.C.Section4.8 ChooseDifferentRegion 1.IntrotoEraSection3.1 2.AfricaSection3.2 3.AmericaSection3.9 4.CentralandNorthernAsiaSection3.5 5.EuropeSection3.4 6.TheFarEastSection3.7 7.TheIndianSubcontinentSection3.6 8.TheNearEastSection3.3 3.9America:8000to5000B.C. 10 3.9.1NORTHAMERICA BacktoAmerica:Beginningto8000B.C.Section2.9 9 Thiscontentisavailableonlineat. 10 Thiscontentisavailableonlineat.


54 CHAPTER3.8000TO5000B.C. ThelandbridgefromSiberiatoAlaskabecameinundatedabout8,000B.C.and,asmentionedpreviously,thelater arrivingEskimosandAleutscamebyboatandrepresentedthelater,classicalMongolianrace,ascontrastedtothe earlieroriginalMongolianstockwhocameoverabout20,000B.C.PossiblystilllatercametheAthapascans,who slowlymovedinlandwheremanystilllivetodayincentral,northernCanada.SomeoftheseAthapascanseventually migrateddowntothesouthwestUnitedStateswheretheybecametheApachesandNavajos.AdditionalNotesp.55 IntheUnitedStatesareabiggamehuntingcontinuedthroughoutthisperiodbutwithagradualdecreaseinthenumber ofanimalsavailable.By8,000B.C.NorthAmericanIndianculturewasalreadydividedintothreegreatpatterns: EasternWoodlands ,whichwilllaterbecalled"Archaic" Desert ,possiblyrelatedto EasternWoodland WesternPaleo-Indian AlthoughtheEasternWoodlandsactuallyexistedfrom8,000B.C.toabout1,000B.C.,duringthis8,000to5,000B.C. periodunderdiscussionitwascalled"EarlyArchaic"andwascharacterizedbybiggamehuntingwithshingand shellandplantgathering.BurialmoundswerebeingbuiltineasternCanadaby5,000B.C.Ref.213[288]Inthe mid-westtherewasarelatedsub-culturecalled"Modoc",withevidenceofmanoandmetatestonemortarandpestle existingabout7,200B.C.AnothervariationexistedintheOzarks,OklahomaandMississippi.AdditionalNotesp. 55 TheWesternPaleo-IndianCulturewasoriginallyabiggamehuntingtraditioncongregatedintheGreatBasinlying betweentheCascadeMountainsofsouthernOregonandtheRockiesofIdahoandrunningsouththroughNevada, westernUtahandtheeasternpartofCalifornia.The"OldCordilleranTradition"isanamegiventothecultureof IndiansintheOregonandWashingtonareasdatingfrom7,800to5,700B.C.whousedcharacteristicakedstone pointsknownas"Cascadepoints".Around7,000B.C.someofthehuntersfromtheGreatBasinareamigratedsouth intothemountainsandtablelandsofthesouthwest-i.e.southernColoradoandUtah,alongwithArizona,NewMexico andtheMexicanstatesofSonoroandChihuahua.Thismigrationwasprobablyprecipitatedbyweatherchangeswhich weremakingsemi-ariddesertsofthepreviousgreatsavannahsoftheBasin,andtheconsequentdisappearanceofthe game.Onelargebranchoftheseancientimmigrantstothesouthwesthasbeengiventhenamerecentlyof"Cochise" fromacountyinArizona.Theso-calledSulfurSpringsPhaseofthiscultureranfrom7,000to5,000B.C.andwas asocietydependentonhuntingancienthorses,mammoths,antelopeandbisonwithakedprojectilepoints.TheLake MojaveareaofsouthernCaliforniahasyieldedkite-shapedpoints,choppers,drillsandscrapers,someofwhichhave beendatedbackto9,000B.C.At6,000B.C.theclimatechangedwithamarkedriseintemperatureassociatedwith drought.Thegreatherdsdiedoutincludingthemastodonsandcamels.Manyareasweredenudedandtherewasa shiftingofIndianpopulationandachangeintheirlivingpatterns.Ref.45[66],209[282],210[283] 3.9.2MEXICO,CENTRALAMERICA,ANDTHECARIBBEAN By7,000B.C.intheTehuacanValleyofMexicotherewerepeoplelivinginrocksheltersandusingstonecooking potswhichwereleftinthecenterofthehearth.Maizewasusedinthesamevalleybetween6,000and5,000B.C. andatsomepointtheturkeywasdomesticated.Beforethedevelopmentofpotterysomepeoplesmayhaveused animalstomachsasliquidcontainerstohangoverres.Inthesamevalleythereisevidenceoftheuseofsixfood resourcesthemagueyplant,cactusfruitspricklypear,treelegumeslikethemesquite,wildgrasses,deerandrabbits. Cultivatedplantsprobablymadeuponly5%ofthediet,asopposedto54%fromhuntingand41%fromcollecting wildplants.Thecommonbeanandmaizewereintroducedintothevalleyabout5,000B.C.Maizeapparentlywent underconsiderablegeneticchangewithcultivation,butsinceitlacksanimportantaminoacid,itwasfortunateforthe Indiansthatitwaseateninconnectionwithbeans,whichsuppliedthedecit.SeealsoAfricainthe16thcenturyC.E. Section30.2.TherewassquashintheMexicanhighlandsbefore5,000B.C.Ref.211[284],209[282] 3.9.3SOUTHAMERICA Asearlyas8,000B.C.theneedforartisticexpressionapparentlyexistedinthehighAndes.Wementionedinthelast chapterthatprehistoricpeoplehadpaintedclothing,butnowwecanaddnecklaces,bracelets,carvedpendantsand


55 geometricallymarkedbones,paintedgreen.Thesepeopleatepricklypearcactus,alderseeds,tomatoesandplants withrhizomesandtuberssuchasjiquimas,potatoes,ullucuandpossiblymaniocandsweetpotatoes.Thereisalso refuseofmanylandmammalssuchasbucksandroedeer,vixcahas,camelidsandrodents,aswellastheremainsof sh.Althoughthecavesweresixtymilesfromtheocean,marinemolluskshavebeenfound,suggestingthatthese menmigratedattimestotheseashore,probablylivinginthecondensedfogoasescalled lomas ,asthebeachland otherwiseiscompletelyarid.By7,000B.C.therewereallsortsofprojectilepointsinVenezuela,Chile,Boliviaand Peru.Long-headedhumanskeletonsalongwithbothextinctandmodernanimalshavebeenfoundinBrazildatedto thesametime. NativesofbothAmericasareofextremelyvariedtypes.InSouthAmericatherearepeoplewithCaucasianappearance butdarkbrownskin,alongwithMongoliantypeswithAfricanfaces,butofpaleorsallowcomplexion.Big,straight non-aquilinenosesareseenfrequentlynearCuzcointhehighAndes,wherenon-Mongoliancharacteristicsmixwith trueAsiaticones.ManyscholarssuchasJulianSteward,PaulRivet,MiguelCovarrubiasandHeineGildern,aswellas HeyerdahlandFell,whowillbementionedofteninthismanuscript,areallcomingtotheconclusionthattransoceanic voyagesfromsouthernAsia,Polynesia,evenAustraliaorAfrica,havehelpedpeopletheNewWorldsincetheBering Straitmigration.Theearlymenof8,000to4,000B.C.unearthedintheexcavationsofProfessorEngelRef.62[91] werealldolichocephals,prognathous,big-bonedandtall,whereasthe16thcenturypeoplefoundbytheSpaniardswere ofonlymediocreheight,mesoorbrachycephalicwithshortlimbsandslenderframes. By6,000B.C.someAndeanpopulationswerealreadyadvancedtothestageofcomparablegroupsintheNearEast, notyettruefarmersorherders,butlivingasedentarytypeoflife,occupyingwelldenedterritories.Onasouth Peruvianplainbetweenmountainspurs,inlandfromthecoastataboutthe16thparallel,therewerehundredsof inhabitantsusingwaterfromnowdrywadis.Seashorevillagesofthesamemillenniumhavealsobeenfoundand becauseofthecompletesurfacedessication,humanshavebeenuncoveredbysimplybrushingoffthesand.They stillhavetheirclothes,skinandeyesafter7,000to9,000years.Millingstoneshavebeenfoundineveryhutandin graves,particularlyintheSantaValleyofPeruandtheeasternAndes.Itispossiblethatllamasandalpacasbeganto bedomesticatedontheeasternslopesatabout6,000B.C. IntheColumbiaandVenezuelaareasbetween7,000and3,000B.C.Meso-Indianslived,eatingseafood,berries,seeds, rootsandtubers.Remnantnowcanbeidentiedbythelargemoundsofshells,ashesandfooddebris.Thesenorthern SouthAmericanswerealsonavigators,fortracesofthesamepeoplearefoundonalladjacentislands.Documentation regardinghumidChileandArgentinaislackinginthisearlyperiod,althoughgroupsofpre-agriculturalistscertainly occupiedthewesternslopeoftheChileanAndesattimesabout8,000B.C.althoughperhapsnotcontinuously.Itis possiblethatsomeftyvalleysincentralPeruandaridChilewereinhabitedbygroupsofupto2,000peoplebefore agricultureappearedonthecoast.Ref.209[282],45[66],62[91] NOTE :ExcavationsatAnangulaIslandintheAleutianchainshowevidenceofsettlementtherearound7,000 B.C.Mummiesonneighboringislandsarewrappedinfursandwovengrasses.Ref.310[204] NOTE :Paleo-Indianskeletons,amanandboywithheadsrestingonturtleshells,foundatRoundRock, Texas,havebeendatedatabout7000B.C.Ref.298[128] ForwardtoAmerica:5000to3000B.C.Section4.9 ChooseDifferentRegion 1.IntrotoEraSection3.1 2.AfricaSection3.2 3.CentralandNorthernAsiaSection3.5 4.EuropeSection3.4 5.TheFarEastSection3.7 6.TheIndianSubcontinentSection3.6 7.TheNearEastSection3.3 8.PacicSection3.8


56 CHAPTER3.8000TO5000B.C.


Chapter4 5000to3000B.C. 4.15000to3000B.C. 1 4.1.1CHAPTER3-FIFTH&FOURTHMILLENNIAB.C. Backwardto5000to8000B.C.Section3.1,000TO3,000B.C. MichaelCheilikRef.28[48]fromCityUniversityofNewYork,callsthisperiodtheChalcolithic Chalcos = copper, lithos =stone.Afterdraftanimalsweredomesticatedandwheeledvehicleswereinventedtransportationover longdistancesbecamepossible.Astageofintellectualdevelopmentknownasmythopoeicmyth-makingarrivedand persistedforcenturies.Theforcesoftheuniversebecameappreciatedandpersonal.Sometimeinthiseracamethe "DawnofCivilization"asinafewareastruecivilizationsappeared.Itisprobablynotunbelievablethen,thatalsoat thisperiodtheweatherandclimatewasthemostidealofthelast100,000years,withthepossibleexceptionofour owntimethepastone-halfcentury.Ref.28[48],224[299] Asweshallseeinthedevelopmentofthisperiodofhistory,EgyptandMesopotamiahavelongcompetedinthe historians'annalsforthehonorofbeingtheoldestsourceofcivilization.Veryrecentlycarbon-14datingandbristleconedendrologystudiesincorrelation,havesuggestedthatsomeoftheMediterraneanislandsparticularlyMalta mayhavehadanadvancedculturebeforesuchappearedinthefertileNileValley.Ref.164[223].Furthermore, recentDanisharchaeologicalexcavationsontheislandofBahrainintheArabianGulfhaverevealedacivilization antedatingthatofMesopotamia'Therecentrevisionofthecarbondatinghasnowevenplacedsomeofthestone towersandmegalithsoftheBritishIslesbacktocorrespondingearlydates.Whatdoesthismean?Itisdifcultto conceiveofextensivecivilizationsdevelopingonlyonislands.Moreprobableisthethoughtthattheseislandswere onlyrefugesorway-stationsforaseagoingpeoplewhohadbeendislodgedbysomecatastrophefromtheiroriginal homes,perhapsasyetundiscoveredandunidentied.Coastlineshavechanged,oldlandsarenowcoveredbyseas, andmanycitiesmayyetlieburiedundersanddunes,lavaandashesorwaterinmanypartsoftheworld.Alongthe Afro-Asiaticcoastsmuchhaschangedevensincethe5thcenturyB.C.whenHannosaileddowntheAtlanticAfrican coastwithsixtygalleysand30,000settlerswhoestablishedportswhichhavenowbecomeinlandelds.TheRomans discoveredanoldcityontheAtlanticcoastofAfrica,alreadyveryancientwhentheyfoundit,withimpressivesunoriented,megalithicstructures.Theycalledthis"MaqomSemes","CityoftheSun"or"Lixus,theEternalCity"and feltittobeolderthananycityinsidetheMediterranean.Theseimpressiveruinsarenownolongeronanislandor thecoast,butarehalf-buriedonaheadlandonaridgesurroundedonallsidesbyateldsoftheLucusRiverdelta, withtheoceanonlybarelyvisibleinthedistance.ThisisaboutthreemilesupstreamfromthemoderncityofLarache, Morocco,whichisitselfaboutseventymilesdowntheAfricancoastfromtheStraitofGibralter.EngleRef.62[91] hasreportedthattheoceanshorelineinwesternSouthAmericaabout6,000yearsagowasmuchtotheeastofwhere 1 Thiscontentisavailableonlineat. 57


58 CHAPTER4.5000TO3000B.C. itistoday.CouldnotthisalsobetrueofthewesterncoastofAfrica?Atanyrate,intheruins"AlargeRomanmosaic ofNeptunebearswitnesstoformerlinkswiththeocean,whiletheruinsofArabmosquesandRomantemplescover earlierBerberandPhoenicianstructures,rettedinturnfromgiganticblockshauledfromfarawaybytheunknown sun-worshipperswhorstchosethissite" 2 .Ontheotherhand,drylandhassunkintotheAtlantic,makingunderwater canyonsextendingoutintotheoceanoorfromAfricanrivermouths.Oceanoorshaveneverceasedtomove,and somegreatgeologicaldisasterdisturbedtheAtlanticandsplitthecountrysideofIceland,creatingagiantriftcanyon thatrunsacrossitandbeyondintheoceanoor 3 .Radio-carbondatingsofatreeembeddedinlavainthisriftindicated thatthecatastropheoccurredaround3,000B.C.Doesthishavesomebearingontheshiftingofpeoplesaroundthe Mediterraneanatthistimeandtherathersudden"new"locationsofcivilizationsontheislandsandthensubsequent locationsinEgyptandMesopotamia? SuddenchangesoccurredonMaltaandCreteandCyprusatabout3,000B.C.withasuddenendtotheNeolithicphase andthebeginningofamajornewera.IfageologicaloccurrenceaboutthattimeintheAtlanticwasgreatenoughto splitIceland,itseemspossiblethattidalwaveswouldhavecausedfarreachingdisasters,forcingpopulationgroupsto searchfornewlands,andsucheventscouldhavebeenrememberedinmanypeopleslegendsasthetimeofthegreat ood.AsAlexanderMarshackRef.130[180]haswritten,art,agriculture,science,mathematics,astronomy,the calendar,writing,cities-thesethingscouldnothavehappened"suddenly".Thequestionishowandoverhowmany thousandsofyearsdidthepreparationrequire?Ref.130[180],95[140],61[90],164[223] Forwardto3000to1500B.C.Section5.1 ChooseDifferentRegion 1.AfricaSection4.2 2.AmericaSection4.9 3.CentralandNorthernAsiaSection4.5 4.EuropeSection4.4 5.TheFarEastSection4.7 6.TheIndianSubcontinentSection4.6 7.TheNearEastSection4.3 8.PacicSection4.8 4.2Africa:5000to3000B.C. 4 4.2.1NORTHEASTAFRICA BacktoAfrica:8000to5000B.C.Section3.2 InthisperiodtherewereCushiticspeakingHamiticpeoplealongtheRedSeaandtheGulfofAdenonthecoastlineof thehornofAfrica.InEgypt,sometimebetween4,500and3,100B.C.theBadarianCultureexisted,withagriculture, irrigation,clearingofjunglesandswampsandpictographicwriting,whichmayhavebeenimportedfromSumeria. TheseBadariansmayhavecomefromsouthofEgyptviatheRedSeaandWadiHammarat,butitispossiblethat immigrantsfromJerichoalsoarrived,bringingfood-producingtechniques.TheoverallpopulationofthelowerNile wasprobablylessthan20,000at5,000B.C.Ref.83[123]Theclimatewascoldanddampandthepeoplewore kiltsorlongskirtsmadeoflinenorskinswiththefurinward.Theylivedinsometypeoftentsorperishablewall homes. Hippopotamiandcrocodileswereinevidence,andintheareaofelBadaritherearebodiesofdogs,sheepandoxen wrappedinmattingorlinen.Thissuggestspossiblereverencefortheseanimals.LowerEgypthaddomesticgrazing 2 AsquotedinHeyerdahlRef.95[140],page356 3 Thisnorth-southvalleysplitsthemid-AtlanticridgefromIcelandtoBouvetIslandinthesouthAtlanticandrepresentstheboundarybetween crustal,tectonicplates 4 Thiscontentisavailableonlineat.


59 animalsfromtheLevantbyabout4,500B.C.,buttheBadarianslivedprimarilyinmiddleEgyptandtheirpottery datestothesecondhalfofthe5thmillenniumbythermoluminescence.Thattheyhadoutsidecontactsisevidenced byivoryspoons,shellsfromtheRedSeaandturquoisebeadsfromtheSinai.Recentndsofavastnumberofreed ships,manywithmastsandsailshavebeenmadeinthelongdried-upwadibetweentheNileandtheRedSeawhich maywelldatebacktothisperiod.TheEgyptiansarebasicallyHamitic,butmaywellhaveaddedmixturesofNubian, EthiopianandLibyannatives,comingfromtheSaharaasitslowlydried,alongwithimmigrantSemiticorArmenoid tribes.Cattlewereusedasbeastsofburdenperhapsby4,000B.C.Thesailwasusedfromabout3,500B.C.on,and potterydatingto3,100bearspaintingsofsickle-shapedsailingvessels,apparentlybuiltwithreedsandcompletewith cabinsandcenterboards.Egyptwasrstunitedasthe"OldKingdom"underMenes 5 ,who,askingofUpperEgypt, subduedLowerEgyptandunitedthetwowithanewcapitalestablishedatwhatwaslatercalledMemphis.Although Egypthadnocopperortin,itdidhavegoldandtherewerefabulousgoldsmithsinMemphisactuallyaclanofdwarfs fromtheearlydaysoftheUnitedKingdom.Ref.175[241],94[141],95[140],45[66],213[288] 4.2.2NORTHCENTRALANDNORTHWESTAFRICA ANeolithicHamiticculturewaspresentinAlgeriaandMoroccowithagriculturalsettlementsandpotteryby5,000 B.C.TheSaharawasquitewetfrom7,000to2,000B.C.andthemanylakesreachedtheirmaximumextentabout3,500 B.C.whenLakeChadcoveredsome200,000squaremiles.Itisnowtheonlyremaininglakewith15,000squaremiles ofwater.TheriversoftheSahararaninlandsothatalluvialmaterialgraduallylleduptheinlandbasins,blockingand slowingthestreams.Intheercesunthatfollowedthechangingclimate,thewaterevaporatedandthemarshesdried out.SaltdepositsarestillworkedatsuchplacesasAmadror,TeghazaandTaoudenniwhicharesimplyoldinland basins.ThepeopleofthewetSaharawereNegroidandtheyraiseddomesticatedcattleandleftbeautifulworksofart onrockswithsomeguresashighastwenty-sixfeet.Elephants,antelope,wateranimalsandshwereabundant.The NegroidpeopleofthiserawerenottheBushmanoid,round-headedpeoplepicturedontherockdrawingsbefore6,000 B.C.Ref.8[14],176[242] 4.2.3SUBSAHARANAFRICA At4,000B.C.thereweretwolanguagesofthewesternSudanfamily-YorubaandIdoma-buttheywerealready verydifferentandhadapparentlybeendivergingforseveralthousandyears.Ref.83[123]IntropicalAfricathere wereprobablyscatteredbandsofpeopleswhosedescendantsarethepygmiesoftheZaireforestsandBushmenof theKalahariDesert.ThersttrueNegroesprobablylivedasshermenalongtheNileandtheNigerriversandthe savannahnorthandwestoftheforestabout4,000B.C.Ref.175[241],83[123] NOTE :ArcheologistM.A.HoffmanoftheUniversityofSouthCarolinaRef.316[142]writesofthe factorsallowingthedevelopmentofthe"rstnation",underNarmerMenes.AtHierakonopolis,inUpper Egypt,about3800B.C.,therewasslightseasonalrainfall,woodedgrasslands,fertileoodplainsandeasy accesstotheNile.Thereweretwosettlementsintheareawithmud-brickandwattle-and-daubhouses spreadovera100acreareaandhavingperhapsasmanyas10,000people.ThisiscalledtheAmratian periodalsoNaqadaIandexcavationshaveproducedmaceheads,assymbolsofcentralauthority.Ahuge potteryindustrywaspresent,makingRedWarepotterywhichwastradedupanddowntheNile.Some wasusedintheelaborateburialswhichwerepartoftheEgyptians'religiousbeliefs.Justafter3500B.C., however,withtheareabecomingmorearid,potterieswereabandonedandtheAmratianperiodcameto anend,aspeoplemovedintomorethicklysettledvillagesalongthewetterNileoodplain,initiatingthe GerzeanorNaqadaIIperiod,whichlasteduntil3100B.C.Aneliteclassinthenewvillagesbuilttemples, palaces,largertombsandpossiblyanirrigationsystem,renderingtheoodplainabletoproducebigger andmorereliableharvests.Butthewatermanagementandexcessgrainstorageproblemsdemandedmore centralcontrol.VariouskingsfoughtfordominanceandnallyitwasNarmer,whosucceededinpolitical unicationoftheentireEgyptianNilevalley ForwardtoAfrica:3000to1500B.C.Section5.2 5 MenesisnowconsideredtobeoneandthesamewiththelegendaryKingNarmerofHieraconopolis,soeulogizedbyProfessorToynbee.Ref. 221[295],68[106]AdditionalNotesp.59


60 CHAPTER4.5000TO3000B.C. 4.3TheNearEast:5000to3000B.C. 6 4.3.1ARABIANPENINSULA BacktoTheNearEast:8000to5000B.C.Section3.3 ThiswasthefountandbreedingplaceoftheSemiticpeoples,althoughatthisparticulartimeonlyBedouinsand nomadtribesmenexistedandtherewasnotruecivilization,atleastinthewesterntwo-thirdsofthepeninsula.Recent excavationsontheIslandofBahrainandadjacentSaudiArabiahavesuggestedthepresenceofavanishedempire whichtheSumeriansreferredtoas"Dilmun",centerofearthlyparadise.Excavatedobjectsindicatecommercial activityorientedbothtowardsIndiaandMesopotamia.Surfaceshardsandimplementshavebeendatedbacktoabout 4,000B.C.Ref.176[242]ApparentlyaftertheWetPhase,about4,000B.C.therewasaprogressivedessication oftheArabianpeninsulawhichmayhavecontributedtothenorthwardmigrationsofpeoplesintotheSyrianDesert whichbeganshortlythereafter.Ref.88[131]AdditionalNotesp.62 4.3.2MEDITERRANEANCOASTALAREASOFISRAELANDLEBANON ThepeopleofthecoastintheseearlymillenniamayhavebeenoftheoriginalMediterraneanracenowrepresentedin thispartoftheworldonlybytheGeorgianCaucasians.Timnal,insouthernIsrael,wasasourceoflargeamountsof surfaceoresofmalachite,sotherewasaChalcolithicPalestiniancivilizationcalledtheGhassulianCulture,usingthe rstdeliberatealloy,arsenicalcopper.Ref.8[14]Theoriginallocationsofcoastaltowns,andlatermajorcities, wasoccasionedtogreatextentbythelocationofspringsandthustherehasoftenresultedcontinuousoccupationof thesamespotsovermanycenturies,withtheconsequentriseofdebrismounds,ortellsRef.88[131].Additional Notesp.62 4.3.3IRAQANDSYRIA IraqistheareaoftheancientMesopotamia,awordderivedfrom mesos meaning"between"and potamos or"river". Thewheelandtheplowarethoughtbymosttohavebeeninventedorbroughtheresometimeabout3,500B.C.1.Cattle wereusedasbeastsofburdenaboutthesametime.ThereisevidenceofirrigationonasteppeeastofMesopotamia by5,000B.C.,andclassicallyhistorianshavedescribedthreemoreorlessseparatecivilizationswhichdevelopedin theriverbasinsofMesopotamiaperhapsasearlyas4,500B.C.Themostimportantofthesewillbediscussedrst: SUMER OntheEuphratesRiverAllhistoriansseemagreedthattheSumerianswerenon-Semitic,buttheiroriginis muchdisputed.SomehavesuggestedIberianorDravidianafnities.McEvedyRef.136[187]thinkstheymay havebeenpartoftheaboriginalCaucasianpeopleandtothisisaddedtheopinionofSirLeonardWoolleyRef.238 [318]thattheirlanguagewasthatoftheearlyCaucasians.Theyusedcopperfrom5,000B.C.onwardandtheirclay tabletsgiveusrecordsbackto3,300B.C.inthecityofUr,whichwasthenaseaport.ThegeographyofMesopotamia haschangedgreatlythroughthemillennia.InadditiontotheTigrisandEuphrates,theKarunRiverfromthePersian mountainsandWadialBatin,drainingtheheartofArabia,allenterthePersianGulf,thelattertwoatalmostright anglestotheformertwo.Manymillenniaago,thelasttworiversdischargedamassofsiltacrossthegulf,whichthen extendedevennorthofpresentdayBaghdad,andeventuallymadeabaragainstwhichsimilarsiltofthetwochief riverspiledup,formingdrylanddirectlyacrossthegulf.Theeffectwastoturntheupperendofthethenexistinggulf intoastagnantlakewhichwasstillfedbythewatersoftheTigrisandEuphrates,butwhichthenturnedfromsaltyto brackishandthentoactualfreshwater.Eventually,ofcourse,eventhelakebuiltupwithsilt,makingtheareathemost fertilelandonearth.AlthoughUr,thenontheseacoast,becamethegreatcapitalofSumer,thecityofEridu,south ofthis,seemsolderandinanearbyvillageofal'Ubaidtherehasbeenfoundancientpottery,insomewayssimilarto potteryalsofoundatSusa,inancientElamandwhichmighthaveacommonancestryfromsomeforeignplace.Could theoriginbeBahrain,theislanddownthegulfwhereDanishexcavationsnowshowacivilizationpossiblyolderthan Sumer?ThereisaSumerianlegendwhichtellshowaraceofmonsters,halfshandhalfhuman,camefromthe PersianGulf,ledbyOannes,andintroducedtheartsofwriting,agricultureandmetallurgy. 6 Thiscontentisavailableonlineat.


61 TheSumerianshadwheeledvehicles 7 ,wheel-madepottery,sailboatsandanimal-drawnplows.Thesailboatswereof particularinterestbecauserecentinformationindicatingamuchgreaterandextensivemaritimetradewithlarge,reed, wash-throughshipshasbeenmadeavailable.ThorHeyerdahl,constructingsuchashipfromthereedsoftheTigris Euphratesdeltaregionin1980hasdemonstratedthatsuchshipscouldsailtoIndiaandtoAfrica.Theconceptthat thecivilizationofBahrainmayhaveantedatedSumeriscompatiblewithanewtheorysuggestedbyHeyerdahlRef. 95[140]anddiscussedunderII,Cofthischapter.FromtherecordsofUrthereisevidenceofthepresenceofboats ofalmostonehundredtonsandaceramicboatmodelintheIraqMuseumwithacylindricalfootingforitsmastdates backtoatleast4,000B.C.Thepotters'wheelwasinventedinErechabout3,000B.C.,perhapsalongwiththebrick mold. ThesesameSumeriansdevelopedtheduodecimalsystemofmeasurementgivingrisetoourtwelveinchestothefoot, sixtyminutesinanhourandthreehundredsixtydegreesinacircle.Inadditiontotheisland"Dilmun",theymention "Magan"asadistantcoppermountainand"Meluhha"whichmaywellhavebeenthegreatIndusValleycivilization. At5,000B.C.theyhadprimitiveirrigationsystemsusedtowatereldsasfarasthreemilesoneithersideofariver. Theresultinglargerandrichercrops,alongwiththenecessityofwateradministrationsystems,probablyledtothe growthofsomeofthetowns.Eventually,however,thisleachingoutoftheearth'ssaltsledtosoilinfertility.Thefood ofSumerincludedbarley,wheat,millett,chickenpeas,lentils,beans,turnips,onions,garlic,leeks,cucumbers,lettuce, cressandmustard.Therewasplentyofshandsomebeefandvealifonecouldaffordit.Thebeefsource,however, wasfromanimalsaftertheirusefulworklifewasoverandthereforeitwastough.Muttonwascommonalongwith goatandpork,thelastonlyuntilabout1,800B.C.TheIndo-EuropeannomadsroamingthroughtheMid-Eastmay havestartedtheloathingofpork,sincetheycouldbeherdedonlywithdifcultyandhadlittlestaminaformovement. FortypercentoftheSumeriangrainyieldwasusedforaleproduction,butsincenohopswereavailabletherewasno truebeer. Atempleworkmanreceivedtheequivalentof2.2Americanpintsofaleadayandseniordignitariesvetimesthat amount,someofwhichtheymayhaveusedascurrency.ThecultivatedgrapecametoMesopotamiafromtheCaucasus about5,000B.C.andinlateryears,astheirrigationsouredthesoilandgrainbecamemoredifculttogrow,many peopletooktoeithergrapeordatewines.Ref.211[284],95[140],238[318],136[187],94[141],175 [241],213[288] AKKADIA-KISH ThissecondcenterofcivilizationconsistedofaSemiticpeoplelivingtothenorthandwestof Sumerwithaseparateculture.ThereisevidencethattheirThirdDynastywasineffectasearlyas3,638B.C.More willbeheardabouttheminthenextchapter. 4.3.4IRANPERSIA Athirdcenterofcivilizationwithcopperweaponsandtools,hieroglyphicwritinganddomesticatedanimalsappeared eastofSumer,withacapitalatSusa.OlderwritersthoughtthattheymighthavebeenaNegroid 8 people,some modernsfeelthattheywereprobablytheancestorsoftheMedes,whileMcEvedyRef.136[187]writesthatthey wererelativesoftheSumerians,inthattheywereapartoftheoriginalCaucasianraceofGeorgians.Wearespeaking oftheancientcountryofElam,apartofpresentIran.TherewasmuchcopperaroundthesouthernCaucasus,theshore oftheCaspianSeaanddowntothePersianGulf.RemainsofaChalcolithicculturehavebeenfoundatAnau,Tepe HissarandRarjydatingto3,000B.C.Paintedpotterycultureswithmixedfarmingandtradeactivityexistedincentral Iraninthe2ndhalfofthe5thMillennium.Copperlyingfreehadbeenfoundandhammeredintoutensilsbeginning about7,000B.C.andabout5,000B.C.copperwasobtainedbyringmalachitewhichreleasestheowingmetalat arelativelylowtemperature.Tinore,oftenfoundwithmalachite,soonyieldeditsmetalandthetin-copperbronze alloyresultedinsomeareasby3,800B.C.Thebestbronze,consistingof15%tin,isthreetimesashardascopper alone.Ref.21[34],45[66],136[187] 7 Asnotedinthepreviouschapter,TragerRef.222[296]saysthatthewheelwasinventedmuchearlier,justafter6,500B.C.inSumeria 8 Asforexample,H.G.Wells,Ref.229[307]


62 CHAPTER4.5000TO3000B.C. 4.3.5ASIAMINOR InthiseratherewerecoloniesoftheCycladiancivilizationalongthecoastandawelldevelopedChalcolithicculture ofbasicCaucasianpeoplesinland.A1978studyofskeletonsfromadigatKalinkayaincentralAnatolia,datingtothis period,indicatedthatthepeoplewererelativelyshort,themenaveragingvefeetfourinchesandthewomenjustve feet.20%ofthewomenhadhealedanklefracturesorfootbonechanges,probablyfromfallsintheirrockycountry homes.Thereissomeindicationofnutritionalstressinbowedtibiae,attenedlongbonesandattenedpelvicinlets. 33%ofthelimitednumberofskeletonsstudiedshowedvertebralosteoarthritiscomparedto50%inmodernUnited States,and12%showedextremityosteoarthritiscomparedto29%inmodernU.S.Ref.4[8].Agricultural societieswerewelldistributedandtherewastradeandmigrationwithothercountriesoftheNearEast.Ref.88 [131] ForwardtoTheNearEast:3000to1500B.C.Section5.3 ChooseDifferentRegion 1.IntrotoEraSection4.1 2.AfricaSection4.2 3.AmericaSection4.9 4.CentralandNorthernAsiaSection4.5 5.EuropeSection4.4 6.TheFarEastSection4.7 7.TheIndianSubcontinentSection4.6 8.PacicSection4.8 NOTE :Althoughthereisstillmuchconfusionandargumentabouttheoriginanddomesticationofthecamel, recentwriterssuggestthatdomesticationoccurredinsouthernArabiapossiblyasearlyasthe4thmillennium B.C.andtheirusewasextendedtoEgyptevenbeforetherstdynasty,thatis,before3100B.C.Ref.313 [249]Anotherrecentwriter,HamblinRef.315[125],however,althoughagreeingthatdomestication occurredamongthesouthernArabiantribes,wouldputthedatemuchlater,at2500B.C. NOTE :WhenancientIsraelwasunderPtolemaiccontrollateinthe4thmillenniumB.C.,Jemmehinthe northwesternNegevdesertwasoccupiedbyasmallgroupofChalcolithichuntingandfarmingpeople,but subsequentlyitwasapparentlyabandonedforsome1,300to1,400years.Ref.295[300] 4.4Europe:5000to3000B.C. 9 4.4.1EUROPE ItwaswarmerinEuropeafterabout5,000B.C.thanatanytimebeforeorsince.Ref.91[135]Theoriginofthe originalIndo-Europeanlanguagespeakersremainsanunsolvedmystery,withsomeclaimingthesepeoplestartedon theBalticshores,othersintheBalkanportionoftheDanubeandstillothersinthesteppesofsouthernRussiaandon northoftheCaspianSea.Thedateoforiginalsoremainsundecidedwithsomebelievingitdatesbacktobetween 6,000and5,000B.C.andothers,particularlysomelinguists,toamuchlaterdate.Weshallbeginourdiscussionof theseideasinthenextchapter. 9 Thiscontentisavailableonlineat.


63 Araceofdarkwhites,perhapsakintotheIberiansofSpainandtheGeorgiansoftheCaucasus,developedanisland civilizationasearlyas4,000B.C.centeredonCrete,butapparentlywithcoloniesonCyprus,Greece,AsiaMinor, SicilyandsouthernItalyasimportantpartsofthewhole.Theirlanguageisuncertainandtheirearlywritinghasnot yetbeendeciphered,buttheyhadearlytradeandcontactswithEgyptandmayverywellhaveevenprecededthe classicalknowncivilizationsofEgyptandMesopotamia.Reedboatsandreedboatillustrationsonpotteryhavebeen foundthroughouttheMediterraneanfromMesopotamia,Egypt,thecoastofSyria,Lebanon,Cyprus,Crete,Corfu, Malta,Italy,Sardinia,Libya,AlgeriaandoutthroughtheStraitsofGibralter.Asmentionedinapreviouschapter, recentcarbondatingcorrectionsindicatethepossiblepresenceofadvancecivilizationsonsomeoftheseislandsprior tothemoreclassicalonesonthecontinents.TheoldRomanbeliefthatLixus,ontheAtlanticcoastwastheoldestcity intheworld,supportsthepossiblehypothesisthatcivilizationmovedeastwardtowardEgyptandnotthereverse. Aninterestingside-lightistherecentnewspaperreportfromRussia,detailingthendingsofancient,buriedhuman buildingsandwallsofacityfarbelowtheoceansurfaceaboutone-halfwaybetweenPortugalandtheMadeiraislands. Againthequestionofthe"LostcontinentofAtlantis"ismentioned,butitisperhapsofsomemomentthatthearea describedandallegedlyphotographedunderwaterisalmostdirectlyouttoseafromLixus.Wedoknownowthat thespiraldecorationsofbuildingsonMaltadatebefore3,000B.C.andthatcopperwasminedonCyprusprobablyas earlyas4,000to3,000B.C.Ref.95,178,224,18 Justbeforethecloseoftheperiodunderreview,acivilizationcalledthe"Cycladic"existedallalongtheshoresofthe MediterraneanSeaandseemstohavebeenthehighestcultureofthetimes.Inlandataboutthesametimetheancient HelladicorMycenaeancivilizationbegantodeveloponthenorthernplainsofGreece.ProfessorIvanBenedikov, BulgarianarchaeologistRef.171,saysthatthereisevidenceofanancientThracian,Indo-Europeancultureinthe areaofBulgariaandthattheyproducedgoldornaments,gurinesandpottery.Thisisreinforcedbythebeliefsof ProfessorColinRenfrewRef.179[244]whofeelsthatthefantasticgoldornaments,someweighingthirteen pounds,foundatVerna,BulgariaontheBlackSea,representtheoldestgold-workingknown,antedatinganythingof thistypeintheNearEast.CoppertoolsweremadeinRomania,HungaryandBulgariaasearlyas4,500B.C.This datinghasbeenconrmedbytheBritishMuseum.Ref.164[223] NowsomeveryinterestingtheoreticalpropositionsmustbediscussedwithrelationtothepopulationofancientGreece. Weretheindigenouspeopleknowntoinhabitthepeninsulaafter6,000B.C.thesamewholaterbecameknownasthe Mycenaeans,orwerethelatterinvadingconquerorswhoovercametheoriginals?Iftheformeristrue,then,since theMycenaeansspokeanearlyGreeklanguage,theremusthavebeenIndo-Europeanspeakersintheareaby6,000 B.C.Butsomelinguistssaythiscannotbe.AnotheralternativeistheideachampionedbyProfessorMarijaGimbutas, thatKurgansfromthelowerVolgasteppesmigratedbylandandseaVikingsofthe4thmillenniumB.C. 10 toallthe BalkansandtheGreekpeninsulaabout2,300B.C.andbecametheAchaeans 11 .Ref.171,179[244],88[131], 215[290] TheDanubianINeolithicCulturewhichspreadfromtheNearEast,nowreachedwellupintoGermany,andthisis usuallydescribedasanIndo-Europeanculture.Village-basedagriculturewaspresentinHungaryby5,000B.C.In Switzerlandthelakedwellers,withhousesonstilts,builteitherinthelakesoronadjacentmarshygroundasearlyas 5,000B.C.TheextremenorthofcentralEurope,however,wasstillsubarctic,withonlyhuntingtribesfollowingthe herds.NewpeoplesintroducedmixedfarmingincentralEuropeabout4,400B.C.TheseNeolithicpeopleslivedin villagesconsistingofsixtothirteenwoodenlonghousesaveragingabout325feetlong,andtheyusedtheso-called Linearpottery.Theygrewwheatbyaslashandburnmethodandkeptcattle,sheepandpigs.Thisistheculturewhich spreadintonorthernFranceandBelgium. 10 Ref.215,page268 11 "Achaeans"isoftenusedinterchangeablywith"Mycenaeans"


64 CHAPTER4.5000TO3000B.C. Impressed-warepotterypeoplelivedallalongthecoastofthewesternMediterraneanby6,000B.C.Theislandof MallorcaintheBalearics,about125milesfromtheeasterncoastofSpain,wasdenitelyinhabitedbymaninthe5th millenniumB.C.,co-existingwithruminantartiodactylmammals.TherewereBowlCultureagriculturalsettlementsin France,northernSpainandEnglandinthe4thmillenniumandthesepeoplewereprobablydistinctfromtheWindmill Hillgroupswhichweshallidentifylater,andoftheoldIberianorWesternMediterraneanrace,whichmayhavespread byboatuptheAtlanticcoast.Smallboatsweredenitelyinuseforcoastaltransportby5,000B.C.InBelgiumaint mineofabout4,300B.C.hasbeendiscoveredwhichrequiredtheminerstogothroughaboutthirtyfeetofunstable gravelandsandtoreachtheint.Thetunnelswereshoredinsideandatthebottomtheminefannedoutintoaweb ofgalleries.ThefarmersofBelgiumandnorthernFranceofthiseracamefromGermanybetween4,000and3,000 B.C.andbuiltlargefarmhousesandusedLinearpotteryofthetraditionofcentralEurope.Incontrast,thepeopleof France,usingChasseypotteryafter3,500B.C.developedaseparateNeolithicfarminggroup. TheearliestintmineofBritainwasinSussexandhasbeendatedtoabout4,300B.C.TheareaoftheSalisburyplain insouthwesternEnglandwasinhabitedbytheWindmillHillpeoplebyabout4,000B.C.,comingfromthecontinent. Theywereafarmingpeoplewithcattle,goats,pigs,sheep,dogsandwheat,whoaddedshandshellshtotheir diet.TheybuiltatleastseventeenknownenclosuresandprobablyactuallymanymoreinthisareaofEnglandwith thelargestoftheseontopofWindmillHillaboutoneandone-halfmilesnorthwestofAvebury,andthustheorigin oftheirarcheologicalname.Thisparticularcausewayenclosurewasbuiltabout3,250B.C.andoriginallyconsisted ofthreeconcentriccircles,thelargestbeing1,200feetindiameter,coveringtwenty-oneacres.Some1,300pottery vesselshavebeenrecoveredfromthisspot,anditisthoughttohavebeenmoreorlesscontinuouslyusedforoverone thousandyears.This,andtheothersimilarconstructionswereprobablyusedforritualorceremonialcentersrather thanforhabitation.WhentheseWindmillHillpeoplearrivedinEngland,about4,000B.C.,itwastheendofthe MesolithicAgeinBritain,andtherewerecertainlyotherpeoplealreadytherelivingassemi-nomads,makingintand stonetoolsforcuttingandshapingtimber,red-deerantlersandskins.MostofsouthernEnglandwasheavilyforested, butWessex,withchalkandlimestone,hadlightervegetationandwasattractivetotheimmigratingstockbreedersand agriculturalists.SomefeelthatcattlemayhavebeenshippedtoEnglandfromthecontinentasearlyas5,000B.C. ThecircularenclosureswerenottheonlymysteriousconstructionsoftheSalisburyplainsinthoseearlytimes.The 4thmillenniumB.C.wastheperiodofthe"longbarrows"ofwhichtherearesome260inBritainwith148ofthem intheWiltshirecountryarea.ThebestknownoftheseistheWestKennetLongBarrow,locatedsomeone-halfmile southofAvebury.Constructedatabout3,600B.C.itisthreehundredfortyfeetlongandseventy-vefeetwideatits widesteasternendandeightfeethigh.Itwasoriginallysurroundedbyacurbofstones.Theeasternone-eighthof thebarrowisastonetombwithvecarefullymadechambersinwhichforty-veskeletonshavebeenfound.Atthe entrancearemanyuprightstones,linedupatrightanglestotheaxisofthemound.Nofunctionhasbeenyetidentied forthewesternseven-eighthsofthebarrow. TherstNeolithicAgesitesofIrelandarefoundinCountyTyrone,datingfromabout3,700B.C.onwards.The SandhillsWarePotterypeoplethereexploitedthesalmonfromtheBoyneRiverandby3,250livedinrectangular, timberhouses.Theforestswereclearedandcereals,oxen,sheep,goatsandpigswereraised,perhapsafterthe additionoftheimmigrantsrelatedtotheWindmillHillpeoplementionedabove. NextwemustdiscussthemysteriousandproblematicalmegalithswhichhavebeenfoundallovertheMediterranean islands,alongthecoastsoftheIberianpeninsula,France,BritainandsouthernScandinavia.Traditionallyithasbeen taughtthatthe2,500B.C.periodwastheoneofthismegalithicculture,butrecentcorrectionofcarbondatingby bristle-conepinecorrelationhasputtheAtlanticmegalithsbackanother800yearstobefore3,000B.C.Onetheoryis thatthisculturewasbasedonareligionspreadbypriestsandmerchantsperhapsfromMalta?,butasweshallsee whenwediscusssomeoftheseremainingmonumentsinthenextchapter,theirfunction,atleastinsome,appearsto havebeenfargreaterthananysimpleritual.Ithasbeenestimatedthatthereareatleast50,000ofthesemegalithsin WesternEuropeandcountlessnumbersofothersmusthavebeendestroyedthroughtheages.Recentlytherehasbeen speculationthattheoriginalmegalithbuildersmayhavespreadfromBritainsouthward,ratherthanthereverse.


65 TheseimmigrantsalsosettledinIrelandandwesternmainlandcoastalareas,butavoidedtheMidlands.Inthisperiod ofglobaloptimalclimate,therewereprehistoricfarmsinScotlandandNorthernEnglandinlatitudeelevationswhere todaynoagricultureisfeasible.Atabout3,000B.C.thisEdenterminatedwithasharpreturnofcolderweatherRef. 227[303],176[242],136[187],215[290],176[242],45[66],224[299],88[131],7[12] At5,900B.C.therewerestupendousgeologicalchangesstilloccurringinthenorth.Menhadlivedintheareanow coveredbytheNorthSeabutastheglaciersmeltedandreceded,theearth'scrust,previouslydentedbytheweight oftheice,begantoriseanditisstillrisingthroughoutmostofSwedentoday.Southofthis,thewaterspouredinto theNorthSeaandovermuchofDenmark,sothatthemainpartofthislandremainedattachedtoEuropeonlybya thinstalkatHolsteinandtheDanishtribesbecameisolatedandremainedvirtuallysoforsomecenturies.TheDanes knewhowtosailandcanoeandhadinttoolsandweapons.AllsouthernScandinaviaandtheBalticsettlementsof thiserahadtheFunnelRimpottery.Rockscribingsofpetroglyphshewnintooroccasionallypaintedonrockfaces representinganimalshavebeenfoundallovertheScandinavianpeninsula,aswellasinFinlandandRussia,dating backtoatleast5,000B.C.Mostofthesearelife-sizeandareoutlinedrawingsinnaturalisticstyle,althoughanother typewithstylizedanimalshasbeenfoundatVengenandAusevik,NorwayandNamforseninSweden.Justafter4,000 B.C.somesayearliercontactwithEuropeproperincreasedwiththeresultthatnewpeoplegrowingbarleyandwheat andraisingherdsofcattle,sheepandpigsmigratedintotheScandinavianarea.WerethesethesameastheWindmill HillpeopleinEngland?.LikeotherareasinWesternEurope,thiswasalsotheeraofmegalithictombs,ofwhich somethousandsstillstandinsouthernScandinavia.Duetotheverywarmclimatewhichdevelopedafter5,000B.C., vinesgrewinsouthernNorwayandthewholeofScandinaviahadmixedanddeciduousforests.Ref.8[14],88 [131] ThereisarcheologicalevidenceofhumanhabitationonthesouthernplainsofRussiadatingfarbackintoprehistoric times,andnomadicpeoplesroamedthecountrythroughoutthecenturiesofthischapter.Ofparticularinterestarethe Kurgans,knowntoliveonthelowerVolgaevenin5,000B.C.SeealsoSOUTHERNEUROPE,thischapter.They hadhorses,lovedtoghtandburiedtheirdeadundertumuli.TheymaylaterhavemigratedtoGreecetobecomethe Mycenaeans.MarijaGimbutasofU.C.L.A.thinksthesepeoplearetheoriginalIndo-Europeansandthatabout4,000 B.C.theyexpandedintotheDanubebasinanddownintotheBalkanpeninsulafromthere.Mostarcheologistswould denythattheyaretheoriginalIndo-Europeansbutdoagreethatatsometime,probably3,500to3,000B.C.,these peopledidover-runmuchofEurope,usingwheeledcartsandbronzeweapons. WildgrapeswerebroughtundercultivationintheCaucasusinthe4thmillenniumB.C.TheFinnsorLapps?were endemicinnorthernRussiaandoccupiedallnorthernclimesoutsidetheareaofNeolithicCulture.TheLinearPottery CulturespreadfromHungaryaroundthenorthernedgeoftheCarpathiansintoRussiainthemid-5thmillenniumand agriculturespreadthroughtheVolga-DonregionfromtheDanubebyabout4,500B.C.Central,eastEuropewasinthe latecopperageafter3,500B.C.,astheCarpathianssuppliedplentyofcopperandlatergoldandtin.Ref.45[66], 8[14],215[290],211[284],88[131],222[296] ForwardtoEurope:3000to1500B.C.Section5.4 4.5CentralandNorthernAsia:5000to3000B.C. 12 4.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:8000to5000B.C.Section3.5 12 Thiscontentisavailableonlineat.


66 CHAPTER4.5000TO3000B.C. AnearlyphaseoftheYang-ShaoCulturewhichhasbeenmentionedinconnectionwithChinahasalsobeenunearthed atPan-p'o-ts'unincentralAsia.Ithadaslashandburnagriculture,domesticatedanimalsandhand-madepottery. IncontrasttoourremarksabouttheinventionofthewheelinSumer,someauthoritiesbelievethatitwasinventedin westernAsiapriorto3,500B.C.,butthecircumstancesareunknown.Itispossiblethattheinventorswererelativesof theKurgansofsouthRussiawhodidbringwheeledchariotsintoEurope.Ref.175[241] ForwardtoCentralandNorthernAsia:3000to1500B.C.Section5.5 4.6TheIndianSubcontinent:5000to3000B.C. 13 4.6.1THEINDIANSUBCONTINENT PeoplesoftheIndusValleyraisedwheat,barley,peas,sesameseeds,mangoes,datesandcitrusfruitsonirrigated eldsby4,000B.C.Theyusedasses,horses,buffalo,camelsandcattlebothformeatanddraftanimalsRef.222 [296]Wovencottonfabricwasinthesamevalleyby3,000B.C.MajorsiteshavebeenunearthedinwesternIndia andPakistanoftheethnicgroupcalled"Brachycephals",whowerewidelyscatteredthroughoutSind,Baluchistanand Rajasthan,withelaboratesettlements,usingcopperandbronzeby39000B.C.Neolithicsitesofcattleraisingpeople livinginvillagesofwattleanddaubormudhutshavebeenexcavatedintheGangesValleyandthesouthernpeninsula, datingtothe4thmillenniumB.C.Ref.45[66]Continueonpage89 4.7TheFarEast:5000to3000B.C. 14 4.7.1THEFAREAST BacktoTheFarEast:8000to5000B.C.Section3.7 TherewasaNeolithicYang-ShaocultureinbothcentralandwesternChinawithdomesticatedanimalsandcultivated millet,whichreachedapeakabout3,000B.C.TheChinesearenotahomogeneouspeople,andrepresentamedley ofhumanvarieties,differentinorigin,language,character,customsandgovernment.TheearliestChinesecitywas LiangCh'engoftheLung-ShanCulture,datingtoabout3,500B.C.Theinhabitantshadgreattechnicalskillanda highleveloforganizationandritual.PriortothattheancestorsofthepresentChinesecivilizationweredevelopingan agriculturalcommunityaround49000B.C.intheloesscoveredhighlandsofnorthandnorthwesternChina,wherethe welldrainedsoiloftheriverterraceswasidealfortheearlycrops.TheLung-ShanCultureappearedonthelowland northChinaplainandeventuallyspreadoverallofChinaproperexceptthesouthwest,butithadmanyregional variations.Overallitwascharacterizedbywheelmade,unpainted,blackpotterywithaburnished,lustroussurface. Thepeoplelivedinwalledcommunitiesontheriverplains,almostfromManchuriatoVietnam.Theyhadriceas wellasmillet,domesticatedcattleandsheep.TheirreligionemphasizedancestorworshipRef.8[14],101[146] AdditionalNotesp.67 Neolithicsocietiesonly. Neolithicsocietiesonly. 13 Thiscontentisavailableonlineat. 14 Thiscontentisavailableonlineat.


67 ThereisevidenceofabronzeindustryinThailandby3,600B.C.andprobablythetincamefromMalaysia,which remainstodaytheworld'sgreatestproducerofthatmetal.WildricewascultivatedatNonNokTha,Thailand,by3,500 B.C.SomeexcavationsneartheLoatianborderatBenChiengshowbronzeweaponsandwheels,carvedivoryand pottery,allbeautifullymade.SometimeinthisperiodMalayanpeoplejoinedtherstinhabitantsofthePhilippines andMadagascar.HypotheticallysomeofthemcouldevenhavegonetoBrazilaroundthesouthendofAfricaRef. 155[214],215[290],211[284],176[242],175[241]AdditionalNotesp.67 ForwardtoTheFarEast:3000to1500B.C.Section5.7 ChooseDifferentRegion 1.IntrotoEraSection4.1 2.AfricaSection4.2 3.AmericaSection4.9 4.CentralandNorthernAsiaSection4.5 5.EuropeSection4.4 6.TheIndianSubcontinentSection4.6 7.TheNearEastSection4.3 8.PacicSection4.8 NOTE :HumanbonesofthisperiodhavebeenfoundatSongzeexcavationsnearShanghai.Ritualceramics weremadewiththepotters'wheelandtheartisanswerebeginningtotempertheirwaresduringring.Ref. 314[255] NOTE :JoyceWhiteRef.296[312]describesacurrentexhibitatBanChiang,whichhasobjectsrecently excavatedfromtheStoneAgeof5000B.C.totheBronzeAge,beginningatleastby3600B.C.These excavationsindicatesettlementsoonafter4000B.C.,withraiseddomesticstockandprobablyrudimentary ricecultivation.Unusualwastheuseofmetals,notinanurbancontext,butinvillages,insuchthingsas spearpoints,axesandpersonalornaments.Theyhadbeautifulpotteryfrom3600B.C.on,andtheculture, overall,lastedabout4,000years.JohnPfeifferRef.297[232]conrmsthesendingsandaddsthat350 bronzebracelets,anklets,rings,axeandspearheadsweredistributedamongabout2,000otherobjects.The bronzeseemstohaveappearedfullblownwithoutantecedentpurecopperuse.Whetherthiswasbroughtin fromtheoutsideordevelopedlocallyisnotknown. 4.8ThePacic:5000to3000B.C. 15 4.8.1THEPACIFIC BacktoThePacic:8000to5000B.C.Section3.8 About4,000B.C.seasrosetotheirpresentlevelandthedingowasintroducedtoAustraliaperhapsbyboat.The Australiansmalltooltradition,inarchaeologicalterms,appearedonthatcontinent.MankindwasintheSoloman IslandsinMelanesiabyabout3,000B.C.Ref.8[14]AdditionalNotesp.67 NOTE :TheargumentsgoonabouttheoriginandrouteofsettlementofthePolynesianislands.Sinoto Ref.300[267]hasrecentlyexcavatedanancientsailingcanoeonHuahineintheSocietyIslandsgroup, andreportsthatthisdatesto3000B.C.Hisconclusionthatthisindicatesthatancientmarinerssailedfrom Asiatotheseislandsisdifculttoverifyfromhispaper.Hesaysthatlinguistsareabletotracelanguage 15 Thiscontentisavailableonlineat.


68 CHAPTER4.5000TO3000B.C. rootsofearlyPolynesiansailorsbacktoatonguespokeninSoutheastAsia5,000yearsagoandthatthis isstronglysupportedbyarchaeologicalevidenceofwesttoeastmovement.Theactual"evidence"isnot detailed.ThereislittledoubtbutwhatthePolynesianancestorscamefromSoutheastAsia,buttheirroute totheeasternPacicandthetimescheduleisstilldebatable.Thereismoreaboutthisargumentinthemain outlineinthe4thcenturyC.E.andafter. ForwardtoThePacic:3000to1500B.C.Section5.8 ChooseDifferentRegion 1.IntrotoEraSection4.1 2.AfricaSection4.2 3.AmericaSection4.9 4.CentralandNorthernAsiaSection4.5 5.EuropeSection4.4 6.TheFarEastSection4.7 7.TheIndianSubcontinentSection4.6 8.TheNearEastSection4.3 4.9America:5000to3000B.C. 16 4.9.1NORTHAMERICA BacktoAmerica:8000to5000B.C.Section3.9 Inthefarnorththerewasamicro-bladetraditioncalled"LittleArm"withevidenceofcaribouandelkhuntingdated from5,500to4,000B.C.InCanadaby4,000B.C.theMaritimeProvincesweresettledbyhunters,shers,and gatherers.TheColumbiaplateaufolks,previouslymentioned,werehuntingelkanddeerintheforestsofDouglasr andwesternyellowpine,andshingforsalmonintheColumbiaby9,000B.C.Ref.209[282],45[66] Between5,000and3,800B.C.thetemperatureloweredagainandprecipitationincreasedsothatsomegamereturned astheclimateapproachedwhatitistoday.Evensothehuntingculturesgraduallygavewaytoatypeinwhichthe peoplewerenotspecializedinasingleskillbutwereversatileenoughtoattemptotherthings. IntheEasternWoodlandstherewasnowa"MiddlePeriod"withgreatvariationfromareatoarea.Someusedantlers andbonesforsh-hooks,spearsandharpoons,somelearnedtousecopperfortoolsandornaments.Inthelatter respect,adistinctivecultureoftheGreatLakesandupperMississippiValley,beginningabout4,500B.C.,wasthe "OldCopperCulture"inwhichthemetalwasworkedeitherinthecoldorhotstate,butitwasnevermeltedorcast. Knives,barbedharpoonpointsandatlatlweightsthrowingsticksweremadeinthisway.Therewasnobiggame presentandmostoftheinhabitantsoftheeasternsocietiesusedsteatitevessels.TheearliestoftheArchaicCulturesis sometimescalledthesouthern"IndianKnollSociety",withalaternorthernLauretainCultureabouttheGreatLakes andoneastwardwherealongtheLabradorcoastiteventuallycamefacetofacewithEskimos.Ref.64[94],45 [66],209[282] ThewesternDesertCulturewasorientedtowardplants,collectingofsmallseedsandrootsforfood.Plantberswere usedforbaskets,footwearandnetsforsnares. 16 Thiscontentisavailableonlineat.


69 Inthesouthwest,theChircahuaPhaseoftheCochiseCulturemadeitsappearanceabout5,000B.C.andwastolast about3,000years.ItwastherethatmaizerstappearedintheUnitedStates,sometimebetween3,000and2,000 B.C.,apparentlybroughtupfromMexicowhereithadbeencultivatedlongbefore.TheCochisecouldgrowthecorn becausetheyhadthesoil,therightgrowingseasonandthenecessaryskillsandtools.Theycouldalreadyweave basketsinwhichtostoreitandhadlongusedgrindingtoolstopulverizeseedsandnuts.Thisearlydesertsocietylater gavewaytothePuebloandMexicanempires.InCaliforniatheSanDiegoCountyArcheologicalSocietyrecently broughtsuitagainstalanddevelopmentrm,allegingthatitintentionallymarredasitethoughttohavebeenoccupied byLaJollaIndians3,000to7,000yearsago 17 .ExcavationsonCatalinaIslandjustofftheCaliforniacoast,showthat mangorgedhimselfonabaloneinthe4thmillenniumB.C.,almostwipingoutthecoloniesRef.106[152],211 [284],45[66],210[283] 4.9.2MEXICO,CENTRALAMERICAANDTHECARIBBEAN SantaLuisa,intheVeracruzareawasoccupiedbefore4,000B.C.andbecamemajortradecenterwithanextensive irrigationsystem.Thepeopleweresuccessfulhuntersandgatherersaswellasearlyfarmers.By3,500Mexicancave inhabitantsreliedheavilyonagriculture.Onethirdoftheirfoodcamefromdomesticatedplants,includingmaize, beansandothers.MaizewasdestinedtoplaythesameroleherethatwheatandbarleydidintheNearEast.Inthe TamaulipasMountainstheyhadbeguntodomesticatesummersquashandchilipepper,andthebottlegourdasawater container.Earlymanalsoategrasshoppers,antsandtermites. Wespeculatedatthebeginningofthischapterthatthetimeofabout3,100B.C.mighthavebeenamilestoneinhistory whensomefantasticupheavaloccurredintheAtlantic,withfar-reachingsecondaryeffectsinthedevelopmentof earlycivilizationsinEgyptandtheNearEast.Itisamazingthen,tondthezerodateintheincrediblyaccurateMaya Calendar,whichwillbedescribedlater,tobe"4AhauCumhu",whichconvertstoourcalendarasAugust12,3,113 B.C.!Nosatisfactoryexplanationofthatdatehaseverbeengiven,butMayawrittenandoraltextsandthoseoftheir descendantcivilizationsclaimdescentfromacivilizedpeoplewhosailedinfromtheeast!Ref.236[314],211 [284],95[140] 4.9.3SOUTHAMERICA Datingtoprobablyabout5,000B.C.,inthoselastcenturiesbeforerealagriculture,isthepartiallyexcavatedvillageon alomaatPalomaonthedryPeruviancoast.Thevillageextendsover1,900feetinlengthatanaltitudeof660to825 feet.EngleRef.62[91]excavatedonly2trenches,removing35,000cubicfeetofruble,usingonlytrowelsand brushes.Some90gravesand45hutswerethusexposedandfromthatheestimated,byextrapolation,thatcomplete uncoveringoftheentirevillageareaswouldinvolve7,000,000cubicfeetofdebristoberemovedtoreveal9,000 gravesinandaroundsome4,000to5,000houses.Obviouslythiswasnotdone. Radio-carbondatingsindicatethatcottonandbeanswerepresentintheupperinter-Andeanvalleysabout6,000B.C. butinthecoastalvillagestheywerenotpresentuntil5,000B.C.orshortlythereafter.AtChilca,about45milessouth ofLima,portionsofanothervillagehavebeenexcavated,showingmultiplearcheologicallayers,indicatingmultiple re-occupations.Carbon14datingindicatestheearliesthabitationat3,500B.C.Largemolluskswerepresentbutare nolongertobefound,sotheshorelinemaythenhavebeenmuchfarthereastandtheretreatoftheocean-lineand consequentlythemollusks,mayhaveledtotheabandonmentofthesite.Onlyafewsiteshavebeenuncovered,since acubicyardofkitchenmiddenweighsabout2,600poundsandsosiftingavillageof71/2acresthatformsamound 1yardthickmeansthe"siftingsome36,000tonsofdebris,theequivalentofatrain1,000carslong" 18 17 ComplaintshavebeenmadethatotherconstructionprojectshavedestroyedhundredsofprehistoricIndiansitesinCalifornia.Estimatesgive morethan600Yokutsvillages,campsitesandburialgroundsinMercedandStanislauscounties.LoggingoperationsintheSierraNevadarange havechurnedupinnumerablesimilarsites.AlongthesouthcoasttherewereChumash,Gabrielinos,Fernandenosandsomeothers,dependingupon ashingandfoodgatheringexistence.Thesepeoplewereapparentlyfreeofintertribalwarsanddidnothavethecyclicalfaminessufferedby groupsdependentuponfarmcrops.Theylivedinlargevillages,usedplankcanoesandtradedwithvillagesontheChannelIslands,oftenbartering thecoastalbasketryforefgiescarvedfromthesteatiterockofCatalinaRef.106[152]. 18 FromEngelRef.62[91],page98.


70 CHAPTER4.5000TO3000B.C. MaizewasbroughtdownfromMexico,butpotatoesandmaniocweredevelopedfromlocalplants.Theearliestdated potteryintheNewWorldisfromColombia,from3,090B.C.,sand-temperedwithwide-linedincising.Cottonhas beenusedforatleast4,000to6,000yearsintheAndes,replacingotherplantsthatcouldbeusedforspinningand makingcloth. WehavewrittensomethingofPatagoniaandTierradelFuegointhelastchapter.Theislandsofthewesternarchipelago offthetipofSouthAmericawerestillblockedbyiceuntilabout5,000B.C.andtheAlacalufarrivedafterthattime. Theywerealittlepeoplewiththemenrangingfrom61to62.5inchesandthewomen56.9to57.7inches,withatruly Asiaticappearance,includingthickblackhair,Mongoloidspotsandverylittlebodyhair.Theylivedentirelyfromthe ocean,divingoffboatsmadeofboardssewedtogether.LaterthesepeopleweresoldasslavesbytheChonostothe north.Ref.45[66],62[91] ForwardtoAmerica:3000to1500B.C.Section5.9 ChooseDifferentRegion 1.IntrotoEraSection4.1 2.AfricaSection4.2 3.CentralandNorthernAsiaSection4.5 4.EuropeSection4.4 5.TheFarEastSection4.7 6.TheIndianSubcontinentSection4.6 7.TheNearEastSection4.3 8.PacicSection4.8


Chapter5 3000to1500B.C. 5.13000to1500B.C. 1 5.1.1CHAPTER4THIRD&FIRSTHALFSECONDMILLENNIUMB.C. Backwardto5000to3000B.C.Section4.1,000TO1,500B.C. At3,000B.C.thesealevelwasperhaps10'belowthepresentlevelandafter7,000yearsoffarmingtherewere perhaps100,000,000peopleintheworld.Inthisperiodweshallseethedevelopmentofmanynewcivilizationsand thegeneralmigrationofsocietiesthroughouttheworld.Writtenrecordsareavailablefrommanyplacesandthere arethebeginningsofscienceandimprovementsinmetallurgy.BronzewasusedintheOrientasearlyas4,000B.C. andcontinuedtodominateuntil1,800B.C.whentheIronAgebeganthere.InEuropetheBronzeAgedatedroughly from2,000to1,000B.C.About2,700B.C.thecircleofcopperworkingincludedalloftheBalkansandGreece,Asia Minor,theCaucasus,Mesopotamia,IranianPlateauandalloftheArabianPeninsula,alongwithEgypt.Thelimit ofNeolithictechniquewentfromJaxartes,westoftheAralSea,acrosssouthernRussiatotheBalticandacrossthe southernhalfofScandinavia.Some500yearslaterthelineofcopperworkingextendedfromIranupintothesteppes northoftheJaxartesRiverandacrosssouthernEuropethroughalltheDanubianIIIculturalareadowntheAdriatic andacrosstoAfrica,includingpartoftheCushiteareaonthehorn.By1,800B.C.copperwasusedinallofthe BritishIslesandallEuropesouthofmid-ScandinaviaandwellnorthinRussia.Alloftheaboveareawasthenwhat mightbecalledChalcolithic,whileinArabia,Egypt,someofAsiaMinor,ThraceandGreecetheNewBronzeAge wasappearing.By1,600B.C.,thisBronzeworkinghadspreadalloverEuropeexceptthenorthernhalfofBritain, Scandinavia,westernIberiaandNorthAfrica.Insofaraswhatmightbecalled"truecivilization",however,themap onthenextpagegivestheclassicalconceptofthetime-framesinvolvedRef.211[284],224[299],136[187], 222[296]. Forwardto1500to1000B.C.Section6.1 ChooseDifferentRegion 1.AfricaSection5.2 2.AmericaSection5.9 3.CentralandNorthernAsiaSection5.5 4.EuropeSection5.4 5.TheFarEastSection5.7 6.TheIndianSubcontinentSection5.6 7.TheNearEastSection5.3 1 Thiscontentisavailableonlineat. 71


72 CHAPTER5.3000TO1500B.C. 8.PacicSection5.8 5.2Africa:3000to1500B.C. 2 5.2.1NORTHEASTAFRICA BacktoAfrica:5000to3000B.C.Section4.2 OutonthehornofAfrica,meninSomaliawereproducingfrankincenseandmyrrhforsaletoEgyptasearlyas 3,000B.C.TheCushitic-speakingpeoplecontinuedexpansionsouthofEgyptandintoNubia.Duetothechangein theSaharaclimate,moreNegroandSudanicpeoplesettledjustwestoftheCushitesalsoKushites,increasingthe populationthereRef.8[14]AdditionalNotesp.74 AmapofEgyptofthisperiodmaybefoundintheearlypagesofthenextchapter.Theexactdatingofthevarious dynastiesanderasofancientEgyptcontinuetobedebated. NOTE:InsertMaptakenfromReference97page61 ThedatesusedinthismanuscriptarethosegivenbyProfessorEastoninTheHeritageofthePastRef.57[82]and thesearefairlywellcoordinatedwiththoseusedinTheColumbiaHistoryoftheWorldRef.68[106]andother recentpublications.TherststoneconstructedsepulchreofpyramidaldesignwasbuiltatSaqqara,nearMemphis, duringthereignofZoseralsoDjoser,anearlykingofthe3rddynasty,between2,700and2,630B.C.Thiswas calledthe"StepPyramid"andwasactuallythecreationofImhotep,chiefministeroftheking,amanwhowaslater deied.Recentdesertstudieswouldsuggestthatthissteppyramidandthelargeronestofollowwereactuallyshaped afternature'sowndesert,wind-sweptdunesofthewesterndesert.Sand-stoneandsolidrockmountainsanddunesall seemtohavenaturallyassumedaconicalshape,asthewindsspiralaboutthemtoexhausttheirenergyatthepointed top.Itisverypossiblethattheman-madestructuresweremodeledafterthesenaturalones,anditissaidthatarocky knollofunknownsizeunderliestheGreatPyramidandthatthereisanaturalstoneout-croppingatthetombofQueen Khent-Kawes.Itisthussuggestedthattheancientsnotonlysimplyenlargedandrenedalreadyexistingnatural conicalstructures,butthattheverynatureoftheseshapeshaveallowedthemtowithstandthewindsandsandstorms ofalltheagessincetheywerebuilt 3 .Stillmoreintriguingisthendinginthedesertofformsverymuchlikethe sphinx,indicatingthatwhereconstantlydirectedwindshitcertaingeologicalformationsanunusualshapesomewhat likethatofarecliningdogwithraisedhead,isformed. Canthesphinxsimplybeadressed-upnaturalformationofthistype?Similarshapeshavebeenfoundinthedesert asfarbackas1909Ref.59[87],243[88]andtherearesuggestionsofthesamephenomenoninpartsofUtah today.CopperminesweredevelopedintheSinaibyPharaohSnefu,asuccessorofZoser.Healsousedlargeshipsto increaseseatradeRef.222[296]. BronzewasinuseinEgyptby3,000B.C.andthegreatpyramidswerestartedabout2,600B.C.inthetimeofCheops ofthe4thdynasty 4 .BecauseofthefertilityoftheNileoodbasinsinthis3rdmillennium,theaveragepeasant producedthreetimesasmuchfoodashisfamilyneededandthushewascapableoffeedingtheoodcontrolworkers andthebuildersofpublicbuildingsandPharaoh'stombs.Therstwoodenboatsweremadeinexactimitationofthe oldreedboats.AnentiresuchvesselofCheops',datingto2,700B.C.,hasrecentlybeenexcavatedfromhispyramid. Ithasalengthof143feetandappearsmoregracefulthanalaterVikingship,butcouldonlyhavebeenusedfor ceremoniesonthesmoothNile,asithadnointernalribsandcouldnothavesurvivedoceansailing.Onlythepapyrus shipsfromwhichitwascopiedcouldwithstandtheoceanwaves. 2 Thiscontentisavailableonlineat. 3 TheconicalshapesofprimitivesheltersfromtheAmericanIndiantepeestoAfricanandArabianDeserttentsandMongolianandKazakyurts incentralAsiamayallresistthewindsinthesamewayRef.59[87] 4 ThomasRef.213[288],page32datestheGreatPyramidat2,900B.C.andcommentsonitsexactlysquaredbase,the50degreeslopeof allsurfacesandthefactthatthestonesaresowellttedtogetherthatabladecannotbeinsertedbetweenthem


73 AllsubsequentrulersoftheOldKingdombuiltgreatpyramidssuchasthatofCheopsandtheseediceshadgreat religioussignicance.Thereisnodoubtthatgreatnumbersofslaveswereusedintheirconstruction,andtheywere obtainedchieyfromNubiaandsomeofthesewereevenexportedontoIraq.ToynbeeRef.220[294]feelsthat the4thdynasty,600to2,500B.C.representstheheightofEgyptianSocietycultureandgrowth.Thepopulation atthattimewasprobablyaboutthreemillion,ormoreRef.83.Disintegrationofthesocietyor"timeoftroubles", accordingtoToynbee,beganinthe6thdynasty,300to2,200B.C.andforfourcenturiestherewasnocentral controlbutonlysmallfeudalstatesruledbyprovincialgovernors,the"nomarcha",wholeviedtaxesandkeptsmall armies.Kingsdidexist,butinnameonly.About2,000B.C.AmenemhetI,aThebiannomarch,marcheddownthe Nileandestablishedthe12thdynastyasacentralrulinggovernment,beginningthe"MiddleKingdom"ofEgyptian history.Toynbeeconsidersthisthe"UniversalState"ofthedegeneratingEgyptianSociety,inwhichthesinsofthe pyramidbuilderswerevisitedontheirsuccessors,butProfessorCheilikRef.28[48]describesthisasaperiodof increasingtradeandcontactswithothercountries,inspiteofsomepoliticaldeterioration.WhenamummyofWah,an ofcialofthisThebesDynasty,wasunwrappedattheMetropolitanMuseumofArtinNewYorktheyestimatedthat about365squaremetersoflinenhadbeenused.Thiscraftofmummicationhadbeendevelopedoveralongperiod andallthetechniqueisstillnotknown.Certainlytherststepwasremovaloftheinternalorgansofthedeceased, sometimesbyanabdominalincision,sometimesbyacorrosiveagentintroducedinanenema.Thesecondstepwas dessicationwiththeuseofnatron,eitherdryorinsolution.Finallythebodywasanointedwithbalmsandointments andtheextensivebandagingbegan.Allofthiswassimplytopreservethebodyasaneternalrepositoryforthesoul. Ref.246[23] TheportofByblosonthePhoeniciancoastwasalargeemporiumforEgyptianproductsandEgyptianwareswere wantedinCreteandMesopotamia.WiththeconquestofNubiaalargesupplyofgoldwasobtainedandahighpointof prosperitywasreachedunderSenusertalsoSesostrisIII,878-1,840B.C..Egypthadapopulationatthattimeof seventoeightmillionRef.176[242],95[140],57[82],68[106],8[14],220[294],28[48],213[288]. TheMiddleKingdomendedwithabouttwohundredyearsofturmoilanddisputesforthethrone,until1,680B.C. whenthenomadSemiticscalled"Hyksos"probablyCanaanitesinvadedfromtheArabianarea.Theseinvaders broughtthedomesticatedhorsewithchariotwarfareandmenusingcompositebowsandwerethusinvincibleatthat time.TheymadetheircapitalintheNiledeltaatAvarisandtheiroverlordscalledthemselves"pharaohs".Previous totheadventoftheHyksos'horsestheEgyptianshadusedonlythedonkeyasabeastofburdenbuttheinvaders didnotpenetratethecountryfarfromtheNiledelta,andtheEgyptiansconsideredthemselvesadistinctandseparate peopleanddidnoteasilyacceptstrangersornewideassotheyrefusedtoadopteitherthehorse-drawnchariotorthe compositebow.ThepopulationasawholewasthusnotgreatlyinuencedRef.246[23] About1,567B.C.anotherThebianking,Kamose,startedawarofliberationfromupperEgyptandrecoveredmostof theterritoryfromtheinvaderSemites.Thejobwascompletedbyhisbrother,AmosisI,afewyearslater.TheHyksos movementprobablypresentedthenalupheavalintheAmoriteseriesofexpansionsthatwillbediscussedunderthe sectionontheNEAREAST,below.ItwasprobablyatthetimeofthisSemiticdominationthattheBiblicalJoseph movedintoEgyptRef.231[308],122[170],8[14],136[187] Thebow-drillwasusedinEgyptfrom2,500B.C.onandrulesofmeasurement,theplumb-line,constructionofaright angleandtheshapingofstoneswithamason'ssquarewereallfeaturesofthissociety.Ahmescalculatedtheareaofa circleabout1,600B.C.andPtah-Hotepwasagreatphilosopherofthe3rdmillenniumB.C.TheMiddleKingdomwas alsoaperiodofnecraftsmanship.Abeercalled haq wascommonlydrunkandwasmadefromredbarleyoftheNile valley.Breadwassupposedlyalsorstmadehereinthedynasticperiodbecauseofthedevelopmentofanewkindof wheatwhichcouldbethreshedwithouttheapplicationofheat.Theass,ofAfricanorigin,wasrstusedforregular tradebetweenEgyptandIraqsometimeafter2,000B.C. OurknowledgeofEgyptianmedicineexceptforcommentariesfromGreekandRomanwriterscomesfromseven medicalpapyrusesdiscoveredinthelastcentury.Theoldestofthese,thefragmentaryKahunPapyrus,dealswith veterinarymedicineandwomen'sdiseases.Thenext,datingtoaboutthe17thcenturyB.C.,isconcernedwithsurgical mattersbeginningatthetopoftheheadandworkingdowntothemid-chest.Thelongestofthepapers,theGeorge EbersPapyrus,datestoaboutthe16thcenturyB.C.andisanextensivetherapeutictextwrittenamillenniumbefore


74 CHAPTER5.3000TO1500B.C. Hippocratesandcontainingprescriptionsdatingbackto3,700B.C.Itwasprobablyacopyofolderdocuments.This papyrus,twelveincheswide,unwindstoalengthofsixty-sixfeet.Egyptiansratherroutinelyremovedallinternal organsafterdeath,savingtheminspecialcontainersasthebodyproperwasmummied,buttheyknewverylittle aboutthefunctionsoftheseorgans.Althoughtheypaidmuchattentiontocleanliness,havingalmostanational fetishofkeepingthegastro-intestinaltractcleanwithmultiplepurges,emeticsandenemasofeveryconceivablekind, diseasewasstillrampant.Mummiesshowevidenceoftuberculosisofthespinewithaccompanyingspinaldeformities andcoldabscesses,clubfoot,polioandmeasles,nottomentiontheundoubtedparasiticinfestationstheymusthave obtained,andstilldo,fromtheNile.Eyediseases,particularlytrachoma,leadingtoblindness,wereandarestill commoninEgypt.ItrespondssometocopperpreparationsanditisinterestingthatEgyptianwomenworegreen eyemake-up,probablymadefromcoppersalts.Ingeneral,treatmentwasamixtureofreligio-magicalgesturesand theuseofanextensivepharmacopoeiaandsomelimitedsurgicalproceduressuchascauterization,circumcisionand occasionaltrepanningoftheskull,ifindeed,thiswasactuallyamedicalprocedure.Dentistrywasadvancedwith prosthesisconstructionasearlyas2,600B.C.Egyptianphysicianshadgoodreputationsthroughouttheancientworld andathome.Therewasapparentlyadenitemedicalhierarchy,beginningatthetopwiththePharaoh'sphysician. SpecialtrainingschoolsforphysicianswereattachedtotemplesRef.211[284],125[173],15[26],213[288]. AdditionalNotesp.74 5.2.2NORTHCENTRALANDNORTHWESTAFRICA TheHamiticBerbershadawellestablishedNeolithicCultureinalargeareaalongthecoastofNorthAfrica,butthey hadnocopper.TheywereprobablydescendantsoftheancientMediterraneanpeoplesandrelatedtotheIberiansand Basques.Thereweretwomajorsubgroups: Thenomadic Tauregs ofthedesertwhomaintainedstricthereditaryclasses,withanancientalphabetandusing artistictrappingsontheircamelsandjewelryonthemselves,and The Kabyles ,particularlyofAlgeria,livingasasettledtribe,longfamousforpotterymadewithouttheuseof thewheel.Ref.46[76],19[32] DessicationoftheSaharasetinabout3,000to2,500B.C.,causingsomepastoraliststomoveintothejunglesofthe NileValleyandotherstomovesouthwiththerains.ThisshifttoaridconditionsintheSaharamayhavestimulatedthe emergenceofcivilizationinEgypt.By2,000B.C.,asreectedintheSahararockdrawings,rhinoceroses,hippopotamusesandgiraffeshadalreadyvanishedfromthisarea.Southwardexpansionofcereal-growingoccurredduringthe 2ndmillenniumB.C.asmilletandsorghumweredomesticatedastropicalcropsRef.215[290],176[242],8 [14] 5.2.3SUBSAHARANAFRICA Thesouthernshiftofthecereal-growingbelt,duetothechangeintheSaharaclimate,resultedinanincreaseofthe Negropopulations.Ref.8[14] NOTE :Kerma,1,500kilometersnorthofmodernKhartoum,wasthecapitalofKush.EgyptoftheMiddle KingdomhadtodealwiththeseNubiansanddidsowithfortsatSenna,some270kilometersnorthof Kerma.Thecityitselfwasanextensiveurbandevelopment,particularlyafter2000B.C.Thelargetombsof "royalty"containedanimalsacricesandsomeofthemevenhadupto400humansacricedretainers.The NubianculturespreadovercentralandnorthernSudan.ThisparticularcultureofKermaalmostcompletely disappearedaftercolonizationoftheareabythepharaohsoftheXVIIIDynastyofEgypt.Ref.303[25] After1,520theNewKingdomofEgyptusedNubiangoldtohirecharioteersasaprofessionalforce.Ref. 279[191] ForwardtoAfrica:1500to1000B.C.Section6.2


75 5.3TheNearEast:3000to1500B.C. 5 5.3.1THENEAREAST BacktoTheNearEast:5000to3000B.C.Section4.3 Inadditiontosomenewcivilizationsappearinginthisregionthereweregreatchangesintheoldone.Wemustrealize thatinthissinglechapterwearereviewingeventsspanning1,500yearsoraperiodequaltothatfromthetimeof ChristtotheReformationinEurope.Inafewlimitedways,therewasactualregressionintheNearEastatthistime asthelocaltindepositsbecameexhaustedandtheareaslippedbackoutoftheBronzeAge. NomadicSemitictribescontinueddominationofthecentralareasofthepeninsula,whileotherSemiticempirescontrolledthefertilenorthwesternregionofArabiaandpresentdayJordan.About2,250B.C.theAkkadianswere extendingtheirinuencedownintothisareaandsome400yearslateranArabiantribeofAmoritesbegantheirrst expansionandbegantooverowthisentireareaoftheFertileCrescent,rollingoverintoMesopotamiaandbeyond. TheancientbasicpopulationofthisareawereCanaanites,originallySemiticnomadswhohadearlymigratednorth fromArabia,butintheperiodunderreview,twootherpeoplesappearedtheJewsandthePhoenicians.Ref.175 [241]AdditionalNotesp.79 SemiticspeakingpeoplelivedaBronzeAgeurbanlifeinPalestinefrom3,000to2,200B.C.butthenfortwoorthree hundredyearsthecitylifeappearstohavebeendestroyedbyaninvadingnomadicpeople,probablytheAmoritesfrom deepintheArabianpeninsula.After1,900B.C.populationreturnedtotheurbanareasandthatperiodmaythenbe describedasthetrueCanaaniteera.TheAfricancamelwasusedinPalestineforcaravantradeby1,600B.C.Theexact timeofthearrivaloftheJewsisdebated.TheirowntraditionsaysthattheycamefromUrinabout2,200B.C.,but theyprobablycameupoutoftheArabianPeninsulasomewhatlater.Theytoo,ofcourse,wereaSemiticgroupwho rarelyintermarriedwithotherstocks,yetsomefeelthattheyreceivedtheircharacteristicnosefromthenon-Semitic Hittites.Ref.229[307]DuringtheseearlycenturiestheJewsremainedastwelvemoreorlessindependenttribes, withastateofcivilizationdevelopingabout1,800B.C.MostofthemthenenteredEgyptbetween1,800and1,650 B.C.perhapswiththeir"cousins",theHyksos.ItissaidthatJudaismwasfoundedbyAbraham,aprinceofUr,living inCanaanin1,700B.C.,ashereplacedhumansacricewithsacriceoframs.Ref.18[31],213[288],222 [296] TheoriginofthePhoenicianswhofoundedthecityofTyreandsettledalongastripofcoastonehundredmileslong andtenmileswide,about2,800B.C.isnotdenitelyknown,buttheymayhavebeensimplyanotherSemitictribe fromtheregionofthePersianGulf.From2,600B.C.on,theywerethebusiestmerchantsoftheancientworld, manufacturingformsofglass,workingmetalandproducingafamouspurpledyefromMediterraneanmollusca.The forestofLebanonsuppliedtheentiremiddleeastwithtimberandtheincrediblydurableLebanoncedarallowedthe earlyPhoenicians,aswellastheHittites,toabandontheearlierpapyrusreedsforboatsofwood.Thesepeoplewere shrewdtraders,stealingfromtheweak,cheatingthestupidanddealinghonestlywiththerestofmankind.Theysailed theseasinseventyfeetlong,narrowgalleyswithoarsandonelargerectangularsail,developingtheartofnavigation astheysailedfromtheirhomecitiesofTyre,ByblosandSidontodevelopagreatcolonialempire.Theywereknownin theBibleasSiddonians.UgaritwasaCanaaniteandPhoeniciancitywhichhasbeendubbedthe"Shanghaiofthemid2ndmilleniumB.C.",becauseitseemedacross-roadofworldtrade.TextsinSumerian-Akkadian,Hurrian,Egyptian 5 Thiscontentisavailableonlineat.


76 CHAPTER5.3000TO1500B.C. andHittitehavebeenfoundthere.TheoldestknownalphabetwasapparentlynativeCanaanite,laterimprovedbythe Phoenicians.SometextsshowcloseassociationofHebrewstoCanaanitesbeforethetimeofMoses,andmuchofthe moralteachingandidealsofjusticeoflaterHebrewpro-phetswereforeshadowedhereandthereareparallelstothe laterBiblicalpsalms,etc.Ref.95[140],87[132] ThetimberresourcesofLebanonwerealreadyconsiderablydepletedby2,000B.C.buttheyhavecontinuedtobe exploitedrightdowntothepresenttime.Oliveoil,grain,grapes,sheepandcattlewereproductsinantiquity.Slaves hadalwaysbeenusedsome,butafter2,000B.C.largenumberswereimportedfromEgypt,sothatitwassoonnot uncommonforhouseholdstohavethree.Ref.88[131],213[288],PROPER Theterm"Sumerian"hasbeencoinedbyscholarsfromtheplacenameof"Sumer"whichbythethirdmillenniumwas usedtomeansouthernMesopotamiaasapposedtoAkkad,thenorthernpart.Sumeriawasacitycivilizationandthe importantcitiesofUr,Uruk,Larsa,EriduandKishhadpopulationsrangingfrom15,000to250,000.Oneormore templecommunitiesconstitutedacity,withpriestadministrationandwork-gangstooperatetheirrigationsystem.The landofthecitywasdividedintoseveralcategories,withsomeeldsownedbythegodsandworkedontheirbehalf, someeldsrentedoutannuallytoindividualsandothersawardedtoindividuals,rent-free. TherstdynastyofUrhasbeendatedarchaeologicallyandhistoricallyfromtheKing-listsroyalgenealogicaltablets foundonthesitetoabout2,700B.C.,buttherewasahighcivilizationatUrbeforethis,perhapswiththecity functioningunderthesuzeraintyoftheErechDynasty.Atleastwhatappearstohavebeenaroyalcemeteryhasbeen excavated,datedpriortotherstdynastyofUr,inwhichtheritualofburialincludedhumansacrice,varyingfrom sixtoseventyoreightypeople,sometimesincludingassesandcartswithgroomsandvariouswomen'sbodies.There wasnoevidenceofviolence;themenandwomensacricialattendantsprobablysimplydrankadrugandwentquietly tosleep.NothinglikehumansacricewasevermentionedfromthelaterSumeria.Atanyrate,theactual,historical rstdynastyofUrwasthatofMes-an-ni-pad-daofabout2,700B.C.anditlastedsupposedlyfor177years.During thelaterpartofthistime,atabout2,600B.C.ithadsucceededinconqueringvarioussurroundingareas,underKing Urukagina.ThiswasfollowedbytheusurpationofneighboringUmmabyKingLugalzaggesi.Situatedontheat landsofthelowerEuphrates,Sumerhadnonaturaldefensesandthecitiesbecametemptingobjectsofplundertothe barbarouspeoplearound.About2,300B.C.SumeriawasconqueredbytheneighboringAkkadiansundertheirgreat leader,SargonI.TheSumeriancultureseemedtocontinueinthenew,combinedempire,however,anda"Golden AgeofUr"resulted.Sargonwroteofshipsladenwithgoodsinharborathiscapitalandtherewerecaravansof200 donkeystraveling12to15hoursadayplyingbetweenArmeniaandIraq.From2,112to2,015B.C.Urremainedthe capitalofthisgreatempire,ruledbythevekingsofthethirddynasty.Iraqhadapopulationofbetweenfourandve millionatthattime. OneofthecharacteristicfeaturesofeachgreatSumeriancitywasthezigguratandthatofUrhasbeenthebest preserved.IthasbeensuggestedthatiftheSumerianscameoriginallyfromtheCaucasus,onemightassumethat theyfeltthattheirgodshadtohaveamountaintostandorliveon,andsotheybuilttheziggurats,assubstitutes.Ur wasdestroyedsometimeafter2,000B.C.andthenforawhileitwasunderIsinlordship,thenunderthecityofLarsa andnallyundertheElamiteswhocamefromsouthPersia.TheElamiteprince,Warad-Sin,whobecamekingofUr, rebuiltandenlargedthetemplesoftheancientcityandhissuccessor,Rim-sinservedaskingofLarsaalso,andduring hisreignthepopulationofthe"oldtown"ofUr,thatis,withintheoriginalwalls,includedanestimated4,250houses, probablywith34,000people.Thewholecity,then,musthaveexceeded250,000andmayhavebeentwicethatlarge.It wasamanufacturingcenterwithrawmaterialsimported,sometimesfromoverseasviathePersianGulf.Gold,copper ore,hardwoods,ivory,pearlsandpreciousstoneswereallbroughtbyshipandrecordedinbillsoflading.Ref.238 [318],28[48],213[288] ButUrwasnottolastmuchlonger.Althoughthereisstillsomedisagreementaboutdating,weshallassumethat HammurabistartedhisruleinBabylonin1,783B.C.andtheninthe12thyearofthereignofhisson,Samsi-iluna,the


77 BabyloniansdestroyedthewallsofUrwithaterriblethoroughnessandlaidwastetothecity.Upuntilthattime,all thetabletsandtextsofUrandtherewerethousandsofthemwerewrittenintheSumerianlanguageCaucasian?, butafterthatdestructionthetabletswereintheBabylonianlanguage.Theinvaderstookoverthecuneiformwriting, buttheSumerianlanguageitselfbecameadeadliteraryandreligioustongue.ThisfallofSumeriamayhavebeen preparedinpartbyinternaldisintegrationandclasswarswithinthecity-stateRef.238[318],28[48] TheconqueringBabylonianswereactuallyAmoritesandthenewcombinationofAmorite-Akkadian-andnon-Semitic SumeriancivilizationbecameknownastheBabylonian 6 ,withtheSemiticstrainthedominantone.Hammurabihad forgedoutthisempireandputhiscapitalatBabylon.Pleasenotethemapbelow. NOTE:InsertMaptakenfromReference97. Agriculturethrivedasgreatnewirrigationcanalsweredeveloped.TheBabylonians,ofthesamebasicstockas AbrahamandthelaterHebrews,orJews,hadthebeginningsofastronomyandtheabilitytopredicteclipses.They hadacalendarandcouldhandlecubicequationswithtwounknowns.TheBabyloniansocietydemonstratedthe developmentofanimperialpoliticaltheory,animprovedadministrativetechnique,especiallythroughtheuseof writtencommunication,thedevelopmentofabureaucracyandprofessionalarmy,andnallybettermethodsofintercityandinter-regionaltrade,alongwiththepromotionofanindependentmerchantclass.Acodeoflaws,basedon Sumerianprototypes,hasbecomefamousastheCodeofHammurabi,putintoeffectabout1,750B.C.Thiscode coveredmostordinarylifeactivities,evencondemningalehousesforunder-strength,over-pricedbeer.Fortypercent ofthegraininsomecitieswenttothemanufactureofbeer.Thecodealsoregulatedmanymedicalfeesforsuchthings astreatingseverewounds,tumors,andbrokenbones.Thefeeswerehigh-forexample,thatforsuccessfullytreating afreeman'sbrokenbonewasveshekelsofsilver,avalueequaltotheyearlyrentforamiddle-classdwelling.But thepunishmentsforpoormedicaltreatmentwereequallyelevated.Ref.68[106],220[294],211[284],125 [173] Sometimeabout1,600B.C.orperhapsslightlyearlier,BabyloniawasconqueredbyacombinedforceofAryan McEvedy,[Ref.136[187]],saysCaucasianKassites1fromtheeastandHittitesfromnearAsiaMinor.TheHittites quicklywithdrew,takingtheSumerianscriptwiththem,leavingtheKassitestoruleBabyloniaforaboutsixcenturies. SomebelievethattheybroughtthehorsewiththemfromtheSamartianatlands.Ontheotherhand,LewinsohnRef. 122[170]saysthatridinghorseswererstmentionedinhistoricalrecordsatthetimeofHammurabi,about2,000 B.C.,althoughchariotshadbeenusedearlierbySumeriankings.Asmentionedearlier,Mesopotamiawasthehomeof thespectacular,brick-builttemplemonumentscalled"ziggurats",manyhavingbeenbuiltbetween3,000and500B.C. Amongtherstofthesewasonecalledthe"WhiteTemple",probablydedicatedtoAmu,godofthesky,atancient UrukErechoftheBible,capitalofseveralSumeriandynasties.Itwasbuiltabout3,000B.C.onaplatformfortyfeet high.EventheKassitesbuiltziggurats-theremainsofaspectacularonestillsometwohundredfeethigh,remainsat Aquarquf,theKassitecapitaljustwestofBaghdad.Ref.136[187],122[170],176[242] AdditionalNotesp.79 RecentexcavationsinnorthwesternSyriabetweenwhatwassubsequentlyUgaritandCarchemish,indicatethatagreat empirewithacapitalcityofEblaexistedpriortoandafterthe23rdcenturyB.C.Fifteenthousandcuneiformtablets withcommercialrecords,treatiesandchronicleshavebeenfound,writteninapreviouslyunknownSemiticlanguage. Thisisfourtimesthenumberofallpreviouslyfoundtextsofthisperiod.Itisevidentthatmetallurgy,textiles,ceramics andwoodworkingwerewelldeveloped.ThirtythousandpeopleintheCityweresurroundedbyabout250millionin theimmediatearea. Morethanvethousandgeographicnamesappear,indicatingfargreatersettlementoftheNearEastatthatancienttime thanpreviouslybelieved.BeirutandByblos,DamascusandGaza,aswellasSodomandGomorrahareallmentioned. 6 AswiththeHurriansandMitannianstobediscussedlater,itisprobablethattheCaucasianKassiteswereledbyanAryanIndo-European aristocracy.Ref.45[66]


78 CHAPTER5.3000TO1500B.C. SomepeoplenamedmaybetheAbraham,EsauandSaul,oftheBible.ThelanguageandcultureofEblamayhave survivedinsuchlaterCanaanitecentersasUgaritandevenPalestine.Thrivingby2,400B.C.oreven2,500,Ebla's kingsapparentlycontendedwithSargonofAkkadfordominationoftheEuphratesarea.Sargon'sgrandson,NaramSin,conqueredEbla,butitroseagain,onlytofalloncemoreabout2,000B.C.,perhapswipedoutbytheAmorites. TheirlanguagehasbeenidentiedasaforerunnerofalltheCanaanitedialects,whichincludeUgaritic,Phoenician andHebrew.Translationbecamepossiblebecauseofthendingofsomeduallanguagedictionaries,containingboth SumerianandEblaite.Ref.117[164] Attimeswarandattimesperiodsofcooperationoccurredwithanotherpowerfulcity,Mari,abouthalf-waydownthe EuphratesfromEblatoBabylon.TheFrenchexcavationsatMarishowaroyalpalaceofthreehundredroomsand courtsandevidenceofEgyptiantrade.AtonetimeMariwasruledbyShura-Damu,sonofEbriumwhohadbeen probablyEbla'sgreatestking.ThesekingswereelectedandEbriumhadservedfourtermsofsevenyearseach.Ref. 117[164] TothenorthwestweretheAssyrianswhobegantoriseasamilitantpowerby1,700B.C.andtothesouthwest,between theAssyriansandtheEgyptians,wasanotherSemitictribewhichwasoriginallyaBedouingroupappearingfromthe Syriandesertandwhosedescendantsaretoday'strueSyrians.Theymayhavebeenpushednorthandeastasthe HyksoswereexpelledfromEgypt.TheymadeDamascustheirchiefcity.Ofgreatestimportance,however,wasthe migrationoftheAmoriteswhocameoutofthedesertabout2,100B.C.totakeovermostoftheentirearea,including thecityofBabylonandthentheentireEuphratesValley.PleaseseeparagraphsaboveonMesopotamia,properp. 76. Finally,comingoutoftheiroriginalhomelandeastandnorthofLakeVanArmeniaasearlyasthelate3rdmillenniumB.C.wereanAsianic-speakingpeoplecalledHurrians,whosettledinlargenumbersinnorthernSyriaand Mesopotamia.AlthoughtheHurrians,themselves,maywellhavebeenoftheold,originalCaucasianrace,theyapparentlyhadanaristocracyofIndo-Europeanorigincalled"Mitanni".By1,600B.C.theyhadaseriesofkingdoms. SomeauthoritiesbelievethattheyintroducedthehorseandchariottotheNearEastaswarvehicles.Whatisoften calledtheMitanniKingdomwasactuallyafederationofHurrianstatesunderthekingsofWahukanni.Atoneperiod, KingTushrattacapturedandheldthestonecapitalofAssyria,Nineveh.Ref.136[187],45[66] TheBronzeAgeontheplateauofcentralIranbeganabout3,000B.C.Abasicagriculturaleconomywassoonaugmentedbyexportoflapislazulifromthenortheastandsteatitesoapstonefromthesoutheast.Themetalindustry followedthatofElamandBabylonia.TheElamitecivilizationwithitscapitalatSusacontinuedtoourishinalimited geographicalareaandtheirantagonismsandmilitaryvigorweremanifestedintheirraidsofSumer.TheMitanniand theHurrianslivedinpartsofnorthernIranbeforetheirmigrationsintonorthernSyria.Writingsappearedearlyin Persia,notablyintheregionofElam,wheretheculturalrelationswereclosertoMesopotamiathantotheremainder ofPersia.ElamitesalsohadindirecttradewithEgypt.Ref.18[31],45[66] Thelinguist,PeiRef.168[229],believesthattheIndo-Europeanpeoplesandtheirbasiclanguageoriginatedby about2,500B.C.eitherontheIranianplateauorabouttheBalticSea,whileWellsRef.229[307]wouldput thedateseveralthousandyearsearlierSeealsoEasternEuropep.84.McEvedyRef.136[187]indicatesa southernRussiaandlowercentralAsianoriginaroundtheAralSea,withtheseearlyIndo-Europeans,whichhelabels "Iranians",asbeginningmigrationsfromcentralAsiadownintoIranby2,250B.C.andevenpushingintoSyriaby 1,600B.C.TheirgrayGurganpotteryisfoundattheexcavationsiteofTepeHissarjustsouthandeastoftheCaspian Sea.ThesesameIraniansspreadacrosscentralAsia,becomingthebasepopulationofthesteppe,whileanother segmentmovedsouth,eventuallyinvadingIndia.AstheIraniansstormedintotheMiddleEastattheendofthetime periodunderreview,theywereaccompaniedbyclansoftheCaucasianKassitesandHurrians,withwarchariots. PleasealsoseeEurope:5000to3000B.C.Section4.4.Ref.168[229],229[307],136[187],88[131]


79 PrehistoriccoppercultureshavebeenvalidatedbyexcavationsofTroy,000-2,400andAlisharHuyuk,0002,800.Asthesegreatcoppersuppliesweredeveloped,theaxisofhistorybegantoshifttothisMediterraneanregion andawayfromMesopotamia.About3,000B.C.therewereaseriesoflocalearlyBronzeAgecultures,includingthe YortanCultureofnorthwestAnatolia,whichhadcloserelationshipstotheCycladicCultureoftheAegean,andthe rstTroyKisarlik.TheTrojanartisanslearnedtotoughencopperbyalloyingitwithsmallamountsoftinbyabout 3,000butthesourceofthistinisun-known.Regionaldivisionsinthepeninsulabecamequitemarkedwitheach controlledbyanativedynastyandmetropolitancenterssoonbecamequitewealthy.Ref.88[131]By2,000B.C. theAssyrianshadtradingpostsinthearea,suchasatKaneshmodernKultepewheretheformofcertainnamesin tabletsindicatesthearrivalofanIndo-Europeanspeakingpeople,theHittites.By1,750B.C.thelatterhadbecomea dominantmilitarycaste,controllingimportantcities.Theymayactuallyhaveappearedrstsomevehundredyears earlier,settlinginthebendoftheHalysRiver,buttheiroriginismuchdisputed. TraditionallytheyhavebeendescribedascomingdownfromtheregionoftheCaspianSea,butmorerecentstudies wouldsuggestthattheyhadoriginfromtheAegeanSeapeoplesandcameatthisperiodfromtheshoresofGreece andtheAegeanIslands,alongwiththeirkinsmen,theLuviansalsoLuwians.TheHittitemigrationwasonlythe centralcomponentinatrioofdisplacements.FromnorthoftheBlackSeatheUsatoveweremovingintotheBalkan areaandatthebaseoftheAnatolianpeninsulatheCaucasianKhirbetKerakweremovingdownintoSyriaandeven intoPalestine.ThesepeoplehavealsobeencalledHattitesandrepresenttheoriginalpopulationofAnatolia. TheHittitelanguagehaddeclensionalandconjugationalformssimilartobothLatinandGreekandsomeoftheir simplewordswerevisiblyakintomodernEnglish,suchas: Vadar -water,and Essa -eat. TheHittiteshadsharp,aquilinenosesandWellsRef.229[307]feltthattheyhadfusedsufcientlywiththeearly Hebrewstogivethelatterthisnoseasatrademark.ThebasicpopulationofTurkey,today,alsohasthisphysical feature.TheHittiteshadironandusedit. TheirsocietywasprobablyrelatedinsomewaytotheSumerianandmanyoftheircustomsweresimilar.Politicallytheyhadawarrioraristocracy,buttheyalsohadart,religionandwriting,allexhibitingcloseafnitieswith Mesopotamianmodels.TherstknownrulersoftheoldHittiteKingdomwereLabarnasandhissonHattusilisII.In 1,595B.C.,underMuresilisI,theyconqueredBabylon.TheLuvians,relatedtotheHittites,hadpenetratedAsiaMinor duringthelatterpartofthe3rdmillenniumB.C.andweresoonactiveinthewestwithaprincipalcityofBeycesultan ontheRiverMeander.Thatcitywasdestroyedin1,750B.C.,perhapsbytheHittiteKingLabarnasI. EastoftheHittiteswastheareaofancientArmenia,knowninthattimeas"Urartu"andinsomeplacesintheBibleas "Ararat".Thepeoplewecall"Armenians"today,however,probablydidnotarriveuntilatleastthe8thcenturyB.C. EvenintheearlytimeofthethirdmillenniumtheoverlandtraderoutesoftraderstothesteppesofAsiacrisscrossed thisland,andtheindigenouspopulationwasskilledinthesecretsofancientmetallurgy.Inatleastthelaterpartofthe periodundersurvey,thebasicpopulationofUrartuwascomprisedofthenon-Semitic,probablyCaucasian,Hurrian andVannicpeoples.Ref.136[187],45[66],88[131] NOTE :Jemmeh,mentionedpreviouslyinanoteonpage1183,wasreoccupiedwithaMidoleBronzesettlementabout1,800B.C.Ref.295[300] NOTE :ItshouldbenotedthatSargonIandhis54,000menplunderedallofMesopotamiaaroundKish,devastatingthecountrysidetotheeast,therebypreventinganotherarmyfromgoingthroughuntilthepopulation andcropshadbeenrestored.Ref.279[191]ItwasintheMesopotamiaareathatthetwo-wheeledchariot wasinventedabout1,800B.C.asaresultofthedevelopmentofspokedwheelswithafriction-reducinghub andaxledesign.Thecompoundbowwasalsodevelopedsothatmobilityandrepowerinwarweregreatly


80 CHAPTER5.3000TO1500B.C. increased.Thesteppepeoplewerebestabletotakeadvantageofthisandbetween1800and1500B.C. wavesofbarbariancharioteersoverrantheMiddleEast.Atthesametimerichmerchantswereusingdonkey caravanstomovetineastwardandtextileswestward,fromthePersianGulftoAnatolia,withprotsupto 100%inayear.Ref.279[191] ForwardtoTheNearEast:1500to1000B.C.Section6.3 ChooseDifferentRegion 1.IntrotoEraSection5.1 2.AfricaSection5.2 3.AmericaSection5.9 4.CentralandNorthernAsiaSection5.5 5.EuropeSection5.4 6.TheFarEastSection5.7 7.TheIndianSubcontinentSection5.6 8.PacicSection5.8 5.4Europe:3000to1500B.C. 7 5.4.1SOUTHERNEUROPE BacktoEurope:5000to3000B.C.Section4.4 TheBritishMuseumhasdisplaysindicatingtheoriginalcivilizationintheAegeanandeasternMediterraneanshould becalledthe"Cycladian",existingfrom3,000to2,000B.C.andtobeconsideredseparatefromtheCretanorMinoan Civilizationwhichfollowed 8 .Although,asnotedinthelastchapter,peoplewithanadvancedNeolithicCulturelived onCretefrom6,000B.C.onward,theBronzeAgestartedonlyabout2,600B.C. TherearesomewhobelievethattheEgyptianandAnatolianinuencesstimulatedthedevelopment,butmostnow feelthatthiswasapurelylocalprogressoverathousandyearperiod.Fortherst600yearsorsoofthisBronze Age,civilizationwasratherlowkey,anditappearsthattheremayhavebeenfolksofseveraldifferentoriginson theisland.Homerwasprobablytruthfulwhenhedescribedthreepeoples-theEteocretans,theKydoniansandthe Pelasgians.TherstofthesemaybeconsideredtheinitialtrulyCretanpeople,perhapsofLuvianoriginandspeaking theasyetundecipheredLinearAlanguage.TheBulgarianlinguist,VladimerGeorgiev,claimingdeciphermentof thePhaestosDiscfoundonCretein1910,believesthatthatrepresentedaLuvianlanguagewhichwasdominanton theislandaround1,700B.C.andthattheEteocretansandPelasgianshadsimilarlanguages.TheKydonianslivedin westernCrete,languageunknown,buttheyweredenitelynotGreekinorigin.ThePelasgianswereanAegeanpeople whooriginallymayhaveinhabitedalloftheAegean,ThraceandtheGreekmainland.Theirlanguagewasmid-way betweenThracianandHittite-Luvian.ObviouslyMinoawasamulti-lingualcivilization. TherstpalacesandcitiesofCreteappearedabout2,000B.C.,includingKnossus,Phaistos,MalliaandZakros.The rsthadabout80,000people 9 andthevastpalaceforthekingcalled"Minos",whichwaslocatedthere,wasthelargest andmostelaborateofall.Ithadexquisitepotteriesandtiles,bathroomswithrunningwater,toiletswithdrainage systemsandevidencesofrichappointmentsandjewelery.Theconstructionofsuchpalacesanditsaccouterments requiredanynumberofspecializedcraftsmen-architects,stonemasons,carpenters,plasterers,painters,potters, sculptors,gem-cutters,glassmakers,faiencemakers,smiths,weaversandprobablyothers. 7 Thiscontentisavailableonlineat. 8 Dr.FrankStubbingsRef.215[290],page114believesthattheCycladicandMinoanoriginatedataboutthesametime,800B.C.and existedsidebyside,alongwiththeMycenaeanontheGreekmainland 9 CotterellRef.41[62]saysnolessthan20,000betweentheyears2,000to1,700B.C.


81 Thevehundredyearsfollowing2,000B.C.sawtheshipsoftheMinoansroamingunchallengedontheAegeanSea. TheCretannavyapparentlyclearedtheseasofpiratesandprotectedthehomelandfrominvasionsothattherewasno necessityforanykindofforticationontheisland.Thecommercialeetwasinvolvedinextensivecommercewith surroundingislands,theNearEastandEgypt.Thelattersuppliedscarabseals,carvedivories,copperandtin 10 and Egyptianlinen,whilereceivingoliveoil,paintedpottery,timberandwoolencloth.TheCretansaresaidtohavehad 100,000sheep.AnalabasterjarbearingthenameoftheHyksosKingKhyanhasbeenfoundandconrmsprobable delegationsandtradewithEgypt.Perhapsfromover-population,theMinoanssentcoloniststovariousotherislands andthemainlandofGreece.TheislandTherawasanimportantMinoansatelliteandacolonyontheislandofKythera, betweenthewesternendofCreteandthePeloponnese,wasstartedbefore2,000B.C.andwasstilloccupiedat1,450 B.C.CretanfashionsspreadthroughouttheislandsandeventoGreeceandAsiaMinor. RecentexcavationsnearArkhanes,southofKnossos,haverevealedatempleforthedead,datingto1,800B.C.with anoblewomanburialwhichincludedsuchthingsasagoldsignetringwithacultsceneconrmingthatMinoans, likeotherpeoplesofthattime,hadtheancientbeliefinthedyingandresurrectedgod.Thereisevidenceofanimal sacriceandapparentlyintimesofgreatstress,asintheearthquakeperiodabouttobedescribed,theyevenused humansacrices.Ref.18[31],136[187],129[179],215[290],109[155],186[254],211[284],213 [288],188[257] About1,700B.C.violentearthquakesdemolishedtheoldpalaces,buttheywereallrebuilt,forthemostpartonentirely newplans.Duringthisrebuilding,Minoancivilizationacquireditsdenitivecharacterandthebuildingsdeveloped theiruniquecharm,eleganceandgrace.Intheperiodofthenewpalaces,thepopulationofCretehasbeenestimated at256,000with50,000underthedirectruleofKnossos.Thepalaceshadgreatstoreroomsandworkshopsandthe earliestwritinghadtodowithaccountingforwheat,oil,barley,olives,gs,livestock,wineandhoney.Horsesare notdocumentedontheislandbeforethe15thcenturyB.C.whenthetechniqueofusingheattobendwoodforspoked wheelsbecameavailable.Theoverallsocietywasastratiedtheocracywiththepriest-kingatKnossossupremeand lesserpriest-kingsintheotherpalaces.Thelatter,inturn,weresurroundedbytheirnoblesandtheirwomenand beneaththemwasthepeasantry,stilllivingessentiallyinaStoneAgeeconomy.Incontrasttomostotherancient civilizationstherewerenoslaves.Amongtheupperclassesbothsexesworejewelryandparticipatedinart,dancing, musicandwhenyoungandsupple,inthefamousbullacrobatics.Themeaningofthelatterisstillnotclear. AlittlenorthofCreteintheAegeanSeaisthepeculiarlyshapedislandvariouslyknownasTheraorSartorini.This istheremnantofagreatvolcanowhichhaditsrsttraceableeruptionabout1,500B.C.buryingtheislandinashand pumice.In1967ProfessorMarinatosdiscoveredthetephra-preservedcoveredwithvolcanicdusttownofAkrotiri onthatisland.IneffectthisCretanextensionwasaBronzeAge"Pompeii"completewithterracottaplumbingand town-housearchitecture.ForftyyearsorsoafterthatrsteruptionTheraremainedquiet,butweshallhearmoreof itinthenextchapter.Ref.109[155]AdditionalNotesp.85 IfoneacceptsthetheorythattheKurgansofsouthRussiamigratedtoGreecetobecometheMycenaeans,thedate of2,300B.C.isprobablyappropriate.SomebelievethereweretwowavesoftheseKurgans,withthesecondwave comingjustbefore1,600B.C.Thesewereahard-ridingwarriorclasswhodominatedtheirearlierbrotherstobecome asmall,powerful,rich,rulingclass.TheoriginalinhabitantsofbothmainlandGreeceandtheadjacentAegeanislands wereperhapsrelatedtotheCretansinspeechandrace,butthedevelopmentofcivilizationonthemainlandhadbeen arrestedbymassiveinvasionsattheendofthe3rdmillenniumbybarbarouspeoplesfromAnatolia,andacenturyorso laterbyinvadersfromthenorth.ThelattermayhavebeentheKurgans,therst"Greeks",althoughsomeauthorities believethattheGreek-speakersarrivedmuchlater.LiketheMinoans,theBronzeAgeGreeks 11 hadpassedthrough centuriesofhumblelivinginsmallvillages,obviouslypoorandwithlimitedtrade,chieywithCrete.Ofthevarious tribes,themenofMycenaeasoondominatedbyvirtueofchariotwarfareandby1,600B.C.therewasanadvanced styleoflife,centeredinthatcommunity,butwithinuencesextendingtoCreteandinuencedbyCrete,withships 10 CotterellIbidreportsthattherewasadequatecopperavailablelocallyandthattinwasimportedfromBulgariaandRomania 11 Theterms"Mycenaeans"and"Achaeans"bothsimplymean"BronzeAgeGreeks"


82 CHAPTER5.3000TO1500B.C. ofbothvyingforcontroloftheMediterranean.PeiRef.168[229]saysthattheclassicalGreeklanguagewas welldifferentiatedbythattime.Thesailhadbeenusedafterabout2,000andthishadallowedforbettershingand increasedmaritimetrade.Withdomesticationofthegrapeandolive,newindustriesappearedandthrived.Magnicent tombs,withmassesofgoldartobjectsaredatedtothe16thcenturyB.C.Ref.215[290],8[14],168[229],41 [62] ExcavationsatMaliq,Albania,haveprovedthatpeoplelivedtherein2,800B.C.,perhapsbeforethearrivaloftheIndoEuropeans,andtheymayhavemaintainedsomerelationswithMycenaea.InthethirdmillenniumB.C.andforawhile after2,000B.C.mostoftheBalkanswasoccupiedbytheTumulus,BattleAxeandCordedWarepeoplesPlease seeB.CENTRALEUROPE,thischapterwhomayhavedescendedfromthecopperandgoldsmithsdescribedinthe previouschapter.Intheearlysecondmillennium,however,theareawascrisscrossedwithmigratingtribes,particularly theGreekpeoples,describedimmediatelyabove.TheIllyrians,settlinginYugoslavia,wereanIndo-Europeangroup relatedtothepre-CeltswhowerelocatedjusttothenorthwestinthepresentareasofHungaryandAustria.Withthe developmentofagricultureinthesandy,glacialsoilofnorthernEuropeattheendofthistime-frame,theBalkans becamesomethingofabackwater.Ref.8[14],178[245] ThebasicpeopleofancientItalyweretheWesternIberiansoftheoriginalMediterraneanrace,andtheywereessentiallythesoleinhabitantsofallItaly,Sicily,SardiniaandCorsicaexceptforsomecoastalsettlementsbytheeastern Mediterraneanpeople,untilabout2,000B.C.wheninvadersdescendedfromthenorth.ThelatterweretheItalics,part ofthewesternbranchofearlyIndo-Europeanspeakers,relatedtothe"LigurianCelts".TheybuilthomesonfoundationsofpilesTerramaraandtheirdescendantsbecamethebasicstockofpresentdayItaly.By1,850B.C.these peoplehadoccupiedallofItalyexceptthenorthwesternone-quarterwhichwasoccupiedbyEtruscans,whoMcEvedy Ref.136[187]insists,wereremnantsoftheWesternIberians.AncientpeoplesalsoremainedonSicilyandthe westernislands,althoughby1,"CeltoLigurians"fromsouthernFrancehadoccupiedCorsicaand Sardinia.Ref.136[187] 5.4.2CENTRALEUROPE By3,000B.C.allEuropebutnorthernScandinaviahadfarmingcommunities.Indo-Europeanspeakinggroupslived throughoutcentralEuropefromthebeginningofthisperiod'svariousmodicationsofthebasiclanguage.Professor JanFilipRef.194[266],patriarchofCeltichistoryofCharlesUniversity,Prague,describeda"CordedWare" or"BattleAxe"peoplerepresentingtherstIndo-Europeanspeakersofthisarea,livingthereabout2, theprecursorsoftheCelts,anddominatingtheearlierNeolithicCulturesofnortherncentralandwesternEurope. TheAustrianSalzkammergutwassettledabout2,500B.C.withtheinhabitantsgettingsaltfromsaltwells.Ref.91 [135]Asageneralwestwardmigrationoccurredtheareabecamedominatedabout1,850B.C.bytheBell-beaker Culture,namedfromthebellshapedcupsfoundintheirgraves.Theoriginofthispotterysocietyhasbeenmuch disputed,someclaimingitstartedinSpainandspreadeasttoGermany,andsomethereverse,butifitwas,indeed,a cultureendemicwiththeearlyIndo-Europeans,thentheexpansionmusthavebeenwestwardfromtheoriginalIndoEuropeanzone.TheAunjetitzCulture,avariationoftheBell-beaker,oweredinsouthwesternGermanyandAustria fromthe18thtothe16thcenturiesB.C.Excavationsinthelattercountryhaverevealedbronzeneedles,armspirals, daggersandceramicswithintricatedetail.Asagriculturespread,sometimesasseedsweremovedtonewclimesthey wouldscarcelygrowandweedswouldtakeovertheelds.Onsomeoftheseoccasions,however,itwasdiscovered thattheweedsthemselvescouldbeusedandcultivatedinstead.Inthismannerryeandoatsdevelopedinnorthern Europe.Ref.45[66],136[187],194[266],211[284],91[135]


83 5.4.3WESTERNEUROPE TherewasalateCopperAgeinSpainwithtechniquescomingacrosssouthernEuropefromtheCaucasus,after 3,000B.C.AsourceoftinwasfoundinnorthwestSpainsothattheareacouldreadilyparticipateinthebronze industriesbetween2,500and1,500B.C.Someofthemetal-usingcommunities,suchasthoseinsouthernSpainand Portugalabout2,500hadtobefortiedandsomehadtwohighwallswithoutlyingfortressestogivewarningofattack. Defendersfoughtwithbowandarrows.Ref.175[241] Inthelastchapterwediscussedthe4thmillenniuminhabitantsofEngland,theWindmillHillpeople.Itwasprobably thesewho,atthebeginningofthe3rdmillennium,startedtobuildaseriesofremarkablestonemonumentsinsouthern England.Thebestknownandmostthoroughlyinvestigated,writtenabout,photographed,paintedandromanticized ofthese,isStonehenge.Theoriginalstructure,Stonehenge1,datestonotlaterthan2,900whentherewerealready some180separatehabitationcentersinWessex.AtStonehenge,rstofalltherewasdugacircularditchsome1,050 feetincircumference,41/2to6feetdeepand12feetwide.Thepurposeofthiswastosupplythechalksoilforabank whichwasthusbuiltupalongtheinnersideoftheditch.Ithasbeenestimatedthatthisalonerequiredabout28,000 man-hoursofwork,usingred-deerantlersforpicksandwhateverforshovels.Thebankmeasures320feetindiameter andwasatleast6feethigh,althoughsomesay20feet,withacausewayentranceonthenortheast.Onlyafewstones wereusedinStageI,acoupleatthecausewayentranceandperhapsthefourStationStones,butamysteriousfeature wasagroupof53postholesalsointhecausewayentrance. Mostmodernscholarsareconvincedthatthesewereusedforpreciseandconstantobservationoftheextremenortherly risingsofthemoonforahundredyearsormore.Itrequiresnineteenyearsforthemoontoexactlyrepeatitscourse inrelationtotheearthandsun,sothatpredictionsofmoonpositions,possibleeclipses,etc.requirelongperiodsof observation.Theaveragediameterofthepostholesis3feet6inches,withadepthof21/2feet. Thereisnoevidencethattheyeverheldstonesorwoodenposts.Somehaveyieldedcremationremains,akesofint, cups,etc.alladdingtothemystery.ProfessorFredHoyleRef.99[144]believesthatthiswasnotbuiltbylocal people,butbysomewhocameespeciallytoplacethecircleattheexactspotneededforsomeastronomicalreasons. AfterPhaseIofStonehengewascompletedbutbeforePhaseIIanotherenormous,strangeconstructionappeared aboutone-halfmilenorthofStonehenge.Thisisanarrowhorse-shoeshapedearthworkswitheachlegrunningforone andthree-quartersmiles,andwhichiscalledthe"Cursus",becausesomehavefeltitrepresentsaNeolithicrace-track. ThereissomeevidencethatthebluestoneswhichweshallseewereusedinStonehengeIIhadearliereitherbeenused forsomepurposeorstock-piledatthewesternendofthisCursus.Thereareabouttwentysimilarconstructionsin Britainandthisoneisthesecondlongestanditmayevenpre-dateStonehengeI.ThelongestCursusisatDorsetand measures6.2milesinlength.Ref.7[12]TherearenoneoftheseconstructionsoutsideBritain. BeforethenextphaseofStonehengewasconstructed,theBell-beakerpeoplearrivedfromthecontinent,500-2,300 B.C.withtheircopperworkingskillsandtheirarrow-headsanddaggers.TinwasdiscoveredinCornwallandabronze industrycouldsoondevelop.ItwasthesesameBeakerfolkswhosubsequentlybridgedthetransitioninIrelandfrom theNeolithicperiodtotheBronzeAgebetween2,000and600B.C.,introducingcopperandgoldornamentation. ThesepeoplealsomigratedintoScotlandtofusewiththeearlierintuserswhohadcomefromIrelandandNorway atabout3,000B.C.McEvedyRef.136[187]callstheBell-beakerpeopleofthecontinent"Celto-Ligurians"and althoughwedislikegettinginvolvedinsemantics,wefeelthattheyweredenitelynotLiguriansandprobablynot rightlycalledCelts,asthelatterwerenotyetdenitelyseparatedfromthegeneralmassofIndo-Europeanspeaking peoplesofcentralEurope. ButtoreturntoStonehenge,PhaseIIdatestoabout2,100B.C.,withtheplacementofadoubleBluestoneCircle, withstonessixfeetapartinthecenteroftheoriginalconstruction.Partofthis,however,wasnevercompleted.The amazingthingisthat82oftheseophiticdoloritestonesweresomehowbroughtfromtheironlysource,thePrescelly MountainsofDyfed,Wales,-some135miles"asthecrowies"or240milesbyseaandland,eachweighingseveral tons,toStonehenge.ProfessorGeraldHawkins 12 hascalculatedthat209,280man-dayswererequiredtomovethese 12 AsnotedinBalfourRef.7[12],page90


84 CHAPTER5.3000TO1500B.C. stones.InadditiontotheBlueStoneCirclesan"AltarStone"wasadded,theentrancewaswidenedandanewaxis alignmentmadeorastronomicalsightings.ThisPhaseIImayhavebeeninuencedbytheBeakerpeople. ThemostspectacularpartoftheStonehengedisplay,however,isPhaseIII,whichconsistsoftheSarsenCircleof thirtyuprightsandlintels,someweighingupto45tons.ThesemassivestonescamefromnearAveburyandalmostof necessityhadtobemovedoniceabouttheyear2,000B.C.whenEnglandwasmuchcolderthanbeforeorsince. ProfessorAlexanderThom,astronomerandmathematician,althoughdifferingfromHoyleastomanydetails,is equallysurethattheseancientstonebuilderswereabletopredicteclipses,andaftermanyyearsofstudybelievesthat allthemenhirslongstonesandcromlechscurvedstonesofBritainandBrittanyaswell,aresimilarinpurpose. Thereareofcourseotherstonecircles,some900alltogether,tobefoundthroughouttheBritishIsles.One,knownas DurringtonWalls,istwomilesnorthofAmesburyandwasbuiltbyskilledcarpentersofabout2,500B.C.probably withasloping,cone-shapedroofandacentralcourtyardopentothesky.Itis1,720feetindiameter.Areton?warriors undoubtedlyinhabitedtheseregionsafterabout1,900B.C.formingarulingpoweraristocracywhichlastedsome600 years.ThemysteriousstoneringofBrogarononeoftheOrkneyIslandsaswellasthegreattombatMaeshowedate to2,300B.C.,thesametimeastheconstructionoftheEgyptianpyramids.Later,atabout1,600B.C.,therewasatime ofhighsealevels,andthecoastalforestsofBritainwereinundatedbythesea.Ref.176[242],178[245],224 [299],7[12] Thelargestman-mademoundofantiquity,risingtoaheightof130feetandspreadingatitsbasewellover51/2acres, representinganamazingsurveyingandengineeringfeatofStoneAgeman,hasrecentlybeenexcavatedatSilbury Hall,notfarfromAvebury,inWiltshire,England.Multipletunnelsintothisgiantmoundhavefailedtorevealany skeletonsanditspurposeremainsunknown. Recentguresshow4,350dolmensusuallytombs,2,070menhirs,30cromlechsand110alignmentsinFrance.The mostimpressiveofallmaybethe3,000unitsmadeupof10to30columnsofmenhirsstretchedovertwomilesof countrysideatCarnac,France.Theremayhavebeenaselectclassofprieststrainedinstudyingtheheavens,andthese mayhaveoriginatedinEngland,withalaterpassingonofthesecretstothepriestsoftheCelts,theDruids.Caesar wrotethatthepriestlydisciplineoftheCeltswasdevelopedinBritainandwascarriedfromtheretoGaul,andby oral,notwritten,tradition.ProfessorThom'sstudiesindicatethatallthesestonemonumentswerebuiltonmultiples ofastandardunitofmeasurementcalledthemegalithicyardandwhichistheequivalentof2.72feet.Althoughmen hadworkedonthesemonumentsfor2,000years,afterabout1,500B.C.nomorewerebuilt.ProfessorHoylebelieves thatlatergenerationsofastronomer-priestslosttheabilitytokeeptheastronomicalsystemsuptodate,begantomake errorsandthenlosttheirfollowings.Ref.99[144],215[290],176[242],7[12] 5.4.4SCANDINAVIA About3,000B.C.afewimmigrantstoDenmarkbroughtagricultureandbig,polishedint-stoneaxestouseastoolsto cleartheforest.Theseaxeshavebeenfoundbythetensofthousands.Dolmensofstone,suchaswementionedunder WESTERNEUROPE,havebeenfoundintherangeofthreetofourthousandandaremorenumerousinDenmark thananyplaceintheworld.Megalithictombswereconstructedandmanydeadwerelaidtorestineach,someofthe deadwearinghundredsofamberbeads. Beginningabout2,500B.C.therewerepeopleofatleastfourdifferentcultureslivingsidebysideinsouthScandinavia. Theywere: 1.Thedecliningremainsofthemegalithiccivilization. 2.TheSingle-graveCultureofJutland,whichwasrelatedtothenext. 3.Boat-axeCultureofsouthSweden. 4.PittedWareorPit-combWareCulture,tobediscussedbelow. After2,000B.C.thesevariouspopulationsfusedtogetherinaNeolithicCulturewhichmadebeautifuldaggersand otherinstrumentsofint.By1,500metalworkhadappearedinauniqueNorthernBronzeAge.


85 Afterabout2,000B.C.theamberbeadsnolongerappearedintombs,astheamberhadbeguntobetradedtothe Mediterraneancivilizations.StonecuttingandintquarrieswereearlyDanishindustries.TheBattle-axepeople, latertobecalled"Teutons",appearedabout2,000B.C.,buttheyusednobronzeforanotherthousandyears.Farming communitieswerepresentallthroughsouthernScandinaviathroughoutthethirdmillenniumB.C.anditwasthese StoneAgemenwholeftthehugegravechambers.FinlandandthefarnorthweresparselypopulatedwiththePitcombWareCulture,characterizedbyferociouslooking,rod-likearrowheads.Ref.215[290],117[164],88 [131] 5.4.5EASTERNEUROPE TheBalticareaandwesternRussiawerecolonizedchieybyIndo-Europeansafter3,000B.C.Anexceptionwasthe nomadicancestorsoftheEstonianswhoreachedtheBalticfromthevalleysoftheupperVolga.Theywererelatedto FinnsandHungarians,withalanguagewhichwasnotIndo-European.InthethirdmillenniumthePitGraveCulture oftheUkraniansteppesshowedwheeledcartsanddomesticatedhorses.Thismayrepresentthesiteoftheproto-IndoEuropeans,althoughasmentionedabove,theargumentgoeson.SovietandGermanphilologistsbelievethattheorigin ofthesepeopleandtheirlanguagehadtobenearthemouthoftheVolgaatthenorthendoftheCaspianSea,with spreadfromtherebothwestwardintoEuropeproperandsouthwardandeasterlyintoIranandthenIndia.Theyrefer tothepeopleas"Ur-people"andthelanguageas"Urlanguage".ThisconcepthasbeensecondedbytheUnitedStates archeologistofBaltdescent,MarijaGimbutas,afterherstudyofthekurgansburialmoundsofsouthernRussia.The Kurganpeopleseemtohavelefttheirhomesbetween2,400and2,300B.C.torstinvadethenorthshoreoftheBlack SeaandthentheterritoryoftheTrans-Caucasus.Themountainpeopleofthelatterareahadalreadyhadmuchcontact withtheMesopotamiancivilizationsandhadacivilizinginuenceonthebarbarianKurgans.TheHittitesmayhave movedoutfromthiscultureinabout2,000B.C.Ref.91[135]Oldrivernamessuggestthatby1,500B.C.the entireregionbetweentheBalticandtheAlps,theBritishIslesandHungary,wasoccupiedbypeoplespeakingasingle Indo-Europeanidiomcalled"OldEuropeanLanguage"bytheIndo-Europeanist,HansKrahe 13 .Aspecialsectionat theendofthischapterwillgiveamoreorlesscompletebreakdownofthevariousIndo-Europeanlanguages.Inthe meantimeletusreturntoournarrativeabouteasternEuropeinthisparticulartime-frame. TheUkraineandsomeareasfarthereastweresooncolonizedbypastoralgroups,someofwhichweretheancestorsof later-dayScythians.NorthofthesteppeanddesertbeltinRussia,aroundfty-vedegreesnorth,therewasathinbelt ofdeciduousforestwithsomefarmers,andstillnorthofthatwerescatteredhuntersofthereindeer.Copperworking extendedalmosttotheArcticby1,850B.C.PeasantfarmersfromcentralEuropecontinuedtopusheastwardalong theforestbeltofcentralRussia,growingthehardycerealsascropsandreachingMoscowandthesouthernUralsby 2,000B.C.Ref.8[14],225[301],45[66],88[131] TheBalticlinguisticgroupofnortheasternIndo-EuropeanscametotheeasternBalticandwesternRussiaareabefore andabout2,000B.C.asagriculturalistsandcattleraisers.TheyoriginallyreachednorthwardtoFinlandandeastward totheupperVolga 14 ,butonlythesoutheasternBalticgroupssurvivedthroughtheBronzeAge,theIronAgeand downtoaboutA.D.500,livingbetweentheOderandDvinarivers.TherearehundredsofBalticloanwordsinthe Finno-Ugrianlanguages.TheGalindiansGolyadofRussianchroniclesweretheeasternmostBalts,extendingupto theMoscowareaandexistingupuntilthe12thcenturyoftheChristianEra.Someislandsofthesepeoplestillexisted aroundSmolensk,VitebskandMinsk,almostupuntilthepresenttime.Theonlytruesurvivorstoday,however, aresomefamiliesinLatviaandLithuania,probablymixedwithinvadingGermans,PolesandRussiansthroughthe centuries.TheyatleaststillhaveBalticlanguages.Ref.8[14],61[90] Evenafter2,000B.C.theFatyanovoCultureexistedincentralRussia.By1,800threeratherdistinctpeoplesoccupied theirownzonesineasternEurope.InadditiontotheBalts,whichwehavedescribedasoccupyingtheBalticarea,to thesouthwasabandofSlavsextendingfromfarinRussiawesttotheVistula,andnallytheentiresouthernareawest andjustnorthoftheBlackSeawasoccupiedbytheThraco-Cimmerians.At1,600B.C.theBaltsandSlavswerestill 13 "Volga"isaBalticwordmeaning"long" 14 AsnotedbyHermRef.91[135],page71


86 CHAPTER5.3000TO1500B.C. withouttheuseofbronze,althoughitwasincommonusetothewestwiththeproto-Celtsandtothesouthamongthe Thraco-Cimmerians.Ref.136[187] ForwardtoEurope1500to1000B.C.Section6.4 NOTE :AstheBronzeAgesetinabout2300B.C.Cypruscameintoitsownbecauseofitsgeologicgiftof copper.TheTroodosMountainsofthisislandwereonceoceaniccrust,thrustupsome70millionyearsago bytheadvancingAfricanandArabiantectonicplatesandtheyareloadedwithcopperandothermetals.At rsttheancientscouldsimplypickcoppernuggetsofftheground.Ref.281[113] 5.5CentralandNorthernAsia:3000to1500B.C. 15 5.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:5000to3000B.C.Section4.5 Throughoutthefteenhundredyearscoveredinthischapter,theIranianIndo-Europeantribesslowlyexpandedinall directions,includingvarioussalientsacrosssouthernAsiabotheastandnorth.By2,500B.C.thehuntingeconomies hadbeguntogivewaytoherdingandagricultureinKazakhistanandcentralSiberia.Horsedrawncartswerein useinTurkistanbythesamedate.ThepotteryofallthesepeopleshowedafnitiestotheMiddleEast.Itwasthe domesticationofthehorsewhichallowedthemtospreadandpenetrateinalldirections. InthefarnortheastofAsia,theMongolpeoplescontinuedtheirowndevelopment,probablymorecloselyrelatedto theChineseculturethantotheIndo-Europeandevelopment.IntheareawhichnowcomprisesthewesternChinese provincesofKansuandSinkiang,butwhichgeographicallyaremoreapartofcentralAsia,thePan-Chanphaseof theYang-shaoCultureappearedabout2,500B.C.withlargeurnspaintedinspiralswithpurple,brown,redandblack. By1,500B.C.thisgavewaytotheHsien-tienCulturewhichincludedfarmingandtheuseofhand-madepottery andcoppertools.Farthernorthwest,intheYeniseiValley,theAfanasieveCulturewithstockbreedersandhunters, stampedpottery,andcopperornamentshavebeendatedtothis3rdmillennium.By1,500B.C.theAndrovonovo CultureexistedbetweentheDonandtheYeniseirivers,withsmallsettlementsofuptotensemi-subterraneanhouses. Theseindividuals,whoweretheancestorsofthelaternomadsofthecentralAsiaticsteppes,grewwheatandmillet andbredlive-stockatthattime.Ref.136[187],8[14],45[66],213[288] ForwardtoCentralandNorthernAsia:1500to1000B.C.Section6.5 5.6TheIndianSubcontinent:3000to1500B.C. 16 5.6.1THEINDIANSUBCONTINENT BacktoTheIndianSubcontinent:5000to3000B.C.Section4.6 InadditiontotheBrachycephalsdiscussedinthelastchapter,otherethnicgroupswerewellestablishedbythe3rd millenniumB.C.Negritos,Proto-AustraloidsandaMediterraneanpeoplenowmainlyassociatedwiththeDravidian CultureandnallytheMongoloidsofthenortheastandnorthernfringes,wereallpresent.Thelatterwereserpent worshipingNagas,whiletheDravidianswereadventuroussailingmerchantswithcitiesofrenementandluxuries. TodaytheDeccan,insouthernIndia,isessentiallyDravidianinstock,customsandlanguage. TheBrachycephal 17 developmentcametoowerintheIndusValleycitiesofHarappaandMohenjo-daronow allinPakistanwithacivilizationwhichsurvivedforalmostathousandyears,550to1,550B.C.withexcellent 15 Thiscontentisavailableonlineat. 16 Thiscontentisavailableonlineat. 17 ThereissomeevidencetosuggestthattheBrachycephalswerethemselvesDravidians.Ref.175[241]


87 houses,elaboratedrainagesystems,bathrooms,etc.-allequaltoSumerianaccomplishmentsandprobablysuperior toBabylonianandEgyptiancultures.AtitsheightthissocietyextendedfarbeyondtheIndusValley,itself,seemap onnextpageandcoveredanareafargreaterthanthecontemporarystatesofMesopotamiaortheKingdomofEgypt. Ofthis,onlyhighcitadels,solidbuildings,uniformgridsofstreetsandtheelaboratedrainagesystemremain.Itwas asocietyofpriests,merchantsandpeasantfarmerswithextensiveseatradewithSumerandBabylonia.Therewas localscriptwritingby2,400B.C.butunfortunatelyithasnotyetbeenconvincinglydeciphered.Nooneknowseven thelanguagefamilytowhichitbelongs,althoughtherearethousandsofshortexamplesonstoneseals,metalobjects andpottery.ThiscivilizedareanotonlyextendedallalongtheIndusanditstributariesbutranforvehundredmiles alongthecoastoftheArabianSea,andFrencharcheologistshavealsodiscoveredremainsofamatureHarappan settlementupinnortheasternAfghanistanclosetotheRussianborder,athousandmilesnortheastoftheIndusmouth. TheHarappansdomesticatedtheIndianjunglefowl,latertobecometheworld's"chicken".Thewomenapparentlyall woreatleastloincloths,butthemenareoftenshownnaked,inthediscoveredgurines.Ref.8[14],176[242], 215[290],44[65],211[284] Thedisappearanceofthisasalivingcivilizationhasbeentraditionallyblamedonthedestructionwroughtbythe AryaninvadersfromBactriaandnorthernIranwhodescendedintothisareabetween1,600and1,500B.C..Although theycameprimarilyasimmigrantstondpasturelandfortheircattle,theywerealsostrongghterswhencombat wasnecessary,andgraduallyallHindustanthelandnorthoftheNarbadaRiverwasundercontrolofthesepeople, nowcalled"Vedics".TheyprohibitedintermarriagewithnativegroupsandthusinitiatedtheCasteSysteminIndia. TheirAryantonguewasancestraltoSanskritandSanskritwasawelldifferentiatedlanguageby2,000B.C..They hadasophisticatedtheologyandwellorganizedpriesthood,bothindicatinginuencesofSumerianandBabylonian religiousideas.SomeauthoritiesputthecollapseoftheHarappancivilizationsomewhatearlier,between1,800and 1,700B.C.andmentionthatthestreetsofMohenjo-darowhenrstexcavatedwerelinedwithcorpses.Iftheinvading Aryanswerenotresponsible,otherpossibilitiesincludedachangeinthecourseoftheIndus,oraterribledrought. ItisofinterestthatmanyIndussettlementswereinareaswheretodaythereisnothingbutdrysandandagriculture wouldbeimpossible.Apparentlyinthoseancientdaysrainfallandriverwaterhadbeenmoreplentifulandthishas beenconrmedbyarcheologicalpollencounts,Thesepollens,whichwereingreatnumbersinthelowermostlayers laterdroppedintheupperlayersofexcavationandwerethenchieyofdesertplants,indicatinganobviousdrought. OnetheoryofthecauseofthishasbeenputforwardbyReidBrysonoftheUniversityofWisconsin,whofeelsthat withincreasingpopulationoftheInduscivilizationtheforestsweredestroyedforfuelandtimbers,andtheresulting deforestationacceleratedtherun-offofrain,decreasingsoilmoistureandloweringthefertilityfromerosionandtopsoilloss.Thenwithovergrazing,aman-madedesertappeared,withrisingdustwhich,inturn,cloudedandcooledthe upperatmosphere,withtheresultingheavier,coolairsinkingdownwardandpreventingrain.Thusitispossiblethat theInduspeople,pushingtheirenvironmenttothelimit,causedtheirowndownfallandnearextinction.Inanyevent, lifedidcontinueinthevalleybutwithoutthehighlyorganizedculturepreviouslyknown.Ref.46[76],68[106], 176[242],45[66],215[290] Figure5.1: IndusCivilization By2,000B.C.PanchewingwasawellestablishedpracticeinIndia.PanistheBetelnut,andlikecocaineitispart narcoticandpartstimulant.WehavementionedthattheAryansbroughtlivestockwiththem,particularlycattle.They atebeef,mutton,milk,andcurdsandusedthecookingmedium"ghi",aclariedbutter,whichcanbekeptformonths. Theyintroducedthisheavydependenceondairyproducts,reinforcedbypreceptsfromtheVedas,whichledslowlyto abeliefinthesacrednessofthecow,apreceptstillexistingtoday.Ref.211[284]

PAGE 100

88 CHAPTER5.3000TO1500B.C. VeryrecentexcavationsatBalakotontheArabianSeacoastofsouthernPakistanindicatethepossibilityofacivilizationevenearlierthantheHarappan,withwelldevelopedceramicsandtheuseofcopper.InthefarsouthinSriLanka, therstinhabitantsweretheVeddas,whoemergedthereabout3,000B.C.Onlyafewofthedescendentsofthese aboriginesstillliveinthemountainousarea.Ref.44[65],38[59] ForwardtoTheIndianSubcontinent:1500to1000B.C.Section6.6 ChooseDifferentRegion 1.IntrotoEraSection5.1 2.AfricaSection5.2 3.AmericaSection5.9 4.CentralandNorthernAsiaSection5.5 5.EuropeSection5.4 6.TheFarEastSection5.7 7.TheNearEastSection5.3 8.PacicSection5.8 5.7TheFarEast:3000to1500B.C. 18 5.7.1CHINAANDMANCHURIA BacktoTheFarEast:5000to3000B.C.Section4.7 Chineselegendsarebountifulwithallegedrecordsatleastbackto3,000B.C.,allofwhicharenoteasytosubstantiate. ExcavationsinChekanyprovinceincentralsouthernChinahaverevealedaNeolithicCulture,theYang-Shao,which wehavementionedpreviously,withpaintedpottery,datingtoabout3,000BC.Themorewide-spreadLung-Shan, blackpotteryculturepeakedatabout2,000B.C.Thelegendsdescribeanumberofgreatemperorswhotaughtthe peoplemarriage,music,writing,painting,shingwithnets,domesticationofanimalsandthefeedingofsilkworms. TraditionhasitthatEmpressSi-Ling,wifeofthegreatHuang-Ti,discoveredsilkabout2,640B.C.Brickstructures mayhavebeenerectedabout2,600B.C.alongwithobservationsforthestudyofstarsandtheconstructionofacorrect calendar.ChinesemedicineallegedlybeganwiththelegendaryFuHsiin2,953B.C.followedbyShenNung,theRed EmperorHung-Ti,whocompiledtherstmedicalherbalmaterial,thePen-Tsao,about2,800B.C.Hesupposedly personallytested365drugsanddrewuptherstacupuncturecharts.Morefamousisthegreatmedicalcompendium, theNeiChingCanononMedicineallegedlydevelopedbyYuHsiung,theYellowEmperorHuangTi,about2,600 B.C..Thiswastransmittedorallyuntilprobablythe3rdcenturyB.C.andwasstilllaterrevisedinthe8thcenturyof theChristianEra.TheNeiChingdealswithallphasesofhealthandillness,preventionaswellastreatment,including acupuncture.Tea,whichgrowswildinManchuria 19 ,wascultivatedthereabout2,000B.C.AtrsttheChinesemerely chewedtheleaf.Ref.38[59],125[173],46[76],45[66],122[170],213[288] FromthemiddleofthethirdmillenniumB.C.theheartoftheYellowRivervalleywasdenselypopulated.Ittook alargeanddisciplinedforcetodrainandoodcontrolthisoodplain.Asmalltypeofpigwasfoundineveryhut andtheox-cartwasknownby2,000B.C.Thehorseandchariotcamealittlelaterwiththehorsessimilartothe wildMongolianponieswithheavyheadsandshortlegs.Foxtailmilletandasmallamountofwheatspreadfrom thewestweregrown.Ricewascultivatedmuchlater,beginningsouthoftheYangzte 20 ,aforeignland,wooded, marshyandpeopledwithnomadsofadifferentrace.Thersttrulyurban,knowncivilizationinChinawastheShang BronzeAgeCultureof1,700to1,600B.C..HuckerRef.101[146]saystheShangmonarchyemergedfromthe HonanbranchoftheLung-Shan,blackpotterycultureandperhapsbeganasearlyas1,176B.C.Recentexcavations 18 Thiscontentisavailableonlineat. 19 ThistellssomethingabouttheclimateofManchuria,inthatteacannottoleratefrostordrought 20 TragerRef.222[296]saysthericewasbroughtfromtheMohenjo-darocivilizationabout2,300B.C.,butthesourceofthisinformationis notgiven

PAGE 101

89 atLoyangandChengchowdemonstrateprogressivedevelopmentfromLung-ShanintotheevermorematureShang. Thereurbandevelopmentwasabout1,000yearslaterthanthatinMesopotamiaandabout500yearsafterthatinthe Indusvalley,sosomeelementsfromthewestundoubtedlydiffusedtoChina.ThelasttwelveoftheShangkings lived273yearsbeginningabout1,395B.C.intheAn-YangareaatYin-hsutheruinsofYin.Theentiredynastyis sometimescalled"Yin"afterthiscapital.TheShangcitieswerelargeandhadahighorderofbronzetechnologyand horse-drawnchariotsaswellasafullydevelopedChinesewritingsystemandaculturededicatedtowaragainstthe outlying"barbarians".Theirbowshada160poundpullandcouldkillat200yards,aweaponlaterusedbythesteppe nomadsandknowntothewesternersastheTurkishcompoundbow.AlthoughtraditionallytheShangwasdescribed ascontrollingmostofnorthernChina,actuallyitwasprobablyalooseconfederationofclans.TheHuang-Hosociety, ontheYellowRiver,hadanideographicscriptabout1,500B.C.Whereveritappeared,writinginChinaisgenerally admittedtobetheresultofdiffusionfromthewest.Ref.211[284],101[146],8[14],215[290],213[288] AdditionalNotesp.89 5.7.2JAPAN PeopledwithNeolithicsocieties. 5.7.3KOREA ThereisarcheologicalevidenceofpeopleonthispeninsulainaNeolithicsocietyby3,000B.C.Ref.113[161] 5.7.4SOUTHEASTASIA MostofthisareahadpeasantfarmersandhuntinggroupsandweknowthatbronzewasusedveryearlyinThailand. Ironobjectsseemtohavebeenmadethereabout1,600B.C.orevenearlier.Thiswas"wrought"iron,madebyheating oreonlytoabout1,083degreesCentigradeandthenhammeringawaytheslagfromtheironglobules.Ref.8[14], 215[290] WavesofStoneAgepeoplecolonizedtheIndonesianislandsfromthemainland.AnAustronesianpeopleusingLapita potteryappearedintheMoluccasareaofIndonesiasometimeinthisperiod,andtheybegantomigrateslowlyeastward. Fromabout3,000B.C.on,theMalaysinthePhilippineswerejoinedbyamoreadvancedracefromIndonesia.These twopeoplesmerged,buildingupatribalsystemknownasthebarangay.Ref.8[14],175[241] ForwardtoTheFarEast:1500to1000B.C.Section6.7 ChooseDifferentRegion 1.IntrotoEraSection5.1 2.AfricaSection5.2 3.AmericaSection5.9 4.CentralandNorthernAsiaSection5.5 5.EuropeSection5.4 6.TheIndianSubcontinentSection5.6 7.TheNearEastSection5.3 8.PacicSection5.8 NOTE :RecentexcavationsaroundShanghaishowevidenceofanearlyNeolithicSocietyatHemudu,where thepeoplecultivatedriceandhaddomesticateddogs,pigsandwaterbuffaloandlivedinwood-framehouses withplankoors.Theymadesilkandcreatedbaskets.ThiswasbeforetheShangperiod.Ref.314[255]

PAGE 102

90 CHAPTER5.3000TO1500B.C. 5.8ThePacic:3000to1500B.C. 21 5.8.1THEPACIFIC BacktoThePacic:5000to3000B.C.Section4.8 Aboriginaldevelopmentinreligion,politicalandeconomiclifecontinuedinAustralia.ImmigrantsfromIndonesia broughtLapitapotteryintotheMelanesianislandsby2,000B.C.andperhapstoMicronesia,justnorthoftheequator, byabout1,500B.C.Ref.8[14],134[184] ForwardtoThePacic:1500to1000B.C.Section6.8 ChooseDifferentRegion 1.IntrotoEraSection5.1 2.AfricaSection5.2 3.AmericaSection5.9 4.CentralandNorthernAsiaSection5.5 5.EuropeSection5.4 6.TheFarEastSection5.7 7.TheIndianSubcontinentSection5.6 8.TheNearEastSection5.3 5.9America:3000to1500B.C. 22 5.9.1FARNORTHANDCANADA BacktoAmerica:5000to3000B.C.Section4.9 TherewerealwaysmorepeopleontheAleutianIslandsthanonthemainland,becauseofamilderclimate.Nevertheless,from4,000to1,000B.C.anArcticSmallTooltraditionexistedinAlaska,spreadingacrossthearcticpartof CanadatoGreenland,givenitsnamefromtheminiaturebladeslashedtohandlesofboneorwalrusivoryusedfor cuttingandscrapingskins.Thebladeswerechippedfromacoreofchert,arockofmicro-crystallinequartz.These AsiaticpeopleevenmigratedtoEllesmereIslandinnortheasternCanada,lessthan800milesfromtheNorthPole, about2,300B.C.,crossingoverthemountainsinagreatnotch,todayknownasSverdrupPass,totheupperendof BafnBay,whichusuallyhasopenwateratleastinthesummer.Canadianarcheologistshaveexcavatedsomeofthese pre-historicsites,wheretheearliestarenowthirtytothirty-vemetersabovethepresentsealevel,althoughtheywere originallyonthebeach.Asinothernorthernareasoftheglobe,theearth'scrusthasrisenslowlyoverthecenturies aftertheliftingofthegreatweightoftheglacialice.FromEllesmereIslandprogressintonorthernGreenlandover wintericewasnoproblem.Byabout1,500B.C.inBritishColumbiaandWashingtonstatepeopleweresettledin villagesandshedforsalmon,althoughtheydidnotpracticecultivation.Ref.209[282],45[66],189[259] Thisistheeraoftheso-calledRedPaintCulture,withnativeAmerindianStoneAgetraditionsderivedfromold northeasternAsia.TheRedPaintorMooreheadCultureoriginallydescribedfromprehistoricgraveyardsinMaine -thegravescontainingredochrehasnowbeenidentiedaspartofalargermaritimeArchaictraditionextending fromnorthernLabradoratthe60thparalleltosouthernMainebetweenabout2,000and1,500B.C.Thisareawas deglaciatedabout7,000B.C.withtundrathenpresentuntilabout3,000whenspruceforestsnallyappeared.The settlementpatternandlifestylesoftheseRedPaintpeopleseemstohavebeendifferentfromboththeEskimosand theMontagnais-NaskopiIndiansofinlandLabradorandQuebec.Hunting,shing,tradingtoolsandrawmaterialsand buryingtheirdeadweredenableactivities.Therootsofthisculturemayhaveextendedbackseveralthousandyears tothePaleo-Indianhuntersofthenowsubmergedcontinentalshelf.Ref.69[107] 21 Thiscontentisavailableonlineat. 22 Thiscontentisavailableonlineat.

PAGE 103

91 5.9.2THEUNITEDSTATES ThereaderisadvisedtoreviewtheprecedingtwoparagraphsconcerningMaineandWashingtonState.Intheeast theeasternArchaicCulturewaschangingabout2,000B.C.inthattherewasthemanufactureofsomecrudepottery andtherewasanincreasedattentiontoburialobservances.SomecallthisthebeginningoftheWoodlandCultureand otherscallitsimplytheLatePeriodoftheArchaicoftheEasternWoodland.Atthesametime,inthesouthwestern states,specializeddesertculturescontinuedtodevelopfromtheArchaic.Asrecordedinthelastchapter,theCochise begancultivatingcornsometimefrom3,000to2,000B.C.,providingthemextranourishmentfortheiruncertaindiet. SquashnowwasalsobroughtupfromMexicoandtinygardensofbothhavebeenfoundallovertheCochisewandering area.SantaCatalinaIsland,twentymilesofftheCaliforniacoast,aspreviouslynoted,wasinhabitedandsomeforty Indiantownsiteshavebeenidentied.ItisobviousthatcoastalIndianshadfacilitiesforoceantravel.Ref.45[66], 64[94],210[283],187[256] 5.9.3MEXICO,CENTRALAMERICAANDTHECARIBBEAN The"Pre-ClassicAge"ofMiddleAmericatraditionallybeganabout2,000B.C.withMayanancestorsbeingsimple villagefarmers,althoughtheearliestMayacarbondatingontheCaribbeansideofYucatangoesbacktobetween2,750 and2,450B.C.ItisentirelypossibletheMayabeginningsmaygobacktoEcuadorat3,000B.C.whiletheOlmec civilizationbeganseparatelyontheGulfcoastmuchlater.In1977NormanHammondRef.85[126]published resultsofarcheologicalexcavationsinBelizeformerlyBritishHonduraswhichseemtoconrmtheoriginsofthe Mayabackatabout2,600-2,500B.C.Hedescribesalowlandpotterycalled"Swash",foundinburialsiteswith humanskeletons.Theadultsamongthelattershowedadvancedtoothwear,suggestingabrasivesintheirdiet.The Mayasteepedcorninslakedlimebeforeboiling,tosoftenitandincidentallyitreleasedcertainamino-acidsnot otherwiseabsorbableandthislime,alongwithgritderivedinthegrindingprocessprobablyaccountedforthetooth wear.Theseindividualsalsoconstructedraisedearthplatformsinswampsbydiggingoutdrainagechannelsand throwingthemuduptomakeplatformsonwhichvariouscropsweregrown.Thepresenceofjade,notnaturally presentwithin350kilometers,indicatesatradenetwork.TheirSwaseyceramics-colorful,decorativeandmaturearedifferentfromthatofMexicoandthesouthernUnitedStatesof2,500B.C.,butaresimilartoEcuadorianpottery ofthisperiod.ThroughoutCentralAmericamaize-farminghadbecomethebasisoflifeby1,500B.C.andthefarmers livedinpermanentvillages.BythesamedateintheTehuacanValleyofMexico,therewascomplexvillagelife, pottery,elaboratedreligiousritualsandintricatesocialorganization.Cornandpotteryhavebeendatedto2,000B.C. inPanama.Ref.45[66],95[140],85[126],64[94],62[91] 5.9.4SOUTHAMERICA Valdiva,asacoastalsocietyinEcuador,likePanama,hadcornandpotterybyabout2,000B.C. 23 .EvansandMeggers, oftheSmithsonianMuseum,areimpressedwiththesimilaritiesbetweenValdivianpotteryandtheJomonpottery ofJapan,believingEcuadormayhavebeenthelandingplaceofaJapaneseimmigration,thusbringingonemore possibilityofAsiandiffusiontotheAmericas.Weshallexamineotherideasinotherchapters.Potatoeswerecultivated intheAndesby3,000B.C.,maniocwasgrownonthetropicallowlandsandthereweredomesticatedanimalsinSouth Americashortlyafter2,000B.C.CeremonialcentersfoundalongthedesertcoastofPerudatetoaboutthesame timeasdidevidenceofmetalworking.TheAnconYachtsiteonthecoastofPeru,dated2,500to2,000B.C.showed chippedleafpoints,string,turnedclothandbaskets,woodentools,shellshhooksandcultivatedplantswhichincluded gourds,cottonandchilipeppers. ThePeruviansusedthepotatoby3,000andsoondomesticatedtheguineapigforfood.CoastalPeruviansgathered protein-richshellshoffthebeachesby2,800andby2,500B.C.,whenthevillageswerelarge,faroutoceanshing forlargershwascommon.Ref.62[91],45[66],209[282],211[284],222[296] EarlyfarmerswereprobablywellestablishedontheEcuadorianseacoastandriverplainsby3,000B.C.Contactwith Mesoamericawascertainlypossiblebywater,butotherwisetherewasa2,000milejunglestretchbetweenthem.What 23 ThomasRef.213[288]saystheEcuadorianshadpotteryevenearlier,at3,200B.C.

PAGE 104

92 CHAPTER5.3000TO1500B.C. EngelRef.62[91]callsthe"beanplanterssociety"cameintobeinginthelowercentralAndes,alongwithcotton clothesandunderwearatabout2,000B.C.Thebonesofsea-lionsaremixedwiththoseoftheseearlyagriculturalists. ExcavationsinVenezuela,likeadjacentareas,showevidenceofmaniocandsweetpotatocultivationfrombetween 3,000and2,700B.C.Bothofthesearerootcrops,butmaniocrequiredspecialpreparationtobemadepalatable.Ref. 95[140],62[91],209[282] ForwardtoAmerica:1500to1000B.C.Section6.9

PAGE 105

Chapter6 1500to1000B.C. 6.11500to1000B.C. 1 6.1.1CHAPTER515THTHROUGH11THCENTURYB.C. Backwardto3000to1500B.C.Section5.1,500TO1,000B.C. LiteracyinthiserawasconnedentirelytotheNearEast,Greece,Egypt,theIndusValleyandChina.TheSumerian cuneiform,carriedatrstbyAssyriantraders,wasadaptedtoHittite,LuvianandHattitelanguagesinAsiaMinor, anditwassoonalsousedbyAmorites,HurriansandMitanni.Finallythepharaohsofthe18thdynastyinEgypt conductedtheirforeignaffairsincuneiformandintheAkkadianlanguageratherthanintheirnativehieroglyphics. Theopensyllabarywhichhadmadeitsappearancebythe16thcenturyB.C.nowwasfollowedbytheconsonantal alphabet.Insomeareasthismayhaveactuallyprecededtheopensyllabary.Thiswasalsoaperiodofmilitarized, barbarianassaultsagainstthecivilizationcentersofEurope,themiddleEast,IndiaandChina.Chariotwarfaregave extraimpetustothebarbarianadvanceandtheirinvasionsincreasedinthewesternworldafter1,200B.C.Ref.136 [187]AdditionalNotesp.93 NOTE :Diffusionofiron-workingskillswiththeconsequentuseofshieldsandhelmetstoprotectagainst charioteers'arrows,facilitatedthenewroundofinvasionsandmigrationsbetween1200and1000B.C.Thus Hebrews,Persians,Doriansandothersenteredthescene.Ref.279[191] Forwardto1000to700B.C.Section7.1 ChooseDifferentRegion 1.AfricaSection6.2 2.AmericaSection6.9 3.CentralandNorthernAsiaSection6.5 4.EuropeSection6.4 5.TheFarEastSection6.7 6.TheIndianSubcontinentSection6.6 7.TheNearEastSection6.3 8.PacicSection6.8 1 Thiscontentisavailableonlineat. 93

PAGE 106

94 CHAPTER6.1500TO1000B.C. 6.2Africa:1500to1000B.C. 2 6.2.1NORTHEASTAFRICA BacktoAfrica:3000to1500B.C.Section5.2 ThestoryofNortheastAfricainthisperiodisessentiallythatofEgyptwithlittlechangeoccurringintheadjacent regions,exceptforCushorKush.AftertheoverthrowoftheforeignHyksosrulerslocalcontrolwasresumedwithin theestablishmentoftheNewKingdomoftheEgyptianEmpire,withthegreatpharaoh,ThutmoseIII,takingoverpart ofthecoastoftheNearEastandbringingEgyptincontactwithothercultures.HeeventookaninterestinAsiatic oraandfaunaandbroughtspecimenshome.ExtensivecommercialtiesresultedinimportsofCretanwares,Syrian amphoraeandAfricangold,ebony,ivory,hidesandexoticanimals.Atabout1,500B.C.theEgyptianshadpushed southtobecomethemastersofKush,"toprotecttheirsecurity"andincidentallytoobtaingold.TheKushites,who mayhavedescendedfromC-groupCaucasoids,becameincreasinglyEgyptianized.Ref.83[123]Thegreatest geographicalexpansion,however,wasreachedunderAmenhotepIII,about1,390B.C.Thisrulerhadhislikeness constructedintwocolossalstatuesacrosstheNilefromLuxor,bytransportinghugepiecesofquartzite 3 somefour hundredmilesfromaquarrydownstreamontheNile.Recentscienticresearch,identifyingtherock,wouldindicate thatthetransporthadtohavebeenaccomplishedonaspeciallybuiltlighterdrawnupstreambyoarsandgangsof draggersonthebanks.AboutacenturyearliersuchagreatbargewasengravedonthewallsofthetempleofQueen HatshepsutatDeir-el-Bahri.Ref.231[308],90[134] NOTE:InsertIllustrationpage103 AmenhotepIVallowedsomepoliticaldecline,but,changinghisnametoAkhnatonorIkhnatonheattemptedtoforce anew,strictlymonotheisticreligionontheEgyptianpeople,butthenewfaithdidnotlastlong.Tutenkhamonruledin 1,355andRamesesII,whoexhaustedhisresourcesinwarsagainsttheHittitesandthenmarriedanHittiteprincess, ruledabout1,250B.C.HebuilttherstSuezCanal,atasknottoodifcultthen,astheseawashigherthanatpresent. AvictoryinscriptionofPharaohMerneptahabout1,224-1,214B.C.mentionstheHebrews,andthismayhavebeen whenMosesledtheHebrewsbacktoPalestine.After1,165EgyptlostallterritorybeyondtheNilevalleyitself.In theearlypartofthisperiodundertheRamessidkingsoftheXXdynasty,thedominantreligionhadreturnedtothe worshipoftheSunGodReandAmon,butgraduallytheOsirianchurchbegantotakeoveramongthemajorityofthe people.ThisinvolvedtheworshipoftheGodOsirisandhissister-wife,thenatureGoddessIsisandtheirinfantson, Horus.Themysteriesofthisreligion,includingthedeathandresurrectionofOsirisandtheinterpretationofIsisas the"MotherofGod"spreadthroughouttheNearEastinthenextmanycenturies,andeventuallyservedatonetimeas bothamodelandarivalforChristianity,persistingwelluptothe6thcenturyC.E.However,atabout1,100B.C.the highpriestofAmontookoverthethroneandtheempirebecameastagnanttheocracy.EvenKushwasabletoregain itsindependence.Invasionsof"Seapeoples"-mixedarmiesofCretansandLuvians,perhaps-probablycontributed toEgyptiandecline.Ref.[48],46[76],38[59],8[14],224[299] ThegloryofEgyptiansciencewasmedicine.Publicsanitationwaspromotedandallwerecircumcisedandtaughtto useenemasascleansingprocedures.Theyusedglass,linen,paperandink,thecalendarandwaterclock,geometry andanalphabet.Theempirehadapeaceful,internalgovernmentwitharegularcensusandpost,bothprimaryand secondaryeducationforsomeandtechnicaltrainingschoolsforadministrators.Wheeledvehicleswerecommon,and theyutilizedbronzeandsuchtoolsasblacksmithbellows.TheNilevalleylackedironoressotheEgyptianswere limitedintheuseofthenewmilitarytechnologythatappearedinadjacentregionslateinthisperiod.Indynastic Egyptthebasicdietofthepeasantconsistedofbread,beerandonions,therstbeingaatbreadcalled"ta",but noblesandpriestscouldchoosefromsomefortytypesofbreadsandpastries. ChickenswereavailableandlatertheNilemarshessuppliedeel,mullet,carpandperch,andsomeoftheseshes, driedandsalted,wereexportedtoSyriaandPalestine.Ref.136[187],211[284] 2 Thiscontentisavailableonlineat. 3 Thepedestalblockswitheachstatuemadeatotalweightof720metrictonseachRef.90[134]

PAGE 107

95 6.2.2NORTHCENTRALANDNORTHWESTAFRICA NeolithicBerberscontinuedtoliveinNorthAfrica.ThepopulationofLibyawasaddedtobyAnatolianSeaPeople, perhapsCretansand/orLuvians,whoattackedEgyptabout1,400B.C.andthencolonizedLibya.Manyofthese invaderswerelateremployedintheEgyptiannavy.Herodotus,Plinyandotherancientwriters,describedapeople called"Garamantes"wholivedinpresentdayFezzanmilesnortheastofTimbuktuandwhotraveledintwowheeledchariotsdrawnbyhorses.Rockengravingsinthisareahaveconrmedthis.WeretheypartoftheSea Peoples?SomesaytheTauregsaretheirdescendants.DenitelyamongtheSeaPeoplewereShardanaorSherden whocarriedroundshields,broadswordsandwhoworefeatheredwar-bonnets.Phoenicianimmigrantssettledin Moroccoabout1,100B.C.andtheseareaslaterbecamepartoftheCarthaginianEmpire. ThiswasconrmedbytheGreekhistorian,Procopius,whowrotethatthisPhoenicianmigrationcameatthetimeof KingDavid'sHebrewwars.Ref.65[96],176[242],66[97],175[241] TheCanaryIslandsintheAtlanticjustoffthecoastofnorthwestAfricawereinhabitedbeforetheknownarrival ofEuropeansbytheGuanche,whowereamixedCaucasoidandNegroidpeople,varyingsomewhatfromislandto island,withblondandbeardedmenlivingnexttodark-skinned,clearlyNegroidindividuals.Thishasbeenconrmed bothbyearlydescriptionsandbymummiesfoundontheislands.The"CanaryCurrent"isastrong,westwardowing AtlanticoceancurrentgoingstraightfromtheseCanaryIslandstotheCaribbeanSeaandthebaseoftheYucatan peninsula.ItisofgreatinterestthattheOlmecs,livingatthewesternendofthisCanarycurrentinAmericaatthisera, wereidenticalphysicallywiththoseGuancheoftheCanaries.ThedistancefromtheseislandstoMiddleAmericais equaltothatfromAsiaMinortotheislands,buttheformertripisinnitelyfasterandsimpleronanything,suchasa reed-boatorevenaraft.Ref.95[140] 6.2.3SUBSAHARANAFRICA NegrofarmersinhabitedtheSudanicbeltandtheirpopulationcontinuedtoincreaseasfruits,vegetablesandcereals werecultivatedintheforestzone.Ghana,inwestAfrica,haddomesticcattleandgoatsby1,500B.C.Therewas alsopottery,stoneaxes,shalearm-ringsandnestonepoints,whoseuseisunknown.InsouthernMauretania,onthe southernfringeoftheSahara,excavationsatDarTichitthaverevealedtheso-calledNaghesphase,datedfrom1,200 to1,000B.C.andshowingcircularcompoundswithevidenceofcattleandgoatherding,shingandsomehunting. Thepeoplehadstoneaxes,arrowheads,gouges,andpottery.IncentralandsouthernAfricanomadicblackBushmen livedintheStoneAge.Ref.8[14],45[66] By1,000B.C.additionalCaucasoidgroupscalled"Azanians"broughtcattleandcerealstojointhepreviouslysettled darkwhitesintheKenyahighlandandadjoiningnorthernTanzania.Theyleftstoneburialchambers,hutcircles, terracedelds,roadsandtracesofirrigation.BytraditiontheAzaniansweretall,beardedandred-skinned.Inlater centuriesthesepeoplewereabsorbedbytheNilo-HamitesandtheBantuNegroids.Ref.83[123] ForwardtoAfrica:1000to700B.C.Section7.2 6.3TheNearEast:1500to1000B.C. 4 6.3.1THEARABIANPENINSULA BacktoTheNearEast:3000to1500B.C.Section5.3 ThereweremultiplenomadictribesintheArabianPeninsulaandverydryareaswereopenedforsettlementbytheuse oflimeplasterforwatertightcisterns.InpresentdayJordan,AmmonbecamethecapitaloftheAmmonitetribeand legendhasitthatthiscitywasconqueredbytheJudeanKingDavid.TheAramic-speakingArameanslivedprimarily aroundPalmyraandwiththeircamelstheybegantoattackthe"fertilecrescent"tothenorthandeast.Atabout1,000 4 Thiscontentisavailableonlineat.

PAGE 108

96 CHAPTER6.1500TO1000B.C. B.C.theybegantomigrateeasttoBabylonia,northtowardAsiaMinorandwesttoDamascus.Theirrelatives,the Chaldeans,begantoemergefromcentralArabiaandalsostartedtowardBabylon,andmoreparticularlytowardUr,in Sumer.Ref.8[14] 6.3.2MEDITERRANEANCOASTALAREASOFISRAELANDLEBANON About1,500B.C.anentirelynewtypeofwritingwasrecordedforthersttime,intheSinaiPeninsula.Thiswas analphabetinwhicheachsignrepresentedoneconsonant.ItsoonspreadamongthePhoeniciansandotherSemites onthecoast.Althoughoriginallywritteninacuneiform,thePhoenicianslaterreplaceditwithletterswhichcouldbe writtenfasteronpaper.Thederivationofvariousmid-easternscriptsisasfollows:Note:Insertchartfromp107 PeoplesofSemiticspeechoccupiedPalestineinsuccessivewaves,includingAmorites,Hebrews,IsraelitesandArabs. Egypt,underThutmosesIII,conqueredPalestinein1,479B.C.andcontrolledtheareaalmostcontinuouslythereafter inthisperiodunderreview.Thisisprobablythetimeofthe"Exodus"oftheJewsfromEgyptbacktothe"Promised Land"inthevicinityofPalestine.Thetruehistoryoftheirlongmigrationbackandthetrialsandtribulationswithother tribesalongthewayandintheregionsofJudeaandPalestinearemixedwithlegendandmythintheOldTestament, whichwaswrittenmuchlater.SaulbecametherstkingoftheJewsin1,025B.C.andsupposedlyDavidbecame kingin1,010B.C.UnfortunatelythereisnocontemporarymentionofthisinanyliteratureexcepttheBibleandthe laterGreekhistorian,Procopius.ThroughoutthiseratheJewsweredominatedbythePhilistineswhowereprobably refugeesfromthecollapsingCretancivilization,orwereLuvians,orboth.Inonebattle,datedat1,141B.C.byTrager Ref.222[296],theIsraeliteslost4,000menandlaterlostanother30,000.ThePhilistineinvasionwasapartofthe SeaPeoplesraidswhichplaguedtheentireMediterraneancoastatthatperiod.Ref.88[131]AdditionalNotesp. 98 ThePhoenicians,asapeople,cannotbedifferentiatedfromthegeneralmassofCanaanitesuntilsometimeinthis 2ndhalfofthe2ndmillenniumB.C.,butby1,200theyhadliberatedthemselvesfromEgyptiandominationandthey soonbecamethetruemastersoftheMediterraneanseaways,sailingtoItaly,Spainandallalongthecoastofnorth Africa.TheymayevenhavesailedaroundthecontinentofAfrica.PresentdayBeirut,however,wasstillsubjectto theAmoritesatthattime.Theimportanceoftheiralphabeticscriptisindicatedinthechartabove. 6.3.3IRAQANDSYRIA Babylonia,onthelowertwo-thirdsoftheTigrisandEuphrates,remainedthroughoutthesevehundredyearschiey underKassiteruleandtherewaslittleprogressincivilizationexceptduringthereignoftheKassiteking,Kurigalzu II,whowasagreatbuilder.Heconstructedinnumerablemonuments,notonlyinUr,butinothersoutherncities.No oneknowsthereasonforthissuddenspurtofindustry,butthegrowingsignsofstrengthinneighboringAssyriaand MitanniandintheareaoftheHittitesmayhavebeenafactor.UnfortunatelynoneoftheKassitemonumentswere particularlyartistic.Asmentionedinthelastchapter,thesepeoplewereprobablyamixedbodyofwarriorswithat leasttwolinguisticelements,anoriginalCaucasianandanIndo-European.TheKassiteswereoverthrownbyraiding Elamitesin1,157B.C.andthepreviouslygreatcityofUrthensankintoobscurityforatleastthreeorfourcenturies. Ref.238[318] TothenorthandwestofBabylonia,proper,theAssyrianswereaccumulatinginanincreasingnumberofcity-states,at rstjustintheareaimmediatelyaroundNineveh,Memrud,ArbilandAsher.In1,244B.C.,however,Tukulti-Ninurta tookoveragreatdealofoldBabylonandapparentlycontestedwiththeKassitesformostofMesopotamia,sothat

PAGE 109

97 thelatterweresqueezedbetweentheseinvadersandtheraidingElamitesfromtheeast.By1,115B.C.theAssyrian Tiglath-PileserIhadlostsometerritoryonthelowerTigrisbuthadgainedaprecariouscorridortotheMediterranean northofDamascus,betweenArwadandSidon. NOTE:InsertIllustration-MapReference97 Upto1,380B.C.variousMitannianlordshadbeendominantinthatarea,butafterShalmaneserIunitedtheAssyrian statesunderonecentralrule,theMitannianswerekeptinasmallkingdomjusttothewestofAssyria.TheAssyrians wereamixtureofwarriorSemitesfromthesouth,non-SemitictribesofHittiteand/orMittanianoriginfromthewest andKurdsfromtheCaucasus.TheyusedacommonlanguagetakenfromSumer,butmodiedittopracticalsimilarity withBabylonian.Multiplelanguagespersisted,however,makingworkdifcultforthescribes,sothatthoseofUgarit 5 nallyreducedtherepertoryofsignsfortheirownlanguagedowntothirty. Priorto1,250B.C.therehadbeenagreatstruggleforcontroloftheAssyrianlands,whichwasthesameareathat hasbeenknownwithvariationsinitsborders,throughouthistorychieyasSyria,includingthecitiesofByblosand Damascus.ThestruggleforcontrolbyEgypt,theHittites,theUgarits,BabyloniansandMitannis,allusingessentially theBabylonianlanguageandchariotry,occurredbecauseSyriawasthejunctionforalltraderoutesbetweentheEast, AsiaMinor,theAegeanandEgypt.From1,500to1,400 B.C.theMitanniintermittentlycontrolledallnorthSyriaandCiliciabutfrom1,380to1,346theHittitescutthemoff anddominatedtheregion.After1,200B.C.therewerewavesofbarbarianinvasionswhichincludedtheHebrews, PhilistinesandArameans,aswellastheSeaPeople,ChaldeansandMedes.Bythe12thcenturyB.C.thedominant peopleinSyriaweretheArameans,whobecamethegreatestinlandtradersandwhoselanguagebecametheparamount commercialtongue.Damascus,attheendofthemajorcaravanrouteacrossthedesert,becamethemostimportant cityoftheregion.Ref.8[14],118[95],28[48] 6.3.4IRAN:PERSIA InthenorthernandwesternpartsofPersia,culturaltraditionswerebrokenabout1,300B.C.withtheappearance ofmonochrome,polishedpotteryalongwiththedenitiveIronAge,andthearrivalfromthenortheastoftheIndoEuropeanlanguages,astheMedesandPersiansmigrateddownfromareasofcentralAsia.Inthesouthwest,Elam continuedasamoreorlessindependentstatewithahighculturallevelwhichreacheditsheightfrom1,300to1,100 B.C.,reachingaspecialpeakunderUntash-Gal.Thelargestsurvivingzigguratintheworld,some170feethighwith velevels,isatTchogaZanbil,someeighteenmilesfromSusa,theancientcapitalofElam.Inthemiddleofthe 12thcenturyB.C.ElamhadabriefexpansionintotheDujalaareaandeasternAssyriaoldMesopotamia,whenthe leaderswereprobablyseekingtogaincontroloftheZagrostraderoutes.TheElamiteshadaglasstechnologyandcast bronze.Ref.18[31],18[31],176[242],8[14] 6.3.5ASIAMINOR:ANATOLIA ThefamousTrojanWar,formerlyconsideredonlyanHomerianlegend,probablyactuallyoccurredabout1,200B.C. withAgamemnonleadingtheMyceneanGreekforcesagainstTroy.HomersaidthattheThracians,ledbyKing Rhesus,cametotheTrojans'aid,anditisknownthatatthattimetheMycenaeansdidassumepoweroverallthe easternMediterranean.HittiteandEgyptianchroniclesseemtoconrmthis.FartherinlandtheHittites,undertheir greatestking,ShubbiluliualsoSuppiluliumasreconqueredcentralAnatoliaandnorthernSyriaandreducedthe Mitannitoasmallvassalkingdombyabout1,350B.C.andallnorthSyriawasundertheircontrolby1,340.In1,250 theyforcedRamsesIIofEgypttoacknowledgetheirkingashisequal.Carchemish,inSyria,wasoneofthemore importantofthesmallerHittitestates,andthepeopleweretheHittitesmentionedintheBible.Atthattime,whatlittle ironwasavailableintheworldwasintheHittiteAnatoliankingdom,butitwasworthfortytimesitsweightinsilver. Infact,itissaidthattheChalybes,asub-tribeoftheHittites,evenmadesteelbarsbyabout1,400B.C.,usingthemin 5 Ugarit,ontheSyriancoast,wasthegreatCanaanitecapital.ExcavatedbytheFrenchin1921,thecityisthoughttohavecontainedabout 10,000peoplewithahighlydevelopedsanitationsystem.Ithadalibraryofcuneiformtablets.Ref.115[163]

PAGE 110

98 CHAPTER6.1500TO1000B.C. limitedquantitiesforknivesandswords.Ref.213[288],page282TheHittitelanguageistheearliestdocumented IndoEuropeantongueandwaswrittenusuallyincuneiformscriptborrowedfromMesopotamiaabout1,500B.C. Thecapitalcity,Hattusas,wasprotectedbyamassive,drystonewallthreeandthree-quartersmilesaround.Someof thestoneswereaslargeastwenty-sixbytwentyfeet.Whenthiscapitalwasmysteriouslysackedabout1,190B.C., thebrickhousesofHattusesweresubjectedtosuchintenseheatthatthebricksfused.Itshouldberealizedthatthe HittiteshadaccesstothesameLebanesecedarforestsasthePhoeniciansandthattheybuiltelaboratewoodenships evenbeforethelatter.AncientHittitesealsindicatethattheyalsobuiltreedships.Remarkableconformitiesexist ifonecomparestheearlyHittitecivilizationandtheearlyOlmeccivilizationatLaVenta,Mexico.Thesimilarities includemotifsandtechniqueofhighlyspecializedceramicefgyjars,stonestatueswithinlaidshellandobsidian eyes,adobemounds,asolardeitysculptedwithafeathercrownandabodyhalfserpentandhalfbirdplumedserpent andsomehieroglyphics-completelydifferentfromothermiddleeasternscripts.Ref.45[66],136[187],215 [290],95[140] Attheendofthe13thandinthe12thcenturyB.C.partoftheHittiteterritorywastakenoverbytheupsurgingSea Peopleandinthe11thcentury,theAssyrianstookovertherest,sothattheHittitecivilization,assuch,diedoutorwas absorbedinthenextfewhundredsofyears.PhrygeaninvadersfromThrace,andLuvians,mayhaveplayedamajor partinthisdestructionoftheHittiteEmpire.Asthepoliticalentitycollapsed,however,theseironsmithsofAnatolia thenspreadfarandwide,takingtheirironweaponswiththemsothattheircultureactuallysurvivedinneo-Hittite kingdoms,particularlyinnorthSyrianearCarchemish.Ref.45[66] Stillfarthereast,inUrartu,alsoknownastheKingdomofVanandlaterasArmenia,theHurrianandVannicpeoples relatedtotheMitanniwhoselanguageswererelatedcontinuedtheirownhighlevelcivilization. NOTE :JemmehwasapartoftheNewKingdomofEgyptandbetween1450and1200B.C.wasoccupiedby Canaanites.Thecityhadaverylargehouseorpalacemeasuring19.2metersby16.5meters,withapaved courtyard.TherewasalargeamountofimportedpotteryfromMycenaea,GreeceandCyprus.Whenthe SeaPeoplesarrived,theyactuallyoccupiedandsettledmanycoastaltowns,includingAshdod,Ashkelon, Gaza,EkronandGath.Ref.295[300] ForwardtoTheNearEast:1000to700B.C.Section7.3 ChooseDifferentRegion 1.IntrotoEraSection6.1 2.AfricaSection6.2 3.AmericaSection6.9 4.CentralandNorthernAsiaSection6.5 5.EuropeSection6.4 6.TheFarEastSection6.7 7.TheIndianSubcontinentSection6.6 8.PacicSection6.8 6.4Europe:1500to1000B.C. 6 6.4.1SOUTHERNEUROPE BacktoEurope3000to1500B.C.Section5.4 6 Thiscontentisavailableonlineat.

PAGE 111

99 TheCretancivilizationendedwithintherstftyyearsofthistimeperiodbuttheexactnatureandcauseofthe destructionisnotknown.SyridonMarinatos,lateInspectorGeneralofAntiguitiesofGreece,believedthatCretewas destroyedbyatremendousvolcanicactioninThera,theislandknownancientlyasKallisteandlateralsoasSartorini. ThislasteruptionoftheTheravolcanowasfollowedbymassivetidalwavesastheislandcentercollapsed,andthese wavessurgedoutwardperhaps650feethighatprobablytwohundredmilesanhour,dealingthesettlementsofCrete apulverizingblow.Theashwascarriedasfaras1600miles,killingvegetationandchokingharbors.Theforceofthis volcanicexplosionhasbeenequatedwiththatof500to1,000atomicbombs.TheashfalloutplungedtheAegeanSea areaintonightforweeks.TotaldepositsoftheashontheremnantofTheraarestilltwohundredfeetdeepandthe sameashhasbeenfoundrecentlytobealayersevenfeetthicksome9,850feetdeepontheooroftheMediterranean Sea,87milesfromthevolcano.ScandinavianscholarsdatethistremendousupheavaloftheMediterraneanworld aslateas1,200B.C.andfeelthattheSeaPeoplewhoroamedtheMediterranean,raidingthecoastsofAsiaMinor andEgyptweredisplacedpeoplesfromislandandothercoastalcivilizationsdestroyedinthisgreatcataclysm.The periodislikenedbyHeyerdahlRef.95[140]towhathehasdescribedasasimilargreatunknowntumultofjust before3,000B.C.ThereisnodoubtbutthattheblastcompletelychangedtheMediterranean,whetheritcompletely destroyedCreteorweakeneditforsubsequentinvasionbyMycenaeans,orwhatnot.TheTheraexplosionwasfour timesgreaterthantheA.D.1,883Javaeruptionthattook36,000livesandspreadacloudofasharoundtheearth'Ref. 129[179],176[242],109[155] ArgumentsstillgoonabouttheactualdatingofthegreatTheraincident,somerecentrevisionsofradio-carbon datingsindicatingthatitoccurredabout1,600B.C.andthuscouldnothavehaddirectbearingontheCretandemise. Regardless,thereisnodoubtthatevenbeforeitsnalend,Cretehadbeensubjectedtodevastatingattacksinits islandterritoriesbythePhoenicians,newmastersoftheMediterranean,andtoattacksathomebytheMycenaean, "barbarian"Greeks.Thelatter,perhapssimplyfollowingtheirownwarlikeinstinctsforplunder,denitelycame ashoreonCrete,atleastlater,andlefttheirmarks,destroyingwhateverremainedofallthepalacesexceptKnossos, whichtheyusedfortheirowncapital.TheMycenaeanrulerswrotetheirlanguageinLinearBwhichhasnowbeenat leastpartiallydecipheredandappearstobeaformofancientGreek.By1,375B.C.evenKnossoswasburnedtothe groundandwhetherthiswasdonebyrebelling,remnantMinoansorsquabblingMycenaeanschiefs,nooneknows. AdisastrousexpeditiontoSicilyhadbeenundertakenataboutthattime,anditsfailuremayhaveledtothefallof theKnossoslords.Stillanotherview,however,isthatKnossosremainedfunctionaluntil1,150B.C.whenitfellto invadingDorianGreeks.Ref.188[257]ThelastvestigesoftheCretanorMinoancivilizationintheircolonies alongthecoastofAsiaMinorwerealsodestroyedatastilllaterperiodbyIonianGreekswhothenmadetheirown settlementsthere.RemnantsorrefugeesfromtheCretansocietyaresaidtohaveedtothePalestinecoast,wherethey becameknownasPhilistines 7 TheTheravolcanowasnottheonlycataclysmicoccurrenceofthisperiod.Therewereearthquakesalloverthe MediterraneanandevennorthernEuropewhilevolcanoeseruptedinItalyandtheSinaiandseismictidalwaves "causedtheseatorecedefromthelandandevensuckedouttherivers" 8 .After1,100B.C.theDorianGreeks,who hadchargeddowntheGreekpeninsula,crossedovertoCretetorepopulateitandbecometheancestorsofitspresent population.Ref.127[176]RhodeswasalsocolonizedbyDoriansfromArgosinthe11thcenturyB.C.Ref.38 [59] MycenaeanpowerwasdominantintheMediterraneanatleastafter1,400B.C. 9 andtheirpotterywaspopularfrom ItalytotheTurkishcoast.Theyusedmanyslaves,especiallywomenwhowereusedinthetextileandbronzeindustries, aswellasinprivatehouseholds.Somewerecapturedinwar,manywerebought.Houseshadushinglavatoriesand bathroomssuppliedwithterracottapipesandslopinggutters.Ref.213[288]Inthe14thcenturyB.C.agiant 7 McEvedyRef.136[187]saysthatsomerefugeeAchaeansmayhavebeenwiththeCretansasthey"transformed"intoPhilistines,asthere arecloseparallelsbetweenPhilistineandMycenaeanpottery. 8 HermRef.91[135],page87 9 GrantRef.75[115]writesthattheMycenaeancivilizationstartedat1,700B.C.

PAGE 112

100 CHAPTER6.1500TO1000B.C. moundcoveringastonetombwasconstructedatMycenaewhichwas48feetindiameter,43feethightothetipofthe domeandhadadoorwaytoppedwithalintelmadeofa100tonstone. Ataboutthe13thcenturyB.C.attheheightoftheirpowerandwhentheMycenaeanscontrolledtheAegeanworld, theysuddenlybegantofortifyalltheircitiesandstrengthentheirdefences,indicatingapremonitionofdisaster.Other GreekspeakingtribeshadbeguntodriftdownintotheGreekpeninsulabyabout1,500B.C.butitwasnotuntilabout 1,300thattheyweresufcientlystrongtobegintousurptheMycenaeanpower,sothatbytheendofthatcentury theMycenaeancitiesandfortresseswereinruins,theartdegeneratedandthewrittenlanguageLinearBhadbeen forgotten.Ref.215[290],176[242]1,250B.C.isusuallygivenasthetraditionaldateoftheTrojanWar,with completecollapseofMycenaeaby1,200,butCotterellRef.41[62]givesthelatterdateas1,150B.C. Therewerethreemaintribesofthenew,invadingGreeks,eachwithitsownvariationoftheGreeklanguage-lonic, AeolicandDoric.TheDorians,descendingfromtheupperBalkansabout1,200B.C.aregenerallycreditedwith theactualdestructionoftheMycenaeanKingdom.Theytookthebestlandswiththelessfavoredregionslefttothe othertribes.AtticabecameIonian,alongwithagroupofcitiesacrosstheAegeaninthecentralsectionoftheAsia Minorcoast,andfromthesepeoplecamethemasterinstitutionofGreekcivilization,thatis,thepolis.Physicallythe polisconsistedofatownorcitywithanareaoffarmandpasturelandsurroundingit.Politicallyitwasacommunity governedbymagistratesandlaws.AlloftheinvadingwarriorshadancestraltieswithcentralAsianomadsandstill livedasimilarlife,eatingsheep,goatandwildhog.Stillanothertribe,theThessalians,enteredGreeceintheprovince whichnowcarriestheirname,sometimebefore1,000B.C.Ref.215[290],136[187],211[284] Thrace,intheareaofpresentBulgariaandacornerofpresentGreecealongwithEuropeanTurkey,beganalively periodwithidentiablerulersandIndo-Europeangods,atabout1,500B.C.Thiscountryhadtwocoasts-oneonthe AegeanandtheotheronacorneroftheBlackSea-andthuswasatthecross-roadofWestandEast.TheThracians wereformidablehorsemenwithatasteforbattle,banditryandelegantgoldobjects.Theirgoldsmithswereproducing masterpiecesinthe13thand12thcenturiesB.C.OneofthelargestgoldndsofEurope'sBronzeAgecomesfrom Vulchitrun,Bulgariaanddatestothisperiod,withmanyresemblancestotheartofMycenaea.Theydidnothave awrittenlanguageandknowledgeofthemhascomechieythroughtheirGreekneighborsandrecentBulgarian excavations.ThiswasthehomelandofthePhrygeans,whobeganatthistimetospreadtoAsiaMinor.Ref.171 Asnotedinthelastchapter,before1,200B.C.Italywasinhabitedbyathinlyscattered,backwardpopulationofdark whitesoftheIberianorMediterraneanrace.ThenmigratingAryanItalicsmoveddown,certainlybytheendofthis period,at1,000B.C.,settledmostofnorthernandeasternItaly,intermarriedwiththenativesandestablishedthe ItaliangroupsofAryanlanguages.ThisincludedtheLatintribesouthandeastoftheTiber,andtheUmbriansand theSabines.Theselatter,livingnearVillanova,mayhavebeentherstEuropeanstolearntheuseofiron.Extreme northernItaly,aswellastheMediterraneancoastsofFranceandpartofSpain,wasoriginallypeopledbyanonEuropeanspeakinggroupcalledLigurians.TheywereapparentlypushednorthbytheItalics,wheretheycamein contactwithearlyCeltssothatabout1,200B.C.thisLigurianculturewasabsorbedintotheCelto-ltalicApennineD andthepeoplegaveuptheirownlanguagetotakeontheCeltic-Ptongue.Subsequentlytheywerereferredtobysome EuropeanhistoriansasCelto-Ligurians.TheysoonadoptedthecremationritualsoftheUrneldCulture.TheItalics atthetoeofItalypushedtheSiclestowardSicily,whichwasinhabitedatthetimebytheSicantribe,ofunknown originandlanguage.InEtruria,ofcentralItalybetweentheTiberandtheArno,therewasaBronzeAgeCulture calledApennineandtherewasanabundanceofcopperandsometinforthemakingofbronze.Copperfromtheisland ofElbawasusedthroughoutthe2ndmillenniumB.C.SouthItalybegantoreceivecontactsfromMycenaeanGreece asearlyas1,300B.C.,particularlyontheislandofPithecusaeonthewest,andVivaraandLipara,andbythe13th centuryB.C.Mycenaeanimportswerealreadycommon.Ref.136[187],75[115] ForhundredsofyearsthepeacefulfarmersofCorsicahadburiedtheirdeadingreatstonechamberswithnearby single,standingmenhirswhichwereroughly-shaped,unadorned,raisedstones,andsomesevenfeethigh.After1,500

PAGE 113

101 B.C.therewasadramaticchangeandthesemenhirsbecamedistinctsculptureswithcarvedheads,tunics,daggersand swords.Whethertheyrepresentedwartrophiesormemorialstoacourageousenemyisstilldebatable.Ataboutthis sametime,oratleastbetweenthe14thandthe12thcenturiesB.C.,atribeoftheSeaPeople,theShardana,cameby wayofLibyaacrosstheMediterraneanandoverranthesouthernpartofCorsica,pushingtheremnantsoftheoriginal Corsicansnorth,andby1,000B.C.thelatterhaddisappeared.TheconqueringShardanaburnedtheirdeadanddid notputupmonuments.Ref.176[242] 6.4.2CENTRALEUROPE Inthistime-frameanIndo-Europeanspeaking,tall,blondepeopleemergedasaconfederationoftribesfromaprehistoriccomplexandbegantoinhabitthebulkofEurope,spreadingoutfroma"nest"aroundtherichoreeldsof BohemiaandthecentralGermanmountains.CalledUnetice,thedistinguishingfeatureofthisBohemian-centralGermancultureupuntilabout1,500B.C.wastheburialmound,butby1,300theyhadgiventhisupinfavorofcremation withtheashesofthedeadplacedinurnsincemeteries,andthusbecomingknownastheUrneldCulture.Thisbecame thecustomoflaterpeoples,includingtheItalics,VenetiansandIllyrians.,anditmayalsohavebeenthecradleofthe threelinguisticvariationsof"OldIndo-European"andpossiblyalsothatofthePhrygiansandArmenianswhosettled inAnatoliaabout1,200B.C.Allofthesepeoplewerefarmers,notmuchinclinedtovillagelife,raisinganimals,hunting,sacricingtosun-gods,usingthebattleaxeandbothtwoandfourwheeledchariots.Peoplelatertobeidentied astrueCeltshadprobablynotbecomedifferentiatedatthistime,althoughthereismuchconfusionintheliterature onthispoint,andmanywouldcalltheearlywavesofIndo-EuropeansoftheUrneldCulturebythisname.Ref.91 [135] Itisprobablethatafter1,220B.C.theScandinavianbranchesoftheoldIndo-Europeanpeopleswhichhadmigrated southafterthecatastropheswhichseemtohaveoccurredthereinthe15thcenturySeeSCANDINAVIA,thischapter, reachedcentralEuropeandspreadwiththelocalpeopleinvariousdirections-sometotheApenninepeninsulatobecometheAmbrones,laterUmbrians-somedrovetheVenetitonorthernItalyandtheforefathersoftheIllyriansto Yugoslavia,andthePhrygiansandArmenianstoAnatoliaandnallysomewenttoGreece.Inthefarnorthofthe continentproper,theThuringiansGermanizednorthGermanyandtheGoths,Burgundians,AlemansandMarcomans preparedtomovewestastheLausitzSlavsmovedinbehindthem.Ref.194[266],91[135] 6.4.3WESTERNEUROPE Itwasinthe12thcenturyB.C.thatPhoeniciansfromSidonrstsettledonthecoastofSpain,buildingalighthouse atLaCorunatobeusedasaguidefortheirshipsgoingtoEnglandfortin.Soonafter,otherPhoeniciansfromTyre establishedtradingpostsalongtheGuadalquiverRiverandnallyfoundedCadizabout1,100B.C.Ref.196[269] AtthisperiodSpainhadabasicpopulationofdarkwhiteswhomayhavebeentheancestorsofpresentdayBasques, andtherewereLiguriansonthewestcoast.ThelatterhadinvadedfromFranceandwereactuallyamixtureofearly orpre-CeltswithCelticspeakingLigurianswhowerenumerousinFrance.McEvedyRef.136insiststhatabout 1,200B.C.abranchofthesesamepeoplecrossedoverintoEngland,conqueringandintermarryingwiththenatives, whowerealreadyamixedgroupofdark-hairedanddarkskinnedpeople,possiblyIberianinorigin,andlight-haired Scandinavians.AllofthesepeoplespreadthroughoutEnglandandWales.TheareaofWessexwasparticularly prosperous,withtradingcontactswithmostofEuropeandtheMediterranean.Workingontheassumptionthatsome oftheseearlyinvadersoftheBritishIsleswereactuallyCelts,wecandifferentiatetwostocks: 1.TheGoidelsGaelsstillsurvivinginnorthernIrelandandnighScotland,representingasurvivaloftheearliest Beaker-folkwithaQ-Celtictongue 2.theCymriandBrythonsBritonsstillrepresentedinWalesastheP-Celtic,Urneldpeople.Thelatterwere closekintotheGaulicBelgi Ref.136[187],196[269]

PAGE 114

102 CHAPTER6.1500TO1000B.C. 6.4.4SCANDINAVIA AstheearlyCelticpeoplespreadacrossnorthernEurope,theydidnotenterScandinavia,andactuallyevenmadea typeofbarriercuttingoffsometradebetweenScandinaviaandtheMediterraneanareas.Inspiteofthissomeiron, whichwasthesecretweaponoftheCelts,seepedintoScandinavia,sothattheyalsohadwhatmightbecalleda "CelticIronAge",eventhoughtheirbasiceconomystilldependedmainlyonimportedbronzetotheextentthattheir uniquemetalworkdevelopedaspecialNorthernBronzeAge.Peopleburiedtheirdeadinlogcofnsinbarrowsand theclothingandhairwerepreservedintact.Rockscribingsofwildanimalsandlegendarysceneshewnintorock continuedtobeproducedthroughoutlargeareasofScandinavia,includingFinland,andevenpartsofnorthernRussia. TherichestndsofthesescribingsstraddlestheSwedish-Norwegianborder.Ref.122[170],228[304] TheclimateinScandinaviawasforawhilewarmeranddrierthantodayandthenitbecamecoldagain.Glaciers expanded,thesealevelsankandvinesstoppedgrowing.InthemoresouthernareastheTeutonicorGermanictribes wereingrowthandsomehadalreadymigratedtoBritainandbackandforthtothemaincontinent.Danishamber wasindemandonthecontinentandby1,000B.C.theDanesdeckedthemselveswithornateweaponsandornaments andusedbronzelursasmusicalinstruments.Navigationsciencemusthavebeenfairlywellestablished,astherewas muchsailingofnarrow,keelboatsaboutEngland,JutlandandBrittanyandperhapseventoGibralterandtheCanary Islands,whereboatdrawingssimilartotheScandinavianoneshavebeenfound.Ref.117[164] 6.4.5EASTERNEUROPE ThepreviouslydescribedUrneldCulture,involvingtheburialoftheashesofthedeadinurns,appearedinPoland about1,300B.C.andwasalsocalledtheLausitzCulture.TheseearlypeopleofPolandweretheLusatians,awestern branchofSlavs.TheeasternSlavsbythePripetmarshesofthemiddleDnieperRiverdidnotusethisburialmethod. NorthofbothoftheseSlavicgroupstheBaltsand/orLettslivedonthesouthshoreoftheBaltic.Asindicated previouslytheymaybeneitherpurelySlavonicnorTeutonicnorCeltic.TheirclassicalBalticBronzeAgeCulture, locatedbetweentheOderandDvina,includedlocalmetalobjects,potteryandburialritesinbarrowssurroundedby stonerings.TothenortheastoftheBaltsalllandareawassparselyinhabitedbyFinnsand/orLapps.Thebulkofthe southernbranchoftheBalticFinnswastheEstonians.OthersofthisgroupweretheLivsnowabout1,000remain onthetipofCourlandandtheVotes.ThereareperhapsafewofthelatterstillaroundNarva,buttheyoriginally occupiedallofIngria.AlloftheseFinns,liketheBalts,cameoriginallyfromthegreatarcoftheVolgaintherst halfofthe2ndmillenniumB.C.andprobablymetwiththeAesti,describedbyTacitus.AstheyreachedtheirBaltic homes,theyintermarriedwithBaltsandLappsinanamountunknown.SouthernRussia,fromtheCarpathianstothe CaspianSeawasinhabitedatthatperiodbytheAryanCimmerians,probablycloselyrelatedtotheThracians.The CimmeriannameispreservedintheCrimeanpeninsulaoftheBlackSea.Ref.136[187],61[90],144[197] ForwardtoEurope:1000to700B.C.Section7.4 6.5CentralandNorthernAsia:1500to1000B.C. 10 6.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:3000to1500B.C.Section5.5 IranianIndo-EuropeantribesoccupiedalloftheareaofsouthcentralAsiafromtheAralSeatotheTarimBasin,and graduallyextendedtheirterritoriesoneasttowardChinaandsoutheastintotheIndianpeninsula.Atabout1,000B.C. IraniansofTransoxiafoundthataridercouldmanagehishorseonabattleeld,initiatingaweaponthatultimately outmodedthechariot.ItisassumedthattheMongolianandtheHunnish-Turkishpeoplesweremultiplyinginthe farthernorthandnortheasternreachesofAsia, southSiberia,theKarasukCulturedevelopedfromtheAndrovonova,andtherewasachangefromsettledcommunities 10 Thiscontentisavailableonlineat.

PAGE 115

103 toseasonalnomadism.SmallcurvedknivessimilartothoseatAn-YanginChinahavebeenfound.Ref.136[187], 45[66] ForwardtoCentralandNorthernAsia:1000to700B.C.Section7.5 6.6TheIndianSubcontinent:1500to1000B.C. 11 6.6.1THEINDIANSUBCONTINENT Betweenabout1,500and1,200B.C.thereweresuccessivewavesofAryancharioteersandbowmenmovingsouth fromeasternIrantotheIndusValley.By1,050theseRig-VedicAryans,withtheirvigorous,objectiveandwarlike attitudetowardlife,hadextendedtheirdomainfromtheSwatValleyofAfghanistantothelandofthe"SevenInduses", andthentheymovedeastwardtowardtheGanges.IntheRig-Veda,orrstperiodoftheAryans,goat,horse,sheepand buffalocouldbeeatenbutonlybarrencows,butby1,000B.C.theAtharva-Vedaforbadeeatingevenbarrencows.The VediccivilizationaccumulatedagreatliteraturetransmittedverballyintheSanskritlanguageasthe"Vedas"Books ofKnowledge.Thesewerelaterwrittendown,butprobablyafter1,000B.C.Hinduism 12 developedfromtheancient SanskritchantswiththeconceptofBrahman,theSupremeBeing,rulingovermanandallofamultitudeofdeities, manyofthemanimistic.ThesoulofeachmanAtmanthroughmanyincarnationseventuallywinsliberationfrom worldlyexistencetoachieveunionwithBrahman.BelowthelevelofBrahmanintheHindupantheonisthetrinity ofBrahmathecreator,VishnuthepreserverandShivathedestroyer.Brahmaisheldtoosacredforpopularrites,but VishnuandShivaareworshipedinhundredsofguisesandformsandcustoms.Vishnuhastenchiefavatarsorforms inwhichhedescendstoearth,includingRamaoftheRamayanalegend,Krishna,herooftheMahabharataepic,and Buddha,ofhistoricalsignicance.Ref.8[14],211[284],25[45] AlthoughancientIndiansocietywasdividedintocolorsor"varnas",laterthelasttermstoodforagroupingaccording tovocation:Brahminsaspriestsandscholars;Kshatriyasasrulersandsoldiers;Vaishyas,themerchantsandfarmers; Sudras,thepeasantsandserfs.Allofthisdevelopedintothehereditarycastesystemwitheventualemergenceofsome 3,000sub-castes.Asearlyas1,000B.C.steelwasmadeinIndia,bymeltingironat1,500degreesCentigradeand addinglessthanonepercentcarbon.Forcontrast,coppermeltsat500degrees.Agriculture,asinancientIraqand China,dependedonirrigation,andthiswasthemosttimeconsumingpartofthefarmers'work.Ref.25[45],21 [34],213[288] Continueonpage146 6.7TheFarEast:1500to1000B.C. 13 6.7.1THEFAREAST BacktoTheFarEast:3000to1500B.C.Section5.7,122B.C.,thenChou About1,500B.C.ChinapassedabruptlyfromtheNeolithicstatetoafullbronzeage,probablygettingbronze-working techniquefromtheNearEastorThailand,astheChinesescholarsclaim.Chinareceiveditsrstfarm-yardpoultryas thedomesticatedjunglefowlfromtheMalayanpeninsula.Ref.222[296]Thersthistoricaldynasty,theShang,as notedinthelastchapter,wasapowerfulpoliticalregimecontrollingmostofnorthernChina,eventhoughinactuality itwasalooseconfederationofclandomains,manylittlemorethanvillagesettlements.Twooftheirsixcapitals, atCheng-chouandAn-Yang,havebeenexcavated,thelattershowingaBlackPotteryCulture.Thepeoplewere 11 Thiscontentisavailableonlineat. 12 Thename"Hinduism"isderivedfromthenameoftheIndusRiver 13 Thiscontentisavailableonlineat.

PAGE 116

104 CHAPTER6.1500TO1000B.C. basicallyChinese,butsomethinkthatthearistocratic,charioteerwarriorleadersmayhavecomefromfartherwestin thesteppes.Theyusedcompoundbowsandbronzeweapons.Forticationsdatingto1,300B.C.alongtheYellow RiverhaveevidenceofthesesamewarriorbandswhomayhaveoriginatedontheIranianplateauandmovedstepby stepfromoasistooasis,conqueringtheNeolithicsocietiesintheirway.Thiswasanaristocraticagewithasharp cleavagebetweennoblewarriorsandhelplesspeasants.ArecentnewspaperarticlereportsthatChinesescientistshave uncoveredtheremainsof1,000slaveskilledashumansacricesnearAn-Yang.Supposedlytheseweresacriced forfuneralsortohonortheancestorsofthenobility,alldemonstratingtheextremecrueltyandbarbarityoftheslaveowningnobilityofthisShangDynasty.Thereligionwasamixtureofancestorandnatureworshipandtheirscriptwas ideographicandstrictlyChinese.About1,200B.C.ironwasusedinitsmeteoricformandtreatedlikeasemiprecious stone.Itwasoftenmountedinbronzettingsforceremonialweapons.Ref.136[187],235[313] Theconceptofheavendatestothebeginningofthisperiod,withtherulerstravelingnorthtoMountT'aiwhere sacricesweremade,sacredmusicplayedandceremonialdancesaccomplished.Shang-TiLordonhigh,ananthropomorphicgod,livedinheavenandwatchedovertheactionsofpeopleandruledtheheavenofvariousspiritualbeings whowereconsideredtobeancestors.Ref.26[47] In1,122B.C.orperhapsalittleearlier,theShangwereoverthrownbytheChou,aclientpeople,possiblyofdifferent ethnicorigin.HuckerRef.101[146]saystheywereChinesespeakingpeopleofLung-Shandescent.TheChou, theShangandthewarriorcharioteersmentionedabove,allmixed,providingthebiologicalpreludetothersttrue, historiccivilizationoftheFarEast.ToynbeeRef.168[229]callsthistheoriginalSinicSociety.Priortothe overthrow,theShanghadconsideredtheChouassemi-barbariansand"countrycousins"buthadnallyconferredthe titleof"ChiefoftheWest"ononeoftheirleadersandhadgivenhimaShangnoblewomanasawife.TheChouhad probablyearlyalliedwithandmixedwithproto-Tibetanpeoplecalled"Ch'iang",considerednobetterthananimalsat onetimebytheShang.ThisideaofunderminingShangauthoritybymakingallianceswithneighboringchiefswas conceivedbyadenitehistoricalgure,KingWen,andwhenhisson,Wu,cametopoweraskingoftheChou,hebuilt anewcapital,Hao,nearwhatisnowSian.Legendsaysthathethenaccumulated50,000troopsandin1,122B.C. overcameaShangarmyof700,000.ApparentlymanyofthelatterwereunhappywiththelastShangkingandactually joinedtheChou.TraditionalsogivesKingWu'sbrother,theDukeofChou,greatcreditforlayingthegroundwork forthelong-livedChouDynastyasheestablishedseventy-onenewadministrativeunitsandbuiltanewcityatmodern Loyangtoserveasanauxiliarycapital.Ref.168[229],101[146] TheseareaswerebothstillinaNeolithicstagewithfarmersandgatherers. ThereisarcheologicalevidenceoftheSomrong-SenCulturespreadingthroughoutallofIndo-China,includingpresent dayVietnam,Cambodia,Laos,etc.ThiswasafullNeolithicculture,withearlybronzeactivityapparentabout1,000 B.C.innorthernVietNam.H.O.Beyerfoundin1948thattangedandrectangularadzbladeswereusedinthenorthern Philippinesbetween1,750and1,250B.C.andnowhereelseinIndonesiaorMelanesia.Theinterestingsequelisthat thesearealmostidenticalwiththoseusedmuchlaterthroughoutPolynesia.Therouteofthisadzandthepeopleusing itfromthePhilippinestoPolynesiacanonlybeexplainedinonewayaccordingtoThorHeyerdahl-uptheJapanese CurrenttobelowtheAleutianstotheNorthAmericancoastandthenbackintothePacic.PleaseseethePacic Section6.8sectionRef.8[14],95[140] ForwardtoTheFarEast:1000to700B.C.Section7.7 ChooseDifferentRegion 1.IntrotoEraSection6.1 2.AfricaSection6.2 3.AmericaSection6.9 4.CentralandNorthernAsiaSection6.5

PAGE 117

105 5.EuropeSection6.4 6.TheIndianSubcontinentSection6.6 7.TheNearEastSection6.3 8.PacicSection6.8 6.8ThePacic:1500to1000B.C. 14 6.8.1THEPACIFIC BacktoThePacic:3000to1500B.C.Section5.8 NewCaledoniaissaidtohavehadhumanhabitation3,000yearsagoanditisknownthatLapitapotterypeoplereached FijiinMelanesiaby1,300B.C.LatertheyreachedTongaandSamoaonthewesternedgeofPolynesiasee6thcentury B.C.Section9.8discussionofthispoint.TheaboriginesofAustraliacontinuedunmolestedatthistime.Ref.8 [14],176[242] ForwardtoThePacic:1000to700B.C.Section7.8 ChooseDifferentRegion 1.IntrotoEraSection6.1 2.AfricaSection6.2 3.AmericaSection6.9 4.CentralandNorthernAsiaSection6.5 5.EuropeSection6.4 6.TheFarEastSection6.7 7.TheIndianSubcontinentSection6.6 8.TheNearEastSection6.3 6.9America:1500to1000B.C. 15 6.9.1AMERICA BacktoAmerica:3000to1500B.C.Section5.9 TheArcticSmallTooltraditioncontinuedacrossnorthernCanadatoGreenlandandthePaciccoastIndianscontinued theirsalmonshing,withoutattemptingcultivation.By1,000B.C.theywerebuildingvillagesalongtheSnake, ColumbiaandFraserriverssouthoftheSnake,therewerelargeovaldwellingswithoorsandatimberframe,usually abouttwenty-vebythirtyfeet.Ref.209[282] TheIndiansofNorthAmericaoriginallyhadlivedbyhuntinggameandgatheringwildfoods,butabout3,000years agotheybeganmakingclayvessels,aninnovationthataccompaniedtheappearanceofagricultureinmanyareas.The potteryfoundinvariousexcavationsitesintheUnitedStateshasadistinctivegrittytemperandisoftendecoratedwith fabricorcordimpressions.Onevillage,calledtheBaumersite,insouthernIllinois,coveredmorethantenacresand 14 Thiscontentisavailableonlineat. 15 Thiscontentisavailableonlineat.

PAGE 118

106 CHAPTER6.1500TO1000B.C. wasmadeupofhousesaboutsixteenfeetsquare.Theuseoflocalstrainsofcorn,beansandsquashafter1,500B.C. gavepeoplethesurplusoffoodandtimeneededtoengageinsomecommunalactivities.Therstsignsofmound buildingappearedinthemiddlewestabout1,000B.C.assomevillagesbegantoburytheirdeadunderlowearth mounds.InthesouthwesttheCochisecontinuedtheirgradualtransitionfromhunter-gathererstotruefarmers.Ref. 215[290],210[283],CENTRALAMERICAANDTHECARIBBEAN VillagelifeinMexicocontinuedtoshowmoreadvancedsocieties.IntheOaxacaValleytherewerevillageswith agriculturedominantby1,300B.C.Eachvillagecontainedtentotwentyhouseswhichweresinglefamilyunitsmade ofwattleanddaub,allopeningintoacommonplaza.By1,200inSanJoseMogoteinthesamevalley,thepeoplebegan tobuildlargeplatformswithlimedwallsandoors.Ref.45[66],209[282]RecentexcavationsatDzibilchaltun innorthernYucatanindicatethatthissite,whichcontainedoneofthelargestoftheMayancitiesofthelatepost-classic periodofA.D.600orlater,hadbeencontinuouslyoccupiedsince1,500B.C.,sothatinallprobabilitypre-Mayanor Mayanpeoplelivedtherewithaneverincreasinglevelofcivilizationforover2,000years. Thebigstoryofthisperiod,however,isthatoftheOlmecswhohaddevelopedacivilizationinthehumid,low-lying, forestregionofsouthernVeracruzandwesternTabascoby1,200B.C.Mostauthoritiesagreewithafewdissenters thatthisremarkablesocietyappeared suddenly ,withoutknownantecedents.TheyweretherstMeso-Americans tohandlelargemassesofstoneinmonumentalsculpturesandtheymayhavebeenresponsibleforextendingthe growthofmaizeinthatarea,chieybyexampleorleadership,astheywerenotthebasicinhabitantsoftheregion. ThelatterwereethnicallyHuastecwhiletheOlmecswereapparentlyanhereditaryrulingclasswhopromotedefcient farmingtechniques,longdistancetradenet-works,largetemplesandpublicbuildings,neart,anofcialstatereligion andsocialstratication.Thequestionofpre-ColumbiancontactswithAmericahasbeenbroughtuptimeandagain, particularlyregardingthisadvanced,suddenlyappearingOlmeccivilization,butthenatureandmethodofsuchcontact andwhetherornotitoccurredatall,continuestobedebated. LiketheEgyptians,theOlmecsandlaterMayaswroteinhieroglyphs,developedacalendarandpredictedthemovementsofplanets.TheseCentralAmericansbuiltat-toppedpyramidssimilartothezigguratsofMesopotamiaand decoratedthosewithbas-reliefsshowingpriestswithSemiticfaciesandlongbeards.Thereisevensomebotanical evidenceofEuropeancontactinthattheOlmecsuccessorsworegarmentsfromastrainofcottonthatseemedtobea crossbetweenalocal,wildtypeandthelong-stapleEgyptiancotton.Thelatterhasthirteenlargechromosomesandthe nativecentralandSouthAmericancotton,whichwasshortstapled,hadthirteensmallchromosomespercell,butthe cottonusedforclothlaterinCentralAmericawasahybridofthetwoaboveandcontainedtwenty-sixchromosomes, thirteensmallandthirteenlarge.OnehastowonderifitisjustcoincidencethattheseOlmecsdevelopedwriting, calendarsystems,pyramidsetc.directlyattheterminusofthestrongAtlanticCanaryCurrent,owingfromthebulge ofAfricathroughtheCanaryIslandstotheGulfofMexicoatthebaseoftheYucatanpeninsula.Theswampy,unfavorablejunglecoastinwhichthiscivilizationdevelopedwouldsuggestthatitmusthavearrivedalmostinfullbloom, fromthesea.TheEgyptiansandPhoeniciansknewmoreaboutastronomy,thekeytooceannavigation,thanthelater EuropeancontemporariesofColumbusandPizarro,anditisdenitelyknownthatthePhoenicianshadsettlementsall thewaydowntheAtlanticcoastofMoroccoby1,000B.C.Ref.176[242],209[282],95[140] ThereisalsothepossibilityofstillotherpeoplesbeingthesourceofearlyforeigndiffusiontotheNewWorld. HeyerdahlRef.95[140]listsfty-twoexamplesofcommoncharacteristicsseenintheearlycivilizationsofAsia MinorHittite,CyprusandCreteandtheearlysocietiesofCentralAmericaandPeru.Theseincludepriest-king dynastiesinsun-worshippingadministrations,brother-sisterroyalmarriages,fullydevelopedscriptwriting 16 ,paper manufacturefromvegetablebers,stonemasonryofamazingaccuracywithouttheuseofmortarandwithmethods oflongrangetransportationofgiganticstoneblocks,colossalstonestatues,repetitiverepresentationsofabearded manalltrueAmerindiansofSiberianoriginshouldbebeardlessghtingagiantsnakestandingonitstail,abird-man standingonaplumedserpentSeeHittites,thischapter,constructionofziggurattypesofpyramids,mummicationof deceasedroyalty,trepanningofskulls,circumcisionasareligiousritual,citiesofadobehousesseparatedbystreetsand 16 NotinSouthAmerica.

PAGE 119

107 withwaterandsewersystems,largescaleterraceagriculturewithirrigationandfertilizers,similarcottonloomsand garments,identicalleatherandropesandalsalthoughthelatterwereuselessinthetropicalswamps,feathercrowns usedbynobles,similarorganizationofstandingarmiesandweaponry,similartoolsandutensils,useofreddyesfrom mollusks,identicalstagesofmetallurgywithoutstandinggoldwork,ceramic,polychromefuneralware,claymodels ofdailylife,aswellasauniversalfemalegoddess,stampedseals,curvedwoodengurines,understandingofthe "zero"concept,beliefintheirownoriginintherstcenturyofthe3rdmillenniumB.C.,remarkablyhighstandardof calendarsystemandnallythesameocean-goingreedshipswithcanvassailhoistedonadouble-leggedmast.We shouldalsonotethatthedateofthebloomingoftheOlmeccivilizationat1,200+200B.C.isthesametimeoften givenfortheTheraupheavalintheMediterranean,withthesubsequentpossibledisplacementoftheSeaPeoplewho rovedtheMediterraneanandpossiblytheAtlantic!SelfportraitsoftheOlmecsoncolossalmonolithshaveshowntwo contrastingtypes-onewithNegroidphysiognomyandtheotherwithtypicalSemiticfeatureswithlongowingbeard -allthisintheswamplandexactlyattheendoftheCanaryCurrent.Ref.95[140] ItisdifculttobecertainoftheexactphysicaltypeoftheoriginalCentralandSouthAmericanIndians,sincethe populationsthatcamebacktolifeaftertheterritoriesbecameindependentofSpain,arenowsocross-bredwith Europeans,ChineseandAfricansthatidenticationisimpossible.TheChinesefactorbringsupstillanotherdiffusion theorythathasbeenadvancedaslateas1975byBettyMeggersRef.141[194]oftheSmithsonianInstitute, whobelievesthattheinvaderswereChinesefromtheShangDynasty!Asothershave,shepointsoutthatinMesoAmerica 17 aslateas2,000B.C.therewasonlyonevillageperkilometerintheestuarysystemsalongtheChiapasGuatemalacoast,butabout1,200B.C.somethingunusualoccurred-thesuddenappearanceoftheOlmeccivilization infullower-andsherelatesthatthiseventwasfeltalmostsimultaneouslyoveralmostallofMesoamerica.This correspondsintimetotheendoftheShangDynasty,inChina.Meggersfeelsthatoneofthemoststrikingaspects ofthisnewsocietywastheextentoftrafcinrawmaterialssuchasobsidian,basalt,magnetite,ilmenite,himatite, serpentineandjadeite,alongwiththetransportationoftheheavy,basaltbouldersoverlongdistances.Shepointsout agreatnumberofsharedculturalfeaturesoftheShangandtheOlmecsocietiesincluding: 1.writing,statingthatafew,oftenrepeatedOlmecsymbolsresembleShangcharacters,andlaterMayaglyphs werereadtoptobottominShangfashioncharactersofMinoanLinearAofCretewerereadsimilarly 2.jade,aprimarycommodityoflongdistancetradeinbothsocieties 3.batonsasasymbolofrank,somewithbifurcatedtops 4.felinedeity,theShangtigerandtheOlmecjaguarbothassociatedwiththeearthgodandbothoftendrawn lackingalowerjaw 5.worshipofmountains 6.cranialdeformation,apparentlyarticiallyproducedinthecenteroftheheadofrulers 7.largegroupsofscatteredvillageswithcentralserviceCenters 8.theconstructionofrectangularplatformswithanorth-southorientation. WhenaskedwhytheMesoamericansdidnotusethewheel,whichwascertainlyusedbytheShang,shereplied,as othershave,thattheAmericanshadnouseforthewheelintheabsenceofroadsanddraftanimals,theruggednessof theterrainandtheabilityofamantocarrymorethanhisweightinfragilecargo. Asmightbeexpected,refutationsofMeggers'theorysoonappeared.DavidGroveRef.80[122]oftheUniversity ofIllinoissaysthatthesocietywhichwehavementionedasbeingintheOaxacaValleybetween1,500and1,400B.C. wasacomplexcultureandperhapsprecededthoseoftheGulfcoast,andwouldmoreapttobetheOlmecancestor thantheShang.Furthermore,hesaysthatthejadecarvingmaynotevenhavebeenOlmecandthatthefelinedeity ideacameupfromSouthAmerica.HealsomakesthepointthatexcavationsbyCoeatSanLorenzeontheGulf coastsince1970haverevealedsignicantOlmecculturallevelswhichpredatethoseatLaVenta,butalsopre-Olmec levels,suggestingthattheOlmeccultureappearedgraduallyratherthansuddenly.Meggersimmediatelyrepliedto thisinapublicationin1976Ref.142[195]statingthattwenty-threeofthereferencesshehadconsultedforher previouspublicationhadbeenwrittenbetween1970and1974andthatshewasstillconvincedthatShangrefugees wereinvolvedinCentralAmerica.TheconceptofthesuddenappearanceoftheOlmecsocietyseemstobegiven 17 Strictlyspeakingtheterm"Mesoamerica"includesGuatemala,Belize,WesternHonduras,ElSalvadorandonlysouthernMexico,including Yucatan.

PAGE 120

108 CHAPTER6.1500TO1000B.C. anotherboostbythe1977publication, TheEncyclopediaofArcheology Ref.45[66]whichdiscussesrecent investigationsatSanLorenzobyYaleUniversity,describingthatcenterashavingthelongeststratigraphichistoryof anyknownOlmeccenterandthatitwasconstructedonanarticiallyraisedmassofland,builtbytheOlmecsto supportanumberofearthernpyramidconstructions,plazasandmounds,alllaidoutalonganorth-southaxis.The writerindicatedthattheOlmecCulturewasemergingatthissitejustin1,250B.C.andthatmostofthepureOlmec monumentsandstructuresactuallydatefrom1,150B.C.onwards. WhetherornottheOlmeccivilizationwasimportedorlocalinorigin,thereisnodoubtbutwhatthiswasthemother ofalllatertruecivilizationsinCentralAmerica,includingtheMayan.ProbableextensionsoftheOlmecintomore centralMexicoareindicatedbyrecentexcavationsatChalcatzingointhestateofMorelos,about85milessoutheast ofMexicoCity.Radio-carbondatingsarefrom1,170B.C.on,andthendingsincludebas-reliefcarvings,platform complexes,etc.,alltypicaloftheOlmecstyle.Ithasbeenpostulatedthatitwasacenterforcontrollingthetrade ofhighlandrawmaterialsobsidian,jade,ironoreandpossiblycottonandchannelingtheseontotheGulfcoast centers.ContactswithnearbyOaxacaseemtohavestimulatedculturalgrowththere,aswellorwasitvice-versa, assuggestedbyGrove?.Atanyrate,withinafewcenturies,Oaxaca,withitsvastlygreaterresourcesandricher agriculturalpossibilities,withirrigation,actuallybegantobethedominantpartner.Ref.81[120],45[66] Stillanother,separatecultureissuggestedbyfairlyrecentexcavationsatLaVictoria,Guatemala,whereMichealCoe Ref.36[57]hasuncoverediridescentceramicpotteryasauniquetechnologicalfeaturedatingfrom1,500to800 B.C.ThissameunusualpotteryhasbeenfoundalsoinPeru,anditseemspossiblethatthetechnologymayhavegone fromGuatemalatoPeruwheretheearliestdatingbyradio-carbonis714B.C.+200years.Ifthisdiffusiondidoccur, itwasprobablybyboatforthatisonlya1,300mileseatripandhasbeenshownpossiblebyHeyerdahl'sraftvoyage andthepresenceofancientsherdsonGalapagosIslands,whichlie650milesofftheEcuadorcoast.Otherpottery ofMiddleAmericawashighlydevelopedbuthadnolocalancestryandCoesuggeststhatitpossiblymigrateddown fromtheWoodlandCultureofNorthAmerica. Severaloftheimmediatelyprecedingparagraphs,particularlythoseconcerningthepossibleculturalderivationsfrom pre-ColumbianEuropeanmigrationwereapplicabletopartsofSouthAmericaaswell.Weshouldnowmakesome observationspeculiartothelatter,however.Foronething,theSouthAmericansdidnothavewritingandwhythisdid notarrivewithotherMid-Americanculturalfeatures,iftherewasindeedearlycontact,remainsanenigma.Asfaras theilliteracyisconcerned,however,weshalldiscoverlaterinthistextthatilliteracydidnothampertheScandinavian VikingsortheMongolKhans.Themostspectacularexcavation,abandonedbetween1,500and1,400B.C.according tocarbon-dating,isElParaiso,nearLima,justthreemileseastoftheoceanontheChillonRivervalley.Thisconsistsof sevenarchitecturalunits,ofwhichonehasbeenprettywellrestored.Theunitswereenormousbuildingsmadeoftwo rowsofheavyquarriedandroughly-shapedstoneblockscementedwithunredclayandthegapslledwithrubble. Thebuildingswereofvarioussizesandshapes,someathousandfeetlong;somealmostsquare165by132feet.There werewidestaircasesandvarioushallsandrooms,someofwhichmusthavebeenforstoragewhileotherswerefor festivitiesandstillotherslivingquarters.Asinglebuildingwouldreachthirtyfeethigh.Asimilarbuildingcomplex hasalsobeenfoundhigherupinthevalley,thirty-sixmilesfromLima.Trepanationanddeliberatedeformationof skullsseealsoMexico,CentralAmericaandtheCaribbeanp.107waspracticedfrequentlyinthisperiod.Inthe lastchapterwediscussedthe"beanplanters"ofPeru.ArcheologyindicatesthatElParaisoandallthebeanplanters' villageswereabandonedataboutthesametime,apparentlyaround1,500to1,400B.C..Noexplanationhasbeen foundforthisrathersuddenandcompletedisappearanceofthissociety,andfurthermoreitappearsthatthePeruvian coastprobablyremaineddesertedforonetothreecenturiesthereafter.Skeletonssuppliedtophysicalanthropologists byFredericEngelfromthevicinityofthelastofthesepre-ceramic,beaneatersshowthepresenceofadifferentethnic groupwithcross-breeding,asevidencedbythepresenceofbrachycephalicandmesocephalicskullsinadditionto theolderdolichocephalic.Onecanimagethatforeignethnicgroupsmayhavebroughtaplaguethatkilledthebean planters,butonecannotruleoutsevereclimaticchangeasthecause. CorngrowinghadappearedinthecentralAndes,bothinthecordilleraandonthecoastby1,500B.C.Although

PAGE 121

109 previouslyusedontheCaribbeancoast,potterydoesnotseemtohavebeenintroducedinwesternPeruuntilabout 1,300B.C.EngleRef.62[91]hadfoundsomeinthecentralPeruvianlowerAndescarbon-datedinthe3,300 to3,500B.C.range,soperhapsbothcornandpotterywerebroughtoverfromtheeasternslopesofthemountains. NearLakeTiticacaandintheCordilleradelaViuda,northeastofLima,earlytypesofpotteryhavebeenfounddating between1,500and1,300B.C.andthispotteryhassubsequentlybeenfoundeverywhereincavesandrocksheltersin theupperAndes.Thecornraisersandpotterymakerswereapparentlyanew,migratingpeople,anddidnotrepresent merelyachangeincultureofthebeanplanters.Basicallyby1,320B.C.AmericansatecornastheEuropeansate wheatandtheAsiansrice.Seafood,especiallyshellsh,however,alwaysplayedanimportantpartoftheAndes peoples'diets,supplyingproteinthattheylackedintheabsenceofmeat.AdeeprefusemiddenonthecoastofPeru hasrevealedacultivatedgourd,usedforvariousartifactsinashingculture.ThesewereonlylaterfoundinPolynesia. By1,000B.C.Peruvianshadhallucinogensandalcoholandweresmokingcigars,althoughtheleafwasnottobacco. Ref.62[91],95[140] ForwardtoAmerica:1000to700B.C.Section7.9 ChooseDifferentRegion 1.IntrotoEraSection6.1 2.AfricaSection6.2 3.CentralandNorthernAsiaSection6.5 4.EuropeSection6.4 5.TheFarEastSection6.7 6.TheIndianSubcontinentSection6.6 7.TheNearEastSection6.3 8.PacicSection6.8

PAGE 122

110 CHAPTER6.1500TO1000B.C.

PAGE 123

Chapter7 1000to700B.C. 7.11000to700B.C. 1 Backwardto1500to1000B.C.Section6.1 Thesethreehundredyearswereaperiodofgreatactivityallovertheglobe,fromnorthernAfricaandtheNearEast acrosstoChinaandeventheAmericas.Aswillbenoted,therearemanynewideasrecentlyformulatedaboutdiffusion ofpeoplesandculturesaroundtheearthinthisperiod,ideasthatarequitestartlingtomostofusandnotgenerally accepted,apparently,bythetraditional,historicalestablishment.Wehaveintroducedtheseconceptsinthismanuscript becauseoftheirinterestandbecausetheauthorspresentsomeveryconvincingarguments,butonlytimewillgivethe naljudgmentontheirvalidity.WereferparticularlytothetheoriesofProfessorBarryFellandtosomeofthoseof ThorHeyerdahl.ThereaderisremindedthatwhentheprehistoriccavepaintingsofSpainandsouthernFrancewere rstdescribed,theorthodoxarcheologicalorganizationsuniformlydecriedthemasfakes!AdditionalNotesp.111 NOTE :CavalryraidsintheMiddleEastandeasternEuropebynomads,beginningwithScythiansafter900 B.C.,keptlimitingagriculturalexpansionshortofitsclimaticlimitsfor2,000years.Ref.279[191] ChooseDifferentRegion 1.AfricaSection7.2 2.AmericaSection7.9 3.CentralandNorthernAsiaSection7.5 4.EuropeSection7.4 5.TheFarEastSection7.7 6.TheIndianSubcontinentSection7.6 7.TheNearEastSection7.3 8.PacicSection7.8 7.2Africa:1000to700B.C. 2 7.2.1AFRICA BacktoAfrica:1500to1000B.C.Section6.2 1 Thiscontentisavailableonlineat. 2 Thiscontentisavailableonlineat. 111

PAGE 124

112 CHAPTER7.1000TO700B.C. AtthebeginningofthelastmillenniumB.C.KushorNubiawasanareaoffertilegrassland,althoughnowitisdesert. Prosperitythenintheareadependedonexportsofivory,ebony,gum,hides,ostrichplumesandslaves.Thenorthern Nubiansweredark-skinnedbutprobablyofAsianorigin,whilefarthersoutharoundpresentdayKhartoum,therewere Negroes.EthiopiabegantobecolonizedbySemitesfromShebainYemeninthe10thcenturyB.C.Ethiopianlegend saysthattheircountrywasfoundedbyMenelik,eldestsonofSolomonandtheQueenofSheba.Inthe8thcentury B.C.KushwasstrongenoughtoconquerEgypt,perhapswiththehelpofthoseEthiopians,andtheyestablishedthe XXVdynastyin725B.C.Ref.83[123] InEgyptthepost-empireperiodoftheNewKingdomlastedfrom1,090intermittentlyuntil525B.C.Theinternal decayofthetheocracywassoonfollowed,asiscommoninhistory,byinvasionanddominancebyforeignpowers. About950B.C.Shishonq,chiefoftheShardanatribeoftheSeaPeoplewhohadfadedintotheLibyandesertsome twocenturiesearlier,revoltedagainsttheEgyptianmonarchandinstalledhimselfaspharaohinthecityofBubastis, establishingtheLibyanDynasty,rulingbothEgyptandLibya.Egyptthenbecameamaritimepower,exporting alabastervaseswithvarioussealstoSpain.Thename"Shishonq"hasalsobeenfoundonsomeAmericaninscriptions, althoughtherelationshipisnotclearatthistime.Asmentionedabove, theKushitesandperhapssomeEthiopianscomingfromthesouth.NoculturaladvanceoccurredinEgyptinthose troubledtimes.Ref.46[76],175[241],66[97]. WhiletheLibyanswereincontrolofEgypttheirinuenceandlanguagespreadfarandwide,eventotheIndo-Pacic regionwheretheEgyptianshadlongminedgoldparticularlySumatra.FellRef.122[170]saystheLibyan languagespreadwithGreekinuencesintoMelanesia.IntheMediterraneanafter813B.C.therewerecoastline coloniesofPhoenicia,notablythegrowingCarthage,locatedintheBayofTunisnearthemoderncityofTunis. Archaeologists,however,havefoundnothingatCarthagethatcanbedatedbefore735B.C.LiketheparentPhoenicia, Carthagealsomanufacturedapurpleclothbyasecretdyeingprocessutilizingthepigmentfromaseasnail,called "Murex",andtheGreeksnamedthetraderswhosoldthis,"Phoinikoi"or"ThePurplePeople".TheRomansthen calledthem"Punici"andlatertheword"Punic"cametoreferexclusivelytotheCarthaginians. InMauretaniathisperiodsawadecreaseinrainfallandshingwasnolongerpossible,butmilletwascultivatedinthe elds.ThiswastheChebkaphaseoftheDarTichittCulture.By1,000B.C.anew,Hamiticspeakingpeoplefromthe north,ancestorsofpresentdayBerbers,hadestablishedthemselvesintheSahararegion,withchariots,horses,goats andcattle.Ref.65[96],84[124],66[97],45[66] MostofsouthernAfricaremainedmuchasinthepreviouscenturies.Sometimeinthis1stmillenniumB.C.abreakin theforestbeltintheeastallowedStoneAgefarmers,herdsmenandperhapscerealgrowerstospreaddowntheRift valleyfromEthiopiaintocentralKenyaandnorthernTanganyika.Ref.8[14] ForwardtoAfrica:700to601B.C.Section8.8 7.3TheNearEast:1000to700B.C. 3 7.3.1THENEAREAST BacktoTheNearEast:1500to1000B.C.Section6.3 3 Thiscontentisavailableonlineat.

PAGE 125

113 NorthandsouthArabiapresentedtwoseparateethnicgroups,separatedbyavastcentraldesert.Thenorthernerswere nomads,butthesouthhadanadvancedculturewithurbanliving,ahighsocialorganization,auniqueirrigational systemandarelativelyadvancedtechnology.Severalkingdomsexisted,suchastheMinaeanandSabaeanYemen. TheQueenofSheba,alsocalledQueenBalkis,supposedlycamefromthelattercountry.Itisgenerallysupposed thatthisQueen,whohasreallyneverbeenfurtheridentied,camefromthelandofSheba,orYemen,yetthereis nohistoricalmentionofthecultureofthenationofShebauntilabouttwocenturiesaftertheQueenallegedlyvisited SolomoninPalestine.ExplorationandexcavationofthatareaofYemenhasbeenhinderedbyIslamicattitudes,for ShebawascursedbytheProphetMohammedasapaganland,andallrecentattemptsatexcavationshavebeentotally thwartedbythepresentMosleminhabitants.AtthetimeofthelegendaryvisitoftheQueenofShebatoPalestine, Solomon'spowerwasatitspeak.HisgarrisonscontrolledalltheroadsfromtheEuphratestotheSinaiandfromthe RedSeatoPalmyra.Hisarmyincluded12,000horsemenand1,400warchariots. Camels,whichhadbeenusedbytheArameansforalongtime,cameintocommondomesticuseabout1,000B.C. andbecamemoreandmoreimportantfordeserttraderoutesandwar.Fourcamelscancarryatonofmerchandise andgoforthreedayswithoutwater,coveringtwenty-vemilesaday.AmajorcamelroutefromYementoPalestine viaHejazcarriedArabia'sresinsmyrrh,frankincenseandbalsamusedinperfumes,incenseandmedicines,butalso musthavecarriedre-exportedgoodsfromEastAfricaandIndia.Thetriprequirednearlythreemonthsbythecoastal route.Thenomadcameldriversofthateraenjoyedadishofcamelhairandblood,mixedandcooked.Maribwas thecapitalofSabaea,oneofthecity-statesofnorthYemenwhichacquiredwealthandpowerfromthiscameltrafc. Anirrigationdam,perhapsbuiltthereinthatperiodlastedmorethanathousandyears.ThenativesofSheba,Ma'in, AqtabanandHazarmothwereSemitesfromthenorth,worshipingthesun,themoonandVenus,whichtheycalled Ashtar,andtheirgovernmentwassimilartothatofSumer.Theyweregeographicallyisolatedandtough.Thecity ofAmman,inJordan,gainedindependencefromSolomoninthe10thcenturyB.C.,but200yearslaterJordan,asa whole,wasconqueredbytheAssyrians.Ref.176[242],136[187],211[284],83[123]AdditionalNotesp. 115 TheshorelineoftheMediterraneanassumedgreatimportanceinthisperiodofworldhistory,asseveralseparate centersofcivilizationdevelopedastheprobableforerunnersofourowncivilization.ThepromotionofHebrew monotheismforecastedthelaterdevelopmentofChristianity,andtheriseoftheGreekCulturewasthedawnofthe Greek-RomanworldwhicheventuallytookoverthatChristianityandbequeathedittothewesternworld.Professor ToynbeeRef.220[294]feelsthatthePhoenicians,IsraelitesandSyriansofthatage,alongwiththePhilistine refugeesfromtheCretanworldandHebrewnomadsfromArabia,alltogetherformedaseparateanddistinctsociety whichhecalledtheSyriac.HefeelsthatitwastheparentsocietyofbothwesternChristendomandtheIslamicSociety oflateryears.Thisisaninterestingtheoryandconvenient,butothersdonotassociatethesecommunitiesinthisway. ToynbeedatesthebeginningofthebreakdownofthisgrouptothedeathofSolomon,butclaimsthatitcontinuedon totheUniversalStateinthe6thcenturyB.C.undertheBabylonianNebuchadrezzar. NOTE:InsertMapfromReference97 SolomonslewallrivalclaimantstothethroneofJudea,includinghishalf-brother,andbecamekingoftheJewsfrom 974to937B.C.RichcopperminesfoundneartheRedSeaandPhoenicianmerchanttradehelpedthetreasuryandgold mininginArabiaallegedlypromotedthroughtheQueenofSheba,wasanextraboon.ThePhoenicians,inexchange foraccesstotheRedSeaandsometwentyGalileantowns,broughttechnicalexpertisetoIsrael.Ataplaceonthe GulfofAqabaperhapsmodernElat,thePhoeniciansconstructedthelongdistanceboatswhichweretheirspecialty andmountedjointtradingexpeditionswiththeIsraelites.WoodfortheboatscamefromLebanon'sgreatcedarsand wasoatedbyseatoJaffe.Asanincidentalnote,Solomonamassedseveraltonsofgoldeachyear,somuchthathe coveredthewallsofhisgreattemplewithit.Althoughinmanywaysunprincipledandwithanalleged700wives

PAGE 126

114 CHAPTER7.1000TO700B.C. hisrstwasthedaughterofthepharaohofEgyptand300concubines,hehadonlyoneGod,Yahweh.Thereis muchconfusionabouttheoriginofYahweh-hemayhavebeenoneandthesamewiththeCanaangodYahu,dating backinthattribeto3,000B.C.who,takenoverbytheHebrewswasre-createdintheirownlikeness,oritispossible thatthe"GodAbraham"wasahouse-holdgodbroughtfromancientUr,whilethe"GodMoses"mayhaveoriginated separately,withafusionofthesetwoaccomplishedlaterbyJewswhodidnotcomefromEgypt.Atanyrate,Yahveh originallywasagodofthedesertandwar,andcouldnevereasilybereconciledwithanagriculturaldeity.Shortly afterSolomon'sdeathhisson,Rehoboam,refusedtoreducetheterriblyhightaxesandtennortherntribesrevoltedto formanewnationofIsraelaroundthecityofSamaria.TwosoutherntribesremainedatJerusalemasthenationof Judah.EphraimtodaythisisinJordanbecamethecapitalofthenortherncountryandJerusalemthecapitalofJudea Judah.Ref.46[76],28[48],176[242] JudeawassoonconqueredbytheLibyanrulersofEgypt.AhundredyearslaterKingShab,ofIsrael,heldoff theAssyriansatQarqarB.C.butinanothercenturytheAssyriansdestroyedadjacentSamariaandbesieged Jerusalem,taking200,000Jewscaptive.Theseweretheso-called"LostTribesofIsrael".SargonIIactuallycarried outthedeportationwhichwaspreviouslyorderedbyhispredecessor,TiglathPileserIII 4 .Inthisatmosphereofpolitical disruption,economicwarandreligiousdegeneration,theJewishprophetsappeared.Theywereradical,anti-clerical andsocialistic.TherstwasAmosB.C.followedbyHoseaB.C.whodenouncedtheIsraelitesforthe worshipofgodsotherthanYahweh.AmosandIsaiah,whoappearedin702B.C.,maybeconsideredasthebeginning ofbothChristianityandsocialism,the" ::: springfromwhichhasowedastreamofUtopias ::: 5 InthisperiodJudah keptsomeindependencebutasavassalstateofAssyria.BiblicalHebrewmedicalideasweredrawnchieyfromthe adjacentMediterraneanconcepts.Theybelievedinsupernaturalcausationofdiseasealthoughtheydidnotenvision aworldlledwithdemonsandspiritsatthattime.Hygieniclawswereenforcedforreligiousanddisciplinaryrather thanmedicalreasons,andtheseregulationsreachedintoalmosteverycornerofdailyliving.Thetabooonporkwas probablynothygienicormedicinalbutsimplybecausepigscompetedwithhumansforthescarcegrainandwater, whilesheepandcattledranklittlewaterandateonlygrass.ManyoftheallegedleprosycasesoftheBiblewere probablyotherskindiseases.SomemedicineswerementionedintheBible-mandrake,balsams,gums,oils,and possiblynarcotics.Nosurgerywasmentionedexcepttheritualcircumcision.Physiciansweretakenfromthepriestly tribeofLevites,andwereapparentlyheldinhighesteem.Ref.125[173] PleaseseemapinconnectionwithGREECE,thischapter ThiswasaperiodofgreatwealthandterritorialexpansionforthePhoenicians.KingHiram,ofthecityofTyre,had friendlyrelationswiththeHebrewkingsand,aswehavenoted,enteredintomanytradeagreementswiththem.The Phoeniciansdevelopedanoverseasempire,includingcoloniesonCyprus,theAegeanislands,inSpainandatCarthage innorthAfrica,carryingandteachingtheiralphabettothenationsofantiquityanddisseminatingtheuseofpapyrus. TheirsettlementatGadeslaterCadiz,Spaingavethemaccesstothegold,silverandcopperfromTartessus.They exportedivorycarvings,silver-work,coloredglassandnefabrics.Theyaresaidtobetherstpeoplewhowereable tonavigatebythestars,sailbeyondthesightoflandandatnightandtovoyageontheseasinwinter-time.Itisto berecalledthatthesepeoplewereprobablybasicallyCanaanitesandtheirchiefobjectofworshipwasthegoddess Ishtar,whosubsequentlybecametheGreekgoddessAstarte.TheBritishMuseumhassomeexcellentPhoenician ivorycarvingsofthisperiod.Ref.18[31],19[32],75[115] JustoverthemountainsfromPhoeniciatheSemiticSyrianshadbeendevelopinganadvancedcivilizationwitha capitalatDamascus.AlthoughdominatedduringthethreehundredyearsofthistimeperiodbytheAssyrians,thetrue Syrianswereaseparatepeople,withtheirowncultureperhapsmorecloselyrelatedtothePhoeniciansandIsraelites thantotheirneighborstothenorthandeast.TheyworshippedAstarteandalsoAdonis,whoregularlyarosefromthe 4 BiblicalreferenceIIKingsXV,29on134 5 DurantRef.46[76],page319

PAGE 127

115 dead.TheAssyrianconquestssoguttednorthernSyria,however,thattheareasubsequentlyremainedunimportantfor thenext400years.TheAssyriansattackedinwaves.UnderAshurnasirpalIIandhisson,ShalmaneserIII-824 B.C.theypushedthroughtotaketheentireeasternMediterraneandowntoPalestineandnorthwardtotheTaurus, whichwasimportantasatraderoutetoEuropeandasasourceofmetals,andthensouthtowardDamascuswherethey cameintoconictwiththeArameansandtheiralliesinIsrael.Ref.8[14]SoonDamascusitselfwasconquered byShalmanesarIV,whowasfollowedafteranintervalbyTiglath-PileserIII.HethenreconqueredArmenia,northern Syria,BabyloniaandoverallextendedtheAssyrianrulefromtheCaucasustoEgypt.Theirmilitaryroadsactually facilitatedtradebythenativeAramean-Syrianswhospreadtheirlanguageandfosteredacosmopolitancultureinthe middleeast.ThelastofthewildelephantsofSyriawerekilledoffinthisperiod,althoughtuskswerestillimported fromAfricaandperhapsIndia,forcarving.Ref.45[66] Asimpliedabove,ancientBabyloniapassedfromKassitetoAssyriancontrolearlyinthisperiod,butbyabout900 B.C.,theChaldeans,whoweresimplyonegroupofArameans,begantoinltratetheregionandeventually,withhelp, theChaldeanaristocracrythrewouttheAssyrians.***Page1185AdditionalNotesp.116 IntheearlypartofthisrstmillenniumB.C.thepeopleofwesternIranwerehassledbyAssyriaandUrartuaswell asbyraidingScythiansfromthenorth.Ataboutthistime,theIndo-EuropeanMedesbegantomigratedownintoIran fromjusteastoftheCaspianandbytheninthcenturyB.C.theystartedtowardAssyria,BabyloniaandElam,asthe latterstillcontrolledsouthernIran. TheHittiteEmpireslowlycrumbled,pushedfromthesoutheastbytheAssyriansandfromthewestbythePhrygians, newlyarrivedfromThrace.ThelastHittitecapitalatCarchemishfelltotheAssyriansin717B.C.Butmeanwhilethe Phrygianswiththeirmostfamousking,Midas,withacapitalcityofGordiumnearmodernAnkara,contendedwith AssyriaandEgyptformasteroftheNearEast.TheyworshippedthegoddessCybeleandtheyounggodAtys,who likeAdoni,annuallydiedandwasresurrected,intheinevitablepatternofthemid-east.Atthecloseofthe8thcentury B.C.,bandsofCimmerianhorsemenfromthesteppeofsouthernRussiaraidedfarandwideinAsiaMinor,eventually destroyingthePhrygiannation.TheLydians,livingbetweentheCaysterandtheHermusriverswereabletorepelthe invadersandsoontookovertheentirearea.Ref.28[48] InUrartuintheeast,theHurrianVannicnationrecoveredfromearlierwavesofAssyrianattacksandabout800B.C. becameaverypowerfulnationknownastheUrartianKingdomwithMountAraratasitscenter.Recentexcavations nearAltinepe,Turkey,haverevealedarchitectureandartthathaveleftheritagesinlaterpublicbuildingsinPersia andmetallurgythatperhapshadinuenceasfarawayastheEtruscancivilizationofItaly.Ref.161[220]They demonstratedgreatengineeringskillinirrigationworks.ProsperousunderasuccessionofkingsfromSarduriI B.C.toRusaIB.C.,UrartuattaineditsgreatestgeographicalextentinthereignofSarduriII-735B.C., withterritoryfromtheBlackSeatotheMediterranean.The"GoldenAge"mayhaveoccurredunderArgistisII B.C.whenthecountrygrewrichbyminingironandsellingittoAsiaandGreece.Someauthoritiesfeelthatthis wasthecenturywhentheArmenians,whoeventuallygavetheirnametothisarea,migratedacrosstheEuphratesand intermarriedwiththeindigenousVansandHurrians.OzgucRef.161[220],however,datesthatmigrationtothe next,7thcenturyB.C.Attheendofthisperiod,theHurriannationwasweakenedbycombinedAssyrianpressureand invasionofmigratingCimmerianhordesfromeastoftheBlackSea.Ref.8[14] NOTE :Assyriandocumentsof854B.C.tellhowGindibu,with1,000camelridersfromthe"Landofthe "Aribi"aidedtheKingofDamascusagainsttheAssyrianKingShalmaneserIIatthebattleofKarkor. OverlandtrafcwithcamelsnorthandsouthinthepeninsulabecamesaferthanwatertrafcontheRed Sea,withitsoff-shoreislandsandreefsandviciouspirates.Smallcitiesnearoasesorspring-fedwellsgrew intointernationalcenters,richingoodsandcultureinthisrstmillenniumB.C.AnexampleTaimainthe

PAGE 128

116 CHAPTER7.1000TO700B.C. north,whereareligiousreformer,Nabonidus,movedfromBabylonandbuiltagreatpalace.Thecitywas surroundedbysevenmilesofwall.Ref.315[125] NOTE :Thefundamentaladministrativedevicesfortheexerciseofimperialpowerweredevelopedbythe AssyriansandthesesubsequentlyremainedfairlystandardintheMiddleEastuptothe19thcentury.The Assyrians,ratherthanthesteppenomads,mayhavepioneeredcavalryintheuseofpairedhorsemen,with oneriderholdingbothsetsofreinssothatthesecondridercouldusebothhandsforhisbow.Ref.279 [191] ForwardtoTheNearEast:700to601B.C.Section8.3 ChooseDifferentRegion 1.IntrotoEraSection7.1 2.AfricaSection7.2 3.AmericaSection7.9 4.CentralandNorthernAsiaSection7.5 5.TheFarEastSection7.7 6.TheIndianSubcontinentSection7.6 7.TheNearEastSection7.3 8.PacicSection7.8 7.4Europe:1000to700B.C. 6 7.4.1EUROPE BacktoEurope1500to1000B.C.Section6.4 Thegreatislandempiresofpreviouscenturiesnolongerexisted,andalloftheseareaswereintegralpartsofeither GreeceorAsianstates.Forexample,thesouthernhalfofCypruswasnowunderPhoenicianinuence,whilethe northernhalf,alongwith RhodesandCretewereunderGreekcontrol.Atvariousperiodsaround800B.C.Assyrians,EgyptiansandPersians conqueredCyprus,butletnativekingsrule.DorianGreekscontinuedtocontrolCrete,however.Ref.38[59] AstheclassicalGreeksmultipliedandmigrateddownthepeninsulatheydidnotdevelopacivilizationoftheirown but,asbarbarians,theywreckedoneCretanandMycenaeanandthenbuiltanewoneoutoftheold.TheMycenaean citiesandcultureweresodestroyedthateventheartofwritingwaslostuntilabout800B.C.whentheGreeksadapted thePhoenicianalphabettotheirlanguage.Ref.28[48]"Alpha","beta","gamma"arenotGreekwords,butcome fromSemitictermsforox,houseandcamel. Thedevelopmentofironworkingtechniquesalsocontributedtoculturalchangeandawellproportioned"geometric" potteryappearedabout900B.C.ThislaterturnedupinEtruriainItaly,perhapsascopies.EarlyGreecewasnotfertile enoughtosupportafast-growingpopulationandtheneedformoreland,coupledwithpoliticaloppressionbythe rulingclassesledtotwohundredyearsofextensivecolonialexpansioninvolvingalltheshoresoftheMediterranean 6 Thiscontentisavailableonlineat.

PAGE 129

117 aswellastheAegeanislands,Sicily,andThrace.Thecoloniessoonbecameindependentofthemothercities,which continuedtoghtamongthemselves.Thucydidesdatestheearliestseabattleofhistorytoabout712B.C.between CorinthiansandCorcyraeans.Corinthwasformedfromtheunionofagroupofvillagesearlyinthe8thcenturyB.C. andsoonwaswealthybecauseitwasonthekeylandroutebetweenalltheHellenesso-namedfromthemythical KingHellen,progenitorofallGreekpeoples. TheGreeksaddedvowelstothePhoenicianalphabet,andsoontheirlanguageandtheirloveofbeautyfusedintothe Greekgeniuswhichtransformedtheworldofthattime. NOTE:InsertMapReference97:GreekandPheonicianColonies TherstOlympiadwasheldin776B.C.Ref.45[66],216[291],68[106],75[115] Thefertile,woodedislandofEuboea,justofftheGreekcoastbecameagreatmaritimepoweraboutthe9thcentury B.C.establishingatradingpostatAlMinaonthecoastofSyriawhichsubsequentlybecameagreatsourceofgold andsilver.Similarly,inthe8thcenturyB.C.theyestablishedatradingpostontheislandofPithecusaeoffthewest coastofItalyfordevelopmentoftradewiththeEtruscancity-states.R-75 TheupperBalkanareaseethedwithDacians,ThraciansandGreeksandatthistimeahordeofferocious,bearded, barbariangiants,theScythians,appearedaroundtheBlackSea,displacingtheCimmeriansfromaroundthenorth shoreandtheCrimea. Atthesametime,theGreekswerebringingcivilizationbackintotheareaofThracewithvariouscoloniesalong theAegeancoast.IronworkingwaswellestablishedalongtheThracianandIllyrianareas.ColinRenfrewRef. 179[244]believesthattheThraciangold-smiths,workinginBulgaria,werethedescendantsoftheCopperAge mound-makersdescribedinearlierchapters. TheTerramarepeopleshadalreadyspreadthrougheasternItalyandpartofSicilybytheeraunderdiscussionand probablybecametheSamnite,SabineandLatintribes,asmentionedinthelastchapter.InEtruria,betweentheArno andtheTiber,inthe10thand9thcenturies,B.C.thereweregroupsofIronAgevillagesandbythenextcentury specialbronzesbegantobeimportedfromSardinia.Between750and700B.C.varioushilltopvillagesinthis Etruscanareabegantobeconsolidatedintocity-states,withtrueurbanization.TherstwasTarquinii,somemiles northoftheTibermouthonthewestcoast;thenCaeretothesouth,reachingtheTiber;thenVulcitothenorthof Tarquinii;andnallyClusiumandVeii,asinlandcity-states.AllwerefundamentallyEtruscanpeople,speakinga non-lndo-EuropeanlanguagewhichwasknownlatertoeducatedRomans,butwhichremainsessentiallyuntranslated today.Therstthreecity-statesmentionedabovebecameindependentlystrongseapowers,withlargetradepotentials basedonenormouscopper,ironandtinminesinthemountainsoftheirrespectiveregions.Theytradedthesemuch wantedmetalsforgold,rstthroughthePhoeniciansfromSidonandTyre,thenafter800B.C.withCarthaginians whoestablishedcommercialoutpostsinItaly,SardiniaandSicily,aswellasinFranceandSpain.Inthe8thcentury itwastheGreeksfromtheislandofEuboeawhoestablishedtheirlargetradingcentersontheislandofPithecusae andonthemainlandnearbyatCumae,togetthemetalsfromthevariousEtruscancity-statesandtheEtruscanheld islandofElba.TheEuboeanconnectionswithSyriaandAsiaMinoralsoallowedthedistributionofOrientalobjects inEtruria.AnotherproductfromtheregionofCampigliesewasalum,usedparticularlyasabinderinthedyeingof fabricsandshoe-leather,bothofwhichwereEtruscanspecialties. About1,000B.C.VillanovanmigrantsfromtheDanube,usingiron,crossedtheTiberandsettledinLatium,exterminatingormarryingtheexistingpopulation.Therewasundoubtedlyagreatdealofshiftingofpopulationsandmanyof theVillanovansmayhavebecomeassimilatedintotheEtruscancity-statesandcertainlymanyGreeksbecamepermanentresidentsthere,bringingmuchoftheirculturewiththem.TheEtruscansofTarquiniispreadsouthwardacrossthe

PAGE 130

118 CHAPTER7.1000TO700B.C. TibertoCapuaasearlyas800B.C.probablytofacilitatetradewithCumae.ItisamistaketoconsidertheEtruscansas asingle,homogenousgroup,astheylivedintheirseparatecity-states,sometimestradingwitheachother,sometimes ghtingandusuallyfailingineveryattemptatanycoordinatedefforts.GrantRef.75[115]saysthattheywere muchlikethemodernJapaneseinthattheyweregreatimitatorsandtheycopiedallGreekworksofart,addingsome oftheirownimprovementsanduniquevariations. ThereweresettlementsofsometypeatRomeprobablythroughthe10thand9thcenturiesB.C.,butthetraditional datefortheofcialsettlementofRomeisalwaysgivenas753B.C.JustacrosstheTibertheEtruscancity-stateof Veiiwasformedbyacoalitionofvillagesbetween750and700B.C..Ancientwriterssaidthatithadapopulationof 100,000butthiswasundoubtedlyanexaggeration,althoughitprobablywasaslargeasAthens.Veiihadnometals, butbecamerichfromagricultureandthesaltbedsatthemouthoftheTiber.Rock-cutarcheddrainagechannelsand tunnels,sometimestwomileslong,weremadetofacilitatedrainageandtheirroadswereexcellent. BasedonHerodotus'reportsfromLydiansources,thetraditionalconceptwasthattheEtruscanscamefromLydiain AsiaMinor,butalmostallmodernauthoritiesfeelthatthisiscompletelyinerror.Ref.75.McEvedyRef.136 [187]believestheEtruscanswerenativesoftheoldIberiangroupandthattheirhigherculturedevelopedfromearly contactwithGreekswhowereinterestedintheElbanandEtrurianironandcopperdeposits.Thisviewisstrengthened bytheCambridgeUniversityEncyclopediaofArcheologyRef.45[66]whichsaysthatthe10,000knownEtruscan inscriptionsbelongtoanoldMediterraneansubstratumstilllargelyundeciphered.MichaelGrantRef.75gave furtherdocumentationofthisviewin1980.Itisofinterestthatnon-Indo-Europeanlanguageswerealsospokenby theLiguriansandRaetiansofnorthernItaly,theCorsicans,SardiniansandtheSicansofwesternSicily.Tharroswas aPhoenicianportonthewestsideofSardiniawhichreceivedgoldfromSpainandthentradeditextensivelywiththe Etruscancitiesfortheirownmetalandagriculturalproducts.ItwasthewealthiestofalltheSardiniancities,with multipleworkshopsforproductionofgold,silver,preciousgemjewelryandornaments.Ref.75[115]Bronze objectsfromtheseSardinianworkshopswerearrivingatEtruscanharborsthroughoutthe9thand8thcenturiesB.C.In otherpartsofItaly,proper,thereweretheIronAgegroupsofPicentes,VenetiandIapyges.SomeEtruscancity-states, particularlyVolaterraeandClusium,alsoextendedtheirtradeandinuencenorthintotheTransalpineregions.By750 B.C.,underthisimpulse,Felsina 7 hadbecomeaneconomicpower,asanamalgamationofvillageswitheasyaccess toEtruria. About1,000B.C.variousbranchesoftheUrneldCulture,agroupofrelatedtribeswithcommoncultureandburial practices,dominatedtheRhine/Danubeaxis,andbegantoexpandintovalleysofthemainriverthoroughfares.Four mainbranchesgaverisetoimportantgroupsofhistoricpeoples:CeltsinthewestalongtheupperMain,Moselleand theRhone,SlavsinthenorthfromtheElbetoeastoftheOder,Italic-speakersintheregionofHungaryandIllyrians inthesoutheastabouttheriverTiszaandMuresul.Ref.8[14]SomewouldsaythattheCeltsdidnotreallyemerge asadistinctpeopleofcommonlanguage,religionandcultureuntilaboutthe8thcenturyB.C.,andasmanifestedin theHallstadtCulture-500B.C. 8 ,locatedneartherichestsaltdepositsinEuropeanddenitelyinuencedby theEtruscansfromthesouth.In1846some1,100graveswereopenedintheNiederaswellastheHallstadtregions ofAustria,showingtheextensiveironutilizationanddecorationofthisCelticAge.TheCeltswereenergeticand inventive,usingironfortoolsandweapons."TheyintroducedsoaptotheGreeksandRomans,inventedchainarmor, werersttoshoehorsesandgiveshapetohandsaws,chisels,lesandothertoolsweusetoday.Theydeveloped seamlessironrimsfortheirwheels,setourstandard4feet81/2inchrailroadgaugewiththespanoftheirchariots, pioneeredtheironplowshare,therotaryourmill,awheeledharvestertwomillenniabeforeCyrusMcCormick 9 FarthernorththerewaseverincreasingpressurefromtheGermanictribeswithsomeTeutonsalreadymovingupthe ElbeandRhine.TheoldestGermanicwindinstrumentsdatebackto800B.C.InatriangularareainnorthernEurope boundedbytheriversAllerandSaalinthewest,alinerunningeastfromtheriverSommetotheTaunusmountains 7 "Felsina"wasanEtruscanname,latercalled"Bononia"byRomans,aftertheconqueringBoiiGaulictribe.Itisnow"Bologna". 8 HermRef.91[135]datestheHallstadtCulturefrom700to450B.C. 9 FromMerleSeveryRef.194[266],page588.

PAGE 131

119 totheheadoftheSaal,andbytheNorthSeacoastonthenorthwest,therewerenoCelts,andbeforetheGermanic tribesbegantheirmigrationsfromtheeastandnorth,thepeopleinthisareaspokeanolderlanguagethaneitherCeltic orGerman.Someplace-namesinthisregionstillbearthestampofthisunknowntongue,anotherexampleofancient EuropeanswhodidnotspeakanIndo-Europeantongue.Ref.8,91 Intheearlypartofthisperiod,thepeopleofwesternEuropewereinamiddleBronzeAge,speakinglanguagesat presentunknown.InSpainthePhoenicianshadreachedthelowerreachesoftheGuadalquivirRiverinAndalusiaand theytradedformetalsminedbythenatives,whoseemtohavebeenmainlyBasques.ThelargestPhoeniciancitywas TarshishGreek-TartessosandthescripttheyusediscalledTartessian,anonlyslightlymodiedPhoenician.The shipsofTarshishwerethelargestsea-goingvesselsknowntotheancientworld. TherstIndo-EuropeanspeakingtribeswhoemigratedintoFrancebetween900and700B.C.ranintotheLigurians whowereshort,muscularfarmers,dangerousinbattle.TheyhadalreadyhadcontactwithGreektradersandGreek civilization.Ref.91Bytheendofthe8thcenturyB.C.Indo-Europeanpeopleswerepouringintoallareasofwestern EuropeandevenbeforethattherewasextensivetradingoccurringfromthecontinenttoBritain,asevidencedbythe importedtools,weaponsandtrinkets.ItwillberecalledthatthepossibilityofstillearliermigrationsofCeltic-speaking peopletotheBritishIsleswasmentionedinthelastchapter.ItispossiblethatthePictsofScotlandweredescended fromtheprehistoricAbernethyCulture,peoplewhomayhavemigratedfromGermanytoScotlandabout1,000B.C. OurverylimitedknowledgeoftheirlanguagesuggestsamixtureofCelticandsomeolderspeech.Theywereexcellent metalsmithsandhadasymbolicartwhichsurvivesonsomestones.Ref.65,43,45. DenmarkcontinuedinanextendedBronzeAgewithanon-egalitariansocietybasedonamixedfarmingandherding economy.ButtheDaneswerealsohighlyskilledmetallurgistsandcarpentersandhadcontactswithcentralEurope. Thepoliticalleaderwasalsothereligiousleaderandtherewasaneliteclasswhocontrolledtradeandreligion.While intheearlyBronzeAge,precedingtheperiodunderdiscussion,thedeadwereburiedinwoodencofns,inlatertimes ,100-500B.C.cremationwascommonandtheasheswereoftenplacedinapotteryurn.Archaeologistshave uncoveredabout350hoardsofbronzeandoccasionalgoldobjectswhichmayhaverepresentedreligiousofferingsof somekind.Theobjectsincludedtools,swords,neckrings,armbands,brooches,beltornaments,buckets,cups,bridle bitsandshields,allofexcellentworkmanship,perhapsconstructedbyveryspecializedcraftsmen.Eighty-oneofthe hoards,datedfromthe9thtothe8thcenturies,B.C.,allcontainwomen'sornamentsinwhatappeartobespecialsets. Thepresenceofanimalbonesandharvestingsicklesinsomehoardssuggestthatpartofthepurposeofthehoardswas toinsurefertilityofthecropsandherds.Ref.257TheDanesalsodevelopedtheirownIronAge,usingbog-iron. ThepeopleofJutlandofthisperiodweretheVandalsaboutwhomweshallhearmuchmoreinlaterchapters. SouthernSwedenalsocontinueditsBronzeAgecultureatthistimeandtherewasageneralspreadofTeutonictribes throughoutthearea. AlongtheBalticcoastwereGermantribesandBalts.FromtheElbeeasttobeyondtheOderweretheproto-Slav, UrneldCultureLusatians,destinedtobecometheWesterngroupwhichhadmigratedfromtheeastCarpathiansto theDnieperareabecametheEasternSlavs.Some140milesnorthwestofWarsawtheLusatiantownofBiskupin hasbeenexcavated,showinganextra-ordinarystoneenclosedareaofveacreswithonehundredidenticalhouses arrangedinthirteenrows,allmadeofoakandpine.a130yard-longwoodencausewaylinkedthecity,whichwas originallyonanislandinalake,tothemainland.Itisobviousthatinadditiontobeingskilledintheuseofwoodthese peoplehadahighsocialdevelopment,andsomefeelthattheirknowledgewascarriedoverlatertotheDruidsofthe Celticpeople.

PAGE 132

120 CHAPTER7.1000TO700B.C. By800B.C.theEasternSlavswerecompletelyconqueredbytheferociousScythianswhotookovertheareaabout theBlackSea.TheSlavsofthisregionweretheancestorsoftheRussian,UkranianandWhiteRussianpeoples,and theyhadaninnateaptitudeforworkinmetal.TheScythianswereprimarilyofIndo-Europeanstockbutmayhavehad someaddedMongolelements.InadditiontodominatingthelocalSlavs,theScythiansdisplacedtheCimmerianswho hadpreviouslyoccupiedthenorthshoreoftheBlackSeaabouttheScythiansbecausemuchthathasbeendescribed aboutthemhascomefromHerodotus'ThePersianWarsRef.92andonemustalwaystakethistales"withagrain ofsalt".InBookIVhedescribedavisittoScythiaandwroteoftheirlegendsandcustoms.Theseincludedvarious barbarousactivitiesincludingtheirpropensityforbeheadinganenemy,thenskinninghimandmakingcoats,capsand cushionsfromtheskin.Theskullsmayhavebeenusedfordrinkingcups,aftergildingoftheinteriors.Thebloodof therstvictimwasalwaysdrunkandscalpsweretakentobelaterusedasnapkins.Herodutustoldofhard,cruelmen withleatheryskin,lthyhair,wildcavernouseyesandmanywives,alllovingstrongwineandsmokinghashishwhile livingchieyinthesaddle.Ref.92,176,8Theymustnothavebeencompletelysavage,however,asarcheologists haveshownthattheyproducedhighlydevelopedartsandcraftswithgoldnecklaces,miniature,castanimalgures anddelicateglassware.Ref.91****Page1185AdditionalNotesp.120 NOTE :TheScythianscamefromtheAltaimountainregionsofAsia.Ref.279 ForwardtoEurope:700to601Section8.1 7.5CentralandNorthernAsia:1000to700B.C. 10 7.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:1500to1000B.C.Section6.5 SouthcentralAsiawasnowoccupiedbyvariousmigratingIndo-Europeantribes,somemovinggraduallysouthbetweentheAralandCaspianseasandothersmovingwesttowardthesouthernRussiansteppe.Ordos,theregionof MongolialyinginsidetheloopoftheYellowRiverwhereitturnsnorth,wasinhabitedbynomadictribes,including theHsiung-nu,anAltaic-speakingMongoloidpeople. 11 Broaddaggers,curvedknives,harnessornamentsandbelt plaqueswithanimalproleshavebeenamongtheremnantsfound.RockcarvingsinTibetalongtheupperIndus RivervalleyinLadakhontheTibetian-Kashmirborderdating2,000to3,000yearsagoindicateStoneAgehunters withbowsandarrows.DuetoagradualcontinuedriseoftheHimalayanarcandtheresultinglesseningoftheeffective rainfallthroughthecenturiesmuchofthisareaisnowdesert.Ref.8[14],45[66],182[250] ForwardtoCentralandNorthernAsia:700to601B.C.Section8.7 7.6TheIndianSubcontinent:1000to700B.C. 12 7.6.1THEINDIANSUBCONTINENT InthelastchapterwediscussedthesouthernandeasternexpansionoftheinvadingAryans.Theirmigrationsoon becamesharplylimitedbecausethe"forestpeople"theyencounteredhadendemictropicalandparasiticalinfestations ourishinginthemoist,warmclimatewhichmeantdeathanddestructiontotheinvaders.Theaboriginalforestpeople wereonlygraduallyincorporatedinspecialcastes,thruineffectisolatingthemfromtheconquerors,andthiswas anotherelementinthedevelopmentofthecastesystem.Itwasonlyaftersomeadaptationtodiseaseandtheadvent ofiron,inabout800B.C.,thattheAryanVedicsbegantoactuallycleartheforestofnorthernIndiapreparatoryfor farmingandlargescaleagriculture.Ref.140[190],8[14] 10 Thiscontentisavailableonlineat. 11 SomeauthoritiesdenythattheHsiung-nucanbeidentiedasaseparatepeopleonthebordersofChinauntilthe2ndcenturyB.C.Seereferences 45and127andthismanuscriptunder4thcenturyB.C.,CENTRALANDNORTHERNASIA. 12 Thiscontentisavailableonlineat.

PAGE 133

121 Inthesouth,tinycommunitiesdevelopedinthefragmentedland,eachwithitsownreligious,politicalandeconomic life.DistinctivemegalithicculturesgrewuparoundMadres,KeralaandMysore.Sea-faringpeoplesatthetipofthe peninsulatradedbyseawiththeMiddleEast,shippingivory,spicesandthecottonplantstoMesopotamia.Itisof considerableinterestthatdoimens,verysimilartothoseofEurope'ssecondandthirdmillenniaB.C.,havebeenfound throughoutIndia,butnoneseemtodatebeforethe8thcenturyB.C.andsomemuchlater.Ref.8[14],136[187], 215[290] TheorganizationandwritingoftheVedasritualsbeganabout1,000B.C.andprobablycontinuedfor500years.The writingoftheUpanishadsbeganabout800B.C.andcontinuedforabout300years.Thelatterconsistedof108 discoursesbyvariousteachers,saintsandsageswiththeresultingopinionsandphilosophiesofmanymen.Thebelief intransmigrationappearedthere.AccordingtoToynbee'stheoriesRef.220[294]thisistheheightoftheoriginal VedicSociety.OfincidentalnoteisthelegendinSriLankathatKingSolomonsentemissariestothefabledcityof Gems,Ratnapura,togetpreciousstoneswithwhichtowootheQueenofSheba.Ref.108[153] 7.7TheFarEast:1000to700B.C. 13 7.7.1THEFAREAST BacktoTheFarEast:1500to1000B.C.Section6.7 TheleadersoftheChouDynastyrewardedtheiraidesbymakingthemalmostindependentrulersofthemanyprovinces intowhichthenewrealmwasdivided,thussettingthestageforafeudalismwhicheventuallyproveddangerousto government,butstimulatingtoChineselettersandphilosophy.AtsometimeduringthisperiodtheInstitutionsofChou wascompleted,detailingthedutiesandorganizationsorphysicians.Hao,southoftheWeiRiver,wastheChoucapital until771B.C.whenthelastkingoftheWesternChouDynastywaskilledbyanoble,ashiscapitalwasoverrunby Northerners.AyearlaterhissonproclaimedLo-Yang,southoftheYellowRiverinHonan,ashiscapital.Thisstarted thetimeoftheEasternChouDynasty,butthemainfunctionsofthekingthenbegantobechieyceremonial,asthe variousarealordscontrolledtheirownsections.Thisfeudalagewastolastforsome500years.Itwasdifferentfrom EuropeanfeudalisminthattheChourulingclasswasprincipallyuniedbykinshiptiesandthekingwasconsidered astheheadofavastfamily.By700B.C.therewerethreepowerfulfeudalstatesgivingonlylip-servicetotheChou king.ThesewereCh'inintheoldroyaldomaininShensi,ChininthenorthandCh'iintheeast.Thissubdivisionof theEasternChou,whichlastedover250years-481B.C.iscalledthe"SpringandAutumn"era,afterthename "Ch'unch'iu"whichhasthesamemeaning.Ref.101[146],125[173]AdditionalNotes Althoughthereweresome200Choustateletsbythe8thcenturyB.C.therewerestillmanynon-Chinesepeopleabout theborderswhostillhadsometimesmilitaryandsometimesdiplomaticcontactwiththeChoucourt.Inthenorthwere the"Ti",inthewestandcentraluplandsthe"Jung",ontheeasterncoastthe"I"andinthesouthallnon-Chinesewere lumpedtogetheras"Man".IntheYangtzedeltaregionwasaloosepoliticalentitycalled"Wu"andfarthersoutha Yuehstate. Fromthephilosophicalstandpoint,therewasnowashiftfromthefearofspiritualbeingstoemphasisonhuman behaviorandthegroundworkwaslaidforthelaterhumanisticthoughtsofConfucius.TechnicallytheChinesealso advancedandevenbuilticehouseswhichwerekeptcoolbyevaporation.Theydevelopedacurvedmouldboard plowwhichoverturnedtheslicedsod,andwasusedcontinuouslythereafterforricecultivation.Thisadvancementin agriculturewasnotusedinEuropeforanother1,400years.Ref.26[47],211[284],213[288] 13 Thiscontentisavailableonlineat.

PAGE 134

122 CHAPTER7.1000TO700B.C. BythebeginningoftherstmillenniumB.C.,thenorthernAinupeoplehadextendeddowntothecentralislandof Honshu,whilethesouthernaborigines,speakingaformofJapanese,ledsedentarylivesasshell-sheaters.This situationcontinueduntilabout500B.C.Ref.12[21] Theseareasremainedessentiallyasnotedinthelastchapterp.104.AdditionalNotes ForwardtoTheFarEast:700to601B.C.Section8.4 ChooseDifferentRegion 1.IntrotoEraSection7.1 2.AfricaSection7.2 3.AmericaSection7.9 4.CentralandNorthernAsiaSection7.5 5.EuropeSection7.4 6.TheIndianSubcontinentSection7.6 7.TheNearEastSection7.3 8.PacicSection7.8 NOTE :SomescholarsthinkthatthecollapseoftheWesternChouDynastyin771B.C.mayhavebeena resultofaScythiancavalryraidfromtheAltairegion.TherecordsofcavalryharassmentfromMongolia arenotclearuntilthoseofthe4thcenturyB.C.Ref.279[191] NOTE :RecentaerialphotographyoverKhoratPlateauinThailandhasrevealedevidenceof60moated settlementsfrom1to400acresinsize,datingbacktothis1stmillenniumB.C.Thissuggeststhebeginning ofcentralizationinthatregion.Ref.297[232] 7.8ThePacic:1000to700B.C. 14 7.8.1THEPACIFIC BacktoThePacic:1500to1000B.C.Section6.8 Asmentionedinthelastchapter,FellRef.65[96]writesthatwesternPaciclanguagesweregreatlyinuencedby LibyansailorsastheyhelpedtheEgyptiansminegoldinSumatra.Fellactuallyusedtheterm"Polynesian"whenhe probablyshouldhaveused"Melanesian"or"Micronesian"whereNeolithiccultureswereknowntohaveourishedat thattime.Furthermore,itmustbenotedthatthiswholeidealacksconrmationbyanyothersourcematerialavailable totheauthor.Whileweareoncontroversialground,itseemsappropriatetointroducethetheoriesofThorHeyerdahl concerningtheentirePacicregion.Heyerdahlisabonadeprofessorofanthropologyandbiologywithhisown museumatOslo,withsomefollowingonthecontinent,butwhoseworkhasnotbeenwhole-heartedlyacceptedinthe UnitedStates.Whetherthisistheresultofthefrequentsuspicionofconservativeprofessionalsinanyeldforthose oftheirnumberswhowriteforpublicconsumptionandprot,ornot,remainstobedetermined.Thefactsremainthat hehasdoneseveralyearsresearchinthesouthernPacicandpresentsanenormousamountofmaterialthatwouldbe difculttorefute.Wethereforepresenthisideasforseriousconsideration. WemuststartwiththerealizationthatthePacicOceancoversone-halfoftheearth'ssurfaceandis,itself,ahemiglobewithonlyinnitesimalamountsoflandscatteredatgreatdistancesasislandsacrossitsvastexpanse.IfNew Zealandisexcluded,thecombinedsurfaceareasofthePacicislandswouldnotcoveranareahalfaslargeasNew 14 Thiscontentisavailableonlineat.

PAGE 135

123 YorkState.Micronesiaisthatgroupofcoralatollsbarelyrisingabovetheoceansurfaceandintotalsurfacearea lessthanthatofLongIslandandwhichislocatedeastofAsiaandnorthoftheequatorbutinanoceanareaequating thetotalwidthoftheAtlantic.SouthofMicronesiaandtheequatorisPapua-Melanesia,asimilarlywidewaterarea beginningwheretheIndonesianarchipelagoendsandstretching4,000milesfromwesternNewGuineatoeasternFiji. Thesearelarge,highislandsofcontinentaltype,formingalmostanuninterruptedbridgeeastward,leavingonlyFiji asanoceanicgroupdistinctfromtherest.EastofbothMicronesiaandMelanesia,runningbothaboveandbelowthe equator,liesPolynesia,agroupofislandsandatollslyinginatrianglewithHawaiiatthenorth,NewZealandinthe southandEasterIslandintheeast. ThesettlingofPapua-MelanesiabyStoneAgepeople,travellingalmostbyfootoverlandbridgesinprehistoric timesSeeThePacic:Beginningto8000B.C.Section2.8hasneverbeendisputed.ExceptperhapsforFiji,no navigationalproblemswereencountered.TheproblemofthesettlementofMicronesiaismorecomplicated,although mostscholarsareagreedthatthetribesthererepresentamixtureofunidentiedpeoplewithlaterintrudersfromboth MelanesianandPolynesianareas.Windsandoceancurrentswouldfavoroverseasdriftsfrombothoftheseareas. ThesettlingofPolynesiaisstillundercontroversy.Theclassicalconcept,stillpropoundedinmosthistories,isthat thePolynesianislandswereuninhabiteduntilfairlyrecenttimesi.e.A.D.600to1,000whenthepeoplespreadby outriggercanoesfromMelanesiaandSoutheastAsia.ButHeyerdahlandothershavequiteconvincinglydemonstrated twofallaciesinthisconcept.Firstofall,thereisnowarcheologicalevidencethatthePolynesianislandswereoccupied longbeforethetruePolynesiansasweknownthemtodayeverappeared,andsecondlyitcanbeshownthatitwas impossibletosailorcanoeeastwardfromAsiainthesouthernPacictotheeasternPacicuntilthetimeofvery modernsailingships.EventhegreatSpanishvesselsofMendanaandothersinthe16thcenturyoftheChristian EracouldnotsaildirectlyeastfromMelanesiaandMicronesia,becauseoftheverystrongwestwardcurrents.After arrivinginthewestPacictheyalwaysre-turnedhometoEuropebygoingonwestacrosstheIndianOceanand aroundthesoutherntipofAfrica.TheonlypossiblesearoutefromIndonesiatoAmericabyprimitivecraftwasnorth upalongJapanontheUrdanetaRoutetobetweentheAleutianislandsandHawaiitothecoastofNorthAmerica. AllofPolynesiacanbeeasilyreached,ontheotherhand,fromAmerica,evenbyprimitiverafts.Thislatterfacthas beendemonstratedbyHeyerdahlwithhisKonTikirafttripfromEcuadorwestwardacrossthePacic.Theessence ofHeyerdahl'stheoriesisthattheoriginalpeopleoftheeasternPacicislandscamefromtheancientcivilizations ofEcuador,PeruandperhapsMexicoandwerenotthepeoplewethinkoftodayasPolynesians.Thelattercame muchlater.Thesituationisbestexempliedbystudiesofthepeople,archeologyandhistoryofEasterIsland.An oldtraditionofthatislandinsiststhattheisland'searliestancestorscamefromavastdesertlandtotheeastandthat thesailingtimefromtheoriginalhome-landwassixtydays.Someoftheearlypeopleallegedlywereofwhiteskin andofthesesomehadredhair,whileothersweredark-skinnedwithdarkhair.Bothofthesetypesweredescribed byearlyEuropeanvisitorstotheisland,suchastheDutchRoggeveen,in1722.Wecannotheredetailallthedata whichhasbeenpresentedasevidence,butHeyerdahlisquiteconvincinginhistheorythatEasterIslandandothersof thePolynesiangroupwereearlypopulatedbypre-IncasailorsfromSouthAmerica,particularlyfromtheTiahuanaco civilizationwhichwouldhavebeentheclosesttoEasterIsland.Itmustbeemphasized,however,thattomakethis assumptionreasonable,onemustalsoaccepttheideathattheTiahuanacocivilizationandothersinearlyAmerica mighthavebeeninstigatedbyMediterraneanvoyagers.EarlygraveandmummystudiesintheTiahuanacoareaof the19thcenturyC.E.haveconrmedthatsomeweredenitelydifferentfromtypicalAmerindians.Particularlyithas beennotedthatthehairwasnotthatofAmerindians,butneintexture.Inpre-Incatimes,Peruprobablyhadamixed populationandfromtheresuchamixedgroupcouldeasilyhavereachedPolynesiainoneormoremigrationwaves. ThisentireconceptisstrengthenedbythewritingsoftheeminentFrencharcheologist,FredericAndreEngel,whohas workedforovertwentyyearsinPeruandwhosaysthattheGalapagosgroupandEasterIslandmusthaveplayedapart inearlySouthAmericanhistorysincepre-ColumbianpotteryhasbeenfoundontheGalapagosanditisnotdifcult tocomparethegreatstatuesofcertainSouthAmericanstatesandthoseofEasterIslandandthepolyhedralwallsof Cuzco,PeruandthoseoftheMarquesasislandsofPolynesia.Othersalsowritethatpermanentsettlementsweremade between1,000and500B.C.inPolynesia,fromwhateversource.Ref.95[140],62[91],134[184] ForwardtoThePacic:700to601B.C.Section8.5

PAGE 136

124 CHAPTER7.1000TO700B.C. ChooseDifferentRegion 1.IntrotoEraSection7.1 2.AfricaSection7.2 3.AmericaSection7.9 4.CentralandNorthernAsiaSection7.5 5.EuropeSection7.4 6.TheFarEastSection7.7 7.TheIndianSubcontinentSection7.6 8.TheNearEastSection7.3 7.9America:1000to700B.C. 15 7.9.1AMERICA BacktoAmerica:1500to1000B.C.Section6.9 TheArcticSmallTooltraditioncontinuedinthefarnorth.CenteredattheFraserRiverdeltaabout1,000B.C.and extendingfromsouthernAlaskadowntonorthernCalifornia,wastheNorthwestCoastTradition.EskimoandOld Cordillerantraditionsmayhavecontributedtothissocietywhichincludedhuntingandgatheringofmultipleriver andmarinefoods-mollusks,salmon,halibut,whale,sealandseaotter.Outofwoodthepeoplemadecanoes,plank houses,carvedhouseholditemsandwoodenslatarmorthatmayhavebeenderiveddirectlyfromAsia.Ref.45[66] IntheUnitedStatesarea,theBurialMoundIperiodoftheWoodlandtraditionwastypiedbytheAdenaCulture ofOhio,Indiana,Kentucky,PennsylvaniaandWestVirginia.Similarareascouldbefound,however,fromCanada throughMinnesotaanddowntotheLouisiana-Texasborder.Thecharacteristictraitswerewoodlandpottery,burial mounds,someashighas66feet,andthebeginningsofagriculture.Indianslivedinsmall,scatteredvillageswith roundhouses,usingwattleforwallsandthatchforroofs.Ref.45[66],215[290]InsoutheastUnitedStatesan Archaictypeofcultureextendedthroughouttheperiodunderreview.StudiesofremainshavebeenmadeintheSt. JohnRiverofFloridaandtheSavannahRivercultureoftherivervalleybythesamename.Themajorweaponwas ashortheavyspearpropelledbyathrowingstickwhilebonesh-hooks,stonenetweightsandstoneaxeshavebeen found.Fibertemperedpotteryhadbeeninuseinthisareaforalongtime.Ref.258[264] AndnowwemustmentiontherecentandverycontroversialworkofoneBarryFell.ProfessorFellisateacher ofmarinebiologyatHarvardUniversity,buthealsoclaimsanextensiveeducationinancientCelticlanguagesat EdinburghUniversityandthusprofessestobeoneofthefewwhocanreadancientscriptsinCelticandotherancient tongues,includingEgyptian,PhoenicianandLibyan.ItishisassertionthatinvariouspartsoftheUnitedStateshe hasfoundstoneinscriptionsinthoseancienttongues,seemingtoprovethatthosepeoplevisitedorevencolonized partsofAmericainthisearlyperiod.Ofspecialnote,inthetimebracketofthischapter,ishisclaimofPhoenician inscriptions,writtenintheCelticalphabet,atasitecalledMysteryHill,NewHampshire,datedto800to600B.C. HefeelsthatGoedelicCeltsfromSpainandPortugalexploredandsettledmultipleareasinNewEnglandduringthe rstmillenniumB.C.andthatthePunicphasejustmentionedundoubtedlyfollowedanoriginalCelticoccupation.In addition,hehasallegedlytranslatedtheso-calledPontotocsteleofOklahomaasanextractfromthe"HymntoAton", achantofthepharaohAkhnaton,datingfromthe13thcenturyB.C.,althoughFellsaystheOklahomaversioncan 15 Thiscontentisavailableonlineat.

PAGE 137

125 scarcelybeolderthanabout800B.C.,believingitwastheworkofanearlyIberiancolonistwritinginthescriptfrom theCachao-da-RaparegionofnorthernPortugal.SimilarlyhewritesthattheDavenportsteleofIowahasthreeseparate scripts,-EgyptianhieroglyphicsalongsideIberianandLibyanscripts.Previouslythesestelaehadbeenconsideredas fakes.Fell'sinterestinghypotheseshavenotyetbeengenerallyacceptedandseemtohavebeenmoreorlessignored bytheprofessionalarcheologists.Ref.122[170] IntheCochiseareaofsouthwestUnitedStatesanewandmorevigorousstrainofcornwasimportedfromMexico about1,000B.C.Anewplant,theredkidneybean,alsoappearedastheCochisebegantobuildsimplepit-housesand groupthemselvestogetherinsmallvillages.Asagriculturalactivitiesmadeeasierliving,theyhadtimetodevelop earlypotteryformsandsoongurinesofpeopleandanimals.FindingsintherefuseoftheVentanaCave,some100 milesfromTucson,haverevealedthesegradualchangesfromhuntertofarmer.Ref.210[283],CENTRALAMERICA,ANDTHECARIBBEAN InpreviouschapterswehavementionedtheearlyculturesinbothOaxacaandTehuacanwhichareadjacentareasin southernMexico.AtTehuacantheAjalpanculturalphaseranfrom1,500to850B.C.andexcavationshaverevealed thatabout40%oftheirdietcamefromagriculturalproducts,31%fromwildplantsand29%frommeat.Various settlementswerescatteredalongthewaterways,withcavesforsummeroccupationtoescapetheheat.Population increasedrapidly,asagriculturewasimproved.Thenextphase,beginningin850B.C.,wastheSantaMaria,which sawtheriseoftempledvillages,agurinecult,andsomeirrigation.Ref.259[174]TheZapotecsofMonteAlban Oaxacadevelopedtruecivilizationswithpopulationsinthetensofthousands,ahierarchyofsocialclasses,acivil service,priesthoodsandspecialistsincommerce,administrationandgovernment. TheOlmecsatthebaseoftheYucatanpeninsulahadsimilarprogressandadistinctiveculturedominatedbyapowerful religionwithskyorraindeitiesintheformofjaguarpeoplewithdroopingorsnarlingfelinemouthsanddeformed heads.TheyoriginatedthebaranddotcalendarwhichtraditionallyhasbeencreditedtothelaterMayasandtheyhad nejadecarvings.Astheirpopulationincreasedtheycontinuedtoliveinvillagesscatteredthroughouttheforest,but atintervalstheybuiltimpressivecentersforceremonial,civicandperhapscommercialuse.Eachcenterwasthefocal pointforthelifeandcultureofsome10,000people. FourtypesofexoticmaizefoundinGuatemalawereentirelyconnedtothewesterncoastareaandallareofSouth Americanorigin,givingfurthersuggestionofmaritimecontactbetweenEcuador-PeruandGuatemala.CoeRef.36 [57]hasshownthatboats,evenwithoutthespecialPeruvianguarasasystemofcenter-boardsactingasadjustable keelscouldsailalongtheSouthAmerican-MiddleAmericancoasts,goingonedirectionatcertaintimesoftheyear andreversingdirectionatotherseasons,similartothemonsoonwindsystemoftheIndianOcean.Ref.45[66],155 [214],19[32],36[57]AdditionalNotesp.126 About800B.C.oneofthePeruvianstates,theChavin,underwentanexpansionmuchliketheOlmecsdidinCentral America.Thiscivilization,withsocialclasses,bureaucracies,andpriests,soonspreadthroughoutthenorthernhalfof Peru.HeyerdahlRef.95[140]writesthatthiscivilizationappearstobeadirectextensiondownthecoastfromthe Olmecbe-causethereweremultiplecloselyrelatedjunglecivilizationsinanarrowcoastalline,apparentlyincontact onewiththeotherbysea,whileoutsidethisnarrowcivilizedstriptherewasnothingbutbarbarianjungletribesof AmerindiansthroughoutVenezuela,GuianaandallofBrazil.Andyetthereweremanydifferencesbetweenthe ChavinandtheOlmec'Mesoamericahadwriting,SouthAmericadidnot;Peruhadmetallurgyby300B.C.,Mexico notuntilaboutA.D.1000.EngelRef.62[91]doesnotrelatetheSouthAmericanculturetotheOlmecs,butdoes agreethatitapparentlydevelopedrapidly,perhapsinasinglegenerationandoccupiedmostoftheareaofpresent dayPeru.BeneaththeChavinlayerarchaeologicalspeaking,occasionallycomplete"pre-ceramic"villagescanbe found.TheChavintraitsincludedlow-reliefornamentsmadeonhammeredgoldleaf,cigarsbutnotfromtobacco, carvedandpolishedstonevesselsandtoolsincludingnotchedaxesandcylindricalmaces-someofthestonepiecesso perfectthattheyseemtobereplicasofobjectspreviouslymadeinmetal.TheChavinsalsousedanthracitemirrorsand

PAGE 138

126 CHAPTER7.1000TO700B.C. constructedverylargearchitecturalunits,someseveralhundredyardslong.Thedecorativethemesalmostallderived fromvebasicsubjects,asfollows: 1.Africanstylemouthwiththicklips.SeeHeyerdahl'sideasunderCentralAmericap.106 2.Snake-likebodiesprotrudingfromdemoniacalorhumangures.Somearereminiscentofacrocodilesnout, consideredsacredinAfrica 3.Fangs,shapedlikecurvedswords 4.Crenellations,staircasesorgeometricformsrecallingmodelsofbuildingsorfortresses 5.Vesselsrepresentinghumanordemonicheads,animalsandplants ThecenteroftheChavinsocietywasthevillageofChavindeHuantar,probablyatempleat10,000feetaltitude consistingofamassivebuilding500feetlonginaninter-AndeanvalleyonthewestbankoftheMosnaRiver.Engel thinksthatChavinartmaywellbetheproductofforeignimmigration,butfromwhere?SomehavesaidSouthAsia, someChinaandMeggersRef.141[194]saystheJomonCultureofJapan.Engelisimpressedwiththeresemblance toOaxacaandVeraCruz.LasHaldasbecameanothergreatChavincomplex,measuring1,220feetlongby260feet wideandcovering71/2acres,withaplatformoverhangingtheseaataheightof130feet.Chavininuencereached asfarsouthastheMantarobasinincentralPeru,asindicatedbypotteryfoundthere.Ref.255[9] SomewoulddatethebeginningoftheTiahuanacoSocietyto800B.C.Ref.255[9]butsincethisdateremainsvery debatableandsincethefulldevelopmentofthissocietywasreachedonlylater,weshalldeferdiscussionofituntilthe 5thcenturyB.C. Inthe2ndmillenniumandthispartofthe1stmillenniumB.C.adrierclimatereducedtheAmazonianforeststo scatteredrefugesandduringthisperiodmigrationofvarioustribesmayhavebeenrelativelyeasy.Theresulting spreadmayhelptoexplainthemultiplicityoflanguagesspokentheresincethen.Ref.256[151] NOTE :HabitationbeganatColhainBelizeabout900B.C.Thiswaslatertobecomeagreattoolproduction centerbecauseofadjacentdepositsofchertnodules,asdescribedintheAdditionalNotesofthe1stcentury C.E.Ref.304[138] ForwardtoAmerica:700to601B.C.Section8.6 ChooseDifferentRegion 1.IntrotoEraSection7.1 2.AfricaSection7.2 3.CentralandNorthernAsiaSection7.5 4.EuropeSection7.4 5.TheFarEastSection7.7 6.TheIndianSubcontinentSection7.6 7.TheNearEastSection7.3 8.PacicSection7.8

PAGE 139

Chapter8 700to601B.C. 8.1Europe:700to601B.C. 1 8.1.1EUROPE BacktoEurope1000to700B.C.Section7.4 Beginningabout700B.C.andlastingforthenext1,000yearsmostofEuropeseemstohavebeensomewhatcolder andmoisterthanitisnow.Ref.215[290] CreteremainedunderDorianGreekcontrol,whiletheAegeanislandsoverallbelongedtoamixtureofIonianand Doriantribes.RhodesremainedindependentandevenhadacolonyonGela,inSicily.Ref.38[59] TheGreekcivilizationcontinuedtodevelopinGreeceproperaswellasonthecoastsofsouthernItalyandAsiaMinor. Therewasaseriesofcity-states,mostofwhichwerearistocraticrepublicsbytheendofthiscentury.Cavalryplayed adecisiveroleininter-statewarfareandonlythewealthycouldbecavalrymen,withtheresultthatnoblelandowners developedanincreasedinuence.SpartawassupremeinthePeloponnese,whileAthenswasthemajorpowerin Attica.ThehillsidesofAtticahadalreadybeendenudedoflumberforhouses,shipsandcharcoalformetalworking by650B.C.andtheconsequenterosionofthemarginallandremovedthesoiltothepointwherelittlewouldgrowand thepeasantsbegantogointodebt.AllofGreecehadpoorlandforlivestockandthuswithscarcityofanimalfats,the Greekscultivatedolivesfortheiroil,anddependedonfoodimportsfortheremainderoftheirfoodnecessities.The urgentneedforgrainstimulatedmuchoftheirlaterenterprises. Metalcoinswereintroducedstampedwiththelikenessofanearofwheat.Althoughgold,ivoryandmarblewereused onsculptureandpublicbuildings,thecommonpeoplelivedinhousesofsun-driedbrick,builtonrubbleinnarrow streetsstrewneachdaywithlitterthrownfromthehouses.Wiveswereheldtohousekeepingandchildbearingwhile husbands,iftheycouldaffordit,openlytookconcubinesandassociatedwiththehetairae,womenofeducation,wit andbeauty,groomedforthisprofession,notunliketheGeishaofmoremodernJapan.Therewereabouttenslaves foreveryfreecitizenanditwasfeltthataboutonehundredslaveswerenecessarytokeeponephilosopherincomfort. Ref.222[296],211[284],77[117] 1 Thiscontentisavailableonlineat. 127

PAGE 140

128 CHAPTER8.700TO601B.C. TheGreekshadcitiesontheBlackSeacoastofpresentdayBulgariaandRomaniawhileThracebeganitsperiodof highestculture.TheMacedonianswereGreeks,speakingadialectremotelyconnectedtothoseinGreece,proper,but developedseparately.Aseriesoflocalchieftainsruleduntilthemiddleofthiscenturywhenthecountrywaspartially unitedbyKingPerdiccasI.Ref.180[246] OntheItalianpeninsulathereweremultipletribes,includingtheLatinsandtheSabines,butdominatingmostofthe northandcentralpartsweretheEtruscancity-states.Rome,itself,wasruledafter616B.C.byTarquiniusPriscus, sonofaCorinthianGreekmanandanEtruscanwoman.TheEtruscansabsorbedwritingandotherelementsofthe Helleniccivilization,assimilatedandchangedthemandpassedthemontootherItalicpeoples.TheLatinalphabet wasderivedfromtheEtruscans,butthelatterwereneverabletoinicttheirlanguageontheRomansandinessence Romeremainedacityofadualculture.TheEtruscans,themselves,hadattainedacertaindegreeofunityofculture andlanguage.TheyattemptedtoformanEtruscanLeague,butthetieswithadjacenttribesweremorereligiousand culturalthantrulypoliticalandconcertedactionwasdifculttoobtain.TheEtruscansweresuperiorengineers,and theRomanTheophrastus,writinglaterinthethirdcenturyB.C.statedthattheycultivatedmedicineandwererichin theirpharmacopoeia.Thereissomeevidencethattheyexcavatedtunnelsandleveledhillstodrainswampsasmalaria controlprojects.Theydenitelypracticedsomesurgeryanddentistry,usinggoldwiresinthelattereld.Ref.176 [242],28[48],8[14],45[66],185[253],75[115] TheEtruscansseemedtoparticularlylikethepaintedpotsandvasesbroughtfromCorinthinGreeceandweresoon imitatingthemonamassivescale.Neartheendofthiscentury,duetotheacquisitionofmoremetalresources,perhaps attheexpenseofTarquinii,thecity-stateofCaerebecameenormouslywealthy,coveredabout375acresandhada populationofabout25,000.Saleablecopperandironallowedthemtoacquiremassivequantitiesofgoldfromthe GreekmarketsofPithecusaeandCumae.ThereisastrongpossibilitythattheEtruscanalphabet,anadaptationof GreeklettersinuseintheGreekmarkets,wasintroducedtoEtruriabywayofCaere. Ataboutthissametimethecity-stateofVetuloniaapparentlybecameanotherprominentEtruscancommunity,lying justnorthwestofVulciandcharacterizedarcheologicallybygreatmoundtombs,someofwhichreachedaheightof nearlyftyfeet.Largestonesculptureshavebeenfoundinthesetombs,consistingofbothmaleandfemalegurines andapparentlyadaptationsfromSyrianoriginals.Bronzehorse-bucklesindicatemuchhorsetrafc.Jewelworkswith aspecialgranulationprocessofapplyingtinygrainsofgoldweretypical.Villageamalgamationintoasinglecity perhapsoccurredjustattheendofthecentury.Ref.75[115] TherewereGreekcitiesinSicilyandonthesoutherntipofItaly.Inparticular,therewasSybaris,acityofrenowned wealth,situatedinthetoeoftheItalianboot.Itsinhabitantsdelightedinluxuryandpleasures,featureswhichgave risetotheterm"sybarite",stillinourvocabulary.Ithasonlyrecentlybeenlocated,nowburiedtwentyfeetdeepin watersoakedsoil.TheCarthaginianshadatradingpostatMotyainwesternSicily,justafter700B.C. ThiswasanageofCelticdomination,butwithgraduallyincreasingpressurefromGermanicgroupsdescendingfrom thenorth.ItwasthelateIronAgeinAustriaandpeopleworebracelets,ankletsanddecorationsovertheirchests. Intricatedesignsinironwithpieceinterlockingwithclosedeyes,perfectanimalgurines,etc.canbefoundinthe collectionsfrommultipleexcavationsofthisera.CelticornamentationwasgreatlyinuencedbyScythianmodesand thelatteralsocontributedanewconceptofcavalry,includingsnafes,two-partbitsandmovablesidereins.Ref.91 [135]

PAGE 141

129 TheIberiansinmostofthisareawereoverrunbytheUrneldCeltsexceptinthesouth,wheretheTarshishCulture persistedandresistedtheCelticHallstattandlaterLaTeneIronAgeCultures.ContactwithPhoeniciansandrealization ofthelocalmineralwealth,resultedinthedevelopmentoftheonlyreallynativeunitinthisKingdomofTartessos. Greeksalsocametothisareaabout630B.C.,introducingolives 2 andgrapes.InvestigationsinPortugalandSpain in1975and1976revealedstonewritingintheCelticOgam,butusingLibyanandPhoenicianlanguages,indicating afusionofGaelsandnativeIberianswithSemiticandLibyansailors.FellRef.65[96]believesthatitwasfrom thisareathatmarinerssailedonacrosstheAtlantictoAmericaatthistime,andregardlessofone'sacceptanceornonacceptanceofFell'stheories,thereisdenitearchaeologicalevidencethatthesailorsofTarshishsaileduptheAtlantic atleastasfarasBrittany,toobtainCornwalltin.OnlylimitedexcavationoftheTartessianurbandevelopmentshave beenmadetodate.Ref.136[187],88[131],NETHERLANDSANDBELGIUM,ANDBRITISHISLES ThispartofwesternEuropewasnowalmostentirelyCeltic.TheCelticlanguageshadtwolargedivisionswhichthe WelshSirJohnRhyscalledtheQ-CelticandP-Celtic,withtheformerusingQ,KorChoftenwherethelatter usedPorB.TheancientrepresentativesoftheQ-CelticspeakersweretheGoidelsGaelsandprobablytheCelts ofSpainandPortugal,withthemoderndescendantsbeingthespeakersofIrishandScotsGaelicandManx.The ancientP-CelticspeakersweretheBrythonicpeoplesofBritain,theGaulsofcentralandeasternEuropeandthePicts ofScotland.TheirdescendantsarethecurrentBretonsofBrittainy,theCornishandtheWelsh.Ofinterestisthefact thatwhiletheP-CeltswroteusingGreekorLatinletters,theQ-Celtsoriginallywroteinanowdefunctscriptcalled "Ogam",whichhadanalphabetoffteenletters,allconsonantsanddevelopedfromangersignlanguage.Later sometribesaddedmoreconsonantsandvowelsigns.Ref.65[96],91[135] WhileNorway,SwedenandFinlandremainedinaBronzeAgeculture,Denmarkhadbothbronzeandiron.Thiswas atimeofGermanictribegrowth,particularlyinthelattercountry.Ty,innorthernJutland,wastheallegedhomelandof theTeutontribe,whiletheCimbriansaresaidtohaveoriginatedinHimmerland.Thereisstillnocompleteagreement ontherelationshipoftheearlyGermanicandCeltictribes.Inancienttimestheywereoftenconfused,andapparently therewasnotagreatdealofdifferencephysiologically.Languagewassupposedlythechiefdifference,butevenwith thatproblemsarosewithsuchtribesastheTeutonesandAmbroneswhoselanguagesmayhavebeenmixtureswith bothCelticandGermanicelements.Ref.91[135] SouthernRussiawasdominatedatthis7thcenturyB.C.bytheScythianswhonallyabsorbedsomeculturefromthe risingPersiancivilizationononeankandtheGreekcitiesofthewesternandnorthernshoresoftheBlackSea,onthe otherank.SomeelaborategoldsculpturesofthattimehavebeenfoundinScythianburialmounds.NorthernRussia andtheBalticarearemainedasdescribedinthelastchapter.Ref.176[242] ForwardtoEurope600to501B.C.Section9.9 ChooseDifferentRegion 1.AfricaSection8.8 2.AmericaSection8.6 3.CentralandNorthernAsiaSection8.7 4.TheFarEastSection8.4 5.TheIndianSubcontinentSection8.2 2 TragerRef.222[296]creditsthePhoenicianswithbringingtheolivestoSpain

PAGE 142

130 CHAPTER8.700TO601B.C. 6.TheNearEastSection8.3 7.PacicSection8.5 8.2TheIndianSubcontinent:700to601B.C. 3 8.2.1THEINDIANSUBCONTINENT TheVedicCulturecontinuedinPakistanandnorthernIndia,buttherewasnowashiftofemphasisfromtheregionof theIndustotheGangesRiverplains,wherepreviouslyexistingvillagesnowbecametruecity-states.Thejunglesof theGangesareacouldnotbecleareduntilironaxesandplowswereavailable.Thatnewmetal-iron-alsochanged warfaretoregulationinfantryandcavalry.Farthersouth,KosalaandMagadhakingdomswerebuiltbymarcherlords ofthatarea.Ref.45[66],211[284]Continueonpage185 8.3TheNearEast:700to601B.C. 4 8.3.1THENEAREAST BacktoTheNearEast:1000to700B.C.Section7.3 NorthernArabiaandtheregionofpresentdayJordanwerecompletelyunderthecontroloftheAssyrians,butindependentcivilizationscontinuedinthesouth,withregularcamelcaravanstravelingtoEgyptandtootherpartsofnorth Africa.Asnotedabove,YemenwasactuallyoverpopulatedandmanyfamiliesmigratedtoEthiopia.Ref.83[123] AdditionalNotesp.131 ForashorttimetheAssyrianscontrolledtheentireeasternMediterraneanshore,butafterlosingthousandsofmen withadiseaseseeIraqp.130,theyretreatedtotheregionofSyria.InPalestineJosiahbecamekingin639B.C. andlaunchedacampaigntopurifythereligionofYahwehandtorepressalltracesofothercults.ThePentateuch,a codeoflawsdesignedtore-invigoratethemorallifeofthenation,wasstartedin621B.C.Thiscodesupportedthe prophetsbyembodyingthelessextremeoftheirideas.Tofacilitatetheacceptanceofthis,accordingtoDurantRef. 46[76],theelders,withJosiah'spermission,conveniently"found"ascrollallegedlyfromMoseshimself.Thiswas theBookoftheCovenantwhichisprobablypartoftheBiblicalbookofExodusorDeuteronomy.Itisinterestingto notethattheprophetsAmosandIsaiahhadnevermentionedMoses. AttheendofthecenturyJudeawasoverrunbytheEgyptians,underNecho,astheystartedtoattacktheAssyrians. Onlyfouryearslater,in605B.C.,however,theChaldeansofthesecondBabylonianEmpiresoundlydefeatedthe EgyptiansatCarchemish,Syria,andJudahthenpassedunderBabylonianrule.Ref.46[76] TheAssyrians,underKingSennacherib,sackedanddestroyedBabylonin689B.C.andthenproceededundertheir GeneralEsarhaddontothebordersofEgyptwhere,accordingtotheBibleIlKings,apestilencestruckproducing "anhundredfour-scoreandvethousand"corpses,andthesurvivorsretreatedtoNineveh.Ashurbinipalbecameking in669B.C.andledAssyriatotheclimaxofitswealthandprestige,destroyingElamintheprocess.Inthisreign,the governorofUrwasoneSin-balatsu-iqbiwhodecidedtorestoretheancientcity,andmuchwasaccomplishedeven 3 Thiscontentisavailableonlineat. 4 Thiscontentisavailableonlineat.

PAGE 143

131 thoughlaterarcheologistssaythathisbrickworkwastheworstthattheyencounteredinthemanystrataatUr.Ref. 238[318]KingAshurbanipalwasalsotherstbookcollectorofhistory,accumulatinginthis7thcenturyB.C. alibraryof25,000claytablets,someofthemalready3,000ormoreyearsold,includingsomemedical"books"of ancientSumerandAkkadia,writteninprimitiveideographs.InmanywaystheAssyrianshadanadvancedcivilization, producing,forexample,manygreatengineeringfeatsforthattime.Theirmilitarymightwasingreatpartbasedoniron weapons,particularlytheiron-cappedbatteringram.Theyhadexcellentroadsandcommunications.KingSennacherib hadconstructeda919feetlongstoneaqueducttocarryacanalacrossavalleyandthencontinuedwithasixmilelong canaltobringwaterforhisorchardsandparks.Palaceshadlavatoriesandbathroomsasmodernassomeeventoday inpartsofEurope.Ref.213[288]Intheend,however,themilitaryactivityconsumedsomuchmanpowerthat localproductionatrophiedandallvitalshadtobeimported.Theconstantwarfarehadalsokilledoffthestrongest andbravestmen,andthebiologicaltypewasundermined.Thecaptivepeoplesbredandbecameadisintegrating forcefromwithin.In612B.C.anarmyofChaldeannomadsanAramaicpeopleunderGeneralNapopollaser,with thehelpofsomeScythiansandMedes,defeatedtheAssyriansinagreatbattleatNinevehandthelatterdisappeared fromhistory.TheseChaldeansfoundedthesecondBabylonianEmpirewhichcontrolledMesopotamiauntilwellinto thenextcentury.ItwastheirGeneralNebuchadrezzarwhodefeatedtheexpandingEgyptiansatCarchemishin605, givingthemaccesstoalltheoldAssyrianlandsinSyriaandPalestine.By600B.C.Babylonwasthegreatestwalled citythattheworldhaseverknown,andNebuchadressarhadbuiltit. Inthissameperiod,betweenabout630and610B.C.stillanotherpeopleappearedinthisarea.TheseweretheIndoEuropeanScythianswhoraideddownthroughSyria,destroyingandkillingastheywent.Theirraidswereforplunder onlyandnosettlementsweremade.Ref.45[66],238[318],15[26] NOTE:InsertMapfromReference97[13]..THEEAST IneasternIrantheIndo-EuropeanspeakingMedesweregrowinginnumbersandpowerinanindependentkingdom. Theirgreatestking,Cyaxares,startedhisreignin640B.C.buthehadhishandsfullghtingofftheAssyriansinthe westandthehorse-ridingScythianswhoperiodicallydescendedonthemfromcentralAsia,oftendefeatingthem IntheeasternpartoftheAnatolianpeninsula,UrartuortheKingdomofVan,afterbeingconqueredbytheAssyrians, madecommoncauseforawhilewiththeScythiansandunderRusaII-645B.C.successfullyraidedforslaves alongtheAssyrianfrontierastheseslavesweretheessentialfoundationoftheireconomy.Thekingdomcontinued toprosperunderSarduriIIIandbrieyunderRusaIIIuntil609B.C.whentheScythiansturnedonthemandsacked theimperialcityonLakeVan,whiletheMedescrushedtheAssyriansnearby.ThustheKingdomofUrartucameto anendabout600B.C.ThetrueArmenianswereprobablyaPhrygiantribewhichgraduallyoccupiedtheterritoryof Urartuperhapsnotuntilafter612B.C.TheyinitiallyadoptedthereligionofthePersiansandwereunderthekingsof Mediaforatime.Ref.160[219],18[31] ForwardtoTheNearEast:600to501B.C.Section9.7 ChooseDifferentRegion 1.AfricaSection8.8 2.AmericaSection8.6 3.CentralandNorthernAsiaSection8.7 4.EuropeSection8.1 5.TheFarEastSection8.4 6.TheIndianSubcontinentSection8.2 7.PacicSection8.5

PAGE 144

132 CHAPTER8.700TO601B.C. NOTE :Therich,wellwateredareaofYemen,whichwasthencalled"ArabiaFelix",producedadistinctive Arabicscriptabout700B.C. 8.4TheFarEast:700to601B.C. 5 8.4.1THEFAREAST BacktoTheFarEast:1000to700B.C.Section7.7 ThemanyprovincesofearlyChinagraduallycoalescedintovestatescoveringwhatisnowthedistrictofHonan andsomeadjacentareas.ThemostimportantprovinceswereT'si,wherethebasictypeofChinesegovernment developed,andChinorTsin,whichgavetoChinathenamebywhichitisknowntonearlyalltheworldbutitself. TheorganizinggeniusofT'siwasHuanChung,advisertotheDukeofHuan-640B.C..Asprimeminister, KuanChungreplacedbronzewithironweaponsandtools.Castironwasusedeitherinthiscenturyortheearly 6thB.C.,some1,000yearsbeforeitwasusedinEurope.Sophisticatedkilnsdevelopedforringceramicslaidthe foundationforthis,inreachingtheveryhightemperatures,835degreescentigradenecessary.T'sibecameawell orderedstatewithastablecurrencyandefcientadministration.Acodeofmanners,ceremoniesandasenseofhonor wasdevelopedandservedasasubstituteforreligionamongtheupperclasses.Extensivecanalsirrigatedeldsand agricultureandthesilkindustryprospered.HuanChungtaughtthefarmerstodigdrainageditches,storedsurplus grainandrentedfarmequipmentforthem.Ref.222[296]Cartswereused,leathershoeswereworn,andhouses werewellbuilt,withtablesandchairsavailable.IntheearlyyearsoftheSpringandAutumnEraoftheEasternChou, warfarewasreallymoreofapolitegamesmanshipwithverylimitedrealghtingandfewpeoplehurtorkilled.The artofdiplomacywassupreme.Ref.45[66],46[76],101[146] ThreeelementsappeartobemingledintheJapaneserace:AprimitivewhitestrainthroughtheAinus,whoseemto haveenteredJapanfromtheregionoftheAmurRiverinNeolithictimes;ayellowMongolstrain,comingfromor throughKoreainthis7thcenturyB.C.;andabrown-blackMalayandIndonesianstrain,lteringinfromthewestern Pacicislands.Graduallyanewracedevelopedfromthis7thcenturyon.IntheJapanesemythology,660B.C.dates thelegendaryrstemperor,Jimmu. Neolithicsocietiescontinuedaspreviously,withmetalinuseinThailand. ForwardtoTheFarEast:600to501B.C.Section9.3 ChooseDifferentRegion 1.AfricaSection8.8 2.AmericaSection8.6 3.CentralandNorthernAsiaSection8.7 4.EuropeSection8.1 5.TheIndianSubcontinentSection8.2 6.TheNearEastSection8.3 7.PacicSection8.5 5 Thiscontentisavailableonlineat.

PAGE 145

133 8.5ThePacic:700to601B.C. 6 8.5.1THEPACIFIC BacktoThePacic:1000to700B.C.Section7.8 AdvancedNeolithicculturesexistedthroughoutmanyofthePacicislands.InAustralia,theaboriginesdeveloped complexkinrelationshipsandareligioninvolvingtime-consuming,elaboraterituals.Stoneandwoodentabletscontainingsymbolswerekeptinsacredplaceswhichwomenoruninitiatedboyswereforbiddentoevenapproach.Some nepaintingwasdoneonrocksandbark.Ref.19[32] ForwardtoThePacic:600to501B.C.Section9.8 ChooseDifferentRegion 1.AfricaSection8.8 2.AmericaSection8.6 3.CentralandNorthernAsiaSection8.7 4.EuropeSection8.1 5.TheFarEastSection8.4 6.TheIndianSubcontinentSection8.2 7.TheNearEastSection8.3 8.6America:700to601B.C. 7 8.6.1AMERICA BacktoAmerica:1000to700B.C.Section7.9 TheArcticSmalltraditioncontinuedinthefarnorthaspreviouslydescribed. IndianlifethroughoutCanadawasessentiallyasrecordedinthelastchapter. Hereagain,asinthelastchapter,werunintothecontroversialtheoriesofBarryFellRef.65[96].Variousrock inscriptionsofNewEngland,someoriginallyfoundyearsago 8 andothersjustrecently,asatUnion,NewHampshire, andonMonheganIslandoffthecoastofMaine,havenowbeeninterpretedbyFellasbeingTartessianPunic,recording arrivalsofPhoenicianshipsfromSpain.Itishishypothesisthatthesevoyagers,datedfrom700to600B.C.were probablynotexplorersbutmerchants,tradingwithalreadysettledNewEnglandCelts' Inthemidwest,theBurialMoundIperiodoftheAdenavariationoftheWoodlandtraditioncontinued.Hereagain BarryFellintroducesnewcontroversywhenhestatesthatexcavationofsomeofthemoundshaverevealedcopperand bronzetablets,pottery,gurines,etc.showingunmistakablesimilaritiestoancientPhoenicianconstructions.Hesays thesearelocatedinWestVirginia,lowaandOhio,alongmajorrivers.OtherstudentsoftheAdenaCulturemention onlystoneornamentsandengravedslabsinthesemounds,althoughthelaterHopewellmoundssee3rdcenturyB.C. 6 Thiscontentisavailableonlineat. 7 Thiscontentisavailableonlineat. 8 OnesuchinscriptionwasdescribedandrecordedfromMountHopeBay,Bristol,RhodeIsland,in1,780byEzraStiles,laterpresidentofYale College

PAGE 146

134 CHAPTER8.700TO601B.C. certainlyhadvariousmetals,butoflocalorigin.InthesouthwestUnitedStatestheSanPedrophaseoftheCochise Culturecontinuedasadesertsociety,withincreasingpopulationandimprovementsinfarmingandotherskills.Ref. 65[96],215[290],45[66],CENTRALAMERICA,ANDTHECARIBBEAN TheOlmeccivilization,nowsome600yearsold,reachedtheheightofitsdevelopmentwithacenteratLaVenta, Mexico.Everyvillagewaslinkedinanelaboratenetworkoftradeupanddownthevalleysandbetweenthehighlands andthecoasts.Salt,maize,obsidian,oystershells,stingrayspines,sharks'teeth,conchandturtleshellswerealltraded widely.TheOlmecswerenotonlygreatsculptorsbutalsocarversofjade,fromwhichtheymadestatuettes,jewellery andaxes.Tojudgefromtheirart,theOlmecshadtwocontrastingethnictypes,oneremarkablyNegroid,withthick lips,broadnosesandroundfacesandtheotherstrikinglySemiticwithsharpproles,hookednoses,narrowfacesand lipsandpronouncedbeards,usuallyshownaseithersquareorpointedgoatees.Neitherofthesetypeswouldseemto havecomeacrosstheBeringStrait.Pleasealsoseepages124to127andthechartwhichfollowsthenextsection inthischapter.TheMayancalendarindicatesactivityinCentralAmericaby613B.C.butlittleactualknowledgeof thosepeopleisavailableforanothercenturyortwo.Ref.95[140] TheChavincivilizationcontinuedinnorthernPeruandperhapstheTiahuanacoexistedinthehighlandsontheBolivian border,butweshallomitdiscussionofthisgroupuntilthe5thcenturyB.C.AsinCentralAmerica,therearemany equivocalndingssuggestingthepossibilityofmultipleoriginsofSouthAmericanpeoples,ratherthanasingle ancestralstrainfromBeringStraitmigrants.Someofthefeatureswhichcontributetothisconfusionarenowlisted. NOTE:InsertSPECIALSECTION,UNEXPLAINEDFEATURESOFNATIVEAMERICANS ForwardtoAmerica:600to501B.C.Section9.4 8.7CentralandNorthernAsia:700to601B.C. 9 8.7.1CENTRALANDNORTHERNASIA BacktotoCentralandNorthernAsia:1000to700B.C.Section7.5 TheHsiung-nuoftheMongolianregionhadhorsesofvariousbreeds,amongthemonewithanuprightmane.They, liketheHunsofprobablelaterdescent,wereexperthorsemen.EastofMongoliaexcavationshaverevealedtheTagar Culture,datingbackto700B.C.andcontinuingforabout600years.Thisincludedasemi-settledpeoplewhodesigned animalsonsmallknives,beltandharnessplaquesandbroaddaggers.ThelatterhavealsobeenfoundinSouthRussia andonthenorthernbordersofChina. TheIraniansofTranoxianawereamixedgroupoftribes.Some,whomovedonintosouthernRussiawereknown asScythianswhiletheirkinsmenwhoremainedbehindbecameknownasSakas.TheMedeshadprettywellleftthis areatosettleinIransouthoftheCaspian,butbehindthemcametheircousins,thePersians.Zorasterwasbornalong theOxusRiverinthiscenturyanddidmuchofhisteachinginKhurasan.Ref.136[187],8[14],45[66],127 [176] ForwardtoCentralandNorthernAsia:600to501B.C.Section9.5 9 Thiscontentisavailableonlineat.

PAGE 147

135 8.8Africa:700to601B.C. 10 8.8.1AFRICA BacktoAfrica:1000to700B.C.Section7.2 OverpopulationinYemen,ontheArabianPeninsula,forcedbandsofArabstocrosstheRedSeaandsettleonthe northeasternedgeoftheEthiopianplateau.Theyweregoodfarmersandirrigatorsandgotalongwellwiththelocal Cushiticspeakingpeoplewhohadasimilardegreeofculture.Ref.83[123]ThereissomeevidencethatPhoenicians,withtheEgyptianpharaoh'ssupport,weremakingsailingtripssouthoutoftheRedSeaatthistime,andperhaps theyevencircumnavigatedAfrica. Earlyinthecentury,theAssyriansunderGeneralEsarhaddon,thenattheheightofhispower,sweptdownand subjectedpriest-riddenEgypttotributeandrestrictedthekingsofthe25thKushitedynastytothecountryupriver fromThebes.EsarhaddonputNecho,localprinceofSais,incontrolofthedeltaregion,butsubsequentlyNecho's son,PsammeticusIbrokeawayfromtheAssyriansandre-establishedanindependentEgyptiankingdomagainth dynasty-655B.C.andevenpushedtheNubiansandKushitesoutofupperEgypt.Thechiefcontributionofthe Assyrianstothisregionwastheintroductionofiron,whichsoonspreaduptheNile,astheKushites,retiringbackto theircapitalatNapata,tooktheknowledgeofironforweaponsandtoolswiththem.Ref.136[187],83[123],28 [48],175[241],213 Inmid-centurythereweremanyGreekimmigrantstoEgypt,includingmercenaries,colonistsandtraders.Newcrops wereintroducedsuchasgsfromTurkey,vinesfromGreece,sheepfromArabiaandpigsfromSicily.Currency replacedbarterandcaravanroutesweredeveloped.Slavelaborwasusedinminesandquarries.After609B.C. PharaohNechoalsoNikuIIattemptedtorunawidecanalfromtheNiletotheRedSeaandexpendedthelivesof some120,000menintheprocess,butitwasnevercompleted.NechoalsohadanarmyconquerPalestine,butthe Babyloniansranthemoutafteraboutfouryears.Ref.83[123] Cyrene,Libya,wasthesiteofanimportantSpartanGreekcolonybyabout630B.C.Carthagehadcontinedtodevelopandhadiron-workinginitsvarioussettlements,askillwhichthencrossedthedesertthroughtrans-Saharan traderoutes.ItwasatthisperiodthattheAssyrianswereattackingthePhoenicianhomeland,andCarthagebecame increasinglymoreimportantasacenterforthatcivilization.GraduallytheCarthaginianorPunicdialectandalphabet cametodifferfromthatoftheLebanesePhoenicians.BytheendofthecenturyCarthagewasreceivingEtruscan metalsandpottery.SomeofthelatterwasoftrulyItalianoriginandsomeimitationsofCorinthianceramics.Ref.8 [14],66[97],75[115] OnthewestsideofAfricatherewasfurtherclimaticdeteriorationafter700B.C.ThespreadofpeopledowntheRift ValleyintoeastAfricacontinuedandbothcattleandsheepwerekept.Thecentralandsouthernregionshadlittle changefromthesituationdescribedinthelastchapter. ForwardtoAfrica:600to501B.C.Section9.2 10 Thiscontentisavailableonlineat.

PAGE 148

136 CHAPTER8.700TO601B.C.

PAGE 149

Chapter9 600to501B.C. 9.1600to501B.C. 1 9.1.1600TO501B.C. Inorclosetothis6thcenturyB.C.anumberofreligiousgeniusesappearedintheancientworld.KarlJaspershas calledthisan"axialage" 2 .ItwastheperiodofConfuciusandperhapsLao-tzinChina,ofGautama,theBuddhain India,ofZorasterinIran,PythagorasinGreeceandofthegreatestoftheHebrewprophets,Deutero-lsaiahIsaiah40 to59.Therewasamovementtowardsabeliefinasinglespiritualreality,andtheGreeksweresearchingforasingle principletoexplainthematerialworld.Oneresultofthiswasthedevelopmentofmonotheism. Forwardto500to401B.C.Section10.1 ChooseDifferentRegion 1.AfricaSection9.2 2.AmericaSection9.4 3.CentralandNorthernAsiaSection9.5 4.EuropeSection9.9 5.TheFarEastSection9.3 6.TheIndianSubcontinentSection9.6 7.TheNearEastSection9.7 8.PacicSection9.8 9.2Africa:600to501B.C. 3 9.2.1AFRICA BacktoAfrica:700to601B.C.Section8.8 AsthecenturyopenedEgyptwasagainattemptingexpansionintoAsiaundernativerulersandapunitiveexpedition wassentsouthtosacktheKushiteNapotaB.C.forcingthemovementofthisKushitecapitalsouthtoMeroe. Anotherview,however,isthattheKushiterulerssimplyelectedtomovetheircapital300milessouthbecausewood 1 Thiscontentisavailableonlineat. 2 AsquotedinReference8[14],page72 3 Thiscontentisavailableonlineat. 137

PAGE 150

138 CHAPTER9.600TO501B.C. forsmeltingironorewasbecomingscarcerandthelandwasbeingovergrazed.Atanyrate,Meroethenbecamea majorironcenter.KushhadamixedCaucasianandNegropopulationandthereafterremainedindependentofthe variousEgyptianrulers.Thenationoweditsprosperitytotradeinivory,ebony,gum,hides,ostrichplumes,ironand slaves,allofwhichwerecarriedeitherdowntheNiletoEgyptoracrosstheRedSeatoArabiaandMesopotamia. Theyalsohadgreatherdsofcattleandadequateagriculture 4 EgyptmaintainedclosecommercialrelationswithboththeGreeksandLydians.Inthelatterpartofthecentury,the EgyptianswerepushedbackoutoftheAsiaticmainlandagainbytherampagingPersians,andby525B.C.halfof EgyptitselfhadbeenconqueredbythePersianCambyses,sonofCyrus.AfterCambysescommittedsuicidein521 B.C.,Dariuscontinuedtorulemostofthisarea.Ref.175[241],8[14],68[106],28[48] BythistimeCarthagehaddevelopedanempireofitsown,withsettlementsinwesternSicilyandSardiniaandwith contactsinSpainandalongtheAfricancoast.In520B.C.AdmiralHannolanded30,000settlersfrom60vesselsat themouthoftheRiodeOroinwhatisnowWesternSahara.Thecolonylastedaboutftyyears.Ref.222[296] HerodotussaysthatPhoenicianscircumnavigatedAfricain600B.C.,startingintheRedSeaandgoingclockwise. Himilco,sailingfromCarthage,touchedtheshoreofIrelandandfounditafertileland.Allofthisexplorationand expansionbroughtsometroublesclosertohome.Althoughtheyhadpreviouslybeentradingpartners,thecompetition betweentheEtruscanCaereandCarthagenowbecamesoacutethatconictbecameinevitable.Malchus,ofCarthage, consolidatedthePunicpositioninwesternSicilyandthentriedtodothesameinSardinia,althoughthenativeSardinianstatesfoughtbackviciouslyandtheyweresoonhelpedbythemaritimePhocaeanGreeks.Caerethrewinitslot withCarthageonthisoccasion.Herodotus,writinginthenextcentury,saidthatthePhocaeans 5 wonbutinsodoing lostfortyshipsandhadanothertwentyseverelydamaged.TheyreturnedtoAlalia,gottheirwomenandchildrenand resettledinRheguminsouthItaly,leavingCorsicaalsototheCarthaginiansandCaeritans.In509B.C.Carthage signedatreatywiththerisingRome,deningrespectivespheresofinuence.Ref.84[124] BarryFellRef.65[96]infersthatafterthePersianconquestofEgyptandtheriseoftheGreekandRoman empires,theeasternMediterraneanwasclosedtoCarthaginianshipping,soCarthageretaliatedbyclosingthestraits ofGibraltertoallEuropeanvessels.ThenundertheguiseofsupposedSpanishandnorthAfricantrade,theyexploited NorthAmericansilver,copper,hidesandfurs,bringingthembackforthemanufactureofbronzeandthemarketingof thefurs.HefeelsthatthissecrecyisthereasonRomanannalshavenomentionofthetrans-Atlanticvoyages.Todate noonehascomeforthwithanydirectconrmationofthishypothesis. ThatpartofAfricasouthoftheSaharaandtheAbyssinianmassifwasoneofthevegreatremainingreservoirsof savageorbarbarianlife.TheotherfourareaswerethemonsoonforestsofSoutheastAsiawiththeislandsofIndonesia, thesteppeandforestzonesofnorthernEurasia,AustraliaandnallytheAmericas.Ref.139[192] ForwardtoAfrica:500to401B.C.Section10.2 9.3TheFarEast:600to501B.C. 6 9.3.1THEFAREAST BacktoTheFarEast:700to601B.C.Section8.4 4 TodaythisareaofancientKushisalmostcompletelydesert.Ref.83[123] 5 HerodotusdescribedthePhocaeansasplunderersandlooters.Ref.92[136],Book1,pp.89,90 6 Thiscontentisavailableonlineat.

PAGE 151

139,continued AlthoughChinawasnominallystillundertheChouDynastyactuallyitwasessentiallyinafeudalisticagecalledthe SpringandAutumnperiod.Auniqueinstitutionofthisperiodwasthehegemonpawhichwasrulebyayearly conferenceofdukesfromthethreepowerfulstatelets,offsettingtheineffectivenessoftheChouking.From600 B.C.onthepeasantsmaderealprogressinfarmingtheoodplainoftheYellowRiver,byshiftingfrommilletto rice.Vastdiking,draining,canalizationandengineeringcontrolwasnecessarytocreateanunbrokencarpetofrice paddies.Theamountoflaborinvolvedinallthisisalmostunbelievable.Rice,originallyadrylandcrop,stillrequires goodoxygenationofitsrootsandthewatersofthepaddiescannotbecomestagnantbutmustberegularlycirculated, necessitatingconstantattendancetopumpsandvarioushydraulicsystems.FarthersouththeYangsteValleycouldnot befarmedsatisfactorilyatthattime,eventhoughtheriverwasmuchlesswildandgeologicallylessdifcult,because thewarmer,wetterclimateallowedagreatvarietyofparasites.Malariamayhavebeenoneoftheworst,alongwith denguefeverandschistosomiasis,whichhasbeendenitelyidentiedinalater,secondcenturycorpse.Ref.101 [146],140[190],259[174] ThiswastheageofLao-Tzu,thegreatestofthepre-Confuciusphilosophers.Hisidentityisdisputed,butatleast theTaoistphilosophybecameprominentwith"Tao"meaning"TheWay".Basicallythiswasawayofthinkingor refusingtothink,forintheviewofTaoiststhoughtisasupercialaffair,goodonlyforargumentandmoreharmful thanbenecialtolife.TheWayistobefoundbyrejectingtheintellectandallitserrorsandleadingamodestlife ofretirement,rusticityandquietcontemplationofnature.Knowledgeisnotavirtuebutonthecontrary,rascalshave increasedsinceeducationspread.Theworstconceivablegovernment,inthisphilosophy,wouldbebyphilosophers themselves,astheybotcheverynaturalprocesswiththeory.Silenceisthebeginningofwisdom.Disregardofthe Taoledtoillness,notsomuchaspunishmentforsinastheinevitableresultofactingagainstnaturallaws.Toaist philosophybecamethereligionofaconsiderablesizedminorityoftheChinesefromthiscenturydowntoourown time.Confucius,oftheimpoverishedbutnobleK'ungfamily,wasbornin551B.C.anditissaidthathehadsome contactwithandlearnedfromtheOldMaster,Lao-Tze.Histeachingwillbediscussedunderthissameheadingin thenextchapter.ThestandardoflivinginChinaatthattimewasprobablyhigherthaninthecontemporaryGreeceof Solon.Ref.46[76],260[29] TheJomonCulturehuntingandshingsocietyofJapancontinuedthroughthiscentury. TheNeolithicsocietiesofKoreacontinuedasinthepreviouscenturies. ThepeoplewhonowoccupysoutheastAsiabeganataboutthistimetoleavetheirancestralhomesinsouthernChina andTibetandstarttheirmigrationssouthward,displacingorabsorbingtheaboriginesofthearea. ForwardtoTheFarEast:500to401B.C.Section10.7 ChooseDifferentRegion 1.IntrotoEraSection9.1 2.AfricaSection9.2 3.AmericaSection9.4 4.CentralandNorthernAsiaSection9.5 5.EuropeSection9.9 6.TheIndianSubcontinentSection9.6 7.TheNearEastSection9.7 8.PacicSection9.8

PAGE 152

140 CHAPTER9.600TO501B.C. 9.4America:600to501B.C. 7 9.4.1AMERICA BacktoAmerica:700to601B.C.Section8.6 TherewasnorealchangeinthehumanconditioninNorthAmericaatthistime.TheArcticSmallTooltraditionis usuallydividedintotwostageswithwhathasbeencalledtheDorsetStageemergingatabout600B.C.Thiswasan harpoonbasedhuntingcultureextendingallacrossthefarnorth. TheAdenaWoodllandCulturethrivedintheeastandthemiddlewestoftheUnitedStatesandtheinuenceofthe Adenaburialcustoms,religionandartcanbeidentiedoveralargearea,includingChesapeakeBayandNewYork state.Inthe1880sProfessorCyrusThomassurveyedover2,000moundsitesandcollectedover4,000specimensof thisandthelaterHopewellCulture.TheSanPedrophaseoftheCochiseCulturecontinuedinthesouthwest.Ref. 189[259],215[290],CENTRALAMERICA,ANDTHECARIBBEAN IntheOlmeccenteratLaVentaaclaypyramid103feethighwaserectedandsurroundedbyfourcolossalstoneheads. AtMonteAlban,Mexico,onecanstillseerowsofcarvingswithOlmecfeatures.AtTikal,Quatemala,potteryhas beenfounddatingto600B.C.similartosouthAmericanpotteryofthesamedate,suggestingthattradeexistedbetween thetwoareas.About500B.C.,however,theOlmecpeopleseemtohavecollapsedanddisappeared,perhapspassing ontheirknowledgetotheMayaswhobegantooccupysomeofthesameterritory.Archeologicalndsestablisha humanpresenceinVeraCruzasearlyas5,600B.C.andthismayhavebeenfromancienttimesathorough-farefor migrationofHuastecandOlmecsalongthecoastalplain.Ref.176[242],155[214],236[314] ThezeropointoftheMayancalendarcorrespondstoour3,113B.C.andbringsuptheinterestingquestionsastothe ultimateoriginofthosepeoplesandhowtheywereabletotriumphoverthejungletoestablishatypeofcivilization. Themostlikelyhypothesisisthattheywereagriculturalistsoriginallyandthattheymovedinfromadjacentriverestuarinelowlands.Thebulkofarchaeologicaldatapointstoanoriginalincursionofthelowlandsduringthersthalf ofthis1stmillenniumB.C.,buttheearliestceramicsfromTikalandUJaxactundatetoabout600B.C.Theremay havebeentwostagesinthedevelopmentoftheMayasociety,withtherststagecharacterizedbythedissemination ofriverinesettlementsfromthetropicalLowlandsofthePacicandGulfCoastsinthegeneralareaoftheIsthmusof TehuantepecandthesecondstageoccurringwhenPre-classicgroupsabandonedtheriversandmovedintotheinterior. ThislaterstageappearstobelinkedtothebeginningsofMayancivilization.Thechangetotheinteriorhabitatinvolved manyproblemsnottheleastofwhichwastheobtainingofdrinkingwater.Thesolutiontothisproblemwasapparently foundintheconstructionofarticialreservoirsinimpermeableclays.Fedbyarticiallyconstructeddrainagesystems theyallowedforthestorageofmillionsofgallonsofwater.Forcarbohydrates,therelativelysmallcropsofmaize thatcouldberaisedwiththeslashandburnmethod,wassupplementedbytheramon,atreeofthegfamilywhich producesdensecarbohydrateseedsintremendouslylargequantities.Storageplacesfortheseseedshavealsobeen found.Nowshutofffromriverproteins,deerhuntingwasofimportance,afactconrmedfromtheexaminationof hiddencontentsfromTikal.AsthePulestonsRef.261[237]havepointedout,thenecessityoforganizinglaborto constructthelargepublicreservoirsmaywellhavebeenacatalystforthedevelopmentofsocialstraticationandthe developingconceptofastate;andtheutilizationoftheramonwouldhaveallowedstablesettlementswiththerelease ofmuchmalelaborforuseinvariousotherchannels. 7 Thiscontentisavailableonlineat.

PAGE 153

141 TheChavincivilizationcontinuedinPeruthroughoutthiscenturybutthenabout500B.C.theircitieswererather suddenlyabandoned 8 .SomewriterssaythatParacasdevelopeditsownindividualtypeofpotteryinthesouthatthis time,butEngelRef.62[91]doesnotdateParacasIuntilanother300years.MarvinAllisonRef.3[4]hasfound multiplemummiesfromvariousPeruvianandChileancoastalburials,somedatingto600B.C.,withtuberculosis, especiallyofthebonesandjointsandhebelievesthismusthavebeenacommondiseaseofthewesterncoast.The rstknowndenselypopulatedcentersonthenorthcoastofSouthAmericadatefrom600B.C.to150B.C.andhave beencalledthe"Salinarphase"byarchaeologists.Ref.255[9] InthelightofBarryFells'shypothesesconcerningpossibleEuropeanandMiddleEastvoyagerstothenewworld inancienttimes,itisofinterestthatastoneinscriptioninPhoenicianscriptwasallegedlydiscoveredinParahyba Province,Brazil,in1886andatranslationpublishedin1939indicatedthatithadbeenwrittenbyCanaanitesofSidon whohadlefttheRedSeaareain536B.C.the19thyearofthereignofHiramwithtenships,sailingalongthecoast ofAfricafortwoyears,undertheordersofNecho,pharoahofEgypt.Thewritersnotethattheybecameseparated fromtheiragshipandwerecarriedfarawayandlandedonthisunknownBraziliancoast.Whenrstputforththis ndingandtranslationwasdeclaredaforgery,butmorerecentlyithasbeenacceptedasgenuinebymanyauthorities. Ref.176[242]ThesouthAtlanticoceancurrentscomingfromtheAfricanCapecouldeasilyresultinthisdrift. OrnateceramicsdecoratedwithanimalandbirdgureswerecharacteristicoftheBrazilianBarrancoidtraditionof thisandmanyadjacentcenturiesRef.255[9] ForwardtoAmerica:500to401B.C.Section10.9 ChooseDifferentRegion 1.IntrotoEraSection9.1 2.AfricaSection9.2 3.CentralandNorthernAsiaSection9.5 4.EuropeSection9.9 5.TheFarEastSection9.3 6.TheIndianSubcontinentSection9.6 7.TheNearEastSection9.7 8.PacicSection9.8 9.5CentralandNorthernAsia:600to501B.C. 9 9.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:700to601B.C.Section8.7 Therewasprobablyverylittlechangefromthesituationdescribedinthelastcentury.TheTagarculturepeople continuedinthenorth,theearlyMongoloidsinthenortheast,andtheproliferatingIraniantribes,especiallytheSakas andtheeasternMedes,inthesouth. ForwardtoCentralandNorthernAsia:500to401B.C.Section10.5 8 TheNationalGeographicSocietyRef.255[9]reportedin1982thatthissocietylasteduntil300B.C. 9 Thiscontentisavailableonlineat.

PAGE 154

142 CHAPTER9.600TO501B.C. 9.6TheIndianSubcontinent:600to501B.C. 10 9.6.1THEINDIANSUBCONTINENT TheVedicCulturebegantodecayoratleasttostagnate,sothatDariusIofPersiahadlittletroubleinseizingGandhara fromthedisunitedAryans,andtheentireareasoonbecamedividedintomanysmallstates.Darius'advanceintothe IndusValleymarkedtheintroductionofcoinage,ironworking 11 andwritingintoPakistan.Althoughpowerfuland extensivekingdomsdevelopedintheGangesValleyatthattime,theyalwaysremainedunstableandwerenever consolidatedintoanenduringwhole,asinChina,andonereasonwastheheavymicro-parasitismcharacteristicofthe warm,wetGangesclimate.Thisheavyinfestationandinfectionmusthavereducedindividualvigorandcapacityfor physicallabor,andisprobablyonereasonthatIndianempireswerefragileandsubjecttoeasyconquestbyinvaders fromthenorth,untiltheinvadersthemselvesbecameinfested.Thetranscendentalismthatbecamecharacteristicof theIndianreligionsaccordedwellwiththecircumstancesofpoverty-stricken,diseaseriddenpeasants.InToynbee's Ref.220[294]terminology,itwasa"timeoftroubles"andasusualinsuchsituations,newphilosophiesand religionsbegantoappeartosavemanorlifthimoutofthedrudgeryofhislife.Bythistime,thecastesystemwas wellestablishedatleastinnorthernIndia.Benares,atthegentlefourmilecurveoftheGanges,wasalreadythegoal ofthousandsofHinduswhowenttheretobatheanddrinkitswaterandtobeseechthefavorofsomegod.Ref.136 [187],140[190],37[58],220[294] GautamaBuddha,scionofthearistocraticGautamaclanlivingatthefootoftheHimalayas,wasbornin563B.C.He lefthisfamilyandafteraninitialwithdrawalperiodwithselfmortication,hereturnedtotheactiveworldtoteach hisideasofethics.Hedidnotwrite,buttalked,amanofstrongwill,authoritativeandproud,butofgentlemanner andspeechandofinnitebenevolence.HisideaofNirvanawascompleteannihilation.Later,alegendofdivinebirth appearedamongBuddha'sfollowers,buthe,himself,claimednodivineoriginandinfactwasinessenceanatheist, worshipingnogod,havingnoritualandinterestedonlyinethics. InthemiddleofthiscenturytherealsoappearedanotherreligionfoundedbyMahaviraandcalled"Jains".Mahavira taughtthattheroadtoreleasefromthetragedyoflifewastobefoundthroughasceticpenancesandcomplete"ahimsa". Thelattermeansabstinencefrominjurytoanylivingthing.Gandhiwaslaterstronglyinuencedbythissect.Neither BuddhismnorJainismacceptedthecastesystem,whichwasHinduinorigin,andbothwereopposedtoviolenceand toanyanimalslaughter.TheJainsevenhadtobecarefulineatinganyfruitorvegetable,asitmightcontainaninsect whichmightbeahumansoulinre-in-carnation.Finally,theonlyanimalproteinfoodinIndiawasanoccasional chickenor,onthecoast,shandseafood. AryaninvadersfromnorthIndiaarrivedinSriLankainthisortheprecedingcenturyandthepresentdaymajority SinhalesesevenoutoftenSriLankansclaimdescentfromthem.TheyareBuddhistsandtheirsistheofcial languageoftheisland.Ref.136[187],211[284] Continueonpage207 9.7TheNearEast:600to501B.C. 12 9.7.1THENEAREAST BacktoTheNearEast:700to601B.C.Section8.3 ThreepeoplesoftheNearEasthadabsolutemonarchiesinthiscentury-theLydians,MedesandtheBabylonians. Pleaseseemapthissection,lastchapter. 10 Thiscontentisavailableonlineat. 11 SomebelievetherewasironsmeltinginIndiaasearlyas800B.C.Ref.213[288],page271 12 Thiscontentisavailableonlineat.

PAGE 155

143 Incenseandmyrrhmadefromgumresinwerenowfashionableasofferingstothegods,andtheywereproducedin southArabiaandsenttotheMediterranean.TheSabeansofYemenandHadramauttookoverdominancefromthe Mineansandpromotedadvancedengineeringprojects,includingalargedamnearMarib.StilllatertheHimyarites becameparamountinthearea.NorthernArabiawasconqueredbyDarius,thePersian,atthecloseofthecentury. AdditionalNotesp.145 Asthecenturybegan,internalstrifeanddecayseemedimminentinPalestine.TheprophetJeremiah,writingatabout 600B.C.,deploredthestatusandwrotelikeanundercoveragentofBabylonia,seemingtohopethattheBabylonians wouldconquertheJews.Ifso,hishopesweresoonfullledandNebuchadrezzartookthousandsofJewsascaptives,to Babylon.Whilethere,theprophetEzekial,likeIsaiahandJeremiahbeforehim,madeercedenunciationsofidolatry andcorruptionofJerusalem,butatthesametimetriedtokeeptheJewsfrombeingabsorbedbytheircaptors.Evenin bondagetheystayedmoreorlessintact,andtheyprosperedandmultiplied.ButtheydidtakeovermanyBabylonian legends,whichappearedlaterintheOldTestament,intermingledandfusedwiththetrueHebrewstories.Seealso Syriap.143. TheJewswerenallyliberatedfromBabylonbyCyrus,thePersian,in540-538B.C.andtheymigratedbacktotheir homeland.Theprophet,the"2ndIsaiah"actualauthorunknown,whosewritingsmayactuallybeamixturefrom severalmen,begantolifttheJudaicreligiontoaloftystate,re-emphasizingthecomingofGodandtheMessiah.The JewishTemplewasrebuiltinJerusalem.Ref.45[66] Phoeniciawasruledfrom586to538B.C.bytheChaldeanNebuchadrezzaralthoughthecityofTyredidnotfalluntil 573B.C.afterathirteenyearsiege.Laterthecountrywasdividedintofourvassalkindgoms,underthePersians. Extensiveseaactivitycontinued,however,anditispossiblethataPhoenicianshipcircumnavigatedAfricaaboutthis time.SeeIsraelp.143.Ref.222[296] SeemingtoforetellthefutureimportanceofIraqasasourceofpetroleum,eveninthis6thcenturyB.C.oilwas foundonthesurfaceinvariouspartsofthecountryandwascallednaphtha.Bitumenwasusedtocalkships.Ref. 213[288]AnindependentBabyloniaprosperedunderthereignofNebuchadrezzarII,theChaldean,andBabylon becameafamedmetropolis,knownparticularlybecauseofitsfamedhanginggardens.Ass-drawnwheeledcarts,oar drivenriverboatsandcamelcaravansallbroughtamixtureoffood,preciousmetals,dyes,glasswareandtextilestothe city.Thetrafcalsobroughtanoccasionalplague.Ref.222[296]ThissecondBabylonianEmpirewasessentially aSemiticcivilization.AfteraninitialattackonJudea,Nebuchadrezzarcarriedabout10,000Jewsbacktothecapital, butlateralmostallthepopulationofJerusalemwasbroughtinbondagetoBabylon,withthecaptivityperiodrunning from586to538B.C.NebuchadrezzarsupposedlybuiltthezigguratofEtemananki,thoughttobetheinfamousTower ofBabel,whichhassincebeendestroyed.Thebaseofthistowermeasured300feetonaside.Neartheendofhis lifehealsotriedtoreconstructtheentirecityofUr,makingthereconstructedziggurataseven-stageone.Eventhese ancientsdidnotescapeperiodsofsevereination,andthewarsandbuildingactivitiesofNebuchadrezzarresultedin a50%riseinpricesbetweenabout560and550B.C.Ref.213[288]Afterthefamousking'sdeath,theempire crumbledrapidly,hastenedbytheaberrationofthepriestsofMarduk,andsubsequentlytheAchaemenidPersianshad notroubletakingcontrolofthearea.ThecontributionsofBabyloniatoposterityincludethelegends,carriedthrough thecaptiveJews,thatbecameapartofEurope'sreligiouslore,foundationsofmathematics,astronomy,medicine, grammar,lexicographyarcheology,historyandphilosophy,aswellasthedesignfortheziggurats,leadinglatertothe Moslemtowers.ThePersianCyrusbecamekingofBabylonin539B.C.andthecitylostitsimportanceforevermore,

PAGE 156

144 CHAPTER9.600TO501B.C. astherulerlivedinPersia.CyrusdidcompletesomereconstructionworkinUr,however,restoringagateinthegreat wallandprobablyworkingononeofthetemples.Thiswasdoneinspiteofthefactthattherewasthenlittletradeto thiscity.Ref.238[318],28[48],46[76] AsAssyriafell,Cyaxares,kingoftheMedes,extendedhisruleonwestacrossIran,butin550B.C.,Cyrus,princeof Persia,rebelledagainsttheMedesanddefeatedtheirthenking,Astyages,joiningthetwopeoplestogethertomakeIran adominantsouth-westAsianpower.Theyhadirontechnologyandwereabletoexploitthehorseforcommunication andwarfare.Theword"Iran"inPersianisthesameastheword"Aryan"inEnglish.Cyrusproceededtocapture BabyloniaandalmostallofSyriaandSardis,inAsiaMinor.ThisPersianEmpirebecameoneofthebestgoverned inhistory.Itsoonreachedthenaturallimitsinsizeandextentwhichweresetbytheconditionofthesoilandclimate restrictingpeasantagriculture,abuttingonthesteppeinthenorth,thedesertinthesouthandlimitedontheAegean onlybytheirlongsupplylineastheycameupagainsttheGreeks.Ref.140[190]Cyrus'son,Cambyses,extended theempireintoEgyptandthenwentmadandcommittedsuicide.Darius1,ofthejuniorAchaemenidline,became kingin521,thenconqueredthesickScythiansinRussiaandcarriedthePersianEmpiretotheIndusRiverinPakistan. TheofcialreligionoftheAchaemenidDynastywasZorastrianismbutinthewesternareasJudaismco-existedasa competingfaith,andinsomeareasthisresultedinacomplexfusionofbothreligiousthemes.ToynbeeRef.220 [294]considersthisempirethebeginningofthe"UniversalState"oftheoldSyriacSociety,butonemustrealize thattheSyriacstatewasSemiticandthePersianconquestendedtheSemiticruleinwesternAsiaforathousandyears. Ref.140[190],220[294] WeshouldmentionthatstillanotherIraniantribe,theParthians,existedatthistimearoundthesouthernshoreofthe CaspianSea.InthiscenturytheyfellunderthecontroloftheMedesandthenthePersians,butasweshallseethey willbeheardfromagaininthefuture. AlthoughGreekloniancitiescontinuedtoprosperalongthecoast,thecountryofLydiaexpandedtooccupyalmostall theremainderofthepeninsula.ThefabulouswealthofthesepeopleandtheirfamousKingCroesus-546B.C. wasbasedonanaturalalloyofgoldandsilvercalled"electum",andcoinswereinventedtoactasastandardmeasure ofthissubstance.BetweentheseLydiansandtheMedes,thePhrygianandCimmerianpeoplesofAsiaMinorwere absorbed,althoughafragmentofthelatterpeoplesurvivedintheCrimeaasthe"Tauri".Bymid-century,justafter Croesushadsubduedlonia,onthecoast,evenLydiawasengulfedbyPersiaanddisappearedasanation.Ref.28 [48],136[187] AdditionalNotesp.145 TheMedesdrovetheScythiansoutofArmeniaby590B.C.andthenewlyarrivedArmeniansofprobablyPhrygian origincontinuedtolivethereasavigorousrace.AlthoughtechnicallyunderthedominionofthePersianEmpireinthe lasthalfofthecentury,theyremainedessentiallyindependentinactionbecauseoftheirremotenessfromthePersian centerofgovernment.TheArmeniansretainedtheAnatolicorHittitenose. ForwardtoTheNearEast:500to401B.C.Section10.3 ChooseDifferentRegion 1.IntrotoEraSection9.1 2.AfricaSection9.2 3.AmericaSection9.4

PAGE 157

145 4.CentralandNorthernAsiaSection9.5 5.EuropeSection9.9 6.TheFarEastSection9.3 7.TheIndianSubcontinentSection9.6 8.PacicSection9.8 NOTE :Inthenorthwestpartofthepeninsula,nearestthecitiesofPhoenicia,wastheKingdomofDedan, whereLihyanitescarvedlionreliefsabovesandstonetombs,in600B.C.Thiswastheallegedretreatof Moses,wherehemettheBiblicalReuelatthewell.Ref.315[125] NOTE :Until600B.C.Ephesus,onthecoastofTurkey,wasaworld-classloniancity,butthereaftersiltbegan tolluptheharboranditdeteriorated.NowtheAegeanis11kilometersaway.AsimilarfateovertookTroy. Ref.281[113] 9.8ThePacic:600to501B.C. 13 9.8.1THEPACIFIC BacktoThePacic:700to601B.C.Section8.5 MostclassicalhistoriesrecordthatthisandadjacentcenturiessawcontinuedspreadofpeoplefromIndonesiathrough MelanesiaandMicronesiaeastwardintoPolynesiabutaswehaveindicatedinpreviouschaptersthiswasprobably impossiblewiththeseatechnologyavailableatthattimebecauseofthestrongwestwardoceancurrents.Ofinterest inthisregardisBraudel'sRef.260[29],page201statementthatevenin1696agalleon'stripfromManilato Acapulcotooksixorsevenmonthsandresultedinextremedifcultiesinthefeedingofthecrew.Again,weshould reiteratethatthePolynesiansarenotgeneticallyrelatedtoeitherMelanesiansorMicronesiansandtheirculturalhabits andphysicalcharacteristicsareentirelydifferent.Incontrast,ithasbeenfoundthattheIndiansofthenorthwest AmericancoastandcoastalislandsattheeasternendoftheJapancurrentacrossthefarnorthernPacicusedthesame adzesthatwereusedcenturiesbeforeinthenorthernPhilippines.CaptainCookfoundthesealsoinTahitiandother Polynesianislands,whileothersofthel9thcenturyfoundthattheadz-handleandthemethodofsecuringtheblade tothewoodenhandlewereexactlythesameamongthePolynesiansasamongthenorthwestAmericanIndians.20th centuryanthropologistshaveconrmedtheseobservationsandaddedmanyothersimilarities.Theinferenceregarding theoriginofthePolynesiansisclear.TheonlycontactthatthetruePolynesianshadwiththeMicronesianswasthrough theFijiIslandsontheborderofthetwogroupsofislandswhereitseemsthatthepigandthechickenspreadfromwest toeast,inalimitedarea.Onemustrealize,however,thatthesetrue,presentdayPolynesiansdidnotspreaddownthe eastPacicfromtheNorthAmericancoastalislandsuntilamuchlaterperiodthanthis6thcenturyB.C.andinthe meantimeotherpeoplesdidinhabitatleastmanyoftheseislands.Thesourceoftheseaboriginesremainssomewhat uncertain,although,asdetailedelsewhereinthismanuscript,itispossiblethattheycamefromCentraland/orSouth America.Ref.95[140] ForwardtoThePacic:500to401B.C.Section10.8 ChooseDifferentRegion 1.IntrotoEraSection9.1 2.AfricaSection9.2 3.AmericaSection9.4 4.CentralandNorthernAsiaSection9.5 5.EuropeSection9.9 13 Thiscontentisavailableonlineat.

PAGE 158

146 CHAPTER9.600TO501B.C. 6.TheFarEastSection9.3 7.TheIndianSubcontinentSection9.6 8.TheNearEastSection9.7 9.9Europe:600to501B.C. 14 9.9.1EUROPE BacktoEurope700to601B.C.Section8.1 Inthisandtheadjacentcenturiestherewasextensiveadmixturenotonlyofculturesandmaterialsbutofpeoples, themselves,throughoutallareasofsouthernEuropeandevennorthernAfricaandtheeasternMediterranean.There weremigrationsofpeoplesfromGreecetotheAegeanislandsandAsiaMinorandtoItalyandsouthernFrance, whilePhoeniciansandCarthaginiansmovedtoItaly,SicilyandSardiniaandthevarioustribesinbothpeninsulas intermingled,fought,traded,usurpedterritoryandconsolidatedvillages.Peoplesofvaryingracesandlanguages seemedtolivesidebysideattimes,onlytoghtatothertimes.Justasdiverselanguagesseemtobenoimpedimentto students,businessmen,teachersandtravelersinEuropetoday,soitseemstohavebeentruethroughoutthecenturies. ThuseasternandGreekinuencesbecameprominentinItalyandthewesternMediterranean.Ref.75[115] TherewasnogreatpoliticalchangeinthiscenturyfromthelastexceptthatPersiatookoverRhodesanditscolonies. Ref.38[59] ThenodeofGreektradingwasatthePeloponnesianisthmusandGreece'srstmajorcity,Corinth,haddeveloped there.About600B.C.apavedwayallowedshipstobehauledacrosstheisthmus.WhatCorinthowedtothis keypositiongeographically,AthensowedtothediscoveryofsilveratnearbyLaurion.ItwaswiththisthatAthens subsequentlynanceditsnavyusingaslavework-forcerunningtovegures.Ref.249[98]TheIoniansattained greatnavalstrength,butSamos,underPolycrates,becameagreatseapoweralso,usinglong-boatswithasmanyas ftyoars.GreececontinuedtobepolyglotwitheventheIonianshavingfourdifferentdialects.Ref.122[170],136 [187],216[291],58[86] Asthecity-statesincreasedinpopulationsubsistencebecameaprobleminviewofthepoorsoil,andvariouscities solvedthepotentialcrisisinvariousways.WhileCorinthandChalcisestablishedoverseascolonies,Spartaattacked andconquerednearbyGreekneighborsandthusdevelopedamilitarystate.Athens,ontheotherhand,developeda specializedagriculturalexporttradeandstartedmanufacturingbasedontheexportofwineandoilfromtheirgrapes andolives,inexchangeforgrain.MiletusandEretriaparticipatedalsointhistrade.InAtticathetyrant 15 Peisistratus startedapolicyofgrantingstateloanstofarmerswhoplantedtheirlandwithgrapesorolives.Solonforbadetheexport ofanyagriculturalproductexceptoliveoilandthiswasthenaltouchasfarasGreeksoilwasconcerned,because thedeeptaprootoftheolivetreesoakedupthemoisturefardowninthelimestoneanddidnothingtofeedtopsoil. EventhoughAthensgrewrichonthesilverandoliveoil,basicfoodsuppliesstillhadtobeimported,necessitating continuedtrade.TheuniqueartistictalentsoftheAthenianshelpedastheyexportedtheirfamous"black-gure"vases withtheblackshapesstandingoutfromanorange-redbase 16 .Meatwasararityexceptattimesofreligioussacrice. TherewerenopalmsinGreece,butgswereused,particularlydried,inwinter. 14 Thiscontentisavailableonlineat. 15 "Atyrantwasamanwhogainedpowerthroughcoupd'etatandruledextra-legally."Ref.139[192]page202 16 In1970alistshowedthat1,560ofthesevaseshadbeenfoundinEtruria,Italy,andmanymorehavebeenfoundsincethen.Ref.75[115]

PAGE 159

147 AchangeinwarfaretechniqueearlyinthiscenturywasanimportantfactorinchangingsocialrelationshipsinGreece. Thehorsemenofthebattleeld,heretoforechieyaristocratsbecauseofthecostinvolved,werenowbeingreplacedby heavilyarmedandarmoredclustersofinfantrymencalled"hoplites"whichweremassedtogether,shieldsoverlapping, ina"phalanx".Thefarmerswereabletotakeoverthisroleandthetendencytowardthedevelopmentofanaristocratic primacywaschecked.Eventhensomesocialstrugglesdeveloped.Peisistratus-527B.C.backedthecauseofthe poorerclassofhillmenagainstthearistocracyinonesuchuprising.Itispossiblethatthepsychologyofthephalanx helpedtopromotethedemocraticidealofallbeingequal,butcontrarytowhatonemightbelievefromperusingthe classicalschooltextbooks,Greekdemocracywasfarfrombeingtotal.Greatnumbersofslaves,whichweshalldiscuss moreindetaillater,lackedallpoliticalrights;womenwerealsodisfranchised;andresidentalienswereadmittedto citizenshiponlyveryrarely.Actually,throughoutthis6thcenturyGreececitizenrywasprettymuchaclosedand hereditarygroupunitedbytiesofkinship. NOTE:InsertMapstakenfromReference97ANCIENTGREECE,CENTRALGREECE Aesop,offablefame,livedinthersthalfofthiscentury,bornasaslave,physicallymalformed,rough,dogmaticbut brilliant.HebecametheGreekambassadortoLydia,butlater,afterchallengingtheintegrityofthepriestsofApollo, hewassentencedtodieandwasthrownfromacliff.Thales,afterreceivingpartofhiseducationinEgypt,founded theIonianSchoolofNaturalPhilosophyandsetuptherstsystemofabstractgeometryandissaidtohavepredicted theeclipseofthesunwhichoccurredin585B.C.CoinsofsmalldenominationwereintroducedinGreeceatthistime. ToynbeeRef.220[294]saysthat550B.C.markstheendofthetwohundredyearsoftheacmeoftheHellenic civilization,butinviewofthedevelopmentsinthelatterpartofthiscenturyandthenext,manywoulddisagree. EarlyinthecenturytheScythiansextendedtheirpowerasfarwestaspresentdayHungary,butthentheywere decimatedbyamysteriousdiseaseandtheydrewbacktotheirhomelandaroundtheBlackSea.Herodotusmentions adiseaseoftheScythianswhichmadethemsterile,butitisnotknownifthiswasoneandthesamescourgewhich facilitatedtheirdefeatbyDarius,whenlateinthecenturyB.C.thePersianscrossedtheHellespont,conquered thesilverandgoldrichlandofThrace,makingabufferzoneagainstGreece.TheremainingScythiansinthenorth ed,burningthelandbehindthem.ThracehadbeenourishingwithanextensivetradeandGreekstylesandluxuries. Strangelyenough,thePersianinvasiononlyseemstohavestimulatedThracianart.Macedoniacontinueditsownmore orlessunmolesteddevelopment.TheIndo-EuropeanIllyrianshadsettledinpresentdayAlbaniaandtheirmineshad attractedGreekswhosettlednearthemontheAdriaticcoast.Ref.92[136],171,28[48] TheregionbetweenFlorenceandRome,nowknownasTuscany,waspopulatedbytheprosperousEtruscanswho capitalizedontherichcopperandirondepositsofthearea.TheyhadtwelvecitiesinTuscany,additionalsettlements inthePoValleyandtheycontrolledwesternItalydowntoCumae.Inthenorthafter600B.C.Bononiabeganto produceagreatseriesofbronzebucketsshapedliketruncatedconesandbearingguredreliefs.Thesehavebeen foundasfarawayasAustriaandSloveniaandtheBononianonesmaybecopiesofthelatter.OntheAdriaticSea,in thiscentury,severalvillageswerebroughttogethertoformtheportofSpina,notfarfrompresentdayVenice.Spina wascenteredonalong,widecanalwhichconnectedtheseatoalagoon.Thecitycoveredover700acres,chieyon peninsulaeconnectedtothemainlandonlybynarrowtonguesofland.ItwaspeopledbyEtruscansandGreeksaswell asthemorenativeVenetii,andsomeofthelatterapparentlyconvertedtotheEtruscanlanguage. AllofthewesternEtruscancity-stateshadtheirindividualmerchantnavieswhichwereactiveintheTyrrhenianSea, tradingattheGreekandCathaginianportsandtheirtrader-pirateswereactiveevenintheAegean,wheretheymay havehadacolonyontheislandofLemnos.ManyelementsintheirartandreligionhavebeeninterpretedasNearEast inorigin,andaspreviouslymentioned,traditionallyithasbeensurmisedthatatleasttheirrulerswereimmigrants fromAsiaMinor,Lydiainparticular,butthishasnowbeenprettywelldisproved.In1964therewasexcavatedat Pergi,Italy,aletterwrittenonsheetsofgoldleaf,inEtruscan,supposedlyfromHiram,LordofTyre,tothekingof LavinianearRomeandFellRef.65[96]interpretsthelanguageasbelongingtotheAnatoliangroupandrelated

PAGE 160

148 CHAPTER9.600TO501B.C. toHittiteandUrartian.Thisdoesnot,initself,proveNearEastancestryfortheEtruscanpeople.Ref.68[106],65 [96] OriginallythepeopleofRomewereruledbyEtruscankings,who,inturn,appointedornominatedthesenatefrom thepatricianfamilies.ThroughoutmostofthiscenturyRomewasactuallyanEtruscancity,eventhoughthecommon languagetherewasanIndoEuropeanone,destinedtobecomeLatin.Thedrainingofthemarshforerectionofthe RomanForumbyconstructionoftheimpressiveCloacaMaximawasatypicalEtruscankindofoperation.Etruscan metal-work,potteryandarmourappearedinRome,alongwithEtruscanimmigrants.Terracottafriezesareidentical inRomeandVeiiandthegreatsculptor,VulcaofVeii,madethestatueofJupiterforahugetempleinRome.The lastoftheRomankingswasanEtruscanandwhenhewasoverthrowntherepublicwasestablished.After510B.C. thesenatorswereappointedbytwoelectedconsuls.Oneofthese,ValeriusPoplicola,promotedtheLexValeria, sometimescalledthe"HabeasCorpus"ofRome,allowingtheplebianstoappealdecisionsofthemagistratestothe generalassembly,thusfreeingthemfromtheworstclassvindictiveness.Ref.229[307],75[115] Inthesouth,PompeiiwasanimportantharborforNolaandotherEtruscantownsinCampaniaandfragmentsof theirblackpotteryhavebeenfoundthere.AnotherEtruscansettlementwasnearSalerno.ThisEtruscanactivityin Campaniadidnotlastlong,however,asEtruscanCapuaandGreekCumaeclashedviolentlyabout525-524B.C.when aforceofEtruscansinvadedtheareainwhathasbeencalledthe"longmarch".Aristodemus,rulerofCumae,repelled theinvadersandlater,withthehelpofadjacentLatintribes,hefurtherdefeatedtheEtruscansnearAricia,between 506and504B.C.Ref.75[115]InaGreekcolonyinsouthernItaly,Pythagorasestablishedhisbrotherhoodand incidentallydevelopedhisfamousproofofC2=A2+B2inatriangle.Thegroupplacedsuchemphasisonthetheory ofnumbersthatultimatelyitinvolveditselfinaworldofmystical,mathematicalabstractions. SardiniaandthewesternhalfofSicilywereconqueredandoccupiedbyCarthageinthiscenturyandofcoursethere weremultipleGreekcoloniesallalongsouthernItaliancoastalareasaswellasonthesouthernandeasterncoasts ofSicily.SomewhatreplacingtheEubaeaninuenceintheMediterranean,anotherGreekcity-state,Phocaea,now sentitseetwesttoestablishtradingcoloniesatMassaliaandAlalianowAleriaoneasternCorsica.TheseGreeks wereinterestedmainlyintradeformetals,andEtruriawasthenalresource.ThecaptureofthePhocaeanandother IonianhomelandsbythePersiansactuallysentoodsofGreekrefugeestothewestandthusEtruscanartofthisperiod displaysmanyIoniancharacteristics.ThesouthernpartsofFrance,Italy,GreeceandTurkeyaretodayallverysimilar geneticallyintheirpopulations,indicatingtheprobableinuenceofthisearlyGreekcolonization. Fromabout540B.C.onwards,theCaeritans,guidedbylonianartistswhohadoodedthearea,developedanimpressivenewschoolofceramicswhich,amongotherthings,producedhandsomewaterjarswithrichpolychromepaintings ofGreekmythologicalscenes.ThenewwaveofPhocaeansettlerswhoarrivedatAlaliainmid-centuryextensively plunderedthesurroundingterritorieswithaconsequentreactionbyCarthaginianandCaeritannavies.Asnotedearlier inthischapterwhendiscussingCarthage,theseallieswereactuallydefeatedbythePhocaeans,butthelatteralsolost 40shipsandsoontooktheirfamiliesfromAlaliatoRhegum,insouthwestItaly.TheunfortunatePhocaeansailorsof the40capturedshipswereslaughteredontheadjacentshorebytheCaeritans.Ref.92[136],75[115] NOTE:InsertMaptakenfromreference97,GREEKANDCARTHAGINIANCOLONIZATIONOFSICILYAND SOUTHERNITALY Vetulonia,tothenorth,seemstohavereachedtheclimaxofitspoliticalpowerduringthiscenturyasawalledcity withatwomileperimeter.IthadcommercialrelationsacrosstheArnoandApenninesandreceivedamberfromthe Baltic.OneoftheVetuloniadominatedcitieswasPopuloniaonapeninsulaprojectingintotheseanotfarfromElba. Itparticipatedwiththeislandinironandcopperworksandeventuallybecametherealsmeltingcenter,asthesupply ofwoodfuelonElbadwindled. StillnorthofVetuloniaandborderingontheseawasVolaterrae,notedforitsfabricationofbronzesandsculptures ofvolcanicstone.Thecentralcitywassurroundedbyawallfourandone-halfmileslong,anditsareaofinuence extendedovertopresentdayFlorence,wheremoundtombshavebeenexcavated.Volaterrae'sinlandneighborwas Clusium,anareaoriginallyoccupiedbyItalicspeakingUmbrians,butwhicheventuallybecameEtruscanizedwhile

PAGE 161

149 yetremainingbiracial.KingLarsPorsennaofClusiumwasconsideredthemostpowerfulEtruscanofalltime,and histombhasbeendescribedasamagnicentedice,300feetsquare.Theprimaryproductsofthisinlandcommunity wereagricultural,eventhoughvastirrigationanddrainageprojectswerenecessarytolimitoodwaters.Ref.75 [115] InthiscenturytherewasacontinuingproliferationoftheHallstattCelticpeoplethroughoutcentralEuropewitha thinfringeofTeutonsinthenorth.TheScythiannomadsinvaded,particularlyinthegreatHungarianplain,and greatlyinuencedCelticartandsocietyingeneral.Fromthemmayhavecomethewar-horsewiththebronzebitsand harnessesandthehead-huntingcustom,allofwhichwerelaterconsideredapartoftheCeltictradition.BronzeAge Indo-Europeans,ScythiansandGreekconceptsapparentlyallcoalescedintothenewCelticpattern,withacenterat Heuneburg,ontheGermanDanube.Ref.116[165],91[135] By500B.C.theinuxofCeltsintosouthwesternSpainAndalusiawassogreatthatthelocalspokenlanguage changedfromPhoeniciantoCeltic,butevensotheTartessianculturepersistedwithCarthaginianstakingovertheold Phoeniciansettlements.ThePhocaeancolonyofMassiliawasfoundedontheMediterraneancoastofFrancein600 B.C.anditallowedcommercialrelationsbetweentheCeltsandtheMediterraneancultures.Vinyardsmayhavebeen plantedonFrenchsoilaboutthistime,aftertheGreeksstartedimportingtheirownwineintotheMarseillesarea.All theAtlanticcoastandBritaincontinuedunderCelticdomination.Ref.65[96],8[14],196[269] Althoughinthiscenturyironwasusedexclusivelyforfarmingandwar,theScandinaviantribescontinuedtomake bronzeimplements,bibelotsandcostumejewelryofgreatexcellenceandintricacy.Thepopulationswereincreasing rapidlyandpeoplewerealreadybeginningtomigratetotheEuropeancontinent,proper.TheFinnishpeoplecontinued toliveinwidelyspreadvillagesthroughoutthenorthernregionsfromnorthernScandinaviatoandperhapsbeyondthe UralMountains.Ref.88[131] FinnsandLappslivedthroughoutthenorthernareasofRussiawhileBaltsinhabitedthesoutherncoastoftheBaltic SeaandoneasttotheDonRiver.SouthoftheBaltsweretheearlySlavs,andnowthroughthisareatheScandinavians pusheduptheVistulaRiverasfarastheCarpathians.InsouthernRussiatheScythiansweredecimatedbyamysterious disease,althoughDarius'invasionmayhavehadsomethingtodowithitalso.Inthespringof514B.C.Dariusof PersiacrossedtheBosporuswithavastarmyandmovedthroughThraceintoScythia,buthis700,000menwerevery nearlyconsumedbytheScythians'militarywizardryastheyretreatedusinga"scorchedearth"policy,sothatDarius nallyhadtowithdrawtheremnantsofhisstarvingarmy.Ref.176[242] Forwardto500to401B.C.Section10.4 ChooseDifferentRegion 1.IntrotoEraSection9.1 2.AfricaSection9.2 3.AmericaSection9.4 4.CentralandNorthernAsiaSection9.5 5.TheFarEastSection9.3 6.TheIndianSubcontinentSection9.6 7.TheNearEastSection9.7 8.PacicSection9.8

PAGE 162

150 CHAPTER9.600TO501B.C.

PAGE 163

Chapter10 500to401B.C. 10.1500to401B.C. 1 10.1.1500TO401B.C. Backwardto600to501B.C.Section9.1 Atabout500B.C.theculturalleadershipoftheMiddleEastbecameathingofthepast,butthedominanceofEurope stilllayfarinthefuture,sothatforthenext2,000yearsthefourmajorcivilizedareasoftheworld-theMiddleEast, AegeanandItaly,IndusandGangesvalleysofIndiaandChina-allpursuedtheirseparateways,oftenaffectedbywhat transpiredbeyondtheirfrontiers,sometimesborrowingculturalelementsfromQneanotherandrepeatedlyaficted bynomadattacks.Yeteachdevelopedaccordingtoaninnerlogicandmomentumofitsown.Ref.139[192] Forwardto400to301B.C.Section11.1 ChooseRegion 1.AfricaSection10.2 2.AmericaSection10.9 3.CentralandNorthernAsiaSection10.5 4.EuropeSection10.4 5.TheFarEastSection10.7 6.TheIndianSubcontinentSection10.6 7.TheNearEastSection10.3 8.ThePacicSection10.8 10.2Africa:500to401B.C. 2 10.2.1AFRICA BacktoAfrica:600to501B.C.Section9.2 PerhapsasearlyasthiscenturytheartofironsmeltingwasimportedintoSudanfromEgyptviaKush,whichhad becomeanimmenselyrichcountry.TheearlyinhabitantsofAxumontheEthiopianplateausouthofKushwere 1 Thiscontentisavailableonlineat. 2 Thiscontentisavailableonlineat. 151

PAGE 164

152 CHAPTER10.500TO401B.C. probablyofmixedAsianandNegroorigin,andtheywerejoinedabout500B.C.bysettlersfromsouthernArabia, someofwhomwereapparentlyJews.AnEthiopian-Jewishcommunity,aswellasalaterChristianone,hasexistedin Ethiopia 3 uptothepresenttime.FromthosecontactsarosethelegendthattheQueenofShebaboreasonbySolomon, whobecameemperorofEthiopiaandfoundedtheSolomaicDynasty.TheQueenofSheba,ofcourse,livedinthe 10thcenturyB.C. EgyptcontinuedtoberuledbythePersians,withnoadvanceintheirowncivilizationexceptthattheireconomic isolationwaseliminatedandtheydidcompletetheNile-RedSeacanalwhichhadbeenbegunbyNecho.Apparently theoriginalEgyptiancottonwasapoorproductandlinenfromaxdominatedEgyptianclothing.Ref.213[288] TheEgyptianscienceofpreviouscenturiesbegantobepickedupbyGreekswhohadcoloniesatNaucratesonthe Niledelta,withothersalongthecoasttowardsLibya.AllofthiswasfurtherdevelopedinthesubsequentHellenic Culture.Ref.136[187],28[48],175[241],83[123] InadditiontotheGreeksettlementsalongtheLibyancoasttherewerePhoeniciancoloniesallalongthewesternhalf oftheNorthAfricanshorefromLeptiseastofCarthagetothePillarsofHercules.Carthagewasrapidlydeveloping anempireofitsown,controllingtheoldTartessusareaofSpainby480B.C.andlatergainingallofthewesternhalf oftheAfricanMediterraneanshoreline.ItwasmentionedinthelastchapterthatattheendofthatcenturyHanno,of Carthage,hadestablishedalargecolonydowntheAtlanticcoastofAfrica.Otherwritershavedatedthiscolony,some 2,600milesdowntheAtlantic,at490B.C.,butinanyevent,archeologistshaveshownthatHannowasnottherst,as therewerealreadyruinsofalargemegalithiccityofLixus,farsouthofGibralter,justwheretheoceancurrentsweeps pasttogodirectlytotheGulfofMexico.TheRomanslatercalledthisancientcitythe"EternalCity"orbyastill oldername,"SunCity",asitwasapparentlybuiltbysun-worshipperswhoincludedastronomers,architects,masons, scribesandexpertpotters.TheSumerians,Assyrians,Hittites,Phoenicians,EgyptiansandtheLixuspeoplewereall fanaticsun-worshippers,justasweretheOlmecsandtheMochicainMexicoandPeru,respectively.TheCarthaginian HimilcoalsocontinuedhistripsuptothenorthernshoresofEuropetoobtaintinforbronze.Inhisefforttondthe ultimatesourceofthatmetal,andavoidtheCelticmiddlemenofFrance,Himilconallyfoundthechannelislands andthenthecoastofBritain,eitheratCornwallorDevon,eventuallytodiscoverthetinminesofCornwall.Ref.28 [48],136[187],95[140],66[97]TheCarthaginianpositionintheMediterraneanwasweakenedin480B.C. whenalargeCarthaginianforcesufferedanhumiliatingdefeatatthehandsofGreekSyracusansinnorthernSicily. CarthagethenseemedtoalsoloseitsformerEtruscanally,thecity-stateofCaere.PerhapsthisoccurredbecauseCaere hadtriedtoestablishacolonyontheAtlanticislandofMadeiraasameansofinterruptingtheCarthaginianmerchant marine'smonopolyofthetinsupplyfromGaulandCornwall.Ref.75[115] InadditiontothecivilizedcentersofEgypt,KushandCarthage,the4thcenturycenterofCyrene,inpresentdayeast Libya,mustbementioned.ThiswasaGreekcity,settledintheprevious-centurybutwhichnowdominatedanentire communityareawhichwasprosperousandcultured.Ref.83[123] TheclimatecontinuedtodeteriorateintheSaharaandlifeintheAkanjeirCultureoftheTichitValleyofsouthern Mauretaniawasbecomingprogressivelymoredifcult.InthiscenturytheareasofGhanaandKanembegandevelopment,probablywiththehelpofBerbersfromthenorth,andwiththeeconomicfoundationoftheexportofgoldand slaves.ExcavationssouthofLakeChadgiveevidenceofpeople,stoneandboneimplementsandcattle-raisingatthe beginningofthiscentury.Ref.83[123]InNigeriaanironindustrydevelopedontheJosPlateau,andsculptured headsandgurinesinterracottadatingto500B.C.havebeenfoundnearNok,inthatcountry.Aboutthesametime, theNegroes,startingnorthwestoftherainforests,migrateddownthroughtheforestalongthegreatriverstothecentralpartofthesouthernsavannasandthenspreadoutinalldirectionstotheeasternpartofthecontinentandtoward thesouth.TheyspoketheBantulanguage,whichistheancestorofmostAfricanlanguagestoday.Thesementook 3 Theword"Ethiopia"isGreekfor"burnt-face".Actuallythisregionwasusuallycalled"Abyssinia"until1923.Ref.83[123],240[319]

PAGE 165

153 knowledgeofminingandironwiththem.Ref.45[66],8[14],175[241]HottentotsandBushmenstilllivedin thefarsouth. ForwardtoAfrica:400to301B.C.Section11.2 ChooseDifferentRegion 1.IntrotoEraSection10.1 2.AmericaSection10.9 3.CentralandNorthernAsiaSection10.5 4.EuropeSection10.4 5.TheFarEastSection10.7 6.TheIndianSubcontinentSection10.6 7.TheNearEastSection10.3 8.PacicSection10.8 10.3TheNearEast:500to401B.C. 4 10.3.1THENEAREASTTHE1STGREATCENTEROFCIVILIZATION BacktoTheNearEast:600to501B.C.Section9.7 BetweentheGulfofAqabaandtheDeadSeaonthetraderoutebetweensouthArabiaandSyriatheNabataeanKingdomdevelopedwithacapitalatPetra.BecauseofitslocationitwasinuencedbytheAramaicSyriancivilization andstilllaterbytheGreeks.TheNabataeansmigratedupfromthesouthtosettleinthiscliffarea,levyingtollsonall caravangoodspassingthrough.Petrahadatheatre,thermalbaths,palacesandasystemofcanalsforwater.Thisonce thrivingcity,aboutninetymilessouthwestofpresentdayAmman,Jordan,wasburiedforcenturiesandonlyrecently excavatedbytheSwissBurckhardt.QatabanandHadramautweretwonewkingdomswhichappearedonthesouth coastofArabia.Ref.136[187],176[242] ManyPhoenicianportswhichwereconstructedatthisperiodoflowsealevelsaretodaybelowthewaterline.Both PhoeniciaandJudearemainedunderPersianrule,buttheirseparatereactionsdiffered.WhilePhoeniciafadedaway asacountry,livinginthefutureonlyinitscolonyofCarthage,theJewsstrovetokeeptheirnationalidentity. Thepriest,Ezra,calledtheJewstogetherandtheyreadandadoptedtheBookoftheLawofMoses,whichwas probablytherstvebooksoftheBible,the"Torah'orthe"Pentateuch".Thosestoriesweredrawnfromastorehouse ofMesopotamianlegendasoldas3,000includingthelegendsofParadise,theFlood,etc.Nehemiahrebuiltthewalls ofJerusalem-433B.C.andenforcedtheobservanceofthelaw.Ref.224[299],46[76] ThisentireareawasapartofthePersianEmpire,buttherewasarevivalofDamascusasaculturalcenter.Attheend ofthecenturyDariusIIdiedB.C.andhissonArtaxerxesIIbecameemperorwhileabrother,Cyrustheyounger, becameIranianviceroyinthewest.ThelatterrecruitedaforceoftenthousandGreekmercenariesandmarchedthem acrossAsiaMinorintoSyriaandMesopotamiatorevoltagainsthisbrother.inagreatbattleatCunaxain401the GreektroopsdefeatedthePersians,butCyruswaskilledandthemercenariesretreatedwithsomedifcultiesbackto theshoreoftheBlackSeaandthenhome.TheGreek'svictory,however,gavethemrenewedcondenceandhelped 4 Thiscontentisavailableonlineat.

PAGE 166

154 CHAPTER10.500TO401B.C. setthestageforAlexander'slaterAsiaticinvasions.AtthattimemanyJewsstilllivedinBabyloniaandsomeinthe PersiancontrolledcityofUr. NOTE:InsertMapfromReference97.24.THERETREATOFTHETENTHOUSAND 401-399B.C. AsthecenturyopenedDariusIwascontinuinghisconquestsinto-apartofnorthernGreece,beingnallystopped atthefamousbattleofMarathon.ThePersianEmpirenowincludedthirtysatrapiesprovinceseachruledbya satrapappointedbytheking.Ineach,also,wasageneralandanancialofcerresponsibleonlytotheking.These territoriesincludedEgypt,Palestine,Syria,Phoenicia,Lydia,Phrygia,Ionia,Cappadocia,Cilicia,Armenia,Assyria, theCaucasus,Babylonia,Media,Persiaproper,Afghanistan,Baluchistan,IndiawestoftheIndus,Bactriaandother regionsofseveralcentralAsiatictribes.TheofciallanguagewasOldPersian,closelyrelatedtoSanscrit,andwritten incuneiform.Themoregenerallyusedlinguafrancaoftheempire,however,wasAramaic,writteninalphabeticform. ThePersianconquestsweremadepossiblebymountedbowmenandBactriancamels.Thelattermadethelonglances oftheScythiansandotherenemytribesineffective.Ref.28[48],213[288] ThatDariuswasatrue"GrandMonarch"isevidentfromthestorythatathousandanimalswereslaughteredeachday fortheroyaltableinPersopolis 5 .UponthedeathofDariusin485B.C.hisson,XerxesI,inheritedthegreatempire. Hewasasensualmanandwithhimthe"mobofnations",contaminatedwithdrunkennessandimmorality,begantofall apart.XerxesdispersedtheBabylonianpriesthoodanddestroyedtheirtempleofMarduk,butwhenhemadeanother attempttotaketheremainderofGreecehistroopswereturnedbackatThermophylaeandhiseetwasdefeatedat thenavalbattleofSalamis 6 .Stilllesserkingsfollowed-ArtaxerxesIandDariusII,etc.ThelaterAchaemenidkings demonstratedgreatbrutality,inspiteoftheirZorastrianreligion. ThemetalworkersoftheAchaemeniddynastyperiodhaveleftnumeroussmallobjectsofartmadeofgoldandsilver. Theuseofanimalshapeswascommonandthelion,symbolizingroyaltyandpower,andthebull,symbolizingstrength, vitalityandloyaltybeingtwoofthemorepopular.LaterChristianiconographyusedthesamesymbolsfortwoofthe evangelists-Markbeingrepresentedbythelionandthephysician,Luke,bythebull.TheIranianartistshadtheability todeveloplightreectionwhichissaidtobeacharacteristicofthelightonthelandscapeoftheIranianplateauitself. Ref.197[271]AdditionalNotesp.154 IntheearlycenturythisentireareaalsowasmerelyapartofthePersianEmpire,butinthefareasternportionthe Armeniansretainedsomemeasureofautonomy.In499B.C.Ioniancitiesalongthecoast,ledbyAristogoras,revolted againstPersia.Thisso-called"IonianRevolt"washelpedbyshipsfromAthensandEretriaandtheysucceededin burningtheoldLydiancapitalofSardis.Withinveyears,however,therevoltwascrushed,anditwasmid-century beforetheGreekscouldagaincontrolthecoastalcities.Ref.28[48],88[131] NOTE :Xerxesdidnotdevastatethelandashisarmiestraveled,buthehadagentsgatherfoodsupplies fromhisownterritoriesanddeliverthemtostationsalongtheintendedroute.OnceinGreece,however,he eventuallyhadtowithdrawbecausetherewasnowayhecouldfeedhisentirearmyoverthewinter.Hehad exceededthepracticallimitofimperialexpansion.InthisandthenextfewcenturiesIranianwarriorsbreda large,powerfulhorsecapableofcarryingafullyarmoredmanandthehorses,too,wereprotectedbymetal. Althoughthisheavycavalrywasslowerthanthatofthesteppe,itwasmoreorlessarrowproofandcapable ofusewitheitherboworlance.Tofeedthesegreathorsesalfalfawassuppliedbythelocalpeasantsaspay fortheprotectiongivenbythose"cataphracts".Ref.279[191] 5 TragersoquotesthehistorianXenophon.Ref.222[296],page15 6 Xerxes'armycrossedtheHellespontbyjoiningabout700ships,anchoringthemandtyingtheendshipstoland,layingplanks,brushwoodand earthacrossthem.Ref.213[288],page193

PAGE 167

155 ForwardtoTheNearEast:400to301B.C.Section11.3 ChooseDifferentRegion 1.IntrotoEraSection10.1 2.AfricaSection10.2 3.AmericaSection10.9 4.CentralandNorthernAsiaSection10.5 5.EuropeSection10.4 6.TheFarEastSection10.7 7.TheIndianSubcontinentSection10.6 8.PacicSection10.8 10.4Europe:500to401B.C. 7 10.4.1EUROPE BacktoEurope600to501B.C.Section9.9 WiththeultimateGreekvictoryoverthePersians,manyMediterraneanislands,includingRhodesandtheCyclades, nowbecamedependentsofAthens.EventheEtruscanheldislandofLemnosfelltoAtheniancontrolinthatperiod. Attheendofthecentury,however,Rhodespulledaway,formingitsownconfederacyofthreecity-states.Ref.38 [59] Inthersthalfofthecenturythecity-statesofGreecewereoccupiedwithcontinuouswarfarewithPersiawiththerst Persianattackcomingin490B.C.bysea.In480B.C.therewasthegreatbattleofThermophylaeandaconcurrent seabattleatSalamisinwhichXerxeswasdefeated.Between478and477AthensorganizedtheDelianLeagueas adefenseagainstfutureimperialism,withmembersbeingtheAegeancoastandislandallies,withheadquartersat Delos,butwithAthensastheleader.TheseAthenianimperialisticpolicieswereengineeredbyCimon,aristocratic successorofThemistocles.ThePerisanwarsendedabout449B.C.asthePersianEmpiredeterioratedandmostofthe Greekcities,eventhoseonthecoastofAsiaMinorandtheBlackSea,becamefree. ThekeytoAthens'extraordinaryaccomplishmentsinthersthalfofthiscenturylayinhereet,whichmaintained controloftheAegeanandallowedgoodsfromtheeasternMediterraneantoenterthroughtheportofPiraeus.The eetthusnotonlycarriedthewaracrosstheAegeantohelpliberatetheGreekcitiesthere,butalsoallowedforeign contact,thusbringingnewideasandconcepts,allofwhichsetthestageforculturalcreativity.Inthiscontextwemust notforgetthatbehindalltheshippingandtradewasthenecessityforGreecetoimportfood.Thelife-linedemanded grain,eventhoughthis5thcenturyB.C.didseetheuseofthedomesticheninalmosteveryAthenianhouseholdand Greecenowbecamethehomeofnewines.AlfalfawasintroducedbythePersiansandsubsequentlytheGreeksused thisashorsefodder.Ref.47[71],222[296] SomemodernwritershaveatendencytoidealizeGreeklifeofthiscenturyandunderplaysomeofthelesstasteful aspectsofthatcivilization.InallGreekstatesabortionorabandonmentofchildrenwaspermitted.Spartaarranged topreventparentsfromknowingwhichweretheirownchildrenandviceversa,whilethestatedecidedwhetheror notanychildwouldbepermittedtolive.Homosexualitywaswidespreadandpubliclyaccepted.Athenshadbetween 7 Thiscontentisavailableonlineat.

PAGE 168

156 CHAPTER10.500TO401B.C. 75,000and150,000slavesrepresentingsome25to35%ofthepopulation.Ref.213[288],222[296]Finley Ref.249[98]saysthatthisnumberispurelyaguess,andthatwhiletheexactnumberofslavesisunknown,the importantfactisthatthiswasaslavesociety.Urbanismandthegreatincreaseinwealthinitiatedcapitalismandwith theextensionoffullrightstothelowerclasses,freehiredlaborcouldnotmeettheneedsofthecapitalistswho,taking advantageofthealmostcontinuouswars,turnedtoeverlargerscaleslavelabor. AsinPhoenicia,someGreekportsconstructedinthattimeoflowsealevelsintheMediterraneanaretodaybelow sealevel.MedicineofthatperiodinGreecewasamixtureofreligiousmysticismwithsomerationalthoughtand procedures.AscelepioswasworshippedastheGodofHealingandtempleswereerectedforhimforthatpurposeover manycenturiesandwereinpresentdayterminologymixturesofreligiousshrinesandhealthspas.Alcaeon,possiblyof thiscentury,wroteabookConcerningNature,whichmaybethebeginningofGreekmedicalliterature,althoughonly afewfragmentssurvive.Heestablishedaconnectionbetweenthesensoryorgansandthebrain,describedtheoptic nervesandconcludedthatthebrainwastheorganofthemind,thereforealsoresponsibleforthoughtandmemory.A centurylaterAristotlethoughterroneouslythattheheartwasthecenterofsensation.Ref.213[288],281[113], 224[299],125[173] NOTE:InsertMap:GREECEDURINGTHEPERSIANWARS Theperiod475-429B.C.hasbeencalledthe"GoldenAgeofPericles",thegreatestrulerofAthens.Inviewof thethousandsofpagesthathavebeenwrittenconcerningancientGreece,itissometimesdifculttokeepthingsin properperspective.Atticawasactuallyasmallarea,withSunium,themostdistantpointfromAthens,beingonlyforty milesawayalthoughadmittedlythiswasalongwalk,withonlyfeetfortransportation.Itwas,however,aperiod ofliterature,plasticartsandthedevelopmentofthefoundationsofscience.ThiswasthetimeofSocrates,forwhom philosophywasneithertheologynormetaphysicsbutethicsandpoliticswithlogicanintroductionandameans.Ref. 47[71]ItwasthetimeofthehistorianHerodotusbornabout484B.C.andinloniathetimeofthegreatphysician Hippocrateswhofosteredthescienticapproachtothetreatmentofdiseaseasopposedtothepriests'explanation thatdiseasewastheresultofangerofthegods.HewasbornontheislandofCosin460B.C.andbecameknown eventuallyasthe"FatherofMedicine".Protagoras480-410B.C.wasthechiefproponentoftheSophists,who taughtthevirtueofproperuseofwordsandamethodofverbalreasoningaccordingtorulesofargumentwherebya manmighthopetounravelallthemysteriesoftheuniverse.Theirdoctrines,includingonethatstatedthatthelawwas aconspiracyoftheweakagainstthestrong,providedtheoligarchywithjusticationforviolenceandchicaneryused tooverthrowthedemocracyeventually-411B.C.OtherphilosophiesincludedthatoftheCynicswhocared onlyforvirtueandrelationofthesoultoGodwiththeworldanditslearningsamountingtonothing;andtheStoics andEpicureans,usinglogicandrhetorictowardasimilargoal.ParmenidesandZeno,ofthefamousparadoxes,were Eleatics.Ref.47[71],221[295] ThisgreatageofGreeceendedwiththePeloponnesianWar-awarofSpartaandheralliesagainstAthensandhers, whichragedforthirtyyearsbeginningin431B.C.andwhichwastedallthepowerofGreece.Fortyyearsofaggressive AthenianimperialismandlandgrabbingactivitieshadforcedmostmainlandcitiestolooktoSpartaforleadership. AthenshadcontroloftheseasbutcommandedfewmainlandareasoutsideofAttica,anditwasobviousfromthe beginningthatneithersidecouldwin.Thenin430and429B.C.apestilence,whichmayhavebeenamalignantform ofscarletfever 8 ,killedoff25%oftheAthenianlandarmy.ThucydidessaidtheinfectionhadbeguninEthiopia, runintoEgyptandLibyaandmostofPersia,thenthroughPiraeustoAthens,itself.Thelatterneverfullyrecovered andlostthewartoSparta.Apeacewhichwassupposedtolastftyyearswasdeclaredin421B.C.butAthens resumedexpansionistambitions,thistimewithcrueltyandslaughterinconqueredislands.Inreaction,thePersians nancedanewSpartannavycommandedbyLysanderandhecompletelydefeatedtheAthenianeetatagreatbattle atAegospotamiofftheHellespontin405B.C.TheendcameforAthenswhenLysanderthencutoffthegrainsupply lineandlaidsiegetothecityitselfin404B.C..Thenalslaughteroftheinhabitantsmatchedthepreviousplagueof 430-429.Plato,apupilofSocrates,grewupintheatmosphereofthisexhaustingwar.Ref.28[48],140[190], 47[71] 8 AnunsupportedstatementofTrager.Ref.222[296],page17

PAGE 169

157 NOTE:Insert21:GREECEDURINGTHEPELOPONNESIANWAR TherewascultureinThraceandintheGreekcoloniesalongthecoastoftheBlackSea.Manycitieshaddeveloped inMacedoniaandby450B.C.,underthereignofAlexanderI,aveneerofHelleniccivilizationhadappearedonthe rulingclassesofthisarea.Ref.218[69] Italyatthistimewasamotleyofindependenttribesandtowns.TherewasstillanorthernEtruscanpresencenear thePoRiver,withvariouscitiesthere.Virgil,theRomanpoetofpartEtruscanorigin,describeshishomeofMantua ascomposedofthreeraceswhichapparentlyincludedEtruscans,VenetiansandUmbrians,thelattertwobeingIndoEuropeanItalicspeakers. InEtruria,itself,inadditiontoTarquiniiandCaere,whichwediscussedatsomelengthinthelastchapters,weshould nowdiscussVulci,thecity-statejustnorthofTarquinii. Inthis5thcenturyB.C.itshowedamarkedAthenianinuence,withtheAthenian"black-gure"potteryooding thecommunity.Nolessthan40%ofallAtticpotterythathasbeenexcavatedinEtruriaisfromVulci.Butthis city'srealclaimtofamewasitsbronze-work,withmultiplecastbronzestatueswhichwereinturnexportedafar, includingbacktoGreece.ItispossiblethatServiusTulliuswhoruledasKingofRomeafterTarquiniusPriscus,was aVulcentinewiththeoriginalnameofMastarna.Ref.75[115]EarlyinthecenturytheEtruscans,attheheightof theirpowerandalliedwiththeCarthaginians,wereatwarwiththeSicilianGreeksofSyracuseandtheirKingHiero 1.Pleaseseealso1,B,thischapter,andinagreatnavalbattleoffCumaeabout474B.C.theEtruscannavywas destroyed.TheywerethenforcedtowithdrawfromCampaniaandthissecuredtheliberationofRomefromEtruscan control.Eventhen,CumaeandCapuaalikewerestillsubjectedtoseveralyears-423B.C.ofghtingsome hard-nosedmountain,Italic-speakingtribes,theSamnites.Itwasthedescendantsofthelatterwhoeventuallyforged anewCampaniannation.InadditiontotheresistanceoftheCampanianGreeksthecity-stateofCaerewasfurther damagedbyanattackbysixtySyracusanwarshipswhichplunderedharborsonthemainlandandoverranElbaand Corsica.Ref.75[115] UptothispointRomehadactuallyonlycontrolledanareaofaboutnineteenbynineteenmiles,buttheysoondefeated theSabinesandexpandedintotheirarea.InspiteofthesmallnessofRome,thiswastheperiodoftheRomanRepublic. AtthebeginningB.C.therewastherst"secession"inwhichtheplebeswithdrewfromRometoformtheirown city,forcingconcessionsfromthepatricianssuchastherighttohaveofcersoftheirown,tribunesandaediles.Inthe Republictherewerefourclassesofcitizens;thePatricians,consistingofthesuperiorclanswhichsuppliedRomewith generals,consulsandlawsforvecenturiestheMantii,Valerii,Aemili,Cornelii,Fabii,Horatii,ClaudiiandJulii; theEquites,orbusinessmen;thePlebs,orcommons;andnallytheSlaves.TheRomanSenateconsistedof300 membersmadeupofclanheadsfromthreebasictribes,althoughoccasionallyanEquitegotintothatbody.Asaresult ofapoliticalbattleforbetterlawsforthePlebs,acommissionwassenttoGreecetostudythelegislationsofSolon andotherlawmakersandontheirreturn,tenmendecemviriformedanewcodecall"theTwelveTables"whichwere approvedbytheAssemblyandbecametherstwrittenformofalegalstructureofRomeB.C.,servingasthe basiclawforthenext900years.In443B.C.appearedtheinstitutionofcensorshipandin432therstlawdesignedto checkelectoralcorruptionwaspassed.AttheendofthecenturythelongwarofRomeagainsttheEtruscancity,Veii inTuscanywasstarted.AtthesametimetheGaulsdescendedagainfromthenorthandtheEtruscansweresqueezed inthemiddle.Ref.48[72] PeiRef.168[229]statesthatat500B.C.theLatinlanguagewasarough,elementaltongue,lackingmostofthe renementofsyntaxandvocabularytocomelater. TheGreekSyracusanswerebusythroughmostofthiscenturyghtinganddefendingtheirpossessions.Inthebattle ofHimeraonthenorthSicilianshorein480B.C.theydefeatedtheCarthaginiansandthenwereabletodominate

PAGE 170

158 CHAPTER10.500TO401B.C. thewesternMediterranean.WehavenotedabovehowtheysubsequentlydefeatedtheEtruscannavy.In414B.C.the AtheniansbesiegedSyracuse,buttheytooweredefeated,theireetdestroyedandthesurvivorsweretakenasquarry slaves. TheGreekEmpedocles,livinginSicily,developedatheoryofthemovementofbloodtoandfromtheheart,and performedvariousmedical"miracles".Heissaidtohaveraisedawomanfromthedead.Later,Galenwastocallhim theFatherofItalianmedicine.Ref.28[48] By500B.C.thegreaterpartofthenorthernEuropeancoastwasGermanic.Therst,orGermanic,soundshiftinthe AryantonguecreatedadividinglinebetweentheGermanicandotherIndo-Europeanlanguages.Farthersouththe GermanicgroupswerestillcheckedbyCelts.From500or450B.C.onwardistheageoftheLaTeneCelticCulture, namedafterexcavationsitesintheregionofLakeNeuchatelinSwitzerland. CorrespondingtotheGoldenAgeofGreece,therewasawaveofCelticexpansion,withbattlesagainstthecitiesof theclassicalworld.Theyusedtwo-wheeledchariotsascavalryintacticalunitsofthreeandtribalfootsoldiersarmed withspears,slingsandtallwoodenshieldsdecoratedwithmetalbosses,buttherewerenobowsandarrows.The SwitzerlandCeltsextractedtollsastheycontrolledtheheadoftheSeinenavigationonthetinroutefromBritainto thebronzeworkshopsofItaly.AtthattimetheRhinelandhadalreadybecomeimportantinironingotproduction.A reverseowofEtruscanbronzeswentbackuptheriverrouteandthoseartobjectsfoundinGermany,aswellasin BelgiumandLuxemburg,haddeniteinuenceonCelticart.Ref.168[229],194[266],8[14],75[115] RecentexcavationsatHochdorfnearStuttgartinsouthwesternGermanyindicatethattheCeltsofsouthGermanyhad astratiedsocietywithanaristocraticclassthatlivedinhilltopfortresses.Thewealthofthatclasswasbasedontrade linkswithGreekcoloniesinItalyandsouthernFranceandwiththeEtruscans.Thelargetombsofthearistocratswere sometimesonehundredmetersindiameterandheldMediterraneandrinkingvessels,furnitureandotherhousehold luxuries.Theaveragelifespanatthattimewasaboutthirtyyears.TheHallstattcultureexistedintwogreatregions, oneinthewestwithclearCelticfeaturesandaneasternoneinCarinthia,thenorthAdriaticandYugoslavia,which includedtheIllyriansandtheVeneti. OntheeastcoastofSpainandatMassiliaontheMediterraneancoastofFrancetherewereGreekcolonies,but otherwiseallFranceandtheAtlanticcoastwasGaulicCeltic.Thesepeoplealsooverranthebasicpopulationof Ireland,bringingirontothatlandaswellastoBritain,whereitsuserapidlyoutstrippedbronzeafter450B.C.The CeltswhoarrivedinBritaininthiserawereBrythonians,orP-Celticspeakers,fromtheearlyLaTeneCultureonthe continent.Ref.43[64],222[296] OntheNorthSeabetweentheSommeandAllerrivers,includingpresentdayHolland,northeasternFrance,northwesternGermanyandmostofDenmarkisanareawhereplace-namesstillshowremnantsofalanguageneitherCeltic norGerman.TheCeltsnevergotthisfarnorthandtheGermansforalongtimewerewestoftheAller.Aprehistoric peoplewereapparentlysqueezedbetweentheCeltsandtheGermansinthatlocation.Ref.8[14] InthiscenturytherewasatrueIronAgeinScandinaviaandaperiodofcontinuedproliferationofGermanictribes, someofwhichwerespillingoverintoEuropeproper. TheFinnsandtheBaltsoccupiedthesamerespectiveterritoriesasintheprecedingcentury.IntheSlavzoneof PolandanewfashionofdecoratingurnswithfacesreplacedtheoldLausitzstyle.Thischangeappearstohavespread

PAGE 171

159 southeastwardfromtheBaltic.AreasofquiteadvancedcivilizationexistedintheGreekcoloniesontheBlackSea andatthePersianbordersneartheCaspian. OntheRussiansteppetheIraniantribesbetweentheDonandtheAralSeabecameknownastheSarmatianswhile thosefartherwestwereScythians,nowbecomingfarmers.SouthernRussiawasbothcoolerandmoremoistthan earlierorthannowandinsteadofthepreviouslyexistingsteppecountry,by500B.C.woodedorpartlywoodedcountry extendedfromRomaniaeastforonethousandmilestotheDonRiver.Thistendedtorestrictnomadicforagingand raiding.ItwasinthiscenturythatHerodotus,theGreekhistorian,visitedAlbiaonthenorthshoreoftheBlackSeaand wroteoftheScythians.Ref.92[136]HementionedthatsomeoftheScythiansgrewgrain,notfortheirownuse, butforsalechieytotheGreeks.EastofthesefarmerswerethelargestandbravestoftheScythiantribes,reachingas fareastastheDon.Theyusedlargecowstomachstoholdthirtytofortygallonsofwater.Itissaidthatthenativesof theCaucasusMountainswerestillpracticingcannibalismatthistime.Ref.215[290]Ref.176[242]Ref.92 [136]Ref.211[284]Ref.213[288] ForwardtoEurope400to301B.C.Section11.4 ChooseDifferentRegion 1.IntrotoEraSection10.1 2.AfricaSection10.2 3.AmericaSection10.9 4.CentralandNorthernAsiaSection10.5 5.TheFarEastSection10.7 6.TheIndianSubcontinentSection10.6 7.TheNearEastSection10.3 8.PacicSection17.8 10.5CentralandNorthernAsia:500to401B.C. 9 10.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:600to501B.C.Section9.5 TherewerepeopleintheAltaiMountainsofsouthernSiberiaandanadvancedpeoplelivednearMinusinsk,some 800milesnortheastofLakeBalkashandsome200milesnorthofthenorthwesterncornerofMongoliaintheOrdos regionofSiberia.TheRockefellerCollectioncontainsabronzereindeermountedonamarblebaserepresentinga knownTagarPeriodofartfromthatlocation.AsmentionedinpreviouschaptersthissameTagarCulturehasbeen foundinmoresouthernareasofAsia,also.ThePersianEmpireextendedwellupintocentralAsiafromtheAralSea totheedgeoftheTarimBasinandnorthofthistheunconqueredSakasroamedatwill.JustnorthoftheAralSea,at IssiknearAlmaAlta,onethousandgoldobjectsdatingtothis5thcenturyB.C.havebeenexcavated,indicatingthat thishadbeenanimportanttraderoute.Ref.45[66],183[251],176[242] ForwardtoCentralandNorthernAsia:400to301B.C.Section11.5 ChooseDifferentRegion 1.IntrotoEraSection10.1 2.AfricaSection10.2 3.AmericaSection10.9 4.EuropeSection10.4 5.TheFarEastSection10.7 6.TheIndianSubcontinentSection10.6 9 Thiscontentisavailableonlineat.

PAGE 172

160 CHAPTER10.500TO401B.C. 7.TheNearEastSection10.3 8.PacicSection10.8 10.6TheIndianSubcontinent:500to401B.C. 10 10.6.1THEINDIANSUBCONTINENTTHETHIRDGREATCENTEROFCIVILIZATION BacktoTheIndianSubcontinent:600to501B.C.Section9.6 ThiswasacontinuedtimeoftroublesinIndia,withpoliticaldeterioration.Whilepreviouslytherehadbeensome sixteengreatrealmsalongtherichGangeticplain,thenumberwasnowgraduallyreducedtofour-thethreekingdoms ofKasi,KosalaandMagadhaandtheRepublicofVrijji.Nevertheless,someoftheartsandsciencesourishedinthis valley.MostoftheIndusValleyremainedunderPersiancontrol.Ref.136[187] ThedirectionofgrowthofIndiaandsomeofitslimitingfactorshadbeenprettywelldeterminedinthiscenturyin whichBuddhadied.BytheendofthecenturyBuddhismhadalreadyfadedinthislandofitsbirthandthemajor outlinesofthereligiousworld-viewwhichwastogovernallfutureIndianhistoryhademerged,althoughnotyet organizedinitspresentdayform.Ref.46[76] ForwardtoTheIndianSubcontinent:400to301B.C.Section11.6 ChooseDifferentRegion 1.IntrotoEraSection10.1 2.AfricaSection10.2 3.AmericaSection10.9 4.CentralandNorthernAsiaSection10.5 5.EuropeSection10.4 6.TheFarEastSection10.7 7.TheNearEastSection10.3 8.PacicSection10.8 10.7TheFarEast:500to401B.C. 11 10.7.1THEFAREAST BacktoTheFarEast:600to501B.C.Section9.3 GREATCENTEROFCIVILIZATION TheearlycenturywastheproductivetimeofK'ungCh'iu,knowntousas"Confucius" 12 andoneofthegreatphilosophersofalltime.Hetaughtnosystemofphilosophy,merelyhowtothink.Hewasessentiallyanagnostic,butmade aheroicefforttomakemendecent.Therulesofproprietyandwaysoflivingwhichhelaiddowninhisve"Ching" orCanonicalBookswere,however,asortofstrait-jacketpreventingchangeinthecenturiestocome.Hiswasaprim 10 Thiscontentisavailableonlineat. 11 Thiscontentisavailableonlineat. 12 "Confucius"istheLatinizedversionofK'ungfu-tzu,thelatterwordbeingasuperlativevariationof"tzu",meaning"master",-thus"Master K'ung".Ref.101[146]

PAGE 173

161 andPuritanicalway,withoutanyplaceforpleasureandlittleforfriendshipandlove.Nobilitywasamatterofeducationandconduct.Confuciangentle-menruledChinaforovertwomillenniaandthroughmostofthattimegavea remarkablestabilityandcoherencetoChinesecultureandpolitics. Anotherphilosopher,MoTi,appearedinthelasthalfofthecentury,teachinganoppositedoctrineofuniversallove andpeace.AlthoughChinahadknownandusedironforsomepurposesforcenturies,onlyinthiscenturycanitbe saidthatthecountryreallyenteredtheIronAge,atapproximatelythesametimeasScandinavia,BritainandIreland. DuringthiscenturythepoliticalclimateofChinachanged.ThestateofChinbecameweakandwasdivided,leaving Ch'in,Ch'iandCh'uasthedominantpowersnominallyundertheChouDynasty.Warfarebecamelessgentlemanly andstatesnowwenttoseriousbattle,withtheperiodbeginningin403B.C.thereinaftercalledthe"WarringStates era".Thecrossbowandironweaponswereintroducedandaddedtothedeadlinessofwar.Castmetalcoinscameinto usenotlaterthanthiscentury.Ref.101[146] InChinesemedicaldiagnosis,thefeelingofthepulsehasalwaysbeenofprimaryimportanceandtheyhavefeltthat interpretationsofthiscouldreecttheconditionofeachinternalorgan.Apulsechartwasoriginallywritteninthisor theprecedingcenturybyPienCh'iao.Exercise,massageandcomplexcombinationsoffoodtogetproperrelationof yinandyangwereasmuchapartoftreatmentasmedicines,althoughtherewereeventuallysometwothousanditems intheirpharmacopoeia.Ref.125[173] Atabout500B.C.thesouthernaboriginesofJapanbegantobereplacedbytheMongoliantypeofpeopleassociated withmoderndayJapan.Tracesofthesouthernaborigines'curlyhair,grayeyes,brownorevenredbeards,maystillbe foundinuplandvalleys,buttheirchiefcontributionstomodernJapanwastheirlanguage.ThenewcomerMongolians apparentlyjustdriftedinbyraft,canoeorboatandeachgrouplearnedtospeaktheexistingnativedialects,whilethey graduallybroughtinimprovedstonetechniques,thatchedroofs,potters'wheels 13 andnewagriculturalideas.Such artsseemtohaveallowedthenewcomerstosurviveandmultiplytotheextentthattheycouldpushtheaboriginesback intothehills.Ref.12[21] ContinuationofNeolithicsocieties. Continuingthecenturies-longmigrationsfromthenorth,somepeoplesettledinVietnamandCambodia,becoming theChamsandKhmers;someinBurmaandeastThailandbecomingthePyusandMons;someinthelongpeninsula becomingtheMalays.Otherstooktothesea,spreadingthroughoutIndonesiaandeventuallyMelanesia.TheBronze Agebeganhereabout500B.C.withsomeevidenceoftheuseofironincentralSiamThailand.Wehavenoted beforethattheremayhavebeenbronzeinThailandthreemillenniapreviouslyandwemustassumethattheSiamese werefarmoreadvancedinmetallurgythantheirneighbors.Ref.8[14]MetalwasusedwidelyinthePhilippines by500B.C.andtherewasaspreadofagriculture,involvingriceandmillet.Ref.153[210] ForwardtoTheFarEast:400to301B.C.Section11.7 ChooseDifferentRegion 1.IntrotoEraSection10.1 2.AfricaSection10.2 3.AmericaSection10.9 4.CentralandNorthernAsiaSection10.5 5.EuropeSection10.4 13 TheBritishMuseumGuideRef.19[32]statesthattheMongoliansdidnotintroducethepotters'wheelintoJapanuntilabout300B.C..

PAGE 174

162 CHAPTER10.500TO401B.C. 6.TheIndianSubcontinentSection10.6 7.TheNearEastSection10.3 8.PacicSection10.8 10.8ThePacic:500to401B.C. 14 10.8.1THEPACIFIC BacktoThePacic:600to501B.C.Section9.8 Pleaseseetheimmediatelyprecedingmodules.Nonewinformationseemstobeavailableconcerningthisparticular century. ForwardtoThePacic:400to301B.C.Section11.8 ChooseDifferentRegion 1.IntrotoEraSection10.1 2.AfricaSection10.2 3.AmericaSection10.9 4.CentralandNorthernAsiaSection10.5 5.EuropeSection10.4 6.TheFarEastSection10.7 7.TheIndianSubcontinentSection10.6 8.TheNearEastSection10.3 10.9America:500to401B.C. 15 10.9.1AMERICA BacktoAmerica:600to501B.C. ThefarnorthernEskimoCulture,themidwesternWoodlandAdenaCulturesandthesouthwesternCochisetraditions continuedasbefore.InsouthernUtah'sBarrierCanyonnowHorseshoeCanyonontheColoradoRiverjustbeforeit goesintoArizona,rockpaintingsandgurinesdatingbackatleastto500B.C.havebeenfound.Theymaydatemuch earlier.BarryFellRef.65[96]hasfurtherastoundinghypothesesdatingtothiscentury. Forexample,hehasidentiedastonetempleatSouthWoodstock,Vermont,tobeofCelticconstruction,datedafter 433B.C.andlikeothers,orientedwithitslongaxisatcompassbearing123degrees,whichisthehorizonazimuth oftherisingsunontheDecember22wintersolstice,importantintheCelticreligion.Hesaysthatmanymonoliths characteristicofanyCelticlandscapearefoundinNewEngland.Andstillmore-FellstatesthattheZunitonguein ArizonaisbasicallyLibyan,takenfromthelimited,racyandcolloquialvocabularyofLibyannavymensailinginthis centuryfromshipsofTarshishorCarthage.HeinsiststhatthebasicZunilanguageoftodayissimilartoCoptic,with borrowedelementsfromSpanishandEnglish.Oneoftheproblemsinvolvedinacceptingthisisthatmostauthorities donotthinktheZuniexistedasadenitepeopleatthisearlytime,andthattheydevelopedfromtheMogollonCulture muchlater.Ref.195[268],65[96] 14 Thiscontentisavailableonlineat. 15 Thiscontentisavailableonlineat.

PAGE 175

163 ThemiddleAmerica"ball-game",acurious,violentcrossbetweensoccer,volley-ballandpelotaseemedtohavesome religioussignicanceandappearstohavebeendevelopedbytheOlmecs,althoughitbecamepopularallovermiddle Americaby400B.C. 16 AsnotedinthepreviouschaptertheMayaprobablystartedtheirdifferentiationfromother primitivepeoplesinthescrub-coveredlowlandsofnorthernYucatanandGuatemala'sPetenabout2,500B.C. 17 ,slowly strugglingagainsttheinvadingforest.Clearinglandwasdifcultandwasdonechieybyburning.Theirstaplefood wasmaize,oftenwithseveralvarietiesgrowninthesameeld.Althoughtheirlandwasrelativelyinfertile,except alongtheriveroodplains,itwasrichinbuildingmaterials-limestonerock,sandstoneandvolcanicrockaswellas hardstones.Upuntil300B.C.isknownastheformativeperiodofMayanhistory,andthereisnodoubtbutwhat muchoftheiradvancedculturewastransferredfromtheprecedingOlmecSociety.Ref.176[242],263[127] CostaRica,onthenarrowisthmusleadingtoPanamaandSouthAmericahasalongprehistory,butavailableartifacts datechieyfrom500B.C.onwards.InanewchronologyforCentralAmericaproposedbyaseminarin1980,thetime from1,000B.C.toA.D.500intheCostaRicanstorywouldbePeriodIV.Atabout500B.C.theGuanacaste-Nicoya andsomeoftheCentralHighlands-WatershedregionwereinuencedbyMesoamericanculture,withproductionof thesamered-on-buffpotteryandatendencyforallsettlementstopreferlevel,fertilelandsuitableforagriculture. Ref.265[270] ThecompletedisappearanceoftheChavinsocietyofPeruinthiscenturywassosuddenthatacataclysmissuggested. Itmayhaveresultedfromaclimaticcrisisinthatitisknownthatthesealeveloscillatedasmuchas23feetinthis timeperiod.EngelRef.62[91]statesthatinthenorthcentralpartofPeruthereweretwonewsocietiesafterabout 500B.C.,theMochicaandtheGallinazo,bothinanareanomorethanabout240mileslong.Southoftherefromthe HuarmeyValleytotheLurin,southofLima,withanareaofalmost1,200squaremilesthereappearsanarcheological gapofabout1,000years. StillfarthersouththeParacasSocietyappearedattheendoftheChavintimeorafterashortgapandtheveryfarsouth hasnotreallybeenstudied. TheexacttimeoforiginoftheMochicansocietyisdisputedandevenradio-carbondatesaresomewhatconfusing. Engelfeelsthatitexistedfromthis5thcenturyB.C.untilatleastA.D.100andwascontemporarywiththeGallinazos withwhomtheMochicansfought.ThechiefphenonemonofMochicaisaclassicalpottery,handsome,ofvarious shapes,decoratedandsomeofitpink-red.Onsomepotterythepaintingsshowcircumcisedprisonersshackled together,butnoneoftheMochicasareshownnude.SincecircumcisionwasessentiallyunknowninearlySouth America,fromwhencedidtheprisonerscome? Ceramicportraitpaintingsofmanyclassesofmenarefound,includingwarriors,farmers,priests,etc..Thewarriors mayhavearrivedlater,representinganew,conqueringgroup.SomeoftheMochicansitescontainedmetalobjects butthesiteshadbeenlootedlongbeforeanyprofessionalarcheologistsarrived.PleasealsoseeSouthAmericainthe 2ndcenturyB.C.Section13.9.1.3:SOUTHAMERICAforBarryFell'sthoughts. InnearbyViruValleylivedtheGallinazo,namedafteravulture,withagreatbuildingsocietysuperimposedonanage oldstrataofpreviouspeoples.Oneziggurat,82feethigh,obviouslyhadreligioussignicance.Mostsiteshavebeen lootedcenturiesago,astheycontainedgoldobjects,andnallythevalleyseemstohavebeenconqueredanywayby theMochicans. Onatreeless,barrenplain12,500feetabovesealevelincentralPeru,thereexistedperhapsatthistime,theTiahuanaco civilization 18 ,similarineverywaytotheOlmecexceptinthedrasticdifferencesinclimateandgeology.Thesimilar16 Seethissamesectioninthe10thcenturyC.E.Section24.9 17 RecentexcavationsindicateaMayapresenceatCuello,Belizeat2,400B.C.Ref.263[127] 18 IthasbeenverydifcultforarcheologiststoaccuratelydatetheTiahuanacoSocietyformanyreasons.Mostofthegreatareashavebeen lootedextensivelyoverthecenturiesandatpresentallexcavationisrestrictedbytheBoliviangovernment.EngelRef.62[91]hasobtaineda

PAGE 176

164 CHAPTER10.500TO401B.C. itiesofthissocietyatLakeTiticacaandtheOlmecswiththeOldWorldculturesaremany,includingadomesticated, smalldog,withnowildprogenitorinAmerica,theuseofhybridlongstaplecottonandmanyotherbotanicalfeatures. BuildingmaterialsweretreateddifferentlythaninanyotherpartoftheAndes,withmonolithicblocksweighinga hundredtonscutwithgeometricprecision.Theblocksshowmortisedjointsandrecessesinwhichmetalhingescould havebeenplacedtoswingmonumentaldoors.Multipletempleswerebuiltandatleastonebuilding500feetinlength wasincluded. ForwardtoAmerica:400to301B.C.Section11.9 ChooseDifferentRegion 1.IntrotoEraSection10.1 2.AfricaSection10.2 3.CentralandNorthernAsiaSection10.5 4.EuropeSection10.4 5.TheFarEastSection10.7 6.TheIndianSubcontinentSection10.6 7.TheNearEastSection10.3 8.PacicSection10.8 carbon-datingofthedeepeststrataofthecityproperofabout2,000yearsago,butpotteryfragmentsatthatlevelalreadyweredecoratedinhigh classicalTiahuanacostyle,suggestingthatthiswaslateinthehistoryofthepeople.WeareempiricallystartingthediscussionofTiahuanacointhis centuryalthoughitmayhaveoriginatedeitherearlierorlaterbyseveralhundredyears.

PAGE 177

Chapter11 400to301B.C. 11.1400to301B.C. 1 11.1.1400TO301B.C Backwardto500to401B.C.Section10.1 ThiscenturyisparticularlynotablebecauseofthegreatandrapidconquestoftheentireMiddleEastandportionsof CentralAsiaand-IndiabyAlexander,pavingthewayforthespreadofGreekculture. Forwardto300to201B.C.Section12.1 ChooseRegion 1.AfricaSection11.2 2.AmericaSection11.9 3.CentralandNorthernAsiaSection11.5 4.EuropeSection11.4 5.TheFarEastSection11.7 6.TheIndianSubcontinentSection11.6 7.TheNearEastSection11.3 8.ThePacicSection11.8 11.2Africa:400to301B.C. 2 11.2.1AFRICA BacktoAfrica:500to401B.C.Section10.2 Kushcontinueditsprosperitywithextensivetraderoutes.TheruinsofbothNapataandMeroestillstandtodayand therearetheremainsofpyramidslikethoseofEgyptbutalsoHellenisticpillars,Arabianarchesandevenhieroglyphs withHindu-likesymbols,allsuggestingacosmopolitanatmosphere.Axumcontinuedtoexiststillfarthersouth.Ref. 175[241] 1 Thiscontentisavailableonlineat. 2 Thiscontentisavailableonlineat. 165

PAGE 178

166 CHAPTER11.400TO301B.C. TheEgyptiansrevoltedsuccessfullyagainstthePersiansunderthe28th,29thand30thdynasties,butlateinthecentury, asweshallsee,theMacedonian-GreekAlexandertookovertheoldPersianterritories,includingEgypt.Thecityof AlexandriawasfoundedjustbeforeAlexander'sdeathinabout323B.C.andtherewassoonaccumulatedthereagreat researchlibrarycontainingperhaps400,000manuscriptsinliterature,mathematics,astronomyandmedicine.Later, asAlexander'sempirewasdivided,theMacedoniangeneral,Ptolemy,tookoverEgyptandhelpedmakeitintoagreat commercialnation. AportionofwhatisnowLibyawentwithEgyptaspartofthePersianEmpireandthenlaterAlexander's.Otherwise thechiefpointofinterestwasCarthagewhichin-creasedinpopulationandpowerandparticipatedinintermittent warswithSicily.Between310and306B.C.thenaviesofCarthageandtheSicilianGreekswereinaterribleconict withtheCarthaginiansgatheringagreatinvasionforceofabout1,500vessels.Insodoing,however,theyhadto leavethegatesofHerculesunguarded,thusmakingitpossibleforthersttimeinsomeyearsfortheshipsofother MediterraneannationstoreachtheAtlantic.SeeWESTERNEUROPE,thischapter.Topaytheirsoldiers,after conqueringSicily,theCarthaginiansengagedthenestSicilianGreekartiststomakediesforcastingnewSicilianCarthaginiancoins,andtheseweresooncirculatingwhereverthenorthAfricanshadbusinessdealings. Inthepost-AlexanderperiodattheendofthecenturytheLibyanGreeksofCyrenebecamethemajorsourceoflearned menatthecourtofthePtolemiesinAlexandria.Cyreneexportedchieyhorsesandsilphium,anherbusedinRoman cooking.Ref.66[97],211[284] By300B.C.permanentsettlementintheTichitValleyinthesouthwestSaharahadendedbecauseofdesiccation.The SudaneseNegroes,stretchingacrossthecontinentjustsouthoftheSaharanowhadirontechnologyandwithgreater population,betteragriculturalmethodsandpossiblygreatersocialcohesion,theywereabletoexpandsouthward throughoutAfricaattheexpenseofindigenousinhabitantswhomtheyconquered,absorbedordisplaced.Intheearly centuriestheyconnedthemselvestothedrierregionswheretheircerealscouldgrow.Thesewerethepeopleknown intheeastandsouthas"Bantu",althoughactuallythenamereferstotheirlanguage,ratherthantoanyparticulartribe. Ref.68,45 ForwardtoAfrica:300to201B.C.Section12.2 ChooseDifferentRegion 1.IntrotoEraSection11.1 2.AmericaSection11.9 3.CentralandNorthernAsiaSection11.5 4.EuropeSection11.4 5.TheFarEastSection11.7 6.TheIndianSubcontinentSection11.6 7.TheNearEastSection11.3 8.PacicSection11.8 11.3TheNearEast:400to301B.C. 3 11.3.1THENEAREAST BacktoTheNearEast:500to401B.C.Section10.3 3 Thiscontentisavailableonlineat.

PAGE 179

167 NomadictribesroamedthedesertsofArabiaandinthesouththerewastheHimyaritecivilization,aspreviously described.OtherwisethisentireareasharedacommonfateunderrstthePersiansandthenAlexander. InthiscenturyXenophonremarkedonthesizeandsucculenceofthedatesfromthedatetreesofMesopotamia.Palms hadourishedtheresince50,000B.C.andthenet-workofcanalsthatwerebuiltwereidealforthepalmswhichlined them,andtheydidnotimpingeonthegraingrowingland.Anaveragedatepalmproducesonehundredpoundsof rich,sugaryfruiteachyearforsixtyyearsormore,andaverygoodtreemayproduceone-halfasmuchagain.Figs werealsogrownandeatenintheseancientdays.Ref.211[284] IraqandSyriawerecompletelydominatedbythePersiansuntiltheexcursionsofAlexanderlateinthecentury. HedestroyedthePersianarmyatGaugameleontheupperTigrisin331B.C.andbroughtanendtothePersian Achaemenidrule.ItissaidthatinthesameyearAlexandertriedtorebuildtheTowerofBabel,buttheinitialclearing ofthelandalonetook10,000mensometwomonthstocomplete,andhehadtogiveupthetask. Asothers,theancientcityofUrwasdyingandthenalblowcameattheendofthecenturyastheEuphrateschanged itscoursetorunsometenmilestotheeastofthiscityandtherewasnomorerivertrafc.Ref.8[14],176[242], 238[318]MoredetailconcerningAlexander'sconquestswillbegivenunderthesectionontheUPPERBALKANS laterinthischapter. AsnotedinthelastchapterthestatereligionofPersiawasZorastrianmonotheismandtheancientgodswereoutof favor.AsthecenturyopenedthePersianEmpirewasdeterioratingunderaseriesofweakrulers.FinallyDariusIII, thelastoftheAchaemenids-330B.C.losttheempiretoAlexanderofMacedonia.Weshallgivemoredetails alittlelaterinthischapter,butapointnotoftenemphasizedisthateveryPersiangrandeehadbodyguardsandtroops ofGreeksasmercenaries,andthismeantthatAlexander'schiefopponentswereoftenGreeks,andtheymaynothave resistedtoowell'AfterAlexander'sdeathPersiawasadministeredfromSyriabyGeneralSeleucus,whosoonbecame orientalizedandfoundedtheSeleucidDynasty.Ref.8[14] AsthePersianinuencewaned,GreekdominationincreasedandthebulkofAsiaMinoreasilybecamepartofAlexander'sempire.Intheeast,butstillwestofArmenia,intheregionsknownasPontusandCappadocia,aPersiannoble, Mithridates,independentofhiscousinsinIran,carvedouthisownempire.ThesameoccurredinArmeniaattheend ofthecenturywhenaPersiansatrapmadethecountryindependentoftheSeleucidsB.C.andfoundedadynasty thatruledforacentury.Inbothofthesesatrapies,aswellasinBithynia,fartherwest,thebasicpopulationwasstill Phrygian.Ref.28[48] ForwardtoTheNearEast:300to201B.C.Section12.3 ChooseDifferentRegion 1.IntrotoEraSection11.1 2.AfricaSection11.2 3.AmericaSection11.9 4.CentralandNorthernAsiaSection11.5 5.EuropeSection11.4 6.TheFarEastSection11.7 7.TheIndianSubcontinentSection11.6 8.PacicSection11.8

PAGE 180

168 CHAPTER11.400TO301B.C. 11.4Europe:400to301B.C. 4 11.4.1Europe BacktoEurope:500to401B.C.Section10.4 Inthelastthirdofthiscentury,alltheseislandswereconqueredbythemenofAlexandertheGreat,buthiscontrolwas short-lived.By323B.C.RhodeswasindependentagainandCyprusbelongedtoEgyptuntilDemetriusPoliocertes, aspiranttothethroneofMacedon,tookCyprusagain.Thenin307hebesiegedRhodes,using30,000mentobuild siegetowersandengines,butallofthisfailed.Ref.38[59],222[296] Throughoutthepeninsulatherewasendlessconictbetweentheslavesandtheruinedproletarianmasseswhodemandedthatthestatesupportthem.Upuntilabout378B.C.thepoliceforceofAthensconsistedofabout300 state-ownedScythianslaves.AtthebeginningofthecenturySparta,havingwonthePeloponnesianWarwiththe helpofsubsidiesfromPersia,dominatedsouthernGreece;then,byformingan"ArcadianLeague",Thebestookover controlfromabout370to360B.C.;thenAthens,withgrowingspecial-izationofprofessionalsoldiersandgenerals, professionaloratorsandnancialexpertsbe-camesupremeforawhile.Butinthelastpartofthecenturytheunity whichtheGreekscouldnotndamongthemselveswasforcedonthembyPhilipofMacedon.ThebattleofChaeronea B.C.wastheendofGreeklibertyandthebeginning,insomesense,ofGreekunity.Ref.28[48],8[14] Inspiteofthewarsthiswasoneofthegreaterasofculture.Platoliveduntilwellintothiscenturyandthepolitical problemsalwaysremainedacentralissueforhimandhebecameafrustratedpolitician.Themainlyhereditarytripartiteclassdivisionofthe"Republic"correspondedcloselytothedivisionsof6thcenturyB.C.Greeksociety,withan aristocracythatguidedthestate,citizenswhofoughtforthepolisandslavesandforeignerswholabored.Platobrought togetherdiverseintellectualstrandsfromdifferentpartsoftheGreekworldandhedidsowithaconsummateartistry thatfewhaveevenequaled,givingtosubsequentGreekandEuropeanphilosophyitscentralthemesandproblems, aswellasmuchofitsworkingvocabulary.ItisnotgenerallyrealizedthatPlatoalsowrotemedicalspeculations, logicalbutwithoutanydirectexperimentationandleadingtomanyfaultyconclusionsaboutthehumanbody,errors thatpersistedwellintolatercenturiesandweredifculttoeradicate.Ref.47[71],125[173] NeartheendofthecenturyAristotle,apupilofPlato,returnedfromhistravelswithAlexandertofoundthePeripatetic SchoolorLyceum.ScienticmaterialofallkindshadcometohimthroughtheGreek-Macedonianarmies'conquests PleaseseenextsectionUPPERBALKANSandhisworkbecamethebasisofknowledgeeven1,500yearslaterinthe MiddleAgesofEurope.Aristotlepioneeredinbiology,embryologyandphysiologyandwasachampionofinductive reasoning.Threegreatstructuralideasappearedinthiserawhichrulethemindofcontemporarymankindtoday:l Science,inthebroadsense,includinghistoryandrelationofmantothetotalenvironment;theideaofoneuniversal Godofrighteousness;andtheconceptofworldpolicy. TheophrastusfollowedAristotleasheadoftheLyceumandestablishedthebasicconceptsofbotanicalscience,collectingdatafromasfarasIndia.Democritus,earlyinthecentury,haddescribedtheuniverseasbeingcomposedof atomsindivisibleparticlesincapableofdestructionandavacuum.ThistheorywasrejectedbyAristotlebutwasto beemphasizedagaininthe1stcenturyB.C.byLucretium. Hippocratesalsolivedwellintothiscentury.Hedescribedamumpsepidemicandsomethreeandfourdayfevers whichmayhavebeentertianandquartanmalaria.Otherdiseasesdescribedsuggestdiphtheriaandeithertuberculosis orinuenza.Nothingwasmentionedthatsuggestedsmall-pox,measlesorplagueatthattime.Whetherallthe 4 Thiscontentisavailableonlineat.

PAGE 181

169 teachingsthatwehavecometoacceptasHippocraticwritingsareactuallytheworkofoneman,ormany,isnot known.ThereweresimultaneouslygreatmedicalcentersonCosandontheAsiaMinormainlandatCnidosandthe nalcollectionsof"Hippocratic"writingsatthegreatlibraryatAlexandriainthelastpartofthiscenturymayhave actuallybeencontributionsfrommanyGreekphysicians.Injuriestoboneandjointsmadeupalargepartofmedical practiceandmanipulationstoreducefracturesanddislocationsweresophisticatedandsometimesassociatedwith verycomplexbandagingandmechanicaldevices.Thecauterywasusedandtherewasextensiveuseofminorsurgical proceduresfortumors,stulas,ulcersandhemorrhoids.Thejuiceoftheopiumpoppyandofthemandragora 5 was availableforanesthesiaandpainrelief.Booksnumberingseventy-twoandtreatisesataboutfty-ninehavebeen creditedtoHippocrates.Casehistoriesofsomediseasesaresuperb,buttheanatomy,physiologyandtherapy,of course,wasoftenpoorandthespecicdiagnosisofanydiseasewasseldomgiven.Theethics,conductandappearance ofthephysicianwasemphasized.Ref.229[307],125[173],140[190] OfincidentalinterestisthefactthatitwasnotuntilthiscenturythatthenewraisedwheatbreadfromEgyptbecame popularinGreece.Ref.211[284]ThelastthirdofthecenturysawtheaffairsofGreecesubjectedtothedomination oftheirMacedonianneighbors-originallyenemiesandthenallies.Thissituationwillbediscussedatgreaterlength inthenextsection. TheMacedonians,occupyingmostoftheareaweknowasYugoslaviaandBulgaria,werekintotheGreeksandtheir languagewasalmostGreek,buttheyweremorepurelyNordicthananypeopletothesouthandtheirappearancesand customsweresimilartothewildCeltsoftheperiod.PhilipII,whobecameMacedoniankingin359B.C.bysimply seizingthethroneafterhehadbeenappointedregentforhisnephew,wasaleader-kingoftheancientNordic-Aryan type.HavingpreviouslybeenheldhostageforashorttimeinThebes,hehadgainedmuchknowledgeoftheGreeks andheimmediatelydevelopedanarmytrainedintheeffectiveThebanphalanxformationandproceededtoenlargehis kingdomtothenorthbysubduingtheThracianswiththeirgoldminesofMountPangaionandtheneastandsouthto theupperpartoftheAegeanSea.Inspiteofdrunkennessandotherpersonalvices,hewasprobablythebesteducated manofhistimeandwithhisson'stutor,Aristotle;itwashewhoplannedmostofthegreatnessthathissonAlexander achieved.AfterhegainedanAegeancoastlineandtheThraciangoldhesoonconqueredthecoastlineofThessaly. AlthoughtherewasmuchbickeringandchangesofalliancesinGreecethemainobstacletoPhilip'scontrolofthe entirepeninsulawasalwaysAthens,whereDemosthenesconstantlyusedhisoratoricalabilitiestodenouncehim. HistroopsnallydefeatedanAtheniancoalition,however,in338B.C.atChaeroneainBoeotia.Subsequently,ata congressofGreekstatesPhilipwaselected,oratleastrecognized,asCaptain-GeneralofalltheGreeksforanall-out waragainsttheoldenemy,Persia.ThusMacedoniarosetopoliticalimportancebyassimilatingaspectsofHellenism. Ref.28[48],72[110],179[244] ActuallythegreatbattlewithPersiawasnotenjoineduntilafterPhilip'sassassinationandAlexander'scoronation asking.WithinafewyearsAlexanderhadconqueredallwesternAsiaandapartofIndiaandEgypt,carvingout anempire3,000mileswideandinmostregionsupto1,000milesfromnorthtosouth,thusapproachingthesize oftheUnitedStates.Asaccompanyingmapswillshow,theboundarieswerealmostidenticalwiththepreviously existingPersianEmpire.Allofthiswasconqueredwithinabouttwelveyearswithoutmotorizedvehiclesandonly about35,000menincludingsome5,000mercenaries.Heinitiatedtheuseofatorsioncatapulttoshootarrowsand stones,beginningawholenewerainsiegewarfare.Ref.222[296],213[288]Atleastthousandsandperhaps hundredsofthousandsofGreeksfollowedinAlexander'sfootsteps,emigratingtotheEastandgivingadeepHellenic imprintoverandabovethepurelymilitaryconquest.Alexanderdiedin323B.C.attheageofthirty-threeyears,a manoftremendousvanity,attimeskindandconsiderateandatothertimesvicious,cruelanddestructive.Hediedin Mesopotamia,possiblyofmalaria.Ref.125[173] Alexandersetupnocompetentadministrationsinthevariousconqueredareasandafterhisdeaththeempirerapidly collapsed,withdivisionoftheterritoryamongthevariousGreekgenerals.Initiallythedivisionswereasfollows: 5 Thisishyoscyamusalsoscopolamine,aningredientof"twilightsleep"

PAGE 182

170 CHAPTER11.400TO301B.C. 1.GeneralSeleucuscontrolledtheAsianpartoftheoldPersianEmpireandthesouthhalfofAsiaMinorexcept thecoast,clearacrosssouthwestAsiatotheIndus 2.GeneralAntigonuskeptMacedoniaitself,butby301B.C.hewaskilledinbattleandhissonDemetriusIwas defeatedasLysimachustooktheareaofThraceandCassandertookMacedoniaandGreece 3.GeneralPtolemytookEgypt,alongwithmostofthecoastoftheeasternMediterranean,includingJudeaand theoldPhoeniciaandthecoastofAsiaMinor NOTE:InsertMap22.THEEMPIREOFALEXANDERTHEGREAT In400B.C.theGaulsplunderedEtruriainnorthernItaly,conqueringFelsina,whichsubsequentlybecameknownas Bononia.Tenyearslater,underKingBrennus,theysackedRomeitselfandretreatedonlyafterthepaymentof1,000 poundsofgold.ThusbeganthelongRoman-GallicwarswhichdidnotenduntilthetimeofJuliusCaesarinthe 1stcenturyoftheChristianera.InspiteoftheGauls,Perusia,whichhadbrokenfreefromClusium,wasthemost powerfulEtruscancenterintheupperTiberValley.TheClusinesspreadtheiralphabetuptheAdriaticcoasttoVenetia andthenortheastanditbecamethebasisofthealphabetsofVenetia,IllyriaandRaetiaaswellasoftheGermanand Scandinavianrunes.MeanwhiletheRomansalsohadtocontinuetoghttheEtruscancity-stateofVeii,destroyingit about396B.C.andthentakeonthepowerfulandhighlycivilizedSamnitetribesofsouthernItaly.TheonlyEtrurian powerleftintheimmediatevicinityofRomewasTarquiniiandasevenyearwararedupwithitin358B.C.In343 B.C.theGreekcitiesinCampaniaNaplesareajoinedtheSamnitesintheircampaignagainstRome,butinspiteof allthiswarfaresomeadvancementofcivilizationdidoccurinRome.TheCompromiseofCamillusin367B.C.gave concessionstothePlebesandinternaldissensionstopped,leavingenergiesfreeforexpansion.TheAppianWaywas startedatthistime.WhiletheEtruscantownshadalwaysremainedsmall,chieyinthe5,000to10,000bracket,early inthiscenturyRomeprobablypassedthe10,000markanddrewlevelwithTarentum,thelargestGreekcityinItaly. Ref.75[115],8[14],136[187] AlthoughafterthedestructionofVeiibytheRomanstheEtruscanpreponderanceincentralItalycametoanend,some Etruscancitiesstillourished.VulcihadfailedtohelpVeiiinitsdeathstruggleandcontinuedtoexistasathriving city.Afterafortyyeartruce,ghtingagainaredupbetweenRomeandTarquiniiwiththeformerthenalvictorin 314B.C.AtlonglastCaerehadnallybrokenwithRomeandhadjoinedTarquiniiinitslastdays.Itsindependence gone,CaerestillwasagreatcosmopolitancitytowhichRomansonsweresenttolearntheEtruscanlanguageand literature.Ref.75[115] InthelastofthecenturytheGaulsactuallysettleddowninnorthernItalyCisalpineGaullayingthefoundationsfor thecitiesofTurin,BergamoandMilan.TheKyllyrioidisappearedfromSicilyintheearlycenturyandslaverybecame theonlyformofinvoluntarylaborandthisremainedsoaftertheislandwasconqueredbytheRomans.Ref.249 [98]FormoreaboutSicily,seeNORTHCENTRALAFRICA. ThepopulationofthisregionwasessentiallyCeltic,particularlyinAustriaandGermany,althoughsomeGermanic tribeswerewanderingdownfromScandinaviaabouttheVistulaRiverandthesemayhavebeenpushedsomewhat westatthistimebyHunsleavingtheregionoftheVolga.McEvedyRef.136[187]writesthattherewerestillno TeutonssouthofthelatitudeofBerlinandthatthiswastoremainsofortwomorecenturies.EastoftheGermanic tribesweretheBaltsandtheSlavs. TheHallstattCelticcultureinAustriawasbasedonsaltwhichwasminedparticularlyatSalzburgandatDurrnberg nearHallein.InBohemiatinbecameanimportantexport.ThenewerLaTeneCultureevolvedfullowerintheold Celtichomelands,markingthesecondphaseoftheP-Celticspeakers'expansion.Theydevelopedanoriginalart,part ofwhichinvolvedcoveringtinysurfacesofpots,swordsheathsandornamentswithmazesoflines,tinyanimalgures andfaces,allcutinminutedetail.Theymanufacturedbrassandcoveredcopperobjectswithtinandsilveredthem overwithmercury.

PAGE 183

171 IntheirrstcontactswiththeMediterraneanworldtheCelticpeoplestruckterrorthroughouttheexistingcivilizations. Theyweretall,blond,withhairstandingupstifffromtheirforeheadsfromlimewashings,andthenhanginglong behindlikehorses'manes.Theyworelongmustachesanddressedinbrightlycoloredshirtsandbreecheswithcloaks fastenedattheshoulderwithbrooches.Thecloakswerestripedorcheckered.Someworebronzehelmetsandchain breastarmor,althoughotherswentnakedintobattlewheretheychargedwithwildscreamingandsinging,someon footandsomeinfour-wheeledchariotsdrawnbytwohorsesandcarryingonedriverandonejavelinthrower.Cavalry operatedinthesameway,eachmountwithtworiders.Butthemostterrifyingofallwastheircustomofcuttingoff theirenemies'headsandnailingthemoverthedoorsoftheirhuts. IngeneraltheCeltspreferredtoremainpotentiallymobileandkepttheirpossessionsallinastateofreadinessfor travel,butinsomelocationstheydidbuildratherimpressivesettlements.OnesuchwasnearManching,Bavaria, wheretheouterwallwasfourmileslong,enclosinganareaofsomefortythousandacres.Thereisevidenceof goldsmiths,bronzefoundries,ironandglassworks,potteriesandtradinghouses.Notfarawaywasafoundrywhere sixty-twosmeltfurnaceshavebeenexcavated.EveryCeltictownhadsmallfoundriesandmosthadsaltsourcesnearby. Ref.91[135] TheLaTeneCeltswereattheirpeakofpowerthroughoutFranceGaul,England,Wales,ScotlandandIreland.In SpaintherewerealsoCelts,butCarthagehadestablishedaprotectorateoveralltheIberiantribesupasfarasthe Pyrenees.Aninterestingside-lightonthenatureoftheearlyIberianlanguageisofferedbyBarryFell.Ref.66 [97]WehavegenerallybeentoldthattheearlylanguageoftheMediterraneanworldwasuniqueandthatperhaps remnantstodayaretobefoundinBasqueandtonguesoftheCaucasus.Fellsaysthatarecentstudywouldindicate thattheoldIbericlanguagewasSemiticandcloselyrelatedtoclassicalArabic.Arecentlyfoundstoneinscription fromeasternSpainatPujolwasintheancientIberianlettersbutwasGreekinlanguage.Thisprobablydatestoabout 300B.C.whenCarthagestilldominatedMediterraneanshipping. TheentireBritishIsles,called"PretanicIslandsofAlbionandIerne"werecircumnavigatedbyPytheasofMarseilles, buthisstorywasnotbelievedatthattime.HisjourneyhadbeenmadepossiblebytheopeningoftheStraitsofGibralter astheentireCarthaginiannavyhadbeenwithdrawntoattackSicily.Asaresultoftheastronomicalobservationsmade byPytheasonthattriptoBritain,hebegantogetthersthintofthecurvatureoftheearth,andheincidentallylocated theCornishtinmines.Londonmayhavehaditsoriginabout400B.C.whenaCelticking,Belin,rebuiltanearth wallaroundafewdozenhutswheretheWalbrookjoinstheThamesandthencutanopeninginthesouthwallfora landingspot.Ref.222[296]ThatCarthaginianswerealsoinBritaininthiscenturyisat-testedbythendingof Carthaginiancoinsintwoprimaryareas,datingtothisperiod. ThisisprobablythetimewhenthePictseitherinvadedScotlandormadethemselvesknownasanaboriginalpeople. Theirrealoriginisunknown,althoughthemostrecentthoughtisthattheymayhavemigratedfromthenorthofthe continent.InlatertimestheyspokeP-Celtic,butthismayhavebeenacquiredfromawaveofCeltsandprobablydoes notrepresenttheirnativetongue.TheRomansnamedthem"Picts",meaning"paintedones".Ref.91[135],170 [234],196[269] AperiodofcontinuedmultiplicationoftheGermanictribes. Thebasicpopulationsofthisregionshowednobasicchangefromthepreviouscentury.Fromthenorthdownthere wereFinns,Balts,SlavsandnallytheScythiansjustnorthoftheBlackSea.Theuncertainhistoryandlegendsofthe Scythianswereclaried,inpartatleast,byexcavationsofburialmoundsinthe18thcenturyC.E.,withrecoveryof sometwentyexquisitelycarvedgoldobjectsfoundinamineshaftandgiventoCzarPeterofRussia.Thearcheologists foundsubsequentlythatHerodotus'descriptionsofroyalfuneralswasaccurate,inthatconcubine,butler,cook,groom

PAGE 184

172 CHAPTER11.400TO301B.C. andstewards,allstrangled,wereburiedwiththeroyalpersonage.Inadditiongoldcups,largecollarsmadeoftwisted metalandothertreasures,wereincluded.ItisapparentthatgoldwasasacredpartofScythianlife,themetalcoming fromtheCaucasus,UralanddistantUralmountainranges.Wehavethen,anancientbarbarous,bloodypeoplewho atthesametimewerecreativeartists,workingingold.About350B.C.astillstronger,crueler,butrelatedpeople, theSauromatae,begancrossingtheDon,scatteringtheScythiansbeforethem.SomeofthelatterwenttoThrace RomaniaandsomestayedintheCrimea,withacapitalatNeapolis.IfwearetobelieveHerodotus,writingacentury earlier,theSauromataespokealanguagesimilartoScythianbecausesomeAmazonwomenhad,ineffect,seduced someSythianboysandtakenthembacktotheirhomeacrosstheDon.Itwasperhapsthesewomenwhoallegedlyrode andfoughtalongsidetheirmen,givingrisetothelegendthatScythianwomenwerewarriors.Herodotuswritesthat noSauromataeAmazoncouldmarryuntilshehadkilledamaninbattle.Ref.176[242],136[187],92[136] ForwardtoEurope:300to201B.C.Section12.4 ChooseDifferentRegion 1.IntrotoEraSection11.1 2.AfricaSection11.2 3.AmericaSection11.9 4.CentralandNorthernAsiaSection11.5 5.TheFarEastSection11.7 6.TheIndianSubcontinentSection11.6 7.TheNearEastSection11.3 8.PacicSection11.8 11.5CentralandNorthernAsia:400to301B.C. 6 11.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:500to401B.C.Section10.5 AtPasyrykintheAltaiMountainsofsouthernSiberiaeightburials,datedfromthe4thtothe2ndcenturiesB.C.,have beenexcavated.Thesecontainedwoodenchariots,textilesandfurnitureaswellasmenwithskintattoos,allwell presevedbytheperpetualfrost.TheTagarCulturecontinuedthroughoutmuchoftherestofSiberia.Southcentral AsiawasoverrunbyAlexanderashewentfromAfghanistanthroughtheHinduKushtoBukharaandTashkent.At theveryendofthecentury,however,theMauryanDynastyofIndiatookoveralargepartofAfghanistan. AsweshallseeinthesectiononCHINA,below,thenon-ChinesepeopleofMongoliaandtheadjacentpartofSiberia hadnowaboutcompletedtheirslowtransitionintofullhorsenomadismandtheybegantoattacktheChineseperimeter, aswellaseventakingtotheseatowardJapan.SkullsfromtheLakeBaikalregionofnorthernMongolia,datedtothis era,arelowfacedskullsofthepre-Hsuing-nupopulation,andweredifferentfromthelaterhigh-facedskullsofthe trueHsuing-nu.Ref.45[66],8[14],101[146],127[176] ForwardtoCentralandNorthernAsia:300to201B.C.Section12.5 ChooseDifferentRegion 1.IntrotoEraSection11.1 2.AfricaSection11.2 3.AmericaSection11.9 4.EuropeSection11.4 5.TheFarEastSection11.7 6.TheIndianSubcontinentSection11.6 6 Thiscontentisavailableonlineat.

PAGE 185

173 7.TheNearEastSection11.3 8.PacicSection11.8 11.6TheIndianSubcontinent:400to301B.C. 7 11.6.1THEINDIANSUBCONTINENT BacktoTheIndianSubcontinent:500to401B.C.Section10.6 Afteracenturyofwars,thekingdomofMagadhaabsorbedtheotherthreegreatrealmsofGangeticIndiaandestablishedacapitalatPataliputraBatnaonthelowerGanges.In327B.C.AlexanderreachedIndia,takingaboutone-half ofthecountryandmakingKingPorusapuppetruleroverthemostnorthernportion.Onlysevenyearslater,however, ChandraguptaMauryaovercametheMacedoniangarrisonsandannexedalllandeastoftheIndusandsouthtothe NarmadaRiver.In303B.C.hedefeatedAlexander'ssuccessor,SeleucusNicator,andobtainedtheGreekprovinceof Trans-lnduswhichincludedalargepartofAfghanistan.ThisMauryangovernmentthenbecamethemostpowerful thenexistingintheworld,withacivilizationatleastequaltothatoftheGreeks.Taxilawasacityofgreatuniversities; therewerenoslaves.Cottonclothing,madefromaBurmeseimport,waswidelyworn,althoughlndiasoondeveloped itsowncottonsupply.Governmentadministrationwascontrolledbythevizier,Kautilya,aBrahmanwhoknewthe politicalvalueofreligionbuttooknomoralguidancefromit.ThisbecameanautocracywhichToynbeerecognizesas the"universalstate"oftheoriginalVedicSociety.ThisisthoughttobethetimeofPanini'sSanscritGrammar,which codiedtherulesfor"classical"Sanscrit,asderivedfromtheVedas.Ref.8[14],213[288],220[294] TheancientcityofAnuradhapurawasbuiltinSriLankainthiscenturyanditlasteduntilthe11thcenturyofthe ChristianEra.ItwaslocatedinthelowlandsnorthwestofPolomnaruwaandwassuppliedbyawatersystemwhichis stillinusetoday,althoughthecityitselfisburied.Therearemultiplelakereservoirsandbell-shapedhousingrelicsof theBuddha,someashighasfortystories.Ref.108[153] ForwardtoTheIndianSubcontinent:300to201B.C.Section12.6 ChooseDifferentRegion 1.IntrotoEraSection11.1 2.AfricaSection11.2 3.AmericaSection11.9 4.CentralandNorthernAsiaSection11.5 5.EuropeSection11.4 6.TheFarEastSection11.7 7.TheNearEastSection11.3 8.PacicSection11.8 11.7TheFarEast:400to301B.C. 8 11.7.1THEFAREAST BacktoTheFarEast:500to401B.C.Section10.7 7 Thiscontentisavailableonlineat. 8 Thiscontentisavailableonlineat.

PAGE 186

174 CHAPTER11.400TO301B.C. The"WarringStates"periodcontinued,withchaos,corruptionanddivisionofthecountry.Evenso,inthemidstof thistherewasaprofusedevelopmentofphilosophieswithrabidintellectualdiscussionsasinearlierAthens.Mencius wasasuccessortoConfuciuswhore-statedthelatter'sviewsandmodiedthemsothathecontributedgreatlyto thesurvivalofConfucianism.VerydifferentalthoughnotincompatiblewithConfucianistsweretheLegalists,who believedmanbasicallybadandthereforemustbecurbedbystringentlaws.TheNaturalistshadintroducedtheYin femaleandYangmaleprincipleswhichpersistinChinesethoughteventoday.Taoismwasexpandedinthisperiod tosaythateverythinginamaterialworldwasrelative,andthatconceptsexistedonlyascontrasts.Elevencitieswere consideredtobeverylarge,includingtheCh'icapital,Lin-tze,consistingof70,000households,inmodernShantung province.By325B.C.regionallordshadbeguntocallthemselves"kings".ChopstickswereusedinChinaatleastby 400B.C.AlthoughChinesetraditionteachesthatirrigationpracticeswerestillmoreancient,itwasinthisandthenext centurythattheywereusedonalargescale,alongwithintensivelandclearingandthenecessaryhydraulics.Ref.46 [76],213[288],260[29] Themarshycoastaldistrictsdidnotlendthemselvestocharioteeringsotheinfantryarmiesofthesoutheasternstates ofWuandYuehbegantodominatethebattles;chariotghtingdeclinedandby300B.C.therewereinfantrymasses inthehundredsofthousands.Butinthefarwestandnorth,thenon-Chinesenomadshaddevelopedcavalryfornew assaultsonChina.Ref.101[146] Itissaidthatabout329B.C.aChinesegeneralconqueredtheTienKingdomofYunnanandsettledthere,introducing theChineseculturetothisregionalthoughitdidnotcomeunderdirectChinesecontroluntilthe7thcenturyC.E.. RecentexcavationshaveshownaBronzeAgeculturetherewithsomeindicationoftheuseofiron.Theartofthe Yunnanpeople,includinganimaldrawings,seemsrelatedtothepeopleofthesteppesofAsia.Ref.101[146],176 [242] TheJomonhuntingandshingculturecontinued,withamixedpopulation,asindicatedpreviously.Ref.45[66] Nonewinformationavailableforthiscentury. ThepeoplesofSoutheastAsiahaddevelopedacomplexagriculturalcivilizationbythisperiod,growingchieyrice butalsodomesticatedtubersandlegumes,especiallyyams 9 .Theirworkanimalsweretheoxandwaterbuffalo. BronzewasnotusedinVietnamuntilthiscentury,althoughithadbeenusedinThailandforsome3,200yearsand inChinafor900years.Thereasonfortheslowspreadofthemetalisunknown.Burmesecottonwasthebestinthe worldandwasexportedinlargequantitiestoIndia.Ref.176[242],213[288] ForwardtoTheFarEast:300to201B.C.Section12.7 ChooseDifferentRegion 1.IntrotoEraSection11.1 2.AfricaSection11.2 3.AmericaSection11.9 4.CentralandNorthernAsiaSection11.5 5.EuropeSection11.4 6.TheIndianSubcontinentSection11.6 9 ThisreferstolargetuberousrootsoftheclimbingvinesofthegenusDioscoreaandisnotthesameplantasthesweetpotatoofAmericawhich issometimescalleda"yam"butistherootoftheConvolvulaceaefamily

PAGE 187

175 7.TheNearEastSection11.3 8.PacicSection11.8 11.8ThePacic:400to301B.C. 10 11.8.1THEPACIFIC BacktoThePacic:500to401B.C.Section10.8 Australiacontinuedtobeisolatedandunknowntotherestoftheworld.MayRef.134[184]statesthatTongawas probablysettledby400B.C.anditclaimstohavetheworld'soldestmonarchy,althoughnofurtherdocumentation isoffered.Althoughaccuratedatinginformationislacking,wemightmentionatthistimethatthreeislandsofthe CarolinegroupofMicronesia-Yap,LeleandPonapeformerlyAscensionIsland-allhaveprehistoricstonework. Ponapeisoneofthetwovolcanicislandsinthisgroupandhastheruinsofanancientstonecityanddikeworks. Becauseofthe250inchesofyearlyrainfallarchaeologicalinvestigationontheislandhasbeendifcult.Theoriginal peopleofMicronesiamaywellhavecomefromthePhilippines.Ref.134[184] ForwardtoThePacic:300to201B.C.Section12.8 ChooseDifferentRegion 1.IntrotoEraSection11.1 2.AfricaSection11.2 3.AmericaSection11.9 4.CentralandNorthernAsiaSection11.5 5.EuropeSection11.4 6.TheFarEastSection11.7 7.TheIndianSubcontinentSection11.6 8.TheNearEastSection11.3 11.9America:400to301B.C. 11 11.9.1AMERICA BacktoAmerica:500to401B.C.Section10.9 TheDorsetArctic,theAdenavarietyoftheWoodlandsandthesouthwestCochisetraditionscontinuedasdescribed intheprecedingtwochapters.,CENTRALAMERICA,ANDTHECARIBBEAN IntheCentralAmericantropicalforestsofGuatemalaandHondurastheMayanCulturecontinuedtodevelopwithan increasingcomplexityindicatedbytheconstructionofmoundplatformsfortemplesandpalaces.Recentexcavations atCuello,aceremonialcenterofnorthernBelizewhichmayhavehaditsoriginsasfarbackas2,400B.C.,have revealedevidenceofwhatwasprobablyabarbaricreligiousritualofabout400B.C.Twentyskeletonswerefound, somecompletebutotherswithdetachedskullslyingbesidelopped-offlimbs.Thesewerelyinginthecenterofa massive,raisedplatformsome200feetsquareandstanding12feethigh.Ref.263[127]Anothercityonthe 10 Thiscontentisavailableonlineat. 11 Thiscontentisavailableonlineat.

PAGE 188

176 CHAPTER11.400TO301B.C. MayantraderoutealongtheeasterncoastoftheYucatanpeninsulainmodernBelizewasCerros.Thiscommunityhas beenremarkablewellpreservedalthoughitwasabandonedmanycenturiesago.Forthreehundredyears,beginning inabout350B.C.itexistedasamodestshingandtradingvillage.Inthebeginningtheinhabitantslivedonorclose tothecurrentgroundleveloronlowclayplatforms.Inlatercenturiesmarkedchangesoccurredinthemannerof livingandweshallrefertotheseinsubsequentchapters.Ref.264[105]ThemoundplatformsoftheearlyCentral Americanpeopleinitiatedthebuildingofpyramidswhichwasavirtualobsessionforthenext2,000years.Mexico alonemayhavesome100,000asnotuncovered.Ref.45[66],176[242] ThepeopleofnorthernPeruweremeltinggoldandcopperby300B.C.Sincethemeltingpointofthesemetalsisa littlemorethan2,200degreesFahrenheit,onewondershowtheyreachedsuchtemperatures.Thelaterchroniclersof theSpanishsaytheIndiansblewonthereandinstalledtheirhearthsonhilltopswheretheyhadthehelpofthewind. FineColumbianmetallurgyusingthelostwaxmethodwastolaterfarsurpassinqualitythatofeitherPeruorMexico. Ref.62[91] ThehighlightoftheParacasCultureinsouthernPeruwasembroidery."AsintheearlierChavinCulture,thestylized felineanimalplayedanimportantpartinthedecorationoftheirpotteryaswellastheirtextiles. 12 Hybridbirds, beasts,sh,snakesandmenalsomovedupanddownthefabricsinrows,ascottonandalpacawoolwerefabricated intomantlesandotherfabrics,withasmanyas190differentshadesofcolors.Manyoftheirceramicvesselswere characteristicChavinsteep-mouthedjars.MummiesfrommajornecropolisesontheParacaspeninsula,carbon-14 datedtoabout300B.C.,havebeenfoundnearlargequantitiesofhardwoodguara,atypeofcenterboardusedinthe navigationofsail-carryingrafts,attestingtoextensivemaritimeactivity.Thephysicalattributesofmummybodies differedmarkedlyfromthoseofknownSouthAmericanIndians;themummiesbeingforonethingmuchtallerand havingdifferentskullshapes. AllstudiesofTiahuanacoskullshavealsoshownamixtureofskullshapes,withthecranialindicesvaryingfrom71.97 to93.79andhaircolorandshapevaryingalso.InterestingfeaturesofthetremendousTiahuanacostatuesarethedeepseteyesandstraightnoses,quitedifferentfromtheroundChavineyesandthedeer-shapedonesatMochica.Most statuescalltomindtheonesonEasterIslandinthesouthPacic.Ref.3[4],62[91]AtonepointTiahuanaco reproducedanartthemetypicaloftheoldChavinstylewithserpent-likeanimalsprotrudingfromthebodiesofarmed gureswithanimalheads,sometimesfelineandsometimesthatofaneagle.Ahot-landitem,thefeatheredshield, hasalsobeenfoundintheJojoProvinceoftheeasternshoreofLakeTiticacaandthegreatestnumberofTiahuanaco stoneshasalsobeenfoundinthisarea.Somearcheologistshavedescribedthreephasesofpotterydecorationinthat society.Ref.95[140],62[91],10[18] RegardingtheeasternsideoftheSouthAmericancontinent,wemightmentionthatBarryFellRef.122[170] writesthathehastranslatedrockinscriptionswrittenintheancientOgamCelticalphabetincavesneartheupper reachesoftheParaguayRiver,thesedatingprobablybetween500and500B.C.Thewritingallegedlydescribesavisit bymarinersfromCadiz,SpainandthelanguagesupposedlywasavariantofPhoeniciancalled"Iberian".Othershave describedastonefoundonaBrazilianplantationwithallegedPhoenicianwriting 13 ForwardtoAmerica:300to201B.C.Section12.9 ChooseDifferentRegion 1.IntrotoEraSection11.1 2.AfricaSection11.2 3.CentralandNorthernAsiaSection11.5 4.EuropeSection11.4 12 QuotationfromTaylorandBelcher,Ref.10[18],page85. 13 ThisinterpretationhasbeenbackedbyLadislauNetto,DirectoroftheNationalMuseuminRioaswellasbyCyrusGordonofBrandeis UniversityinMassachusetts,butisscoffedatbyEuropeanscholars.

PAGE 189

177 5.TheFarEastSection11.7 6.TheIndianSubcontinentSection11.6 7.TheNearEastSection11.3 8.PacicSection11.8

PAGE 190

178 CHAPTER11.400TO301B.C.

PAGE 191

Chapter12 300to201B.C. 12.1300to201B.C. 1 12.1.1300TO201B.C. Backwardto400to301B.C.Section11.1 ThiscenturymarkedthepeakofGreekcultureatthecityofAlexandriainEgyptandthebeginningofRomandominanceoftheMediterraneanasCarthagewasdefeatedinthersttwoofthePunicwars.Indiahadoneofitsgreatest periodsunderAshokaVardhanaandChinaendeditsformativeagewithunusualprogressiveactivitiespreparingitfor thefabulousHaneratofollow. Forwardto200to101B.C.Section13.1 ChooseRegion 1.AfricaSection12.2 2.AmericaSection12.9 3.CentralandNorthernAsiaSection12.5 4.EuropeSection12.4 5.TheFarEastSection12.7 6.TheIndianSubcontinentSection12.6 7.TheNearEastSection12.3 8.ThePacicSection12.8 12.2Africa:300to201B.C. 2 12.2.1AFRICA BacktoAfrica:400to301B.C.Section11.2 OnethousandmilessouthoftheMediterraneaninwhatisnowtheRepublicofSudantheKingdomofMeroe ourishedthroughthisperiod.AtrsttheculturewasEgyptianbutlateritdevelopedauniqueAfricancharacterwith itsmainindustrybeingironworking.Italsohadgold.ThissocietywasasuccessortoKush,simplywithanewcapital 1 Thiscontentisavailableonlineat. 2 Thiscontentisavailableonlineat. 179

PAGE 192

180 CHAPTER12.300TO201B.C. atMeroe.StillfarthersouthwastheSemiticHabashatKingdom,establishedbymigratingYemenites,withacapital atAxum.ThelocalCushitessoonbegantoacceptthelanguageandcustomsoftheseSemitesandthecountrybegan toprosper,exportingivory,tortoiseshell,rhinoceroshornandnallygold,throughtheRedSea.Ref.83[123] TherealstoryofthiscornerofAfrica,however,remainedinEgypt.InspiteoftheGreekconquestoftheprevious centurymostofEgyptremainedEgyptianandtherewasareturntoEgyptianpoliticalideas.PtolemyIIPhiladelphus,reigningfrom309to246B.C.tookthetitleofPharaoh,theGod-King,althoughpersonallyhewasamodest man,intelligentandcreative.UnderhimtherewascontinuedexpansionalongthePhoenicianandAsiaMinorcoasts. PtolemyIII-221followed.AninterestingaspectofPtolemaicEgyptisitsextensiveexperimentinstatesocialism.Althoughroyalownershipofthelandhadlongbeenacustom,thekingnowsupervisedalleconomicactivity. Thegovernmentdecidedwhicheldsweretobeplantedandwithwhat,wherecropsweretobesoldandforhow much.Itregulatedtransportation,processing,manufacturing,tradeandbanking,soldabandonedbabiesandtaxed everything.Fromabout275to215B.C.thissystemmadethePtolemiestherichestHellenisticrulers.Thiswealth waslavishedonthecityofAlexandriawhichbecamethegreatesttradecenterintheworldandactedasafusioncenter forpeopleofmanyreligions,includingagreatnumberofJews.TheAlexandriaMuseumwasactuallyauniversity, engagedinresearchandrecordsandacertainamountofteaching.DuringitsactivephaseithelpedtoproduceEuclid, Eratosthenes,Apollinus,Hipparchus,HeroandArchimedes. AtthistimethecenterofGreekmedicinealsoshiftedtoAlexandria,withHerophilus,anatomist,andErasistratus, regardedbysomeasthefounderofphysiology.Hedistinguishedbetweenmotorandsensorynerves,gavenamesto theheartvalvesandstudiedarteries,veinsandlymphaticducts.Actuallyanumberofdifferentsectsofmedicinesuch asDogmatism,Empiricism,Methodism,PneumatismandEclecticismdevelopedorradiatedoutfromAlexandria. OneoftheDogmatists,Herophilos,wasresponsibleforanumberofhumananatomicaldescriptionsincludingvarious partsofthebrain,theintestinaltract,lymphatics,liver,genitalorgans,eyeandthevascularsystem.TheMuseum functionedatahighlevelforonlyacentury,however,andafterPtolemyIIitwasswallowedupbytheEgyptian priestcraft.Attic-Greekwasthelanguageofeducationandadministration.Ref.47[71],125[173],15[26],224 [299] TheAlexandrialibrarywasmorepermanent.Includedinthetremendouscollectionofsome700,000volumes 3 was the"corpusHippocratum"madeupofsomegenuineHippocraticwritingsbutalsotreatisesandnotesofhispupilsand evensomematerialfromarivalmedicalschoolatCnidus.Eratosthenesbecamelibrarianin235B.C.andbecamethe founderofthescienceofgeographybymakingmapsandconceivingtheideaofprojections.In239B.C.hecalculated thecircumferenceoftheearthat28,000miles,anerrorofonly13%.Thismeansthatadegreeoflatitudewasthought tobe60miles,ratherthanthetrue69miles,anerrornotgreatenoughtoforestalloceancrossingswithafairdegree ofcertainlanding.Hebasedhiscalculationsonthepropositionthattheearthwasasphereandthatthesun'sraysfor practicalpurposesmaybeconsideredtobeparallel.Longitudewascalculatedbydeadreckoning.Eratosthenesalso reportedthatpapyrusships,withsailsandriggingasontheNile,sailedasfarasthemouthoftheGangesandCeylon, takingperhapstwentydaystogofromtheformertothelatter,thusaveragingabout75milesperday,aspeedofmore thanthreeknotsanhour.Ref.15[26],65[96],66[97],95[140] Towardtheendofthecenturyradicaldecaysetin,withbureaucraticcorruptionandslackness.Asthecenturyendedthe aggressiveSyrianking,AntiochusIII,defeatedthechildPtolemyVandtooktheMediterraneancoastalpossessionsof Palestine,PhoeniciaandAsiaMinorawayfromtheEgyptianDynasty.Thereissomeindicationthatbubonicplague, orsomethingverysimilar,madeitsrstappearanceinEgyptandadjacentLibyainthiscenturyandthendisappeared againforanother800years.Ref.140[190] CarthagewasnowtherichestoftheMediterraneancities,tradinginslaves,Egyptianlinen,ivory,animalskins,Greek potteryandwine,ironfromElba,copperfromCyprus,silverfromSpain,tinfromBritainandincensefromArabia. SomeCarthaginianplantersoccupyingfertilelandinLibyamayhavehadasmanyas20,000slaves.Ref.222[296] 3 Equalto50,000modernbooks.Ref.15[26]

PAGE 193

181 In261B.C.Carthagesupposedlyhad1,500shipswithapproximately150,000crewmen.Thisistobecomparedwith thefamousSpanishArmadaofA.D.1588whenSpainhad120shipsand27,000crew-men,Carthagesoonreduced NumidiatoaseriesofvassalstatesandbecamethecapitalofaSemiticempirewhichspreadallalongnorthAfricaas wellasintheislandsoftheMediterraneanandinSpain.Althoughthelevelofcivilizationwashighinmostrespects, someoftheircustomswerebarbaric,suchassacricinglivingchildrentocertainmaleandfemalegods.Thedetailsof Carthage'sgreatstruggleswithRomewillbegiveninlatersectionsunderITALYandSPAIN.Itwillsufcetosayat thistimethatattheendoftheFirstPunicWaralocalrevolutionbrokeoutinCarthagewhichragedforfortymonths. AndstillCarthagebouncedbacktoghtthegreaterSecondPunicWarwithRome.Attheendofthissecondconict, whenHannibalwasdefeatedbyScipioatthegatesofthecity,itwasthebeginningoftheendofthisgreatcity-state, althoughitstruggledonuntilthemiddleofthenextcentury.Ref.48[72],66[97] ItissomewhatdifcultforustodaytograspthemagnitudeofthePunicWars.TheFirstwasmarkedbysomeofthe greatestseabattlesinhistory.Considerthefollowing,ascollectedfromancienthistoriansbyFellRef.66[97]: Date Name RomanShips CarthageShips CarthageLosses 260B.C. BattleofMylae 150ships 150ships 50ships 256B.C. BattleofEconomus 230ships 230ships 84ships 255B.C. BattlepfHermaeanCape 200ships 200ships 100ships 242B.C. BattleofAegatesIsland 200ships 100ships 100ships Totalshipslost 334ships Table12.1 EachCarthaginianshiphadacrewofatleast250rowers,with120moreofcersandmarines.Thelossesofmenin thesegreatseabattlesmusthavebeenstaggering. AnotherinterestingfactaboutCarthageatthisperiodisthattheircoinschangedfromsilvertogold,butwithjust asmallamountofgold-theamalgamcalled"electrum"-atabout300B.C.Thedesignalsochangedtodepictthe nativeCarthaginiangoddess,Tanith,spouseofBel.Basedonndingssince1976ofallegedCarthaginiancoinsofthis periodfoundinvariousnorthAmericansites,FellRef.66[97]believesthatthesourceoftheCarthaginiangold wasAmerica,obtainedfromAmerindiansinbarteringwithbronzemanufacturesoftheCypriotPhoenicians.Such bronzeworksarenowheldinstorageroomsinCuenca,Brazil,collectedbyProfessorPaulCheeseman.Thisregion wasaformerIncanortherncapital,notedforburialhoardsandundergroundvaluables.Fellalsobelievesthatthese sameNorthAfricanmarinerstradedwithNorthAmericanAlgonquintribesfortimberwhichtheyusedforships.After theterriblenavaldefeatsbyRomeandtheabsenceofanavy,tradewithAmericawasnolongerprotableoreven possible. InnorthernNigeriatheso-calledNokCulturehasbeenidentiedwithterra-cottagurines,andevidenceofironslag andtin-mining,datedbyradio-carbontechniquetoabout300B.C.AlongthehighcliffsofBandiagaraontheedge oftheHomboriMountainsnearthebendoftheNigerRiverinMali,theToloypeoplebuiltgranariesofmudcoils andstoredthemingiantcavesinthecliffs,whiletheirvillageswereprobablyontheplainsbelow.Ref.251[17] AlongtheCongoRivertherewereStoneAgegathersandshermenabout270B.C.Intheeastandsouththerewas acontinuedtake-overbytheSudaneseNegroeswhowerenowcalledBantu,aftertheirlanguage.Ref.45[66],8 [14] ForwardtoAfrica:200to101B.C.Section13.2 ChooseDifferentRegion 1.IntrotoEraSection12.1

PAGE 194

182 CHAPTER12.300TO201B.C. 2.AmericaSection12.9 3.CentralandNorthernAsiaSection12.5 4.EuropeSection12.4 5.TheFarEastSection12.7 6.TheIndianSubcontinentSection12.6 7.TheNearEastSection12.3 8.PacicSection12.8 12.3TheNearEast:300to201B.C. 4 12.3.1THENEAREAST BacktoTheNearEast:400to301B.C.Section11.3 InYemen,ShebaabsorbedMaanabout250B.C.butotherwisetherewasnosignicantchangefromtheprevious century.Ref.136[187] ThiswasapartoftheEgyptianPtolemaicEmpireuntiltheveryendofthecentury,whenitwastakenbyAntiochus IIItheGreat,ofSyria,fortheSeleuciddomains. AsthecenteroftheSeleucidDynasty,thisareamaintainedaGreekculturewithanorientaltwist.Throughtheuse ofrecordsofthemovementsoftheheavenlybodieskeptfromthe8thcenturyB.C.theBabyloniansdiscoveredthe periodicityoftheeclipsesandthemathematicalcoordinatesdeningtheexactpathsofthemoonandthesun.The poweroftheSeleucidsbegantowaneinthiscenturyandmuchoftheirempirefellaway,althoughattheveryendofthe periodKingAntiochusIII,calledtheGreat,restoredtheSyrianfortunesbyreconqueringtheirfareasternrealmsand addingtothedomainalongtheMediterraneancoastfromAsiaMinordowntothebordersofEgypt.Heestablisheda libraryatAntiochandpromotedliterature.Ref.47[71] AfterAlexander'sdeaththeParthiansinthenorthhadrevoltedagainsttheGreekdominationandhadformedaseparate kingdomunderArsaces1.Thesepeopleandthe Persiantribesfarthersouth,graduallyerodedagooddealoftheSeleucidpower.TheParthianKingTiridates212B.C.transferredhiscapitaltoHecatompylosonthesoutheastcorneroftheCaspianSea,tobeonthecaravan routefromSeleuciatoBactriaandatthesametimeheevacuatedSeleucusII.Attheendofthecentury,however, AntiochusIIIreconqueredmostofthisterritorytemporarilyfortheSyrianDynasty,reducingtheParthianArsacesIII Priapatiustovassalship.Ref.8[14],28[48] AlthoughmostofAsiaMinorwasnominallyunderGreekcontrol,dividedbetweenthePtolemiesandtheSeleucids, severalstatesmaintainedmoreorlessindependentkingdoms.Inthesouththesmallbutneandpowerfulkingdom ofPergamumhaddevelopedasaGreciancityunderSeleucusbutitbrokefreeunderEumenesIashealliedwiththe 4 Thiscontentisavailableonlineat.

PAGE 195

183 Ptolemiesin262B.C.Othernon-GreekbutHellenizedkingdomswereBithynia,CappadociaPontus,Armeniaand MediaAtropatine.PontusandBithyniainvitedsomewildCelts,whohadjustdevastatedtheGrecianpeninsula,to cometoAsiaMinorandsettle,hopingthattheywouldactasabufferbetweenthenorthernstatesandtheSeleucids. ButtheseCelticGalatians,onceestablishedincentralAnatolia,terrorizedthecitiesalongthecoast.Thekingsof Pergamum,however,withPtolemaichelp,stoodoffboththeGalatiansandtheSelucids. Pergamumhadbeenfoundedbytheeunuch,Philetairos,formertreasureroftheDiadochLysimachoswhohadabscondedwiththetreasury,goneovertotherivalSeleucusandusedthisfortunetonagleanewstateofhisown.His armywasmadeupofhiredmercenaries.Uponhisdeathhisnephew,Eumenes,defeatedAntiochusandbecamethe mostpowerfulmaninAnatolia.Usinghisinheritedmoneyhefurtherbuiltuphisarmy,foundedcities,pushedouthis bordersandpaidhightributetothewildGalatianstokeepthematadistance.Ref.91[135]Eumenes'nephewand successor,Attalos1,actuallydefeatedtheCelticGalatiansandthensetaboutestablishinglibraries,arts,museums,etc. withsomeofthegreatartistictreasuresofmankind,andthecapitalcityrivaledAlexandriaasacenteroflearning.An exampleofthearchitectureisshowninthepictureonthenextpage-atemplealtarofPergamum,nowreassembled inanEastBerlinMuseum.ThepharaohofEgyptjealouslyforbadetheexportofthepapyrusplantoritsproducts, soPergamumhadtodevelopawritingmaterialofitsownfromanimalskin,subsequentlycalled"pergamentum"or "parchment".Withthistheyaccumulatedsome200,000books 5 .Unfortunatelythisfabulouslittlenationlastedlittle morethanacentury.Ref.28[48],125[173],15[26] InthefareasternpartofthepeninsulaArmeniaremainedunderitsowndynastyuntil211B.C.whenAntiochusIIIof Syriatookcontrolanddividedthecountryintotwosatrapies. ForwardtoTheNearEast:200to101B.C.Section13.3 ChooseDifferentRegion 1.IntrotoEraSection12.1 2.AfricaSection12.2 3.AmericaSection12.9 4.CentralandNorthernAsiaSection12.5 5.EuropeSection12.4 6.TheFarEastSection12.7 7.TheIndianSubcontinentSection12.6 8.PacicSection12.8 12.4Europe:300to201B.C. 6 12.4.1EUROPE BacktoEurope:400to301B.C.Section11.4 At300B.C.therewereCeltsineverypartofEuropeexceptingScandinavia,thesouthernportionsofItalyandGreece andRussia.MostoftheEuropeanrivernamessuchastheRhine,MainMoin,Neckar,Lahn,Ruhr,Isar,etc.are Celticinorigin.IfthevariousCeltictribescouldhavegottenalongtogetherandmadeaconcertedefforttheycould havecreatedoneofthegreatestempiresinEuropeanhistory,buttheydidn't.Ref.91[135] 5 Between10and30"books"ofantiquitywouldcomprise1booktoday,becauseeitherpapyrusorparchmentmadeaverythickroll.Ref.15 [26] 6 Thiscontentisavailableonlineat.

PAGE 196

184 CHAPTER12.300TO201B.C. CretehadbecomeahavenforMediterraneanpirates.TheCyladeswereunderGreekcontrol.SouthofAsiaMinor Rhodeshadbecomeapowerfulcommercialstate.The"ColossusofRhodes"wascompletedin280B.C.bythe sculptor,Chares,aftertwelveyearsofworkwiththespoilsleftbyDemetrius'unsuccessfulsiegeintheprevious century.Rising120feet,thisbronzestatueofthesungodwassolargethatashipcouldpassbetweenitslegs.Ref. 28[48],222[296] ThiswasatimeofconsiderablechaosandconfusionintheGreekpeninsula.TheGalatianCeltsinabout280B.C. raidedfromhighupintheBalkansdownthroughMacedoniaandintoGreeceproperandweredefeatedonlywith greatdifculty.TheCelticarmyprobablyhadnomorethan30,000menandwasledbyBrennus,ofthesamename asthechieftainwhohadsackedRomeoveracenturybefore.GreecewasdividedamongtheAetolianLeague,which expandedinthenorthcentralandwesternareabyforce,theAchaeanLeague,whichexpandedbycontractandthe independentstatesofSpartaandAthens.Theformerwasdefeatedin222B.C.byacoalitionofAchaeanswiththe MacedonianKingAntigonusDoson. AlthoughtherewasashiftofGreekscienceandmedicinetoAlexandria,philosophywasstillprevalentinthehomeland.EpicurusfoundedEpicureanism,abeliefthatpleasureisthechiefgood,butthatthegreatestpleasuremaybe obtainedthroughalifeoftemperanceandsimplicity.Thegreatevilthatafictsmanisfearofgodsandfearofdeath. TheultimateaimofallEpicureantheoriesandteachingwastoridhumanityofthesetwofears.Ref.47[71],91 [135] WhentheMacedonianleader,Cassander,diedin297B.C.,DemetriusIPoliocertesreturnedagaintotryforthe king-ship.HedidtakeAthensin295B.C.butwaseventuallydesertedbyhisowntroopsandbecameaprisonerof Seleucusfortherestofhislife.Ref.222[296]CelticpeopleswerecollectingintheupperBalkanarea,ghting amongthemselvesandperiodicallyraidingsouthward,shatteringallbalanceofpowerinAlexander'soldempireand therstdivisionsamonghisgeneralsandtheirimmediatesuccessors. TheMacedonians,themselves,werecompletelyoverrunforashortwhile.AttheendofthecenturyasHannibalgave Romeitsmostterriblewar,PhilipofMacedonsidedwithHannibalandtheskirmishesofMacedoniansoldierswith RomansinthisissueofthemainwarwascalledtheFirstMacedonianWar. AnIllyriankingdomwassetupatthisperiodwithacapitalatScodramodernScutari,Albaniabutbecauseof IllyrianpiracytendenciestheRomanshadcausetowaralsoagainstthemandultimatelydefeatthem.Southandwest ofMacedonia,thesmallbutstrongkingdomofEpirusourishedandevenattackedItalyacrosstheAdriaticSeaatthe instigationofthelocalGreekcity-states.Ref.28[48] ThiswasacenturyofgreatRomanactivity.By290B.C.allterritoryoftheSabineshadcomeunderRomanrule, andafterthebattleofLakeVadimoabout280B.C.theSamniteresistancewascrushedandRomecontrolledallthe harborsofItalyaswellashavingperhaps40,000slave-captives.In281B.C.aRomangeneralhadalsotriumphedover EtruscanVolsiniiandVulci.Italywasdenselypopulatedbyahardypeasantry,whichgavetheRomansadependable poolofmilitaryman-power.Theirlaborforce,liketheGreeksbeforethem,wasslaves.Rome,too,wasaslavesociety. Ref.249[98] NOTE:Insert23:ITALYBEFORETHEFIRSTPUNICWAR264B.C.

PAGE 197

185 Inthemeantime,Pyrrhus,kingofEpirusintheBalkans,andakinsmanofAlexandertheGreat,respondedtopleasof theGreekcity-statesofSyracuseSicilyandTarentumontheheelofthebootandhelpedthemghttheRomansfor controlofsouthItaly.RomewasevenjoinedbyCarthageinthisparticularght,intheattempttokeepPyrrhusoutof Sicily.KingPyrrhusbrought25,OOOmenandmanyelephantswhichterriedtheItaliansandheinitiallywonsome victoriesatHeracleaB.C.andAsculumB.C.butlostmanymenandmuchstrength,sothatby275Rome hadwonandhadreachedthetoeandheelofthebootofItaly.CarthagestillheldthewesternendofSicily.Ref.8 [14],28[48] By260B.C.Romecontrolled10,000squaremilesofItaly,andwithheralliesanother52,000squaremiles.Ithad about292,000menanditsalliesabout750,000,withatotalpopulationofabout3,000,000.Thispowerfulconfederacy hadnowbecomeapotentialchallengetoCarthageandwarbetweenthetwogreatpowersbrokeoutin264B.C.This FirstPunicWarbeganacenturyofwarfareforthemasteryoftheMediterranean.WithHamilcarseefootnoteon page243leadingtheCarthaginiansandRegulusbecomingtheRomanhero,thiswasessentiallyaseriesofgigantic seabattleswithafewlandskirmishesinSicilyandthesoutherntipofItaly.TheRomanswontheseabattlesby the"corvus",aboardingcranethatallowedtheirsoldierstoboardtheCarthaginianships.SeeNORTHCENTRAL AFRICA,earlierinthischapter,page233.Carthagesuedforpeacein241B.C.,givingSicilytoRomeandremoving restrictionsonRomantradeintheMediterranean.Inthenextfouryears,whileCarthagewastornbyabloodyinternal revolution,RometookSardiniaandCorsicaintreatyviolations.Ref.48[72],8[14] ThesetreatyviolationssetthestagefortheSecondPunicWarbeginningin219B.C.andcontinuinguntil201.The CarthaginianGeneralHannibalSeefootnoteonpage243enteredSpain,enlistedGaulmercenaries 7 ,gothelpfrom MacedoniaandSicily,crossedtheAlpswithmenandelephants,conqueredmostofItalyexceptRomeitself,and inanalwinter,beddedhisarmydowninCapua,southofRome.HewaspoorlysuppliedfromCarthagethrough Tarentum,whichhadfallenin209B.C.andhistroopsnowseemedtolosetheirvigor.Ref.229[307]In202B.C. HannibalwascalledbacktoCarthagewherehewasnallydefeatedbytheRomanGeneralScipio,whowashelpedby NumidiancavalryunderKingMassinissa.Intheend,RomecontrolledallofItalyandSpain,butitwasacostlywar whichchangedRomanlifeconsiderably.Therewasanincreaseinurbanitywithdamagetotheconceptofdemocracy andthebeginningofimperialisticexpansion.Otherfactorsmayhaveplayedadditionalrolesintheendingofrural simplicity.Apparentlyadecliningrainfallabout250B.C.provokedamarkeddecreaseintheowofItalianrivers, withresultingformationofmosquito-breedingmarshesandstagnantpools.Themosquitoes,inturn,broughtmalaria. Grainproductiondroppedandthegrapevineandtheolivebegantobethebigcrops,sothatevenwhentherains returnedlateinthecentury,Romewasalreadydependentforeveronimportedgrain.Thetensofthousandsofslaves obtainedinwarfareaugmentedtheslavesociety.ButthecapstoneandtriumphofRomandemocracyalsooccurredin thiscenturywiththeLexHortensia,in287B.C.,alawinwhichtheSenateagreedthatdecisionsofthetribalassembly shouldhavetheforceoflaw,evenwhencontrarytotheresolutionsoftheSenate. NOTE:Insert25.THEPUNICWARS264-146B.C. InSicilyitwasthetimeofArchimedesandhisgreatscienticaccomplishments.WhenKingHieroofSyracusewent overtoHannibal'ssideintheSecondPunicWar,theRomanssiegedSyracuseandArchimedes'inventionofthewater screwheldtheRomansatbayforsometime.Inthenalattackonthecityin212B.C.,however,thescientistwas killed.Hehadalreadyestablishedthelawsoflevers,methodsofmeasurementofasphereandacylinder,thevalue ofPiandvariouslawsofhydrostatics.HehadeitherstudiedinAlexandriaorhadbeeninclosecontactwithscholars fromthere. TheCelticsettlementofAustriawaswellunderwayby279B.C.andthegreatsaltminesofSalzburgandadjacent areaswereinoperation.Atribecalled"Teutones"hadsettledclosetotheMainRiverandsomehaveinterpretedthis 7 14,000GaulmercenariessignedupwithHannibalandinadditionawholeseriesofCelticunitsintheRomalegionskilledtheirofcersand takingtheirvictimsheadsalong,desertedtotheCarthaginians.Ref.91[135]

PAGE 198

186 CHAPTER12.300TO201B.C. tomeanthatGermanictribeswerealreadyinthisarea,butthesewereactuallysimplyanotherCeltictribe,andthetrue TeutonicorGermanictribeshadnotyetleftthenorthernreachesofGermany. InthersthalfofthecenturySpainwasessentiallyunderthecontrolofCarthageandtherewerevariouswarsofthe localIberian,LigurianandCeltictribesagainsttheseoverlords.TheFirstPunicWarhadstimulatedtheCarthaginians toincreasetheirdominanceofIberia.In238B.C.aftertherstPunicwar,HamilcarBarcalcrossedtoSpainand recapturedthosecitiesforCarthagewhoseallegiancehadlapsedduringthewaryears.Traditionhasitthathefounded BarcelonaandCartagenaandthatinaccordancewithhisrecommendationstohistroopstointermarrywiththenatives, hisownson,Hannibal,didso.HediedduringachargeagainstaSpanishtribeandHasdrubal 8 ,nephewofHamilcar, continuedathreeyearcampaignandthensignedatreatyatCartagenawithRomanenvoysagreeingnottogonorthof theEbroRiver.RomefearedCarthaginianalliancewiththeCeltsinthePyrenees.By221B.C.,however,Hamilcar's son,Hannibal,incorporatingmanyIberiansinhisarmyhadcapturedRoman-GreekSaguntumontheeastcoastand precipitatedtheSecondPunicWar.By218B.C.HannibalhadcrossedthePyreneestoadvancethroughFranceto Italy. TheRomanGeneralScipiotheelderwentfromhishomeinRometoSpaintoghttherearguardoftheCarthaginian armywhichwasstillunderthecommandofHasdrubalandby205B.C.SpainhadbecomeaRomanprovincealthough thecompleteconquestactuallytookanother200yearswithheavytollinmenandmoneybecauseofconstantguerilla warfare.Scipio,however,tookhisarmytoAfricatoattackCarthagedirectly.Itwashisson,ScipioAfricanus, however,whofoughtthenalbattlesinAfrica.Ref.91[135],196[269] AspreviouslymentionedconcerningtheCeltsingeneral,theGaulsbleachedtheirhairandworejewelrybuttheywere alsoviciousghters,chargingintobattlesome-timeswearingchainmailandsometimesnakedorwearingonlycollars andbraceletsandformidablemustaches.Somewereverytall,fair-hairedandblue-eyedandmayhavebeenaruling classoverothershorteranddark-hairedpeople.AsdidtheircentralEuropeanbrothers,theycutofftheirenemies headsandhungthemaroundtheirhorsesnecks,oftenlaterliningtheskullsofenemygeneralswithgold.Whennot ghtingtheyfeasted,drankandhunted.TheGallicwomenoftenfoughtbesidetheirmenSeeQueenBoadiccain1st centuryC.E.underBRITISHISLES.OntheirsouthernankstheCeltictribeswereshowingagradualrisingoftheir culturallevelascontactwasmadewiththesoutherncivilizations,particularlyRome.Ref.194[266] ThenewwavesofLaTeneCeltswereevenmorewarlikethantheirpredecessorsandbecameawarrioraristocracyin WalesandCornwall.TheWelshandCornishlanguagesaresurvivorsofthesegifted,virilepeoplewhowereproneto inter-tribalwarfareanddynasticfeuds.Theysquanderedtheirforceinendlesscompetitiveness.BarryFellRef.66 [97]hasallegedlytranslatedanancientIrishmanuscriptofthe2ndcenturyB.C.whichappearstobeacopyofa3rd centurydocument,becauseofreferencetocertainItalianandSiciliancoinsofthelattercentury,andwhichappears tobeacodeoflawsforIrishCelts,writtenbyaSpanishGael.ThiswouldindicateamuchearlierpresenceofCelts inIrelandthenusuallystated.ThePictsofScotlandwereneveraunitedpeopleintheseearlycenturiesandthetribes warredwitheachotherconstantly. ScandinaviantribescontinuedtoexpandandthismayhavebeentheperiodwhentheydisplacedaMongolianpeople akintoorantecedentsoftheLaplandersandEsquimos,pushingthemintothefrozennorth. 8 ThereweregeneralsnamedHamilcar,HannibalandHasdrubalinthe5thcenturyB.C.aswellastheseapparentdescendantsinthis3rdcentury B.C.

PAGE 199

187 SouthernRussiaandtheEurasiansteppewasstillthebreedinggroundofvariousbarbarianAryantribeswhichperiodicallymovedtowardEuropeproperanddownintosouthwesternAsia.TheScythiansweregraduallybeingreplaced bytheirracialandlinguistickinsmen,theSamaritans,aboutwhomwehavewrittenpreviously. ForwardtoEurope:200to101B.C.Section13.4 ChooseDifferentRegion 1.IntrotoEraSection12.1 2.AfricaSection12.2 3.AmericaSection12.9 4.CentralandNorthernAsiaSection12.5 5.TheFarEastSection12.7 6.TheIndianSubcontinentSection12.6 7.TheNearEastSection12.3 8.PacicSection12.8 12.5CentralandNorthernAsia:300to201B.C. 9 12.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:400to301B.C.Section11.5 ThehomelandoftheParthianswasontheeasternshoreoftheCaspianSeaandabout247B.C.theymovedsouth, takingterritoryawayfromtheSeleucids,undertheirleader,Arsaces.Bactriabecameindependentat250B.C.asa Greco-BactriankingdomunderDiodotus,anditbecamethecenterofawebofcaravanrouteslinkingSiberiaand ChinawithIndia,PersiaandtheMediterraneancities.Ref.8[14]FarthernorthinSiberia,TagarCulturegroups continuedasinrecentcenturies.InInnerMongolia,theHsiung-nuwasjustformingastherstgreatconfederationof Altaic-speakingnomads.Ref.101[146]AfghanistanwasruledbytheMauryaDynastyofIndia,untilthisentire areawasreclaimedbytheSyrianAntiochusIIIattheendofthecentury. ForwardtoCentralandNorthernAsia:200to101B.C.Section13.5 ChooseDifferentRegion 1.IntrotoEraSection12.1 2.AfricaSection12.2 3.AmericaSection12.9 4.EuropeSection12.4 5.TheFarEastSection12.7 6.TheIndianSubcontinentSection12.6 7.TheNearEastSection12.3 8.PacicSection12.8 12.6TheIndianSubcontinent:300to201B.C. 10 12.6.1THEINDIANSUBCONTINENT BacktoTheIndianSubcontinent:400to301B.C.Section11.6 9 Thiscontentisavailableonlineat. 10 Thiscontentisavailableonlineat.

PAGE 200

188 CHAPTER12.300TO201B.C. AshokaVardhanaalsoAsoka,grandsonofChandragupta,cametothethronein273B.C.,monarchofAfghanistan, BaluchistanandallofmodernIndiaexceptTamilLandintheextremesouth.Atrstheruledwell,althoughcruelly. InmidlifehebecameintenselyinterestedinBuddhism,changedhisways,joinedaBuddhistorderandbecamean ardentmissionaryandzealousadministrator.HewashatedbytheBrahmins,thepriestlyclassoftheoldreligion,and inspiteofAshoka'sBuddhismitwasinthiscenturythatHinduismnallyevolvedwithanewgenerationofgods; Shiva,Vishnu,RamaandBrahma.Ref.213[288] Onthe"RockEdictsofAshoka"appear"Arabic"numerals-athousandyearsbeforetheyappearinArabicliterature. ThesenumeralsareoneofourgreatheritagesfromIndia.Amonginscriptionsofthiscenturyarestatementsthat hospitalshadbeenestablishedforhumansandforanimals,althoughitisnotcleariftheseweretherst.Elaborate dispensariesandspecialmaternalandoperatingfacilitieswerealsodescribed.Ref.125[173]Mostartisansof theMauryaEmpireworkedinguildswhicheventuallydevelopedmanyfeaturessimilartotradeunions.Ref.213 [288]AfterAshoka'sdeath,theempirewassplitintoanumberofparts. ForwardtoTheIndianSubcontinent:200to101B.C.Section13.6 ChooseDifferentRegion 1.IntrotoEraSection12.1 2.AfricaSection12.2 3.AmericaSection12.9 4.CentralandNorthernAsiaSection12.5 5.EuropeSection12.4 6.TheFarEastSection12.7 7.TheNearEastSection12.3 8.PacicSection12.8 12.7TheFarEast:300to201B.C. 11 12.7.1THEFAREAST BacktoTheFarEast:400to301B.C.Section11.7,Ch'into207thenHanfrom 202B.C.on TwofundamentalChinesesocialaspectshadbecomeapparentbytheendofthisFormativeAgeoftheearlydynasties: lTheconceptofthepatrilinealfamilyasthebasicunitinsociety,withbloodkinshipsofthehighestimportanceand theconceptofnaturaldifferentiationintoclasses,eachregardedinproportiontotheircontributionstothewhole society. InShangtimesslaveryhadbeencommonwiththeslavesbeingwarcaptivesorcriminals,butthisdecreasedwiththe ChouDynastyandnallydisappearedassocialstatusbecamemoreuidandtransitory.Withthedisappearanceofthe earlyfeudalism,free-holdfarmingbecamethedominantfoodsupportinthesmallamountofarablelandavailable. Aspopulationhadgreatlyincreased,therewasnolongerroomforgrazingherdsandtheChinesehadsettledfor scavenger-breedinganimalhusbandryconsistingofplowoxen,pigs,chickensandoccasionallydogs.Nomadsrst startedbotheringnorthernChinainearnestinthiscentury.Thenomadswereallmilk-drinkersandstillhadthe necessarylactosefordigestingthatintheirphysiologicalmake-up,whilemostChinesedidn'thavethatenzymeafter infancybecauseofthelongscarcityofmilk-givinganimals.Yettoday,Chineseasawholendmilkindigestible becauseofthislackoflactoseandtheclassicalChinesehaveconsideredmilkproductsuncleanortaintedsince 11 Thiscontentisavailableonlineat.

PAGE 201

189 2,000B.C.Yogurt,curdsorcheesecanbeeaten,however,becausethelactosesugarhasbeenbrokendown.Stirfry cookingdevelopedontheoodplainsasaresultoftheverylimitedfuelsupply,usingwaferthinfragmentsofmeat andvegetableswhichcookinminutes.Anotherinnovationcanbeseenwhenabasicbeanistakenthroughseveral processesandallowedtofermentinaloafinadarkareaoverwinter-thenthefungusisscrapedoffandtheleaves aresoakedinbrine.Thebrinyliquid,whenstrainedoff,is"soysauce".Thedebrisoftheloavesismadeintoathick "cheese",nowpartiallyblamedforthehighincidenceofstomachcancerinAsia.Ref.101[146],211[284] EarlyinthiscenturyascontinuedfromthelasttheConfucianprincipleswerekeptaliveandelaboratedforposterity byMasterMengK'o,Meng-tzuLatinized-"Mencius"anextravagant,arrogantaristocratwhoneverthelessrecognizedthatpublicmoraleshouldbetherstconcernofeveryrulerandhedidnothesitatetotellthemso.Butperhaps thegreatestConfucianthinkerofthecenturywasHsu n-tzu.aruthlesslytough-mindedrationalistwhosetdownhis philosophyinawellorganizedbook.Inaddition,thepresentformoftheLao-tzu,theTaoistphilosophy,wasmadein thiscenturywithauthorshipreallyunknown.Ithasbeencalledthemostprofoundandbeautifulbookeverproducedby theChineseandhasbeentranslatedintoEnglishmoreoftenthananybookexcepttheBible.Itsmeanings,however, canstillbeelusiveanddebatable.Ref.101[146] TheeraofWarringStatescontinueduntil230B.C.whenShihHuang-tibeganacampaignofconquestandunication ofChinawhichwascompletedby222B.C.,establishingtheCh'inDynasty.ComingfromtheWeiValley,atrue frontiercountry,theleaderadoptedthistitleofHuang-ti,meaning"AugustLord",butusuallytranslated"Emperor", and"Shih"simplymeans"rst".HebeganasKingZhengofQinatthirteenyearsofage,whenthecountrywas initiallyruledbythechancellor,LuBuwei.ThisFirstEmperorbuilttheGreatWallofChina,oneofthegreatest constructionfeatsofalltime,toprotectthenationagainstbarbarians.Sevenhundredthousandforcedlaborerswere usedinbuildingthewallandthousandsofthemdied,crushedbeneathsomeofthemassivegrayrocks.Thewallwas roughly1,500mileslongandwideenoughforsixhorsestogallopabreastalongthetop.Thenation'srststanding army,consistingofperhapsmillions,wascreatedtoguardthewallfromnortherninvadersanditdiddiscouragethe Huns,whothenturnedwestintoEurope. ShihHuang-tispentthirty-sixyearsbuildingasubterraneanpalaceinwhichhecouldspendeternityandusedseven hundredthousandconscriptstobuildthis,also.Recentexcavationsofhistombindicatethataguardianarmyofsix thousandlife-sizepotterymenandhorseswereconstructedtostandeternalguardathistomb.Inaddition,however, hedidbuildgreathighwaysandencouragedsciencewhilediscouraginglettersandespeciallyConfucianscholars.He buried460ofthelatteralive.Chinawasdividedintoprovinceswithcivilandmilitaryofcialsinahierarchyofranks; writingwasstandardizedandtherewasanelaboratepostalsystemandagreatirrigationsystemintheChengturegion ofSzechwan.ItwastheChinesewrittenlanguageinideographiccharacterswhosemeaningistotallyunrelatedtolocal variationsinpronunciationandspokendialects,andwhichcanthereforebeunderstoodthroughout,thatprovidedan importantunifyinginstrument,eveninthesouthwhichwasoccupiedbypeopleofnon-Chineseorigin. TheYangtzeValleyandothersouthernterritories,althoughunderpoliticaldominationbytheChinese,couldnotbe fullyincorporatedintotheChinesesocialstructurebecauseofdiseasebarriers 12 .Huang-tididbuildtheLingCanal, joiningtheYangtzeRiverbasintotheCantonareaviatheLiRiver,andthiscanalhelpedsupplyone-halfmillion Chinesetroopsconqueringthelandstothesouth.Thecanalisnowusedchieyforirrigation. Inthecountrysidesouthandwestofthecanalone-thirdofthepeopleeventodaybelongtominoritygroupssuchas theZhuang,consideredbarbariansbytheHans. FollowingthedeathoftheFirstEmperor,disorderandcivilwarbrokeout,withnatureaddingitsbitbyoodsand droughts.Shih'ssonwaskilledandchaosreigneduntilKoa-tsu,apettyofcial,turnedgeneralandemergedasthe supremerulerandfounderoftheHanDynastyin202B.C..TheFormativeAgeofChinahadended. Huang-tiisgenerallyregardedastheauthorofthecanonofinternalmedicinecalled"NeiChing",butthismayhave originatedmuchearlierSection5.7.Thisworksaysthatthebloodcurrentowscontinuouslyinacircleandnever 12 Evenatthetimeofthe"FlyingTigers"ofWorldWarII,GeneralChenaultwrotethatcholera,malaria,typhoidandotherlesserknowndiseases plaguedthepeopleofthisarea.Ref.69[107]

PAGE 202

190 CHAPTER12.300TO201B.C. stops.Itdescribesacupuncturewithneedlesfrom1"to10"long,asystemwhichisstillusedtorestorethebalanceof YinandYanginthebody.ItwasinthiscenturythatironweaponsnallybecamecommoninChinaalmostathousand yearsafteritsuseinThailandandintheWest,althoughthemetalhadbeenintroducedsometwocenturiesbefore. AninterestingpointisthatwhentheChinesedidstarttouseironitwascast,ratherthanwroughtiron,andcastiron requiresaheatof1,400degreesCentigradeatwhichtemperaturetheironmeltsandtheslagisdrawnoff,allowingthe moltenirontobepouredintomolds,likebronze.FromthebeginningtheChinesesmithsknewonlythismethod,and theheatrequired,whichneedssometypeofblastfurnace,wasnotproducedintheWestuntilmanycenturieslater. Ref.89[133],219[293],69[107],221[295],215[290],140[190],211[284]AdditionalNotes About300B.C.,anewwaveofMongoloidimmigrantsfromthemainlandintroducedriceculture,bronze,andifitwas notalreadythere,thepotter'swheeltoJapan,beginningtheYayoiPeriod.AlthoughChineserulershadkepttheseri culturesecretuntilthiscenturyitnowcametoJapan,perhapsthroughKorea.Ref.19[32],122[170]Bergamini Ref.12[21]statesthatinadditiontothebronzeandrice,tradersbroughtinironatthistime. TheKoreanpeoplearerelatedracially,linguisticallyandculturallytotheancientpeoplesofManchuriaandSiberiaas wellastotheJapanese,buttheirpost-NeolithiccivilizationcamelargelyfromChina.Inthiscentury,amongseveral existingstates,themostcivilizedwasChosen,asemi-sinicizedcommunityinthenorthwest.Ref.119[166] SOUTHEASTASIA Distinctive,massive,bronzedrumsdecoratedwithimagesofanimalsandmendateto300B.C.atDongSonNorth Vietnam.FromthestudyofmaterialintheNationalArcheologicalMuseuminTripoli,NorthAfrica,BarryFellRef. 66[97]writesthatinscriptionscopiedfromacaveinnorthwesternNewGuineain1974appeartobetheworkofa LibyannavigatorwhosignedhisnameM-WEgyptian"Mawi"means"navigator"soundinglikePolynesian"Maui". ThedateoftheNewGuineainscriptionwas"the15thyearofPtolemyIIIofEgypt"or232B.C.Furthercomments regardingthepossiblesignicanceofthisndingwillbegiveninthenextsection.In218B.C.theChineseHuang-ti, inhisconquests,tookovertheRedRiverdeltaareanowHanoiandHaiphongandbroughtstrongChineseinuences aswellasChinesebloodtothisarea. ForwardtoTheFarEast:200to101B.C.Section13.7 ChooseDifferentRegion 1.IntrotoEraSection12.1 2.AfricaSection12.2 3.AmericaSection12.9 4.CentralandNorthernAsiaSection12.5 5.EuropeSection12.4 6.TheIndianSubcontinentSection12.6 7.TheNearEastSection12.3 8.PacicSection12.8 NOTE :EversincethebeginningofthisHanDynasty,orslighterearlier,jadehasbeenimportedtotheeastern coastalregionsome3,000kilometersfromSinkiangalongtheoldSilkRoad.Thatvarietyofnephriteis consideredtheonlytruejade.JadeveilshavebeenfoundinseveralaristocraticburialsofthelateEastern Chouperiodupto256B.C.inLuoyang.SeealsoAdditionalNotesin1stcenturyC.E.Ironbattle suitscameintouseinthiscenturyorearlier.Ref.306[157]

PAGE 203

191 12.8ThePacic:300to201B.C. 13 12.8.1THEPACIFIC BacktoThePacic:400to301B.C.Section11.8 WenowcometoamostinterestingnewconceptconcerningtheearlyinhabitantsofthePacic,basedonFell's interpretationofthecaveinscriptionsofNewGuineamentionedjustabove.Theseinscriptionsincludestarmaps, navigationdiagramsandevencalculationsattributedtoEratosthenes.Furthermore,infarungPolynesianislands therearelegendsofagreatsailornamedMaui,who"shedupnewlandsfromthesea".Heyerdahl,althoughmaking nomentionofFell'swork,hasattemptedtoshow,andquiteconvincingly,thatnodirecteastwardsailingfromIndonesiaandMelanesiawaspossible,butthatpeoplecouldreachtheeasternPacicislandsbysailinguptheJapanese currenttoornearthecoastofNorthAmericaandthenbackintotheeasternPacicviacurrentsandwindsthatstill prevail.Perhaps,then,bothFell'sandHeyerdahl'stheoriesarecompatibleinsomedegree.Fellclaimstohavefound insouthwesternNorthAmericaMaui'schartsoftheHawaiianIslandsshowingGawiKaui,UwahuOahu,Mawi ZaraMauiandwhathecalledthe"GreatVolcanicIsland"Hawaii.Therelativepositionsoftheseislandsarethe sameasthosegivenonWilliamBligh'smapof1779,exceptthattherelativelylargesizeofHawaiiwasnotrecognized byMaui,indicatingthatheprobablyonlysighteditfromadistanceanddidnotreallyexploreit.OnMaui'schart theentireislandgroupiscalled hawa andtheislandsareplacedincorrectrelationshiptothewesterncoastofNorth Americaonsomeadditionallargermapsshowingtheentirecontinent. ProfessorRaymondA.Dar,distinguishedSouthAfricananthropologist,andagroupfromtheUniversityofAlabama ledbyProfessorAlbertE.Casey,havegivensomesupporttoFell'shypothesisinthattheyhavefoundskullmeasurementsoftheancientpeopleofNewZealandi.e.beforetheadventoftruePolynesiansindicatelinkswithboth NorthAfricans,IberiansandZuniArizonaIndians,aswellassometribesinNewEnglandandNortheasternCanada. TheinhabitantsofNewZealandpriortothearrivalofthePolynesiansinamuchlatercentury,weretheMoriorisand theyweredriventotheChathamIslandswhentheMaoriarrived.TheseChathamIslandershadArabic-Semiticcountenances,oftenwithlarge,hookednosesandreddishhair.ThisinformationfromHeyerdahliscertainlycompatible withFell'sLibyanoriginconcept.AnotherhypothesisdealingwiththepossibleAmericanoriginoftheaboriginesof theeasternPacicislandswillbegiveninthenextchapter.Ref.66[97],95[140] ForwardtoThePacic:200to101B.C.Section13.8 ChooseDifferentRegion 1.IntrotoEraSection12.1 2.AfricaSection12.2 3.AmericaSection12.9 4.CentralandNorthernAsiaSection12.5 5.EuropeSection12.4 6.TheFarEastSection12.7 7.TheIndianSubcontinentSection12.6 8.TheNearEastSection12.3 12.9America:300to201B.C. 14 12.9.1AMERICA BacktoAmerica:400to301B.C.Section11.9 13 Thiscontentisavailableonlineat. 14 Thiscontentisavailableonlineat.

PAGE 204

192 CHAPTER12.300TO201B.C. InthefarnorththeDorsetphaseoftheArcticSmallTooltraditioncontinued.ThisDorsetSocietywastolastoverall, somesixteencenturies.Ref.189[259] Bythiscentury,forreasonsunknown,theAdenaCulturehadfadedandalmostdisappeared,butanewNorthAmerican IndianculturemadeitsappearanceinIllinoisandsoonspreadtoOhio.Namedthe"Hopewell"afteranIllinoismound group,thiseventuallyspreadwidelyoverahugeportionoftheeasternUnitedStates,stretchingfromtheMississippi RivertoFlorida.Althoughthepeopleprobablycultivatedcornandothercrops,huntingandgatheringwerestill ofcriticalimportance.Theybuiltelaborateearthworks,somefordefensivepurposesandsomeasburialmounds. Theyworkedincopper,mica,obsidian,soap-stoneandwoodaswellasclay.Copperandmicacutoutsinvarious designswereseeninefgypipesandoccasionalpottery.Rockcarvingsofsatyrmasksalmostidenticalwithsomeof CarthaginianoccupiedSardiniaandCarthaginiancoinsofthe4thand3rdcenturiesB.C.haveallegedlybeenfound alongtheArkansasRiverbothaboveandbelowWichita,Kansas,accordingtoBarryFell,andhefeelspositivethat theCarthaginianstradedontheAtlanticsideofAmericaforlumber,goldandfurs.Ref.45[66],66[97] Inthesouthwest,insouthernNewMexicoandeasternArizona,CoshiseIndianscontinuedtheiragricultural,hunting andgatheringsociety,butwithstillmoreimprovementinthetypeofcorn,squashandbeans,sothatatruefarming communityhadmaterialized. AstheMayanSocietybegantoourishwemustnotfailtorememberthattheOlmecsleftaheritageofreligiousbeliefs, artisticsymbolismandotherculturaltraditionstoallsubsequentMexicanpeople.RecentexcavationsnearCoba, Mexico,ontheYucatanpeninsulahavebeencalledtheLatePre-classicMayaperiodbyMexicanarcheologists,with adatinggoingbackto300B.C.andwithapeakatA.D.200.TheMayasexcelledinastronomyanddevelopedavery complexsystemofchronologyperhapsoriginatingwiththeOlmecswhichwasremarkablyexactinitscalculation. Forexample,theycalculatedthat405fullmoonsoccurredinaperiodof11,900days,whiletodayastronomersmake it11,959,888days,thusdifferingby1dayevery292yearsorlessthanveminutesayear!Theyrecordedtheir languageinacomplexhieroglyphicscriptcomposedpartlyofideogramsrepresentingwholewordsorideasandpartly ofphoneticsymbolsforsounds,muchasdidancientEgyptianandmodernJapanese.Scholarsarestillworkingon decodingthislanguage,whichisstillspokenbysometwomillionpeople.Ref.176[242] InCostaRicathisMiddletoLatePeriodIVcanbeviewedasatimeofcontactwithmoredevelopedMesoamerican cultures.Superbhumanandzoomorphicceramicefgieswereproducedatthistime.IntheCentralHighlandsAtlanticWatershed,householdremainsalsoresembleMesoamericanpatterns;small,rectangularhousesaresometimes accompaniedbybell-shapedstoragepits.Thepotterywasadornedwithanynumberoftropicalreptileswiththecolor chieyredonbuff.Ref.265[270]ThearcheologicalrecordofwesternPanamabeginsatabout300B.C.and includesceramicsfoundintheRioChiriquirockshelters.TheyweresimilartothosedescribedinCostaRica.We shallnoteinlaterchaptersthatthiswasanareawherebigchiefdomsdeveloped.Ref.266[67] Therewereapparentlyanynumberofsmall,localizedalthoughprosperoussocietiesinvariouspartsoftheEcuador, Peru,Boliviacomplexinthiscentury.AboutthistimeanumeroustribearrivedintheChilcaBasinjustsouthofpresent dayLima,buildingclustersofdwellinghousesmadeofconical,handmoldedclayblocks,atempleandstore-housefortress.TheirtempleresembledaPolynesian"marae",andlargeandimpressiveadobepyramidswereconstructed. Therewereperhaps2,500peopletoavillage,livingoncorn,sea-foodandpotatoesofcultivatedspecies,therstin Peru.SevenLapaLapa 15 systemswithsome10,000structuresmadeofheavystonehavebeenmappedout.Theyhad sometraitsincommonwiththeNazcaswholivedfarthersouthandweretheircontemporaries-suchthingsaspipes withtenholes,triangularobsidianprojectilepointsandcertaintypesofdishes.Ref.255[9],62[91] 15 AtermEngelRef.62[91]usesfortheChilcaBasindwellers.

PAGE 205

193 TheParacasceremonialcenteronthesouthcoastofPerufadedatabout200B.C.althoughthereappearssomeconfusionaboutdatesinregardtotheParacas-Nazcatimeperiods.FellRef.66[97]reportscarbondatingofthe ParacasinthemiddlesouthPeruareabackaboutthe5thcenturyB.C.,whileEngelRef.62[91]makesitmuch later,althoughheagreesthatwhathecalls"ParacasI"wasgonebefore200B.C. 16 Thisterritorywasoriginallypartof theChavinsocietyareaandsomeChavindecorationswerecontinued.TherenowappearedarecentlyidentiedVicus CulturewhichexistedatthebendoftheMaranonRiveralmostonthepresentEcuador-Peruborder.Thisappearsto havebegunabout220B.C.andlastedforapproximatelyvehundredyears.Fromtheartisticstandpointthesepeople areidentiedbyintricatesheet-goldgures.Noseandearornamentsemployingbothgoldandsilverweredeveloped thereandcarriedonevenintomuchlaterIncadays.Ref.45[66],124[172] ThehighcultureTiahuanacomadesmallmicriolithicprojectilepointsofobsidian,quartzorint,andbolasusedfor catchingcamelidsweretypicalofthearea.SomeTiahuanacoidpotteryoftheerashowsaneyeonguresthatbecame Nazcoidoralmondshaped,suggestingahybridizationofthesetwocultures.ThejewelsofTiahuanacowereveryne andwhenfaceswerecarvedthenoseswereaquilineratherthanstraight,asshownonthewingedgodofthefamed GatewayoftheSun,andasfoundonthegodsofEasterIsland.Ref.62[91] AtChiripa,ontheshoresofLakeTiticacathereareinterestingexcavatedarchitecturalstylesdatingtoabout300B.C., wherethewallswerebuiltwithunredclaybrickspaintedred,greenandwhite,restingonapebblebase.Allwalls weredoublewiththespacebetweenapparentlyusedforstoragebinsandsomeasstablesforguineapigs.Theroofs musthavebeenofstraw.Theattachedgravesshowedmalachitebeadsandhammered,thinsheetsofgold.Thepottery hadastylizeddecorationusingGreek-likesteppatternsandothergeometricforms. ForwardtoAmerica:200to101B.C.Section13.9 ChooseDifferentRegion 1.IntrotoEraSection12.1 2.AfricaSection12.2 3.CentralandNorthernAsiaSection12.5 4.EuropeSection12.4 5.TheFarEastSection12.7 6.TheIndianSubcontinentSection12.6 7.TheNearEastSection12.3 8.PacicSection12.8 16 In1982theNationalGeographicSocietyRef.255[9]datedtheParacasPeriodas550to200B.C.

PAGE 206

194 CHAPTER12.300TO201B.C.

PAGE 207

Chapter13 200to101B.C. 13.1200to101B.C. 1 13.1.1200TO101B.C. Backwardto300to201B.C.Section12.1 ThiswasacenturyinwhichtheRomanEmpireballoonedoutparticularlysouthandeast.Incentralandwestern EuropetheCeltsandGermanictribesviedforposition,bothpushedfromthesouthbytheRomans.Meanwhileinthe eastathriving,expandingandcivilizedChinabegantohaveincreasingtroublewithAsiaticnomads,particularlythe Hsuing-nu.CentralandSouthAmericanculturescontinuedtheirslowbutprogressivedevelopments. Forwardto100B.C.to0Section14.1 ChooseRegion 1.AfricaSection13.2 2.AmericaSection13.9 3.CentralandNorthernAsiaSection13.5 4.EuropeSection13.4 5.TheFarEastSection13.7 6.TheIndianSubcontinentSection13.6 7.TheNearEastSection13.3 8.ThePacicSection13.8 13.2Africa:200to101B.C. 2 13.2.1AFRICA BacktoAfrica:300to201B.C.Section12.2 InthesouthernpartofthisareaKushaswellasAxumcontinuedtoourish.About200B.C.EgyptlostallitsacquisitionsoutsideofcontinentalAfricaasthePtolemaicarmiesweredefeatedbytheSeleucidsatPanion.TheMacedonian 1 Thiscontentisavailableonlineat. 2 Thiscontentisavailableonlineat. 195

PAGE 208

196 CHAPTER13.200TO101B.C. dynastycontinuedtoreign,however,andtheiradministrationspromotedcontinuedintellectualandcommercialactivity,particularlyatAlexandria.TheweldingofEgyptandSyriaontotherejuvenatedIonicGreekworldcreatedahigh economicunitandallowedcitiesofthemagnitudeofninetytoonehundredandftythousandpeopletodevelop,the rstofthesebeing,ofcourse,Alexandria.BytheendofthecenturytheEgyptianswerechangundertheHellenic Ptolemyrulingclass,however,andeventuallytheEgyptianpriesthoodswallowedupthePtolemiesastheyalsodestroyedtheAristotelianmentalityoftheMuseum,andscienticenergywasextinguished.Ref.46[76],28[48], 206[83] CarthagerecoveredfromtheSecondPunicWarandregainedconsiderableprosperityalthoughitwassubjectedto frequentraidsfromneighborssuchasKingMassinissaoftheNumidians,whoweretheancestorsoftheBerbers.In 151B.C.CarthagenallydeclaredwaronNumidianowprimarilyAlgeriaandayearlaterRomejoinedthebattle, initiatingtheThirdPunicWar.ForthreeyearsCarthagevaliantlywithstoodtheRomansiegeengineeredbyScipio Aemilianus,butthecitynallyfellandin146B.C.theRomansbrutallyplunderedandburnedit,possiblytoprevent itsfallingintothehandsoftheNumidians.Ref.83[123]ThisprettywellterminatedtheoldPhoenicianEmpire, butthePuniccisternsremainedandstreetplanswerepreservedandlaterusedaspatternsforRomanreconstruction. AfterthislastPunicWarMassinissa'sson,Micipsa,ruledNumidiaandremainedanallyofRome.Misipsa'sheirs includedanephew,Jugurtha,alongwithhisowntwosons.By116B.C.Jugurthahadoneofthesonsassassinated andhadrunofftheotherandtakenhisowncaseforcontrolofNumidiabeforetheRomanSenate.Thelattergave mostofNumidiatoJugurthaexceptforthecityofCirtawhichwasgrantedtotheremainingsonofMisipsa,Adherbal. JagurthapromptlysetsiegetoCirt,killingoffalltheinhabitantsincludingsomeRomanbusinessmen,thusincensing RomeandparticularlytheEquestrianbusinesscommunity.ArmiesweresenttoNorthAfricaonceagain,thistime againstNumidia,butJugurthawasnotdefeateduntilhisfather-in-law,Bocchus,KingofMauretania,waspersuaded byLuciusCorneliusSullatobetrayhim.TheAfricanstruggleendedin105B.C.withJugurthaaprisonerandstrangled inRome.TheRomansthenspreadwestfromCarthage,alsocontrollingMorocco.Ref.53[79],28[48],175 [241] Polybius,theRomanhistorian,regardedtheNorthAfricanGreeksasapeopleconsiderablydifferentfromthoseof Greece,itself.Theywereolive-skinnedandrepresentedafusionofGreekandNorthAfricannatives.Thesewerethe Libyansandtheyweredevotedtothesea,livingallalongtheNorthAfricancoastfromCyrenenexttoEgypt,westto MauretaniaontheAtlantic.TheareaincludednotonlywhatwenowcallLibyabutalsoTunisia,AlgeriaandMorocco. Alongchainofruined,oncegreat,beautiful,marbleandlimestonecitiesnowmarktheplaceswheretheseseafarers oncelived.WhenLibyankingsruledEgypttheirshipssailedtotheAtlanticportsofSpainandFellRef.66[97] saystotheAmericasacrosstheAtlanticandtothePacicviatheIndianOceanandtheMalaccaStrait.Theancient LibyanslivingwestofCyrenespokeadialectofpre-classicalArabiccontainingmanyBerberloanwords.According toFell'shypothesesthismaybetheoriginoftheArabicfoundinsomeAmericanlocations. Radio-carbondatingsfromthewallsandpotsherdsofthemudbuildingsintheMaliregioncavesoftheToloypeople indicatethattheywerestillthereinthiscentury,butnotsubsequently.Ref.251[17]Thiswasaneraofcontinued Negromigrationsdowntheentirecontinent.ThisgradualoccupationofalmostthewholeofthearablesoilofAfrica inthewestbyNegroesandoftheeastandsouthbytheBantu-speakinggroups,overalltookabout1,500years,during whichtimesub-SaharanAfricawaslargelycutofffromtherestoftheworld. ForwardtoAfrica:100B.C.to0Section14.2 ChooseDifferentRegion 1.IntrotoEraSection13.1 2.AmericaSection13.9 3.CentralandNorthernAsiaSection13.5

PAGE 209

197 4.EuropeSection13.4 5.TheFarEastSection13.7 6.TheIndianSubcontinentSection13.6 7.TheNearEastSection13.3 8.PacicSection13.8 13.3TheNearEast:200to101B.C. 3 13.3.1THENEAREAST BacktoTheNearEast:300to201B.C.Section12.3 ArabiandromedarycaravantrafcwasnowthemonopolyoftheNabataeanArabswhomaintainedaseriesofcaravan stations.UponthecollapseoftheSeleucidslateinthecenturytheseArabsthenacquiredDamascusitself.Ref.136 [187] TheBookofDanielwaswrittenabout165B.C.andtheBookofEnochperhapsslightlylater.Intheformeryear JudahMaccabeeandhisbrothers,aftertakingJerusalembackfromtheSyrians,restoredthemonotheisticreligion.It waslatersaidthattheyfoundonlyenoughoilleftinthetempletokeepalightburningforoneday,butsomehowit lastedeightdaysandthisistheeventcelebratedannuallyastheHanukkah.By143B.C.SimonMaccabeehadfreed Judeaentirely,beginningtheHasmoneanDynastyofpriestkingswhichruledJudeaandsomelandseastoftheJordan until104B.C.,afterwhichAristobulusIandhisbrother,AlexanderJannaeus,ruledsavagelyuntilwellintothenext century.Ref.222[296] NeartheMediterraneancoasttherewasathrivingHellenicculturecenteredonthelargecityofAntiochandthe supportingcitiesofLaodiceaandApamia.ThegreatSeleucidKingAntiochusIIIinvadedGreecein192B.C.butwas soonpushedbackbyRomanarmiesandtheRomaneet.In190twooftheScipiobrotherscrossedtheHellespont anddefeatedAntiochusinthegreatbattleofMagnesia,nearSmyrnainAsiaMinor.TheresultwasthattheSeleucids lostallEuropeanandAsiaticpossessionsasfarastheTaurusMountainsandfromthenontheoldSyrianDynasty continuedtodecline.BytheendofthecenturyalmostthisentireareawastakenoverbytheParthians. EasternPersiawasruledbytheParthianArsacidDynastyandtheycontinuedtodevelopapowerfulempire,keepingthe administrativestructureoftheprecedingSeleucidgovernment.In141B.C.MithridatesIofParthiaenteredSeleucia, itself,ontheTigrisRiverandforthenext775years,withonlyafewminorsetbacks,Persiaremainedoneofthe richestandmostpowerfulregionsoftheancientworld.Ref.8[14]TheirmilitarysystemwasbasedonanIranian nobilitybuttheyaccordedtheHelleniccitiesfullautonomyanddidnothingtoweakentheHellenicstamp. ThewesternspreadoftheParthianswastheresult,inpartatleast,ofpressureontheirnortheasternfrontierby migratingpeoplesfromtheAsiansteppes.SomeofthesemayhavebeenaMongolianpeoplecalled"Hsiung-nu" bytheChinese,butprobablythechiefoffendersweretheYue-chi,anotherIraniantribereturningfromaprevious expansionintoAsiaproper.Theirimmediatedescendantswerecalled"Kushans"andtheypushedtheircousinsthe ShakasandSamartiansaheadofthemtowardsouthernRussiaandtheParthiansdownintoPersia.Ref.136[187] 3 Thiscontentisavailableonlineat.

PAGE 210

198 CHAPTER13.200TO101B.C. EarlyinthecenturytheRomanarmiesbegantobeactiveinAsiaMinor,drivingtheinvadingCeltsfromthenorthback outofthepeninsula,anddefeatingtheSeleucidAntiochus,inthebattleofMagnesia,thusinauguratingtheRoman conquestoftheHellenicEast. MeanwhileinnortheasternAsiaMinoractivitywasrampantintheregionsofBithyniaandPontus.Thepeopleofboth weremixturesofThracians,GreeksandIranians,overlyinganantiqueHittitestock.MithridatesVI,whonowinherited thethroneofPontus,wasastrong,educatedman,speakingtwenty-twolanguagesandwiththehelpofGreekofcers andmercenariesheconqueredArmeniaandtheCaucasusandenteredtheCrimeaofsouthernRussia,controllingthe BlackSeaonallsidesexceptthesouthwest.HetheninvadedBithynia,arousingfearsfortheBosporusStraitsinthe mindsoftheRomanmilitary.SothelatterorderedMithridatesoutofBithynia,settingthestageforactualwarinthe nextcentury.TheGalatianscontinuedtoopposePergamum,sometimesallyingthemselveswithBithynia,butthey receivedacrushingdefeatbyEumenesIIin166B.C.,andhadgreatdifcultyholdingPontusofftheirterritory.When thePergamumKingAttalusdiedin133B.C.helefthiskingdomtoRome.ItwasatthisperiodthatHipparchusof Nicaeaelaboratedtheschemeofspheresandepicyclesthatbecametheclassicalconstructionoftheuniverse.Ref.48 [72],91[135] NOTE:InsertMap:26:ASIAMINORIN189B.C WenotedatthecloseofthelastcenturythatArmeniawasconqueredbyAntiochusIIIanddividedintotwosatrapies. Thewesternone,ArmeniaMinor,wasgiventoZadriadesandtheeasternone,ArmeniaMajor,toArtaxis.After Antiochus'defeatatMagnesiain190B.C.thetwogovernorsmadethemselvesindependentrulers,foundingtwo separatedynasties.AttheendofthecenturytheareawastemporarilyoverrunbyMithridatesVI,theambitiousking ofPontus.Ref.119[166] ForwardtoTheNearEast:100B.C.to0Section14.3 ChooseDifferentRegion 1.IntrotoEraSection13.1 2.AfricaSection13.2 3.AmericaSection13.9 4.CentralandNorthernAsiaSection13.5 5.EuropeSection13.4 6.TheFarEastSection13.7 7.TheIndianSubcontinentSection13.6 8.PacicSection13.8 13.4Europe:200to101B.C. 4 13.4.1EUROPE BacktoEurope:300to201B.C.Section12.4 4 Thiscontentisavailableonlineat.

PAGE 211

199 AsthecommerceofRhodesdeclinedthegovernmentallieditselfwithRome,asituationwhichwastocontinuefor severalcenturies.IntheCycladestherewerefrequentchangesofcontrol.Creteremainedasomewhatwildareawith nestsofpirateswhileCypruswasstillsubservienttoEgypt.Ref.38[59] FromthistimeonforanumberofcenturiestheaffairsanddestinyofGreecebecameintimatelyconnectedandalmost inseparablefromtheRomanEmpireandthemilitaryandpoliticalexpansionofHellenismlostmomentum.The RomansfastenedtheircontrolonMacedoniaandGreecewithremarkableeasebetween200and146B.C..Sparta, underNabis,attemptedarevivalofindependencein195B.C.butitendedwithRomanconquest.Attherequestofthe Aetolians,AntiochusIIIbroughtSyrianforcesintoGreecein192B.C.,butthey,too,wereroutedbytheRomansin thefollowingyear.VariousmembersoftheAchaeanLeaguefoughtaslateas146B.C.,buttheydidsoinadivided wayandfell,tobecomeamerebackwateroftheRomanEmpire.AsapoliticalentityGreecedisappearedfromhistory for2,000years.Ref.28[48],222[296],77[117] ItwasmentionedinthelastchapterthatPhilipofMacedoniahadgivensomehelptoHannibalandthathadstartedthe SecondMacedonianWarin200B.C.AlthoughPhilipwasbeateninanalbattleatCynoscephalaein197B.C.hewas graciouslyrestoredtohisthronebytheRomanvictor,T.QuincteusFlamininus.Ref.8[14]AsRometookover moreterritoryinAsiaMinorGreek-MacedonianandRomaninterestsagaincollided,openingthewayfortheThird MacedonianWar-168B.C.inwhichPerseuswasdefeatedatPydna.AfterseventyMacedoniantownswererazed theRomanstookdirectruleofthecountryin146B.C.Inthelatterhalfofthecenturywithitsgolddepositsexhausted anditsmanpowerweakenedbywarsandemigration,Macedoncouldhardlymaintainitsformerplaceamongthe worldpowers. OnthewesterncoastoftheBalkanareatheRomansconqueredScodraAlbaniawithitsKingGenthius,andestablishedIllyriumasoneoftheearliestoftheRomancolonies.LivingintheareasofmodernYugoslaviaandSerbiathe DalmatianssplitfromtheIllyriansandinseverallaterbattlesDalmatiawasalsothenconqueredbytheRomans.The rstGermanictribetoreachintothisareawastheeastGermanBastarnian,whichsettledbetweenthelowerDanube andtheBlackSea.Ref.8[14],136[187] InthersthalfofthecenturyRomecontinuedtheimperialisticconquestsintheMediterraneanbasinsothatby 150B.C.itsterritoriesincludedmostofSpain,allofItalytotheAlps,Sardinia,Sicily,IllyriaandtheentireGreek peninsula.AlliesincludedNumidia,Egypt,Pontusandafter133B.C.Pergamum.In159B.C.afterencouragingthe NumidianstoencroachuponCarthagetostimulateaghtlocally,Romemovedinonthepretextofabrokentreaty, declaringtheThirdPunicWar.Asnotedinanearliersection,by145B.C.CarthagelayinburnedruinsandRome wasincontroloftheMediterranean.AtypicalRomanofthistimewasCato,asour,revengefulman-publiclymoral, butindividuallycruelandselsh.HecouldnotstandhappinessinotherpeopleanditwashewhourgedontheThird PunicWarwiththeslogan"Carthagemustbedestroyed".Ref.48[72] Meanwhileathomeallwasnotwellandthesignsofsocialdownfallwerealreadyappearing.Anuprisingofslaves andfreeworkersbeganin196B.C.andgraduallyincreasedinintensity.In193TiberiusGracchuspassedtheAgrarian Lawwhichwasanattemptatreform,dividinglargefarmsintosegmentstobegiventothepoor.Octavius,another tribune,opposedthereformandTiberiushadhimthrownout,dividingRomeintotwobitterfactions.Tiberiuswas soonmurderedandalthoughhisbrother,GaiusGracchus,becametribuneandcontinuedthereforms,thearistocrats wonintheendandthelandagainbegantobeaccumulatedinlargetractsandwealthconcentratedinthehandsof

PAGE 212

200 CHAPTER13.200TO101B.C. afew.Coupledwiththiswasageneralmoraldegenerationwithrestrictionofthesizeoffamiliesbyabortionand infanticide.Theplunderfromtheprovincesprovidedfundsfororgiesofcorruption.Thegreatindemnitiesexacted fromthecapturedcountries,withgoldandsilverseized,turnedthepropertiedclassesofRomefrommenofmeansto personsofopulencesothatrecklessluxuryresulted.Itwasatimeoftheriseandprominenceofwomen,sexuality, andlicentiousness. In144B.C.anotherAgrarianRevoltbrokeoutasaresultoffourfactors: 1.Theimportofgrainfromabroadreducingthedomesticprice 2.Thegrowthoflargefarms,asmentionedabove 3.Theinuxofslavesforfarmlabor,whichledto 4.Themigrationofthesmallfarmertothecity Thisrevolutionragedfor73yearsandgraduallypassedintoanactualcivilwarattheendofthecentury.Relatedwere revoltsofslavesonSicilianplantationsin135and103B.C.Ref.222[296]FinleyRef.249[98]writesthat "therewasnoactionorbelieforinstitutioninGreco-Romanantiquitythatwasnotonewayorotheraffectedbythe possibilitythatsomeoneinvolvedmightbeaslave" 5 .Millionsofslaveownersboughtandsoldslaves,overworked them,beatandtorturedthemandsometimeskilledthem,withoutlegalretribution. OthertroublesalsodevelopedwiththeinvasioninthenorthbytwoCeltictribes,theCimbriandtheTeutones,who defeatedRomanarmiesastheyrolledondownthroughGaul.InadditiontheNumidiansinNorthAfricaturnedon themandattackedundertheLeadershipofJugurtha,aswehavedetailedinsection1,Bofthischapter. OriginallyRomanmedicinehadbeeninheritedfromtheEtruscansandwasbasedchieyonreligioushealing,but GreekmedicinegraduallyinltratedfromAlexandria.TherstwellknownGreekphysiciantogotoRomewas ArchagathosofSpartawhohadarrivedwithmuchcelebrationandhonorjustbeforethiscenturyopened,butwhowas laterrepudiatedandcalled"butcher".Ref.125[173],249[98] TheGermanicorTeutonictribesnowbegantodominatecentralEurope.Theywerefair-hairedliketheCelts,but taller.By150B.C.thepressureofthesetribesinthenorthandtheRomansinthesouthhadbeguntotipthemilitary balanceagainsttheCeltsandtheirculturestartedtodisappearincentralEuropeexceptinthekingdomofNoricum presentdaysouthernAustriafromwhichtheRomanshadbeenforcedtowith-draw,andSwitzerland.Bytheendof thecenturytheRomanshadprettywellreconqueredtheseareasalso. TheCelticpeopleswerenowconcentratedallalongtheAtlanticstates.Weinsertatthistimeafewremarksaboutthe Celticreligion,sincetheonlysourceofinformationhasbeenfromtheRomanrecordsastheyconfrontedtheCeltsin Gaul.Throughoutalltheirtribes,theCeltshadapriestlycasteofDruids,althougheachgroupseemedtohaveitsown localdietiesandcults.TheDruidswereteachersoftheyoungnobilityandtheyforecastedthefuture.Onceayear, DruidpriestsfromallovermetinsolemnassemblynearChartres,France.Theymediateddisputesbetweentribesand enforcedtheirjudgmentsbyexcommunicationorexclusionfromthesacrices,whichseemedcentraltothisreligion. Thesacricesincludedhumans,oftencriminalsorprisonersofwar,andtheywereoftenburnedinaseaofames. Ref.194[266]ThesuggestionhasbeenmadethattheastronomicalknowledgeandthebasiccultoftheDruids mayhavebeenpassedtothemfromprehistoricpeoplesinEngland. TheGermanictribescontinuedraidsintowesterncontinentalEurope,pushingtheCeltsintomoreandmorerather narrowbandsalongtheAtlanticandintotheBritishIsles.TheCimbersandtheTeutonshadleftJutlandandSchleswigHolsteinabout120B.C.,migratedintoGaul,defeatingseveralRomanarmiesandspreadingfearandterror.Thetwo 5 Reference249,page65

PAGE 213

201 tribesnallyseparated,however,andwerethendefeatedbytheRomanMarius,in102B.C.TheCimbriansmettheir defeatatAquaSextiaandtheTeutonsatVercellae.ButtheCimbrihadalreadysentforcesintoSpainfromGermany andinPortugaltheLusitaniantribes,ledbyViriathus,defeatedallRomanarmiesforeightyearsbeforetheynally fellastheirleaderwasassassinated.InGaul,Romehadtoght"barbarians"allalongtheRhoneRivertoprotect Massilia,andby120B.C.theyhadorganizedsouthernGaulintoaseparateRomanprovince.Ref.8[14],196 [269] WhatappeartobePhoenicianbeadshavebeenexcavatednearSt.Sampson,Cornwall,datingfromthe2ndcentury B.C.on,seemingtoconrmthepresenceoftheCarthaginiansthereastradersfortin.Ref.66[97]InScotland thefusionofPicts,Celts,NorwegiansandBell-Beakerpeoplecontinued,withthePictsprobablythedominantgroup, althoughacceptingsomeCelticspeech.Ref.170[234] TheGermanictribesspreadallthroughScandinaviamovingupacrosstheSkaggerakandKattegotintoNorwayand evennorthernSweden.Manyofthetribesseemtohaveoriginated,oratleastmadetheirpreliminaryproliferations,in theDenmarkarea.Thisperiodappearstohavebeentherstofsomerecurringtimesoftremendouspopulationgrowth insouthernScandinaviawiththeresultingnecessityformigrationofmultitudesofpeoplefromthearea. AnIraniantribe,theSarmatians,hadconqueredandgraduallydisplacedalmostalltheScythians,althoughafewof thelatterremainedeastoftheCaspianSea.AftertheSarmatianshadextendedallacrossthewholeoftheRussian steppethey,inthesecondhalfofthecentury,dividedintothreegroups: 1.Iazygians,westofthelowerDneiper 2.Roxolani,betweentheDneiperandtheDon,and 3.Alans,totheeastandjustnorthoftheCaspianRef.136[187] GreekcoloniesaroundtheBlackSeafellintodecayandtheKingdomofPontus,underMithridatesIV,tookcontrolof mostoftheBlackSeashore,includingtheCrimea.IntheupperDneiperbasin,thenorthwardadvanceoftheDneiper SlavsbegantoresultintheejectionorabsorptionoftheBaltsinthearea. ForwardtoEurope:100to0B.C.Section14.4 ChooseDifferentRegion 1.IntrotoEraSection13.1 2.AfricaSection13.2 3.AmericaSection13.9 4.CentralandNorthernAsiaSection13.5 5.TheFarEastSection13.7 6.TheIndianSubcontinentSection13.6 7.TheNearEastSection13.3 8.PacicSection13.8 13.5CentralandNorthernAsia:200to101B.C. 6 13.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:300to201B.C.Section12.5 6 Thiscontentisavailableonlineat.

PAGE 214

202 CHAPTER13.200TO101B.C. Bactria,astridetheHinduKushandmakingupthenorthernpartofpresentdayAfghanistan,wasruledbyGreek kingsasremnantsofAlexander'sempire,andthecountryallowedIndian,Chinese,IranianandGreekculturestomeet andintertwine.Forthenexttwoorthreehundredyearsthiswasthehuboftheeast-westEcumene,eventhoughthe Yue-chidestroyedthepoliticalunityoftheKingdomofBactria.Ref.139[192]Thistake-overwaspartofanew turmoilwhicharoseincentralAsiaabout130B.C.asHunsfromfareasterncentralAsiaperhapsMongoliastarted topushtheYue-chiTocharianswestwardandtheyinturnchasedafewremainingScythiansbeyondtheJaxartes River 7 .TheScythians,inturn,headedsouthwardanddestroyedtheGreco-Bactriankingdomjustmentioned,ontheir waytothePunjabofIndia,withtheYue-chifollowinglaterinabout100B.C.vianorthernAfghanistan. TheHunsjustmentionedwerechieytheHsuing-nu,underChiefModok,andtheysoondominatednotonlyMongolia buttheIndo-EuropeanoasisstateletsofChineseTurkestanaswell.Armorcalled"chia"waswornatleastbythenobles intheHsuing-nuarmy. Thewordmaymean"hidearmor"butingravesatNoinUla,MongoliaandTuva,Siberiaarmormadeofironscales attachedtofabrichasbeenfounddatingtothiscentury.Bronze,ironandleatherwereprobablyallused.Afterthe conquestofTuva,theHsuing-nupopulation,whichwasalreadyraciallymixed,becameevenmoreEuropoid 8 .Ref. 127[176] TheChineseruler,Wu-Ti,spenttheresourcesandenergiesofChinaforeighteenyearsingreatcampaignsagainst theHsuing-nuandtheywerenallydrivenoutofInnerMongolia,KansuandChineseTurkestan.Ferghana,westof theTarimBasinwasthehomelandof"heavenlyhorses"whichtheChinesefelttheyhadtohaveintheircavalryto counteracttheagileponiesoftheHsuing-nuandotherraiding-nomads.AttheendofthecenturyWu-Tisentarmies tosubduethenomadsofSinkiangandgothroughthisareatogetthehorses.AChineseexplorerhadreachedthis FerghanaValleyin128B.C.andamilitarygarrisonhadbeenestablishedby101B.C.Thewesternedgeofthearid TarimBasinwasthesourceofjadefortheChinesecarvers.Fartherwest,theParthianshadextendedtheirempire southandeasttotakeinpartofKhurasanandtheedgeoftheHinduKush.TheBactriancamel,inthisandadjacent centuries,servedallthebarbariansfromtheGreatWallofChinatotheCrimeaaspackandridinganimals.Ref.139 [192],101[146],8[14],127[176] ForwardtoCentralandNorthernAsia:100to0B.C.Section14.5 ChooseDifferentRegion 1.IntrotoEraSection13.1 2.AfricaSection13.2 3.AmericaSection13.9 4.EuropeSection13.4 5.TheFarEastSection13.7 6.TheIndianSubcontinentSection13.6 7.TheNearEastSection13.3 8.PacicSection13.8 13.6TheIndianSubcontinent:200to101B.C. 9 13.6.1THEINDIANSUBCONTINENT BacktoTheIndianSubcontinent:300to201B.C.Section12.6 7 Thisclassicalviewofonepeople"chasing"or"driving"anotheraheadofthemisnotacceptedbythescholarlyMaenchen-HelfenRef.127 [176]whobelievesthemigrationstookplaceforotherreasons 8 "Europoid"isatermusedbySovietanthropologiststoindicate"non-Mongoloid" 9 Thiscontentisavailableonlineat.

PAGE 215

203 TheIranianYue-chiTocharians,runoutofcentralAsiabytheHsuing-nu,endedupsouthofthePamirs,innorthern Pakistan.Ref.101[146]ThegreatMauryaDynastyendedwiththedeathofKingBrihadrathain185B.C.and thehistoryofthenextvecenturieshasbeenprettywelllostinobscurity.ItisknownthattheMauryawereatleast partiallyoverthrownbythePushyamitrafromtheGangesValleyandthattheythenestablishedtheSungaDynasty. ThiswasaBrahmindominatedgroupwhichcausedtheBuddhiststoretreattootherareaswheretherewassoona oweringofBuddhistsculpture.SomeGreeks,SyriansandScythiansconqueredthePunjabandestablishedaGrecoBactrianCultureunderDemetrius,theGreekBactrianking,anditexistedforsome300years.TheDeccaninthesouth becameseparatedfromtherestofIndiawiththeformationoftheTamilstates.ThesepeoplewereDravidians,a dark-skinnedracewhichsomebelievetobeamixturefromMediterranean,AustraloidandMelanesianorigins. ForwardtoTheIndianSubcontinent:100B.C.to0Section14.2 ChooseDifferentRegion 1.IntrotoEraSection13.1 2.AfricaSection13.2 3.AmericaSection13.9 4.CentralandNorthernAsiaSection13.5 5.EuropeSection13.4 6.TheFarEastSection13.7 7.TheNearEastSection13.3 8.PacicSection13.8 13.7TheFarEast:200to101B.C. 10 13.7.1THEFAREAST BacktoTheFarEast:300to201B.C.Section12.7"Former"HanDynastycontinued Asbrieynotedinthelastchapter,between206and202B.C.Kao-tsu,acondot-tier,hadseizedthethroneofChinaand foundedtheHanWesternorFormerDynasty.Freedomofspeechandwritingwasrestoredandalaissez-fairestyle ofgoverningallowedprosperityandpopulationgrowth.AlthoughKao-tsudiedin195B.C.hiswifeanddescendants ruledconservativelythroughthersthalfofthecentury.Taxeswerecutmarkedly,butstillthestategranarieswere fullandthegovernmenthadvastcashreserves.ThegreatestHanemperorwasWu-Ti,whointhelasthalfofthe centurypushedbackinvadingbarbariansandextendedChina'sruleoveravastterritory,includingKorea,Manchuria andevenpartofTurkestan.ThiswesternterritoryTarimBasinandtheTurfanOasiswasobtainedbywaragainst theHsuing-nu,thetribalfederationofcentralAsiathathaddevelopedalongwiththeChineseEmpireandwhichhad previouslyraidedChinaaswell.ThewesternareabecameimportantbecauseoftheChineseSilkroutestotheWest. EvenbythiscenturytheChinesehadbecomeveryactiveinthesilktrade,startingcaravansatPaochi,movingalong insidetheGreatWalltoitswesternend,thenacrossChineseTurkestan,theneithernorthorsouthoftheTarimBasin, throughthePamirMountainstoMerv.Thesilkroadhadnotfunctionedwellbeforethetimeoftheprotectionofthe ChineseHans,becauseofthenomadpirates. Wu-tiexperimentedwithsocialism,foundinggreatgovernmentindustries,transportationservices,deliveriesandmiscellaneousservices,developedgovernmentalcontrolofprofitandlevieda5%incometax.HemadeConfucianism ofcialandtheConfucianclassicswerereassembledandtranscribed.Throughhisconquests,southandwest,contact wasmadewiththeIndianculturalsphere.Thiswasaccomplishedbysailing3,000milessouththroughthestraitsof MalaccaaroundtheMalayanpeninsulaandthe1,200milesacrossopenseastotheIndianshorenearwhatisnow Madras.Seasonalmonsoonwindswereusedforpoweronboththeoriginalandreturntrips,indifferentseasons. 10 Thiscontentisavailableonlineat.

PAGE 216

204 CHAPTER13.200TO101B.C. Chineseocean-goingjunkshadamuchbettersailarrangement,bettercargoandcabinspaceandmanyotherfeatures unknowntowesternshipsformanyhundredsofyearsinthefuture.Cowrieshells,therstChinesemoney,probably camefromthefarawayMaldiveIslands.TheChineseambassador,ChangChien,spentmorethantenyearsinthe middleeast,gatheringinformationondrugs,viticultureandmanyothersubjects.SometimeduringthisHanDynasty anotedclinician,TsangKung,describedmanydiseases,includingcancerofthestomach,aneurysmandrheumatism. Ref.101[146],68[106],215[290],43[64],8[14],125[173] AdditionalNotes Megaliths,similartotheancientonesofEurope,appearedinthiscenturythroughoutJapanandtheycontinuedto bebuiltforthenexteightorninecenturies.StrangelynoneappearedinChina.Thiswasthebeginningofthe YayoishikiCultureperiodinJapan,butthepeoplewerestillinaneolithicstage.Theseinhabitants,whonowbegan ricecultivation,weavingandtheuseofmetalssuchasbronzeandsomeiron,mayallhavebeenimmigrantsfrom ManchuriaandperhapsKorea,replacingthemorenativeaboriginalsoftheJomonperiod.Theydenitelyhadsome relationshipwithKorea.Ref.215[290],45[66] ThestateofChosencontinuedtoprosper.Neartheendofthecenturyatabout108B.C.anallianceoftheKoreans withtheHsiung-nuprovokedtheChineseemperor,Wu-ti,whopromptlysenttroopsandestablishedanHancolonyat Lo-lang,nearthemodernP'yongyang.Ref.45[66] MuchofthemainlandareaofsoutheastAsiawasnowcontrolledbyChinawithnorthVietnambeingsubjecttothe Chineseforthenext800years.ButtherewasalsoforeigninuencefromIndia.DevelopmentofseafaringintheIndian OceanandtheChinaSeaallowedthepeopleoftheGanges,alreadytoleranttotropicalparasites,toimplantIndian courtculturealongtherivervalleysandislandsofsoutheasternAsia,eveninIndonesia.Inspiteofthetremendous geographicalareainvolved,however,powerfulcivilizationsdidnotdevelop,probablybecauseoftheattenuating effectsofmalaria,dengueandwaterborneinfectionsofthegastro-intestinaltract.TheuseofironspreadfromSiam toBorneoandPalawanbyabout200B.C.Ref.8[14],140[190] ForwardtoTheFarEast:100to0B.C.Section14.7 ChooseDifferentRegion 1.IntrotoEraSection13.1 2.AfricaSection13.2 3.AmericaSection13.9 4.CentralandNorthernAsiaSection13.5 5.EuropeSection13.4 6.TheIndianSubcontinentSection13.6 7.TheNearEastSection13.3 8.PacicSection13.8 NOTE :DuringthereignofEmperorWu-86B.C.theuseofjadeburialsuitsforthearistocratscame intoitsown.ThetombofLiuSheng,Wu'sbrother,providesthebestearlyexampleofthistypeofjade burialshroud.Ref.306[157]

PAGE 217

205 13.8ThePacic:200to101B.C. 11 13.8.1THEPACIFIC BacktoThePacic:300to201B.C.Section12.8 WehaveintimatedpreviouslythatPolynesiaappearstohavebeeninhabitedbysomepeoplepriortothetruePolynesian migrationsoflatercenturies.WhethertheseaboriginaldwellerscameentirelyfromprehistoricAmericaorfrom someotherclimeisnotknownwithcertainty.WearequitecertainthatEasterIslandandperhapsadjacentSouth Pacicislands,suchastheMarquesas,hadimmigrantsfromSouthAmerica,butwhataboutHawaii?Recentlyon anhelicoptertriptoaremote,presentlyuninhabitedpartofKuaui,themostnorthernofthechiefHawaiianIslands, welandedinwhatthepilotcalledtheValleyoftheLostTribeandhedescribedanoldHawaiianlegendthathad thisasthelocationofthelaststandoftheaboriginalpeopleagainsttheinvadingPolynesians.Therewereremnants ofpreviousterracinginthisvalley.WhethertheseoriginalshadcomefromtheAmericasorrepresentedLibyans andotherscomingviatheJapaneseCurrentfromIndonesia,apossibilitysuggestedbythendingsofFellSeeThe Pacic:300to201B.C.Section12.8,isnotknown.Thelater,truePolynesiansdidnothavepottery,butmany ancientsherdshavebeenfoundonHawaii,apparentlyleftfromanearlierpeople.Heyerdahl'sargumentsinfavorof originalsettlementfromSouthAmerica,particularlyPeru,areimpressive.Ofrstimportanceistheora.InHawaii thehusktomato,Physalisperuviania,called"poha",isanAmericancropplantnativefromMexicotoPeru.Cotton, thesweetpotatoandHibiscusofHawaiiallpointtoPeru.ThewhiteoweringHawaiianArgemoneiscloselyrelated totheArgemonegrowninancientPerufornarcoticandanestheticpropertiesandwassimilarlyusedinHawaii.We mustrememberthathumansbroughtalmostalltheplantstothevolcanicandcoralPacicislands,astheywere"born" completelybareandonlyalimitednumberofplantssuchasthescrewpine,sandalwoodsandpossiblylauansand breadfruitcouldhavearrivedbyseaorbirdsbeforetheadventofman.Ref.95[140],134[184]Thequestion ofhowthesweetpotatogottoHawaiiandtheMarquesashasbeendebatedforalongtime.Itwasonceallegedto havebeentakentherebyshipwreckedSpanishcrewsin1528,butDahlgreenofSweden,afterlongstudy,saysthat thereisabsolutelynoevidencethatHawaiiwasevervisitedbytheSpanishpriortoCaptainCook'svisitationsinthe l9thcentury.SomeironimplementsfoundbyCookontheislandsarethoughttobetheresultofdriftagefromJapan. ThesweetpotatoisnativetobothSouthandCentralAmericaandoldHawaiianlegendsaresuggestiveofseacontact withAmerica.Legendsoftheislandsalsorelatethatthesweetpotatowasdriedandusedforfoodonlongvoyages, apparentlytootherPacicislandstheMarquesas?.Ref.207[279]Thereisalsoaremarkablesimilaritybetween theHawaiianat-irontypeofgrinderforpoiandtheCentralAmericanandMexicancorngrinders. ForwardtoThePacic:100B.C.to0Section14.8 ChooseDifferentRegion 1.IntrotoEraSection13.1 2.AfricaSection13.2 3.AmericaSection13.9 4.CentralandNorthernAsiaSection13.5 5.EuropeSection13.4 6.TheFarEastSection13.7 7.TheIndianSubcontinentSection13.6 8.TheNearEastSection13.3 13.9America:200to101B.C. 12 13.9.1AMERICA BacktoAmerica:300to201B.C.Section12.9 11 Thiscontentisavailableonlineat. 12 Thiscontentisavailableonlineat.

PAGE 218

206 CHAPTER13.200TO101B.C. TherewasnointerruptionoftheDorsetSocietypreviouslydescribedintheArcticnorth.InsoutheasternCanada, particularlyintheregionofNovaScotia,theMicmacIndianseventuallyhadscriptwriting.Althoughusuallycredited toworkoflaterFrenchpriests,FellRef.65[96],66[97]givessomeevidenceindicatinganeastLibyanorigin fromneartheEgyptianborderwhereHerodotussaidthatanAdrymachidtribehadadoptedEgyptianmanners.He datesthecontactofLibyansailorswiththeMicmacstothiscenturybutonlyfurtherinvestigationcanreallysettlethis onewayoranother. WehaverecordedpreviouslythatsomeauthoritiesfeelthatAsianmigrationstoNorthAmericaviaaPacicnorthern routecontinuedbyboatdowntoabout2,000B.C.Iftrue,thenoverthevastexpanseofsome20,000to30,000years agreatvarietyofpeoplecouldhavemadethistrek.WeknowforcertainthattheAleutsandtheEskimosareseparate fromtrueAmerindiansandthattheAthabascansofcentral,northCanadawererelativelylatecomers,differentin cultureandlanguagefrommostotherIndians.Nowweshalldescribestillanothergroupofpeople,occupyingthefar westernshoreandtheoff-shoreislandsofCanada,whoappeartobedifferentfromallotherearlyNorthAmerican inhabitantsinmanywaysandwhodevelopedinanisolatedsituationalongtheCanadianwaterways,shutofffrom inlandCanadabyprecipicesandwildmountains.ThesearetheHaidaoftheQueenCharlotteIslandsandtheKwakiutl ofnorthwesternVancouverIsland,bothrankingamongthetallestpeopleintheworld.Theyappeartoberelatedto theSalishorFlatheadIndianswholaterinhabitednorthernMontana,apparentlycomingdowngraduallyfromBella CoolaandBritishColumbia.ThesepeoplearedolichocephalicwhilemostAmericanIndiansarebrachycephalic; theircomplexionsarefairandtheirhairoftensoftandbrown,ratherthanMongoliancoarseandblack.Theearliest EuropeanvisitorstothewesternCanadianislands-Cook,DixonandVancouver-allemphasizedthosefeatures. Inadditionthosenorthwestcoastpeopleoftenhadstrongmustachesandbeards,incontrasttotheusuallytotally beardlessAmerindians.ThustheyhavemanyCaucasianfeaturesandarephysicallyidenticaltotruePolynesians. TheirhomesitesintheCanadianislandsprobablyrepresentway-stationsonthetripthesepeoplemadefromsomeplace inAsiainancienttimestotheeventualdestinationofsomeofthem,inPolynesia.IftheyarerelatedtoMalaysiansit isaverydistantrelationshipandthetwophysicallydissimilarpeoplesmusthaveseparatedfromanoriginalstemin veryancientdays,beforetheMalayasiansevenmigrateddownintothepeninsulanowbearingtheirname.Thetheme oftheunityofthenorthwestAmericanIndiansandthePolynesianswillbefurtherdevelopedinsubsequentchapters. TheexpandingHopewellsphereextendedfromtheAllegheniestothewesternborderoftheMississippialley,north totheGreatLakes,southtoFloridaandtheGulfStates.Theircraftsmenobtainedobsidianforknivesandarrowheads fromtheYellowstoneareaofWyomingaswellasotherrocksfromMontanaandNorthDakota.WehavenotemphasizeditpreviouslybuttheWoodlandCulturewithitsburialmounds,pipes,stoneandcoppergorgets,woodencarvings, potteryefgiesandearringsexistedinthesouthasearlyas1,000B.C.ontothis2ndcenturyB.C.andbeyond.Burial moundsuptofortyfeetinheightarescatteredthroughoutthesouth.Ref.267[321] WedonotliketobelaboracontroversialpointbutisperhapsworthmentioningthatFellRef.66[97]insiststhat Celt-IberianswerescatteredthroughouttheeasternUnitedStatesbythisperiodandthatcoinsfoundinquantityin OhiowerelocalcopiesofancientbronzecoinsofEvia,anoldPortuguesecity.ThisentirequestionofEuropean and/orNorthAfricanvisitorsinAmericaatamuchearliertimethanheretoforeevermentionedinclassicalhistories isaninterestingone.AlthoughFellandThorHeyerdahl 13 ,bothofwhomhavewrittenextensivelyonthissubject independently,havenotobtainedanysignicantagreementfromothersintheeld,thisdoesnotnecessarilymean thattheyareinerror.Wemustrememberthatinthelatterpartofthe19thcenturytheinitialreportsontheextensive andnowfamousprehistoriccavepaintingsandengravingsfrompartsofSpainandLesEyziesregionofFrancewere metwithcompleteskepticismbytheInternationalCongressofPrehistoricArcheologyandAnthropology.Ref.215 [290],66[97],130[180] 13 Heyerdahl'stheoriesapplyonlytoCentralandSouthAmerica,nottheUnitedStates.

PAGE 219

207 InthesouthwesternUnitedStateswherethecornersofArizona,NewMexico,UtahandColoradojoin,theso-called Basket-makerIperiodoftheAnasaziIndianCulturewasinprogressbutfewdetailsareavailablefromthiscentury. FarthersouththeSanPedroCulture,apparentlyamodicationoftheCochise,continuedtobeviable.Ref.45[66],CENTRALAMERICA,ANDTHECARIBBEAN InMexicotheTeotihuacancity-statecontinuedtogrow.ThelatePre-ClassicperiodofCentralAmericacontinued withprogressivepopulationgrowth.TheMayainthePetenareasubsistedoncorn,beansandsquash,astheycleared landbyaslashandburnsystem.Therewerenolargeceremonialcentersasyet. TheVicusCultureourishedinnorthernPeru.AtLakeTiticaca,ontheborderofpresentdayPeruandBolivia,on ableak13,000feetplateauinthemiddleofthepreviouslydescribedTiahuanacoCultureareatherenowwasbuilt abut200B.C.thedenitivecityofTiahuanaco.Itsremainingstonesgiveevidenceofacolossalstyleofbuilding, withformidablemathematicallyorderedwallsandimposingmassivestonesteps.Agiantstoneidol,24feethigh, wasexcavatedin1932byanAmericanarcheologicalteamunderW.C.Bennett.Anotheridol,only8feettallbut ofacompletelydifferentstyle,althoughalsoofredsandstone,wasfoundbesideit.Shrunkenhumanheadshave beenfound,suggestingthebloodycultofhead-huntingand/orhumansacrices.ABolivianscholar,PonceSangines, believesthisculturelastedfrom200B.C.toA.D.1,200withperhapsveburiedcities,oneoftenoverlappinganother inthearcheologicalstrata.LakeTiticacaisthehighestnavigablelakeintheworldanditslargestisland,theIsland oftheSun,hashillswithancientcrop-growingterracesandbeneathitswatersarehighwallsandpavedpaths.The lake,covering3,200squaremilesnowisthoughttohaveoncereachedthewallsoftheancientcityofTiahuanaco, therunsofwhichnowlie25milesawayinBolivia.Thecitymayhavebeenbasicallyareligiousormeetingcenter, asthelargepublicbuildingscouldholdthousandsofpeople.Thereseemstohavealsobeensuburbswerecraftsmen, weavers,smithsandfarmerslivedinmud-brickhouses.Potatoesandcornweregrownastheyareeventoday.The stoneswhichmadeupthelargepublicbuildingsandwallsappeartohavebeenbroughtfromquarriesbetween60 and200milesawayandthemethodoftransportbringsupthesamequestionsandpossibleanswersthathavebeen issuedaboutthegreatstonesofStonehenge,theEuropeanmegalithsandthestatuesofEasterIsland.SomeAmerican prehistorianshavesuggestedthattheTiahuanacopeoplesimplyfusedtogetheralltheupperAndessocietiesthathad beenfragmentedsincetheendoftheChavinCulture. HeyerdahlRef.95[140]quotesmanyoftheveryearliestSpanishchroniclersastheyhaverecordedthenatives' legendsofthegreatpre-Incapast.Inthesethereistherecurringthemesuggestingimmigrantsfromacrosstheocean. LakeTiticacaisgivenasapossiblebeginningpointforIngaViracochaorthecompositeCon-Tici-Viracocha,abearded deitywho"broughthispeoplefrothesea."LegendsamongtheChimuhavethissamedeityarrivingbysealongthe coastmuchfarthernorth.OneofthestatuesunearthedbyW.C.Bennettin1932wasthatofCon-Tica-Viracochain Tiahuanaco,completewithbeardandlonggirdledrobe,decoratedwithanhornedserpentandtwopumas,symbolsof theSupremeGodinbothMexicoandPeru. Ataboutthissametimeof200B.C. 14 andrunningtoaboutA.D.900thereappearedinthenorthofPeruthemysteriousMochicaCulturecompletewithpotteryandclaygurinesandmusicalinstrumentsandclothingresemblingthat ofclassicaltimesintheMediterranean.TheMochehavesometimesbeencalled"theGreeksofSouthAmerica."Fell believesthattheyderivedfromaLibyancolonywhichwasoriginallyinthesouthwestUnitesStatesbecauseofsimilarityofsomedragon-shipartworkandotherfeaturesfoundinancientNevadaandCaliforniadesertsites.Hebelieves extensionsofMaui'svoyagesPleaseseeThePacic:300to201B.C.Section12.8includedthesouthwestern UnitesStatesandthatvisitorsfromtheretonorthernPeruaccountforthecivilizationoftheMoche. MeanwhileonthemiddlesouthcoastthesocietywhichEngelRef.62[91]callsParacasIIdevelopedasacoastal societywithlimitedarchitecture,someuseofcopperandgoldandaveryadvancedstateofweaving.Allskullswere deformedtoapear-shapeandmanyweretrepanned.SomeelementssuggestthattheycameupthecoastfromChile 14 EngelRef.62[91]datesthisearlier,between500and400B.C.Section10.9.1.3:SOUTHAMERICA

PAGE 220

208 CHAPTER13.200TO101B.C. andtheirmanyidentiedweaponsindicateterricbattles.TheNazcasweredirectsuccessorsoftheParacasandthey tooremainedacoastaltribe,althoughwithafardifferentsocialsystem.Thetransitionwasapparentlysomewhat gradualandalthoughtheNazcaSocietymayhavetakenshapeinthiscentury,itdidnotblossomuntillongafter.Ref. 176[242],66[97],95[140],62[91] ForwardtoAmerica:100to0B.C.Section14.9 ChooseDifferentRegion 1.IntrotoEraSection13.1 2.AfricaSection13.2 3.CentralandNorthernAsiaSection13.5 4.EuropeSection13.4 5.TheFarEastSection13.7 6.TheIndianSubcontinentSection13.6 7.TheNearEastSection13.3 8.PacicSection13.8

PAGE 221

Chapter14 100B.C.to0 14.1100B.C.to0 1 14.1.1100B.C.TO0 Backwardto200to101B.C.Section13.1 InthislastcenturybeforetheChristianEratheMediterraneanareawasentirelydominatedbytheRomanEmpirewith intervalstrongresistanceintheeastbytheParthians.Bothofthesepowers,however,hadtokeepwatchfuleyeson theirfrontiers-theRomanstothenorthwherebothCeltsandGermanswereproliferatingandtheParthianstothe northandeastwherenewAsiatichordeswerebeginningtobuild.IntheFarEastthegreatHanDynastyofChina probablyequaledorsurpassedtheRomansinmanyculturalaspects,sizeandaccomplishments. Forwardto0toA.D.100Section15.1 ChooseRegion 1.AfricaSection14.2 2.AmericaSection14.9 3.CentralandNorthernAsiaSection14.5 4.EuropeSection14.4 5.TheIndianSubcontinentSection14.6 6.TheNearEastSection14.3 7.ThePacicSection14.8 14.2Africa:100B.C.to0 2 14.2.1AFRICA BacktoAfrica:200to101B.C.Section13.2 Meroe,nowtheRepublicofSudan,continuedtoourishonethousandmilessouthoftheMediterraneanandAxum continuedwithsomeprosperityintheareaofnorthernAbyssinia,nowEthiopia. 1 Thiscontentisavailableonlineat. 2 Thiscontentisavailableonlineat. 209

PAGE 222

210 CHAPTER14.100B.C.TO0 IntherstpartofthiscenturyEgyptremainedundertheMacedonianPtolemyDynastybutCaesarmarchedintothe countryandtookcontrolbetween48and47B.C.,makingthefamousalliancewithCleopatra,Egyptianqueen.Upon hisdeathCleopatramadeasimilarallianceanddalliancewithMarcAntonyandsuchwasherapparentcharmthatin 37B.C.AntonygaveupallinterestinhisgovernmentandsettledwiththequeeninAlexandriatoalifeofpleasure. StrippedofhisofcebytheRomanSenateanddefeatedatseabyOctavian,hecommittedsuicidein30B.C.along withCleopatra.EgyptwasthenformallyannexedtotheRomanEmpireundertheEmperorOctavian,althoughthelife oftheaverageEgyptianwasprobablylittleaffectedbytheseadministrativechanges.Attheendofthiscenturythere wereabout8,000,000peopleinthiscountry. Numidia,nowAlgeria,joinedCarthagetobecomeRomanduringthiscentury.Thethickbeltofmegalithictombs whichhavebeenfoundacrossnorthAfricadatetothisandthenextcenturyandthushavenochronologicalrelationship tothesimilarbutmuchmoreancientonesofEurope.Noexplanationhasbeenoffered.TheRomanhistorian,Sallust, ofthiscentury,writesthattheLibyansweredescendedfromapeoplewhocamefromAsiaMinorandwerealliedto thePhoeniciansthroughtheirlanguage.Arabhistorianshaverecordedsimilarbeliefs.Ref.215[290],176[242], 66[97]Cyrene,withitslargeGreekcomponent,becameaprovinceofRomein74B.C.Ref.222[296]Inthe Sahara,itself,waterholeshadessentiallydisappearedandtherewasnowtrulydesert.Thegreatdunescalled"ergs" hadformedandtherainshadbecomemostirregular. Therewasnogreatchangeinthesoutherntwo-thirdsofthecontinent.Ironworkingcontinuedtospreadataslowpace intheNigerBasin.ThecamelwasintroducedintotheSaharafromAsiaabout100B.C.TheBantuspeakerscontinued theirslowmigrationdowntheeasternlands.Ref.8[14]Onetheory,basedonarchaeologicalandskeletalremains, suggeststhatatabouttheendofthecenturyafewoftheCaucasoidpastoralistsdescendedfromtheeasternhighlands intoSouthAfrica.FromthemsomeBushmenacquiredcattleandevolvedintothecultureoftheHottentots.Ref.83 [123] ForwardtoAfrica:0toA.D.100Section15.2 ChooseDifferentRegion 1.IntrotoEraSection14.1 2.AmericaSection14.9 3.CentralandNorthernAsiaSection14.5 4.EuropeSection14.4 5.TheIndianSubcontinentSection14.6 6.TheNearEastSection14.3 7.PacicSection14.8 14.3TheNearEast:100B.C.to0 3 14.3.1THENEAREAST BacktoTheNearEast:200to101B.C.Section13.3 DuringtheHellenisticeratheHimyaritesofsouthernArabiahadlosttheirchiefsourceofprosperitywhenpartofthe IndiantradewasdivertedthroughEgypt,butin24B.C.,theywerestillstrongenoughtodefeattheRomanGeneral 3 Thiscontentisavailableonlineat.

PAGE 223

211 Gallus,whohadbeensenttoconquerthemandtheinvadersweredrivenintothedesertwheremanydiedfromheat andthirst.TheNabataeankingdom,inpresentdaysouthernJordan,becamepowerfulatthistime,withacapitalat Petra.Amman,innorthernJordan,wasrstdestroyedandconqueredandthenrebuiltbytheRomans.Ref.176 [242] By78B.C.inJudeatheHasmoneanshadenlargedtheirrealmsothattheirterritorywasasextensiveasithadbeen underSolomon,buttherulersbegantolosetheirreligiosityandyieldedtoHellenizingelements.ToynbeeRef.221 [295]saysthattheJews'CanaaniteculturewasnotabackwardoneandwasprobablyequaltotheHellenicin achievement,butitwasdifferentinethosandtheHellenicwasthemorepotentandsoondominated. In63B.C.,however,JudeawasconqueredbyPompeyforRome.AshelaidsiegetoJerusalem,theJewishKing AristobulustookrefugeinthewalledprecinctsoftheTempleandheldoutforthreemonths.Whentheramparts nallyfell12,000Jewswereslaughtered,withsomeleapingtodeathfromthewalls.Nonesurrendered.Pompeyleft theTempleuntouchedbutexacted10,000talents$3,600,000fromthenationandtransferredallHasmoneancities totheRomanpower.HyrcanusIIwasmadehighpriestandnominalrulerofJudea,butasthewardofAnatipater theIdumean,whohadhelpedRome.TheindependentmonarchywasendedandJudeabecamepartoftheRoman provinceofSyria.HerodtheGreatbecamesubjectkingin37B.C.andusingRomanfunds,nancedalocalarmyto drivetheinvadingParthiansbackoutofthisterritory.HerodwasalsoanIdumeanandnotaJeweitherbyoriginor conviction 4 .Ref.48[72]He,likeotherrulersofhistime,hadloosemorals,tenwives,nineatonetime,metedout cruelpunishmentsandhadanHellenicleaning.ThePharisees 5 wereagainstHerodandbythetimehediedin4B.C. hewashatedbyallthepeople.Hisrealmwasdividedamonghisthreesons.OnourpresentcalendarJesusappearsto havebeenbornbetween7and4B.C.Ref.222[296] Therewereabout2,500,000peopleinPalestineinthiseraandmostofthemspokeAramic,althoughthepriestsand scholarsknewHebrewandtheofcialsandforeignersusedGreek.TherewasconstantstrifebetweentheJewsinthe interiorofPalestineandGentilesonthecoast,andtherewasstrifewithintheGreatCounciloftheEldersofIsraelwho ruledoverthepeopleforreligiousoffenses.ThehigherpriestsandSadduceeswereaconservativeelementholding forthewrittenlawoftheHebrewsTorahandthePhariseesandScribes 6 werealiberalelementvotingtoacceptoral traditionsaswellastheTorah.ThePsalmsofSolomonandtheBookofJoshuaEcclesiasticuswerewritteninthis century,althoughthelatterisnotacceptedbytheJews.Ref.48[72] DuringthiscenturySyriaandIraqbecameprimarilyabattlegroundbetweenthetwoformidableforcesoftheRomans inthewestandtheParthiansintheeast.AlthoughAntiochusVIIIandIXandSeleucusVIeachreignedbriey,in83 B.C.theshrunkenSeleucidKingdomwastakenoverbyArmeniaandtwentyyearslateritbecameaRomanprovince. Ref.222[296]PleaseseemapintheITALYsection,thischapter.AttheancientMesopotamiancityofCarrhae, justnorthoftheupperEuphrates,theRomanGeneralCrassusmettheParthiansandwasdefeatedandkilledbythe ShakabowmenoftheParthians'Surenally.Ref.28[48],8[14] TheParthianswereincontrolofIranandwereprettywellabletocontaintheRomansinSyriaontheirwesternank, buttheywerenowhavingadditionaltroublesontheirnorthernandeasternborders.In88B.C.TigranesIIofArmenia invadedParthia,overrunningfourvassalstates,reducingthesizeofParthiancontrolledterritory.Ref.222[296]In additiontheYue-chiandtheneighboringIranianShakahadalreadytakenBactriaandwerestartingtomoveintothe 4 TragerRef.222[296]claimsthatonthecontraryHerodconvertedtoJudaisminhisyouthandatthetimeofhisdeathwasrebuildingthe greatTempleatJerusalem.Hedoesnotgivethesourceofthisinformation 5 ThePhariseeswereagroupofJewishElders 6 TheScribeswerescholarsoftheLaw

PAGE 224

212 CHAPTER14.100B.C.TO0 MiddleEast,attackingeasternIran.ToholdofftheseattackstheParthiansusedverylarge,heavilyarmoredhorses andmenincavalryunitscalled"cataphracts",againsttheinvaders'light,nomad,bowcavalry. ASIAMINOR:ANATOLIA TURKEY WenotedinthelastchapterthatKingMithridatesIVofPontushadlaunchedanimperialisticcampaignwhichhad broughthimintocontactwiththedispleasedRomans. TheFirstMithridaticWarbrokeoutin88B.C.andMithridatessurgedoutofAsiaMinortotaketheCyclades,Thessaly, MacedoniaandThracebeforehewasstoppeddowninGreece,proper,bytheRomanSulla.Thekingwasgivena lenientpeaceandreturnedtoPontustoraiseanotherarmyandeet.TheRomanlegateinAsia,Murena,realizing thatthekingwasrearming,attackedPontusintheSecondMithridaticWarbetween83and81B.C.,butwasdefeated. TheRomansreturnedtotheattackintheThirdMithridaticWarof75to63B.C.andthistimeallAsiaMinorbecame Roman.WellsRef.229[307]statesthat 100,000RomanItaliansweremassacredduringthiswar.TheRomanconquestwascompletewhenKingNicomedesIII gavehiscountryofBithyniatoRomein75B.C.About350milessouthofpresentdayAnkarawasthesmallcountry ofCommagene,ruledbyCeniochusI,whoclaimeddescentfrombothGreekandPersiankings.Hehadcolossal statuesmade,includingoneofhimself,andsomeofthesethirtyfoothighconstructionshavesurvivedearthquakes, stormsandwars,remainingerectatthepresenttime.Ref.229[307],176[242] ARMENIA TigranestheGreat,actuallyason-in-lawofMithridates,unitedArmeniaonceagainin95B.C.andaddedterritory fromSyriaandCappadocia,makingArmeniathemostpowerfulnationinwesternAsia.By70B.C.hisempire extendedfromtheAraratValleytothePhoeniciancityofTyreontheMediterraneancoast,muchofthisterritory havingbeentakenfromtheParthians.By66B.C.,however,TigraneshadfallenintothehandsofPompeyasthelatter wasdrivingMithridatesofPontustotheeasternedgeoftheBlackSea.ThereaftertheArmeniankingruledmerely asavassalofRome.Ref.222[296]BytheendofthecenturywhenemissariesoftheHanDynastyofChina reachedtheeasternshoresoftheCaspianSea,theyfoundonlystoriesofacivilizationthathadreceded.Thememory ofAlexanderremained,butofRomemenknewonlythatPompeyhadcometothewesternshoreoftheCaspianand thengoneawayandthatCrassushadbeendestroyed. ForwardtoTheNearEast:0toA.D.100Section15.3 ChooseDifferentRegion 1.IntrotoEraSection14.1 2.AfricaSection14.2 3.AmericaSection14.9 4.CentralandNorthernAsiaSection14.5 5.EuropeSection14.4 6.TheFarEastSection14.7 7.TheIndianSubcontinentSection14.6 8.PacicSection14.8

PAGE 225

213 14.4Europe:100B.C.to0 7 14.4.1EUROPE BacktoEurope:200to101B.C.Section13.4 ThiswasthecenturywhenRomegainedcontrolofmostoftheMediterranean.AugustustooktheCycladesand conqueredCretein68-67B.C.andCyprusin58.RhodeswasalreadyunderRomanjurisdiction.Ref.38[59] GreecebecameabattlegroundforseveraldifferentcampaignsincludingtheFirstMithridaticWarwhenthePontus kingwasstoppedonlyafterhehadgottenwelldownintothispeninsula.Athens,whichhadallieditselfwithMithridates,haditsprosperitycometoanendwhenitwassackedbythetroopsoftheRomanSullain87and86B.C.. AftertheseabattleofActiumof31B.C.inwhichAntonyandCleopatralosttoOctavian,Romelegallyaswellas effectivelyheldthewholeofAlexander'sheritageinthislandandGreecebeganareignofpeaceasanintegralpartof theRomanEmpire.TheislandofDeloshadnowbecomethecenteroftheAthenianworldandservedasthegreatest tradingcenterforslavesinthecivilizedworld. ThebasicpopulationofthisarearemainedCelticandasafrontieroftheRomanEmpireitservedasabattlegroundfor theRoman-Celticconicts,aswellaspartoftheFirstMithridaticWar.ThesouthernIllyrianswerenallyconquered bytheRomanAugustusbetween35and34B.C.TheKingdomofThraceremainedintactandnorthofthisthelarge DacianKingdomalsokeptitsindependenceintheareaofRomania.TheGreekscalledthesepeople"Getas". AsthecenturyopenedtherewasstillsomeindecisionastotheactualscopeandpowerofRomeovertheremainder oftheItalianpeninsula.In91B.C.therewasonenalwarbetweenRomeandherneighborsovertheideaofaunited ItalyandthescopeoftheruleoftheRomanSenate.ItendedbythepracticalsurrenderoftheSenatetotheconcept ofreformwhichallowedthereafterallItalianstobecomeRomancitizensbydecree.TheclassicalLatinlanguage emergedabout100B.C.aftersomeimprintsfromthelanguagesofAsiaMinor,theBalkansandGreeceandthis classicaltonguethenheldswayforabout300years. Onthegovernmentscene,whileSullawasinAsiaMinorandtheBalkans,theconsulsCinnaandMariushadinstituted areignofterror,dissolvedtheSenateandruledwith"ironhands"untilMarius'death.WhenSullareturnedhemade himselfadictatorandwhilerestoringlawandorderandtheSenatetopower,hedesolatedlargepartsofItaly,executing over5,000people.Hetriedtoestablishapermanentlyaristocraticconstitutionbutthiswasfollowedbyallsortsof complications.AmongthesewastherevoltoftheslavesunderSpartacusin73B.C.,justafterSulla'sdeath.Theslaves heldoutinsouthernItaly,usingVesuvius'craterforatimeasafortressbutwhentheywereatlastcapturedaftertwo yearsbyCrassusandPompeysome6,000werecruciedalongtheAppianway.Thetwogenerals,formercroniesof Sulla,hadrisentopowerthroughseparateandoriginallyconictingways.GnaeusPompeius,afterprevailingupon SullatogivehimthetitleofMagnusTheGreat,wonprominencebysubduingthetraitorQuintusSertorius,whoas agovernorofSpainhadattemptedtosetupaseparatistregimeofhisowninthatprovince.Crassus,inadditiontohis victoryovertheslaves,hadmadehimselffabulouslywealthythroughvariousandsundryunscrupulousdealsandnow thetwomenunitedtoundueSulla'sconstitutionandhadthemselveselectedconsulsin70B.C.Thiswastheeraof MarcusTulliusCicero,alawyerwhohadashisfondestdesiretobeacceptedintotheinnercircleoftheSenatorialclass 7 Thiscontentisavailableonlineat.

PAGE 226

214 CHAPTER14.100B.C.TO0 andhiswholecareerwasgearedtothataim.ByprosecutingoneofthecorruptprovincialgovernorsCicerogaineda praetorshipandarisetopower.MeanwhilePompeygainedstillmoreesteembyconqueringtheCilicianandCretan pirateswhohadbeenpreventingnormalseacommerceintheMediterraneananddisruptingthegreatslaveemporium atDelos.Soon,therefore,withCicero'shelp,Pompeywasgivenabsolutepoweroverbothlandandseaforcesthrough theentireempire.ItwasthenthathewenttoreorganizetheentireNearEast.Whenhereturnedafterseveralyears involvementintheMithridaticwars,organizingAsiaMinorandSyriaandconqueringJerusalemheallegedlybrought backsometwomillionslaves.Ref.213[288] GaiusJuliusCaesarwastheyoungestrulerofthelateRepublic.By58B.C.hehadbeenahighpriest,staffofcer, nanceminister,militarygovernor,senatorandconsul.Hehadmarriedthreetimes,hadcountlesslove-affairs,led campaignsandbeeninvolvedinvariousintrigues 8 .Asheascendedtheladderofpoliticalpowerhisofcesentailed enormousexpensesandthisgothiminvolvedwiththemulti-millionaire,Crassus,fromwhomhehadtoborrowlarge sumsofmoney.AfteraperiodasgovernorofSpain,CaesarreturnedtoRometojointhepowergroupofCrassusand Pompey. AlthoughmeetingsomeoppositionintheSenateledbyCatotheYounger,afollowerofGreekidealsandstanding foranhonestnancialpolicyingovernment,Caesar,CrassusandPompeyformedanextra-legalcoalitioncalled"the FirstTriumvirate".Eachsoonwenthisseparateway,however,withCaesarconductinghisvictoriouscampaignsin Gaul 9 ,GermanyandBritain,thenreturningtotakecontrolofRome,overPompey'sobjections.Thiswasfollowedby avictorioustriptotheMiddleEastinSyriaandEgypt.WhenCaesarthenreturnedtoRometherewasgreatination andthe"annona",orfreegraindistributionfromthepublicgranarieswasexcessive.Evenby71B.C.some40,000 adultmalecitizenshadbeenreceivingfreegrain,andinthenextdecadesitincreasedgreatlysothatCaesarthought hedidwelltocutbackto150,000free-loaders. MeanwhileCrassushadobtainedcommandoftheeasternforcesandpreparedtoemulatethegloriesofLucullusand PompeyinAsiaMinorandArmenia,butCrassusranintotheParthians.TheseerceIranians,perhapswithTuranian Mongolianmercenaries,killed20,000RomansoldiersalongwithCrassusandcaptured10,000moreattheBattleof CarrhaeB.C.inSyria.TheholdoftheRomansonMesopotamiawasneververysecure. AfterCrassus'deathCaesarandPompeyfacedeachotherasantagonistsandasthemonthswentbydenitelines ofbattleandforcesweredrawnupandactualcivilwarfollowed.CaesarsoonwoncontrolofallItalyandgained Sardinia,SicilyandNorthAfrica.AfterdefeatingPompey'sforcesatIlerdainSpainhereturnedtoRometobemade dictator.PompeyedtotheeastwherehebuiltupaloyalmilitaryestablishmentbutallfornaughtasCaesarcaught uptohiminThessalyin48B.C.anddefeatedhim.PompeyedtoEgyptonlytobeassassinatedbytheteen-aged PtolemyXIII.Afterhavingbeenmadedictator"forlife"bytheSenatein45B.C.,Caesarwasassassinatedby"friends" towhomhisdivineaspirationswereintolerable.TheextentoftheRomanRepublicatthedeathofCaesarisshownin themapbelow. NOTE:InsertMap28:THEROMANREPUBLICATTHEDEATHOFCAESAR MarcAntony,whohadsharedaconsulshipwithCaesar,consideredhimselfthesoleheirofCaesarandhe,withthe latter'snephew,GaiusJuliusCaesarOctavianuslaterOctavianandMarcusAemiliusLepidus,whohadfollowed Sullaasconsul,alltogetherformedtheSecondTriumvirate.Publiclythepurposeofthisassociationwastoavenge thedeathofCaesarbutactuallyitmerelysetuppowerbasesforAntonyandOctavian.Inevitablytheycouldnotabide eachotherandthequarrelsterminatedwiththeBattleofActiumofftheGreekcoastin31B.C.withOctavianwinning andsubsequentlyrulingaloneasemperor,calledAugustus.Thepeopleacceptedhisdictatorshipbecausetheyhad beenfaringsopoorlyundertheprevioussenatorialoligarchy.Areignofpeace,another"GoldenAge",resulted. BeforethistimetheRomanshadraisedarmiesonlyforspecictasks,disbandingthemafterthemissionwasaccomplished,butAugustuscreatedastandingarmyof25legionswiththeequivalentofanother,thePraetorianGuard, 8 TheseremarksaboutCaesarweretakenalmostverbatimfromHermRef.91[135],page164 9 ThereaderwillndsomeinterestingmaterialregardingthedifcultiesofCaesar'sconquestsoftheGaulsundertheheadingofWESTERN EUROPE,inthissamechapter

PAGE 227

215 inItalyashispersonalprotection.Oftheothers,8legionswerestationedalongtheRhine,3alongtheDanubein theBalkanarea,4intheYugoslavterritory,4inSyriaandLebanon,2eachinEgyptandPortugal,andoneeachin northernSpainandCarthage.Eachlegioncontained5,000mendividedinto10cohortsof480each. Inspiteofthe"GoldenAge",thereliefroleshadagainbuiltupinRometo320,000sothatjustunderone-thirdofthe populationhadtoreceivefreegovernmentgraintoexist.Ittooksome14millionbushelsofgraineachyearjustto supplythecityitselfwhere1,500,000citizenslived,housedinsome46,600insulaeapartmentblocksthreetoeight storieshigh,madeofwood,rubbleandbrick.Windowsweresimplywallopeningsandwerecoveredwithshutters orhangings.Onlytherichhadwellsortapsintothecityconduits;therestgotwaterfrompublicfountains.There werepubliclavatoriesandtoiletreceptacleswhichwerefrequentlyemptiedintothestreet.Menialworkwasdoneby about2,000,000slaves,amiddleclasscitizenowningabouteightwhiletherichmighthaveuptoonethousandand anemperortwentythousand.Slavesmadeup35%ofthepopulationofItaly.Ref.249[98]Livystatedthatitwas commonforRomanoratorstostatethat"Jews,Syrians,Lydians,Medes,indeedallAsiaticsareborntoslavery" 10 HorseswereoflittleuseasasourceofenergyinthisRomanperiodastheywerebadlyharnessedwiththeyoketending tothrottlethemandtheycoulddrawonlyalightload.Fourslavescoulddoasmuch.Engineersdidmanagetochange waterwheelstotheverticalpositionandaddgearswhichgreatlyincreasedtheirefciencyforturningmill-stones. Ref.260[29] NOTE:INSERTMap30:ROME100B.C. HellenicculturecontinuedtopourintoRomeandliteratureandarttooknewdignity.Cicero,Catullus,Virgil,Horace andLiviusthehistorian,alltranslatedandadjustedGreeklearningtotheLatintongue.Agreatphilosophicalpoem, givingtheviewsofDemocritusandEpicuruswaswrittenbyLucretius,theRomanEpicurean,duringthiscentury. ThewealthyhiredGreeknursesandteachersfortheirchildren.TheRomanphysiciansofthisperiodwerechiey GreeksoratleastGreek-trained.Asclepiades,originallyofBithynia,developedahighreputationasaphysicianand wasafriendofCiceroandLucretius.HeabandonedtheoldHippocratesdoctrineofthefourhumorsandfeltthatthe physician,notnature,cureddisease.MostRomanpractitionerswereeitherfreedmenorslaves.Ref.48[72],21 [34],1[2],28[48],136[187],125[173],185[253],91[135] LuciusLiciniumLucullus,oneoftheRomangeneralsintheThirdMithridaticWar,iscreditedwithbringingthecherry intoEuropefromthe-shoresoftheBlackSea.EveryRomanaswellaseveryGreekhadhisbeehives,ashoneywas theonlysweeteningcommonintheWest.Indiancanesugarwasmoreexpensiveandtherawcanewasactuallyless tastythanhoney,sotherewasnoattempttoimportit,exceptformedicinalpurposes.Ref.48[72],122[170] TherewasnowapredominanceofGermanictribesintheareaofpresentdayGermanyandCaesarandtheRomans neveractuallypenetratedthatareaalthoughRomanmerchantsandtradersdidappearwithgoodstotradeforfurs andslaves.AstheGermanictribescamesouththeirrstencounterswerewithCelts,butwhethermuchghting wasinvolvedornotisunknown.ActuallytheGermanswereverylittledifferentfromtheCelts;theirreligionsand theirlanguageshadcommonorigins.TheRomanssaidtheGermanswereratherblonder,butotherwiselittlephysical distinctionwasmade. DrususconqueredtheBavarianregionforRomefromtheCeltsin15B.C.andRhaetia,whichincludedpartsof southernBavariaalongwiththeTyrolandeastSwitzerland,wasestablishedasaRomanprovincelateinthecentury. HavingconqueredtheCelticCimbriandTeutonescomingdownattheedgeofItalyandAustria,theRomansnow squeezedtheCeltsoutofAustriaandconsolidatedtheirauthorityalongtheDanubecleartoBudapest.Someofeastern 10 AsquotedbyFinleyRef.249[98],page119.

PAGE 228

216 CHAPTER14.100B.C.TO0 presentdayHungaryappearedtobeapartoftheKingdomofDacia,whichheldoutagainstRomancontrolforanother century. TheCelticBoiipeople,forwhomBohemiawasnamedweredrivenoutofBohemiaatthistimebytheGermanictribes descendingfromthenorth. AsnotedaboveeastSwitzerlandwasincludedintheRomanprovinceofRhaetia.ThecrowdedHelvetiiaroundLake Neuchatelbeganamigrationwestwardwithcattleandwagons,leaving400villagesandthousandsofhomesteads. FearingathreattoherMediterraneancoastalprovince,RomesentCaesarnorthtointercepttheHelvetiiandthishe didastheypouredthroughagorgeleavingtheLakeGenevaarea.Of368,000Helvetii,only110,000gotbackto SwitzerlandastheRomansretainedcontrolofthearea.Ref.194[266] BothoftheseareascontinuedaspartoftheRomanEmpire.IthasbeennotedunderITALYabovethatJuliusCaesar wassenttoSpainin59B.C.tosuppresstheguerrillawarfareandhedidgetsomehelpfromlocalgroups.Itwasstill later,however,afterhehadbeengivenGaulintheFirstTriumviratethathebecamelockedinapowerstrugglewith PompeyandreturnedtoSpain,defeatingPompey'ssoninthegreatbattleofMundanearCordobain45B.C.,thereby gainingmasteryoftheworld.TheIberiansthenadoptedtheRomanlanguageandculture.Ref.196[269] GaulFrancewasstillessentiallyCelticandCaesar'sconquestsbegantheLatinizationofthecountryandhelpedto containtheTeutonicpeopletotheeastoftheRhine.Thecurly-headedParisii,aCeltictribeconsistingofshermen andnavigators,settledaveacreIledelaCeteintheriverwhichisnowinthecenterofParis.TheBataveGermanic tribesettledintheRhinedelta,nowknownastheNetherlandsabout14B.C.andtheyandtheFrisiansbecamethe ancestorsofthemodernDutch.Ref.175[241] AfterJuliusCaesarmassacredtheSwiss,asnotedinaparagraphabove,heproceededinthenexteightyearsto"pacify" allofGaul,takingsomeeighthundredtownsandkilling,byhisowncount,1,292,000men,womenandchildren.He mayhaveenslavednearlyanother2,000,000.In55B.C.Caesarexperiencedanddescribedthegreatestnavalbattle thathehadeverbeencalledupontomount 11 .HisopponentsweretheCeltsofBrittanyandtheiralliesfromBritain, whohadnolessthan220ships,alllargerthanandsuperiorinconstructiontothoseoftheRomansunderAdmiral Rutus.Thesevessels,whichtoweredovertheRomangalleys,hadthecapabilityofcrossingtheAtlanticBarryFell's conceptandwereapparentlyundertheleadershipoftheVenetiofArmoricawiththeirallies,theCuriosolites,the VenellioftheChannellIslandsandCherbourg,theNamnetesandLexoviiofNormandy.Thehigh-bowed,graceful shipspropelledbythewindwereonlydefeatedwhentheRomanshurledfalcesintotheriggingoftheCelticvessels, thenrowingaway,tearingouttherigging.Thengrapplingironswerethrownandthe200menineachtriremewould boardtheCelticvesselandinhand-to-handcombattheynallywon.Ref.194[266],65[96] NOTE:InsertMap27:GAULINCAESAR'STIME OnlanditrequiredagreatengineeringfeatforCaesar'slegionstobreachthe"murusgalliciul",abox-likegridof timberslledwithrubbleandstonethatsurroundedtheCelttownofAvaricumpresentBourges,inthecenterof Franceandthenslaughterthe40,000peoplewithin.TheGaulsatlastralliedbehindayoungchief,Vercingetorix, whorsthadhispeopleburntheireldsandtownsastheyretreatedsothattheRomantroopscouldnotliveoffthe 11 AccordingtoBarryFellinAmericaB.C.Ref.65[96],Caesardescribedthisseabattlein"DeBelloGallico"

PAGE 229

217 land,andthenheinitiatedguerrillawarfaretocutoffnewsuppliestotheRomantroops.Vercingetorixwasnally corneredinthehillsofeastern,centralFrancebehindsomefortications.Caesarfurthersurroundedthesewithnine andahalfmilesofforticationsofhisowntotryandcontaintheCelticchieftain.EventhenVercingetorixslippedout somecavalrybynightandhadthemgatheranadditionalquarterofamillionGaulsfromsomefortydifferenttribes. IntheinterimCaesarhadbuiltstillanothercircleofforticationsfourteenmilesincircumference,facingoutwardto meettheGallicreinforcements.Fordaysthebattlesraged,withthemethodicalbutcheryofthe40,000legionnairesof Romenallyprevailing.VercingetorixemergedalonefromthefortofAlesia,surrenderedandwastakenprisonerto RomewherehewasparadedthroughtheForumandnallystrangledtodeathsomesixyearslater.Caesarallegedly obtainedenoughslavesafterAlesiatogiveonetoeachofhislegionaires.ThecourseofGalliccivilizationwasall down-hillfromthistimeon.Ref.194[266],91[135],213[288] TheBelgictribeswerethelastofthesuccessivewavesofCeltsintoBritain.Theywereapeopleofchariotsandhorses whointroducedacoinageofsilverandcopperandestablishedthemselvesasatribalaristocracy.TheBelgiccapital wasColchester.ThemostancientletteringknowninBritainistobefoundontheBelgiccoins.Thistribeseemsto havebeenamixtureofCelticandTeutonicoriginfromtheregionofthelowerRhine.Theirnewcountryproduced corn,cattle,gold,silver,iron,hides,slavesandhuntingdogs.CaesarcrossedthechannelstartingatmidnightAugust 26,55B.C.with80transportsforhislegions,experiencingconsiderabletroubleinsodoing,withthelossofsome shipsandmen.HewonafewvictoriesovertheBelgaeundertheirleader,Cassivellaunus,buthastilydepartedEngland beforewintersetin.Ref.43[64],91[135] ScotlandandIrelandwereprobablynotyetinvolvedinthesenewinvasionsandremainedessentiallyasinthelast century. AccordingtoTacitus,writingaboutA.D.100,SwedenintherstcenturyB.C.wasdominatedbytheSuioneTeutonic tribe.ScandinaviawasneverenteredbytheRomans,althoughtradewascarriedonwithDanishamber,furandvarious slavesexchangedforseveralRomanproducts,includingwinesandsomeironobjects. InthisandthepastcenturytheGermanicGothshadappearedaroundSwedenandtheBalticSeaandstartedmigration downintonortheasternGermany.JusttotheeastofthemweretheFinno-UgricspeakingEstoniansandjustsouthof theminthePolishareaandextendingintomiddleRussiawereSlavs.InsouthernRussiatheSarmatianswereinthe ascendancyandtheyspreadoutwelltotheeasttotheCaspian. ForwardtoEurope:0toA.D.100Section15.4 ChooseDifferentRegion 1.IntrotoEraSection14.1 2.AfricaSection14.2 3.AmericaSection14.9 4.CentralandNorthernAsiaSection14.5 5.TheIndianSubcontinentSection14.6 6.TheNearEastSection14.3 7.PacicSection14.8

PAGE 230

218 CHAPTER14.100B.C.TO0 14.5CentralandNorthernAsia:100B.C.to0 12 14.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:101to0B.C.Section13.5 InthenorthChina,underEmperorWu-ti,againtooktheoffensiveagainsttheHsiung-nuandrebuilttheoldCh'in wall,thenopeneduptheroutetocentralAsia,extendingcontrolovertheoasisstatesoftheTarimBasin.In44B.C. Wu-tidefeatedtheHsiung-nualongtheborderandpushedthemwestwheretheyedtotheLakeBakalregionalready occupiedbytheYue-chi.ThelatterwerethenpushedwestandsouthtotakeoverBactriaandconfronttheParthian EmpireofPersia.ThelastdefeatoftheHunsHsiung-nubytheChinesemilitaryforcescamein36B.C.whenan expeditionaryforcecompletelybrokeuptheAsiatic'spower.Ref.136[187],8[14] AtthebeginningofthecenturytwoGreekprincipalitiesremainedjustsouthofthecentralAsianMassiveandsouth ofthem,extendingintopresentdayPakistanweretheIranianSakasintheeastandtherelatedIranianSurenKingdom tothewest.AboutthemiddleofthecenturythelatterinvadedtheIndusValley,breakingthepoweroftheSakas anddeposingthelastoftheIndo-Greekprinces.AtaboutthesametimetheHunsalsorecoveredandbegantomore southagainagainsttheGreaterYue-chiKushans,thenoccupyingtheentireregionbetweentheOxusandtheJaxartes rivers,andsoonextendingthroughtheirSurencousins,theircontroldowntheIndusinpresentdayPakistan.Inthis eraTibetwasclosertoIndia,culturally,thantoChinaorotherAsiancenters.Ref.136[187],8[14] ForwardtoCentralandNorthernAsia:0toA.D.100Section15.5 14.6TheIndianSubcontinent:100B.C.to0 13 14.6.1THEFAREAST BacktoTheIndianSubcontinent:200to101B.C.Section13.6"Former"HanDynastycontinued AtitspeaktheHanEmpireunderWu-Tiwasexceedinglyprosperous,rivalingRomebothinsizeandwealth.The capitalcityCh'ang-anhad250,000inatotalempirepopulationofabout57,000,000.WhiletheprogressofmechanizationwasimpededinGreeceandRomebythenumberofavailableslaves,Chinahadtoomanyefcientcoolies. Ref.260[29]WenotedabovethatWu-TiexpandedintotheTarimBasininthewestbydefeatingtheHsiung-nu andthispursuancecontinuedevenafterWu-Ti'sdeath.In51B.C.thechieftainofthesouthernHunscametoCh'angantosubmitasanHanvassal,whilethenortherngroupcontinuedtobechasedfarwestwardintoSamarkand,there tobenallydefeatedbyave-prongedHanforcein36B.C.ButinChinapropertheeconomiccontrolslapsedand nepotismandcronyismresultedinthelossoftheimperialfamily'spower. Atypeofnationaluniversityhadcomeintoexistencetopreparemenforbureaucraticcareersandbytheendofthe centurytheenrollmenthadreached3,000.IntheHanmilitiasystemallmalesregisteredformilitaryserviceat21years ofageandwereeligibleforservicebetweentheagesof23and56years.Allegedlyeverymalewastohavemilitary serviceinhishomecountyonemontheveryyearandoneyearofcontinuousservicesometimeinaguardunit,but soonapracticeofpayingpoorermentoserveone'stimebecamestandardpractice.Inadditiontousingcowrieshells ascurrency,coppercoins,latercalled sapekes bytheEuropeans,cameintouse.Bothofthesecompetedwithsaltand grainasamediumofexchange.Ref.260[29]InthiscenturytheChinesedrilleddeepholes,presumablyforwater, inSzechwanandtheirdrillingmethodswerecopiedcenturieslaterintheUnitedStates.Ref.213[288] InearlyChinathelawsrequiredpunishmentsandtorturethatequaledthatseeninEuropeatamuchlaterperiod. Deathpenaltieswerecarriedoutbybeheadingorbychop-pingtheoffenderintwoatthewaist.Incasesoftreasonor 12 Thiscontentisavailableonlineat. 13 Thiscontentisavailableonlineat.

PAGE 231

219 someequallyseriouscrime,alltheoffender'srelativesmightalsobeputtodeath.Lesseroffendersmightsimplybe mutilatedbytattooing,amputationofnoseorfeetorcastration.Imprisonmentwasrare,buthardlaborongovernment constructionwasusedforminoroffenders.InEmperorCh'eng'sreign-7B.C.authoritywasdelegatedtohis mother'sfamily,theWangclan.Ssu-meCh'ienwasagreatChinesehistorianofthisera.Ref.8[14],101[146] InManchuriaanewstateofKoguryowasfoundedinthiscenturyandsoonalsoincludednorthernKorea. TheYayoishikiCulturecontinuedintothiscenturywithricecultureappearingabout100B.C.Animismandtotemism, sexandancestorworshipsatisedthereligiousneedsoftheseearlyJapanese.Outofthelatterworshipcametheoldest ofciallivingreligionsofthenation-Shinto.Thisfaith,calledtheWayoftheGods,tookthreeforms;thedomestic cultoffamilyancestors,thecommunalcultofclanancestorsandthestatecultoftheimperiallinewithitsfounding gods. AMongoliancastawaygrouponKyushumultipliedsorapidlyasfarmersthattheytookoverallthearablelandonthe islandandwhilesomeoftheaboriginesbecameserfs,otherstooktothehillsfromwheretheycontinuedtoraidthe farmersforcenturies.ThenewKyushucommunitywasorganizedasalooseconfederacyofvillages,eachruledby itsownmatriarchorfertilitymother,andthewomanleaderofthemostpowerfultownwascalledthe"SunGoddess". EarlyChinesetraderscalledher"Pime-ko",or"Hime-Ko",meaning"SunshineChild".Ref.213[288],136[187], 12[21]Inanattempttoobtainmoresea-foodtofeedtheexpandingpopulation,agreatship-buildingeffortwas madein81B.C.Ref.222[296] MostofKoreawascontrolledbytheHanChineseatthistime,butthenorthernportionwasalliedwithManchuriain thenewstateofKoguryo. AlreadycontrollingNorthVietnam,theChinesenowaddedcentralVietNamtotheirterritorywhichtheywereto maintainforcenturies.Noothersignicantchangesoccurred. ForwardtoTheIndianSubcontinent:0toA.D.100Section15.6 ChooseDifferentRegion 1.IntrotoEraSection14.1 2.AfricaSection14.2 3.AmericaSection14.9 4.CentralandNorthernAsiaSection14.5 5.EuropeSection14.4 6.TheNearEastSection14.3 7.PacicSection14.8 14.7TheFarEast:100B.C.to0 14 14.7.1THEFAREAST BacktoTheFarEast:200to101B.C.Section13.7 14 Thiscontentisavailableonlineat.

PAGE 232

220 CHAPTER14.100B.C.TO0 AtitspeaktheHanEmpireunderWu-Tiwasexceedinglyprosperous,rivalingRomebothinsizeandwealth.The capitalcityCh'ang-anhad250,000inatotalpopulationofabout57,000,000.Whiletheprogressofmechanization wasimpededinGreeceandRomebythenumberofavailableslaves,Chinahadtoomanyefcientcoolies.Ref.260 [29].WenotedabovethatWu-TiexpandedintotheTarimBasininthewestbydefeatingtheHsiung-nuandthis pursuancecontinuedevenafterWu-Ti'sdeath.In61B.C.thechieftainofthesouthernHunscametoCh'ang-anto submitasanHanvassal,whilethenortherngroupcontinuedtobechasedfarwestwardintoSamarkand,theretobe nallydefeatedbyave-prongedHanforcein36B.C.ButinChinapropertheeconomiccontrolslapsedandnepotism andcronyismresultedinthelossoftheimperialfamily'spower. Atypeofnationaluniversityhadcomeintoexistencetopreparemenforbureaucraticcareersandbytheendofthe centurytheenrollmenthadreached3,000.IntheHanmilitiasystemallmalesregisteredformilitaryserviceat21years ofageandwereeligibleforservicebetweentheagesof23and56years.Allegedlyeverymalewastohavemilitary serviceinhishomecountyonemontheveryyearandoneyearofcontinuousservicesometimeinaguardunit,but soonapracticeofpayingpoorermentoserveone'stimebecamestandardpractice.Inadditiontousingcowrieshells ascurrency,coppercoins,latercalledsapekesbytheEuropeans,cameintouse.Bothofthesecompetedwithsalt andgrainasamediumofexchange.Ref.260[29].InthiscenturytheChinesedrilleddeepholes,presumablyfor water,inSzechwanandtheirdrillingmethodswerecopiedcenturieslaterintheUnitedStates.Ref.213[288] InearlyChinathelawsrequiredpunishmentsandtorturethatequaledthatseeninEuropeatamuchlaterperiod. Deathpenaltieswerecarriedoutbybeheadingorbychoppingtheoffenderintwoatthewaist.Incasesoftreasonor someequallyseriouscrime,alltheoffender'srelativesmightalsobeputtodeath.Lesseroffendersmightsimplybe mutilatedbytattooing,amputationofnoseorfeetorcastration.Impriconmentwasrare,buthardlaborongovernment constructionwasusedforminoroffenders.InEmperorCh'eng'sreign-7B.C.authoritywasdelegatedtohis mother'sfamily,theWangclan.Ssu-meCh'ienwasagreatChinesehistorianofthisera.Ref.8[14],101[146]. InManchuriaanewstateofkoguryowasfoundedinthiscenturyandsoonalsoincludednorthernKorea. TheYayishikiCulturecontinuedintothiscenturywithricecultureappearingabout100B.C.Animismandtotemism, sexandancestorworshipsatisedthereligiousneedsoftheseearlyJapanese.Outofthelatterworshipcametheoldest ofciallivingreligionsofthenationShinto.Thisfaith,calledtheWayoftheGods,tookthreeforms;thedomestic cultoffamilyancestors,thecommunalcultofclanancestorsandthestatecultoftheimperiallinewithitsfounding gods. AMongoliancastawaygrouponKyushumultipliedsorapidlyasfarmersthattheytookoverallthearablelandonthe islandandwhilesomeoftheaboriginesbecameserfs,otherstooktothehillsfromwheretheycontinuedtoraidthe farmersforcenturies.ThenewKyushucommunitywasorganizedasalooseconfederacyofvillages,eachruledby itsownmatriarchorfertilitymother,andthewomanleaderofthemostpowerfultownwascalledtheSunGoddess. EarlyChinestraderscalledherPime-ko,orHime-Ko,meaningSunshineChild.Ref.213[288],136[187], 12[21].Inanattempttoobtainmoresea-foodtofeedtheexpandingpopuations,agreatship-buildingeffortwas madein81B.C.Ref.222. MostofKoreawascontrolledbytheHanChineseatthistime,butthenorthernportionwasalliedwithManchuriain thenewstateofKoguryo. AlreadycontrollingNorthVietnam,theChinesenowaddedcentralVietNamtotheirterritorywhichtheywereto maintainforcenturies.Noothersignicantchangesoccurred.

PAGE 233

221 ForwardtoTheFarEast:0toA.D.100Section15.7 ChooseDifferentRegion 1.IntrotoEraSection14.1 2.AfricaSection14.2 3.AmericaSection14.9 4.CentralandNorthernAsiaSection14.5 5.EuropeSection14.4 6.TheIndianSubcontinentSection14.6 7.TheNearEastSection14.3 8.PacicSection14.8 14.8ThePacic:100B.C.to0 15 14.8.1THEPACIFIC BacktoThePacic:200to101B.C.Section13.8 TruePolynesiansprobablycolonizedtheHawaiinIslandslessthan2,000yearsagobutpossiblyinthisrstcentury beforeChrist.SimilarlytheMarquesasandSocietyIslandswerepossiblyreachednearthebeginningoftheChristian erabutintheabsenceofmoreprecisedatingweshallpostponefurtherdiscussionofthisdebatableissueuntilthe 4thcentury.Asindicatedinpreviouschapterstheseislandswerealreadyinhabitedeitherbyanearlierwaveacross thenorthernPacicfromtheNewGuinearegionorfromAmerica.PotsherdshavebeenexcavatedintheMarquesas groupandonislandsnearFijiandtheyareofaSouthAmericannotaMelanesiantype.Thecottonplantthehybrid 26chromosometypefromMexicoandPeruspreadfromtheGalapagosIslandstoFijibutnofarther. ShardsofpotteryhavebeenfoundontheGalapagosofftheSouthAmericancoastdatingto2,000yearsago,but whetherthismeansapermanentsettlementormerelythatsomeshipshadtakentemporaryrefugethereisunknown. Ref.176[242],95[140] ForwardtoThePacic:0toA.D.100Section15.8 ChooseDifferentRegion 1.IntrotoEraSection14.1 2.AfricaSection14.2 3.AmericaSection14.9 4.CentralandNorthernAsiaSection14.5 5.EuropeSection14.4 6.TheFarEastSection14.7 7.TheIndianSubcontinentSection14.6 8.TheNearEastSection14.3 14.9America:100B.C.to0 16 14.9.1AMERICA BacktoAmerica:200to101B.C.Section13.9 15 Thiscontentisavailableonlineat. 16 Thiscontentisavailableonlineat.

PAGE 234

222 CHAPTER14.100B.C.TO0 AllacrossnorthernCanadaasfarnorthasEllesmereIslandandnorthernGreenlandanddowntothenorthernshores ofHudsonBayandtheeastsideoftheUngavaPeninsula,theDorsetpeoplecontinuedtothrive.Theycarvedgures ofanimalsfromwalrus'stusksandbone,decoratingthemwithpeculiaroutermarkswhichSchledermannRef.189 [259]hascalledanoutlineofanimals'skeletons.Inthepicturesheshows,however,ithardtoidentifytrueskeletal structuresandthemarksaremorereminiscenttothiswriterofthelunarnotationsofancientEuropeansdescribed previouslybyMarchack.Ref.139[192]ThenorthwestAmericanIndiansoftheCanadianwaterwayscontinuedin activeexistenceatthistime. AccordingtoBarryFell'soriginalhypothesisNorthAmericantradefromsouthernEuropeceasedaftertheconquest ofBrittanyB.C.andtheBattleofActiumB.C.becausetheRomanshadnonavyandneedednoneandthe memoryofAmericawaslost 17 .Inhislatestbookof1980,however,FellRef.66[97]revisesthismarkedly,having allegedlyrecentlybeendelugedwithndingofEuropeanRomancoinsandrockinscriptionsinagreatvarietyof placesinNorthAmerica.RockengravingswhichhebelievestobecopiesofmultiplecoinsmintedlocallyinSpain about20B.C.inimitationofRomancoinsofthesameeraandbearingportraitsofCaesarAugustus,havebeenfound atCastleGardens,Wyoming.FellisconvincedthatthisWyomingsitewasactuallyanearlybankandcenteroftrade withcustomersusingCeltiberianGaedelicastheirmainlanguage.HehypothesizesthatpeopleofWyomingtraded withCeltiberiansandtheirIndianwives,afterthelatterhadmigratedacrossthecontinentfromNewEnglandtoBritish ColumbiaandthentonorthwestUnitedStates.WestArkansasandOklahomahavealsoyieldedcoinswhichseemto tintothissamecategory.Lackingfurtherconrmation,thereadermaymakehisowninterpretation. InthecentralandeasternUnitedStatestherewascontinuedHopewellexpansionwithadistinctiveritualandartistic tradition,probablyindicatingalooselyknitgroupofsocietieswithcommonreligiousandartisticconventions.The Gulfstates,too,wereheavilyinhabitedprobablyasfarbackasthisera.InsouthernColoradotheAnasazipeople enteredintowhatwehavealreadylabeledtheBasket-makerperiod.ExcavationsatDurangoshowbothcaveandopen villagesites,withevidenceofmaizegrowingaswellashuntingactivities.Basketsweremadeofplantbersloosely plaited,coiledorstitchedanddecoratedinredandblack.Ref.215[290],45[66],210[283] TheMogollonCultureinsouthernNewMexicoandeasternArizonaapparentlydevelopedfromtheCochiseCulture andwasmanifestedbyasedentarylifestyleutilizingaplainpotteryandexistingonmaizealongwiththefruitsof somegatheringandhunting.Thename"Mogollon"isonelatelyapplied 18 ,andrstgiventoarangeofmountains runningalmosteast-westacrosscentralArizonaandNewMexico,markingthesouthernedgeofthenorthernhigh plateaucountry.SouthofthisMogollonridgetheterraindropsseveralthousandfeetintothesouthernbasinwith meagerrainfallandhotdesertvalleyswithdesertgrasses,mesquiteandcactus.Inthemiddleofthatbasinthere arenorth-southrunningmountainrangesgoingfromNewMexicowelldownintoOldMexico.About100B.C.the MogollonIndianshavebeenidentiedasinhabitingthisregion.Theycontinuedtoliveinthatlargeareafor1,500 years,constantlyimprovingtheircropsandtools. AtaboutthesametimeanothergroupofIndians,whomayhavebeenstillanotherbranchoftheancientCochise, settledinthehotaridvalleysofthelowerGilaandSaltrivers.TheyhavebecomeknownastheHohokam 19 ,surviving throughtheirdescendants,thePimaandthePapago.TheHohokamlivedinArizonafor1,200years,buildingat Snaketownmorethan5,000housesatarateof400ayear.Ref.45[66],210[283] 17 From AmericaB.C. byBarryFellRef.65[96]. 18 Thenamewastakenfroman18thcenturySpanishofcial. 19 InthemodernPimalanguagethismeans"thosethathavegonebefore".

PAGE 235

223,CENTRALAMERICAANDTHECARIBBEAN TheOlmeccivilizationseemstohavefadedoutatthistimeandnoclearcutexplanationhaseverbeengiven.But intheValleyofMexicothebrilliantcity-stateofTeotihuacnbegantoblossom.Originallyasettlementofmoderate sizesurroundedbyanumberofsimilarsettlementsthiswassoonafulledgedcityandnotjustaceremonialcenter likemanyofthoseoftheOlmecs.Therewerelargescaleirrigationworks,cultivatedtomatoesandpeanutsaswellas maizeandothergrainsandthedomesticatedturkey.ThereisevidenceofafarungtradewithotherareasofCentral AmericaandperhapstheNorthAmericansettlements.FarthersouthinGuatemalatheMayanpeoplecontinuedto expand,beginningwhathasbeencalledtheClassicalAgeandthepeoplesofCostaRicaandPanamalivedaboutas describedinpreviouschapters.Ref.215[290],64[94] RecentexcavationsattheancienttownofCerrosinmodernBelizeindicatethatabout50B.C.theMayainhabitants undertookamassiveurbanrenewal.Thisinvolvedtheconstructionofamassiveurbancomplexwithlargeopenplazas, greatpyramidsand103publicbuildingsanddwellingsarrangedinacarefulplanwiththeentirecentersurroundedby acanal1,200metersinlength.ApparentlyallthiswasundertakenbecauseoftheexcellenttradingpositionofCerros onaYucatanbayatthemouthoftheNewRiver.Thelargestpyramidhadsome30,000cubicmetersofrubblell, twicethesizeofafamousNorthAcropolisatTikalandrepresentsaconsiderableengineeringfeat.Ref.164[223] MultipleculturescontinuedintheareaofGreaterPeru.OnthenortherncoasttherecontinuedtobetheVicusSociety. Theirpottery,featuringresistivei.e.negativepainting,resembledtheGallinazo.Inthemiddlesouthcoastthe polychromepotteryandembroideryfabricsoftheNazcadevelopedaboutthistimebutactualdatingisdifcultbecause oftheextensivelootingofancientdwellingsitesthathastakenplaceinthepast.TheTiahuanacoSocietycontinued tothriveinthehighAndesintheLakeTitacacodistrict.ContactbetweenthesehighlandersandtheNazcaandHuari peoplesofthelowerlandsundoubtedlyoccurredwithexchangeofpotterydyesandothermaterials.Thetwoareasare only120difcultmilesapart.Ref.45[66],62[91] ForwardtoAmerica:0toA.D.100Section15.9 ChooseDifferentRegion 1.IntrotoEraSection14.1 2.AfricaSection14.2 3.CentralandNorthernAsiaSection14.5 4.EuropeSection14.4 5.TheFarEastSection14.7 6.TheIndianSubcontinentSection14.6 7.TheNearEastSection14.3 8.PacicSection14.8

PAGE 236

224 CHAPTER14.100B.C.TO0

PAGE 237

Chapter15 0toA.D.100 15.10toA.D.100 1 15.1.10TOA.D.100 Backwardto100B.C.to0Section14.1 ContrarytowhatdevoutChristiansmightliketobelieve,thebirthofChristhadverylittleeffectontheworldatlarge duringthisrstonehundredyears.PaganRomecontinuedtodominatewesternEurope,theMediterraneanandnorth Africa,dividingtheMiddleEastwiththegreatParthianEmpire.AnewpowerdevelopedinsouthcentralAsiaandpart ofIndia-theKushanEmpire,whilethefaradvancedChinesecontinuedundertheHanDynasty.Sincethischapter doesbegintheChristianera,however,weshallstartourregulardiscussionsoftheChristianchurchatthistime. InthisrstcenturyPaulwhohadactuallyneverseenthelivingJesusandothersgraduallychangedthesimple teachingsofJesusintothecomplexsacerdotalreligionofChristianity,mergingtheprincipleideasofmanyoriental faithsintothenewreligion.EachofthegreatcultsoftheMediterraneanregionhad"mysteries"whichwereusually ceremoniesofpurication,sacrice,initiation,revelationandregenerationcenteringaboutthedeathandresurrection ofthegod.Allsectsassumedthepossibilityofmagicandmiracles,aswellasthepromiseofpersonalimmortality,of anendlesshappinessafteralifeofsubjection,povertyortoil.Thiswasthenalandirresistibleattractionoftheoriental faithsandoftheChristianitythatabsorbedandnallysucceededthem.Theentirewesternworldseemedreadyand preparedforthenewChristbutinitiallythefollowingwasconnedlargelytoGreeksandtourbanmerchants.Ref. 48[72],213[288] Veryrecentlysomefty-twopapyrustexts,includinggospelsandothersecretwritings,somedatingfromthisearly Christianera,werefoundnearNagHammadiintheupperEgyptiandesertinanearthenwarejar.Theseso-called "Gnostic"writingsdescribemanyofthepeopleandeventsfoundintheNewTestament,includingmanyalleged quotationsfromJesus,butwithagreatlydifferentperspectivethanfoundinorthodoxChristianity.Thesetextswere apparentlyhiddenatsomelatertimewhentheirproponentswereunderindictmentas"heretics".Thewritingsincluded, forexample,the"GospelofMary",whichdepictsMaryMagdaleneasonefavoredwithvisionsandinsightsurpassing evenPeter.SomeoftheseGnosticGospelsdiscussthepossibilityoftheultimateGodbeingfeminineandmostindicate abeliefthatJesusneverwashumanandexistedentirelyasaspirit. TheGnosticsgaveabetterplaceforwomeninreligionandhadnohierarchyofelders,priests,bishops,etc.,feeling thateachindividuallookedwithinhimselfforGodandguidance.Dr.ElainePagels,authorofthetextdescribingthese recentnds,feelsthatthisindividualismintheirphilosophyisthereasonthatthe"orthodox"church,withitssocialand 1 Thiscontentisavailableonlineat. 225

PAGE 238

226 CHAPTER15.0TOA.D.100 politicalorganization,wonoutovertheGnostics.Ref.163[222]StillfurthersourcesofearlyChristiandoctrine willbediscussedunderNORTHEASTAFRICA,below.ContinuetoChristianChurch2ndCenturySection16.1 ForwardtoA.D.101to200Section16.1 ChooseRegion 1.AfricaSection15.2 2.AmericaSection15.9 3.CentralandNorthernAsiaSection15.5 4.EuropeSection15.4 5.TheFarEastSection15.7 6.TheIndianSubcontinentSection15.6 7.TheNearEastSection15.3 8.ThePacicSection15.8 15.2Africa:0toA.D.100 2 15.2.1AFRICA BacktoAfrica:100B.Cto0Section14.2 InthesouthofthisregionthekingdomofMeroecontinueditsiron-makingandgoldproduction,unmolested.The kingdomofAxuminnorthEthiopiaandsouthwesternArabianowbecameastrongempire,withacapitalcityofthe samenameandAdulisnowMassawaastheRedSeaportandwithawealthfoundedonivory.Axumwasapagan cityofpalacesandtempleswhichnowhadmanyJew 3 andGreekimmigrants.ThecountryhadmanyGreekinsignias andaGreekeducatedking.Ref.45[66],175[241],83[123] EgyptcontinuedunderRomanrule.InAlexandriatheJewishpopulationincreasedreachingperhapsto40%ofthe totalofthecity.AmongthosewastheJewishphilosopherandtheologian,Philo,whodevelopedtheLogosideasofthe GreekStoicsintoaconceptwhichhascomestraightdownthroughthecenturiesintheChristiantheology."God,in Philo'swritings,istheessentialbeingoftheworld,incorporeal,eternal,indescribable;reasoncanknowhisexistence, butcanascribenoqualitytohim." 4 Inordertocreatetheworldandestablishrelationswithman,PhilofeltthatGod usedagroupofintermediarybeings.WhilethesehadbeencalleddiamonesbysomeGreeksandIdeasbyPlato,they werecalledangelsbytheJews.Althoughpopularlyconceivedaspersons,PhilothoughttheyexistedonlyintheDivine MindsasthethoughtsandpowersofGod,suchpowersastheStoicscalledLogos,whichcreatedandthenguidedthe world."PhilosometimesthinksoftheLogosasaperson.InapoeticmomenthecalledtheLogos'Therst-begotten ofGod',sonofGodbythevirginWisdom,andsaysthatthroughtheLogosGodhasrevealedhimselftoman.Since thesoulispartofGod,itcanthroughreasonrisetoamysticvision,notquiteofGod,butofLogos 5 .DurantRef.48 [72]feltthatPhilo'sLogoswasoneofthemostinuentialideasinthehistoryofthought,althoughitsantecedents inHeracleitus,PlatoandtheStoicsareobvious."PhilowasacontemporaryofChrist,butheapparentlyneverheard ofhimalthoughhesharedunknowinglyinformingChristiantheology.PhilotriedtomediatebetweenHellenismand Judaism.FromtheJudaicpointofviewhefailed;fromthehistoricalpointofviewhesucceeded,andtheresultwas therstchapteroftheGospelofJohn. 6 DuringtheperiodoftheRomanadministrationofEgypttheirrigationsystemswereraisedtogreatefciency.While thegovernmentremainedRoman,thepeopleremainedEgyptianandJewishinthecities.AdditionalNotesp.227 2 Thiscontentisavailableonlineat. 3 TheFalashaoftodayarethedescendantsoftheseJewsRef.83[123] 4 AsquotedfromDurantRef.48[72],page501 5 ThetranslationsoftheseancientwritingarethoseofFellRef.86[129],page54,andtomyknowledgenototherwiseconrmed 6 QuotationtakenfromDurantRef.48[72],page502

PAGE 239

227 RomanCarthagewasthecapitalofproconsularAfricaandsecondonlytoRome,itself,inthewesternMediterranean. Itbecameacenterforeducationandsoonastrong-holdforearlyChristianity.Plutarch,livinginthiscentury,allegedly describedvoyagesoftheCarthaginianstoNorthAmericaEpeiros,inhislanguageviaIcelandOgygiaandareturn routefollowingtheanti-tradewindsaroundlatitude40degreesnorth,backtoSpainandCarthage.DiodorusofSicily describedasouthernroutewhenhespokeofthediscoveryofanislandbyCarthaginianswhichmayhavebeenCuba. Ref.84[124],66[97] TherulerofMauretanianorthernMoroccoandwesternAlgeria,anotherPtolemy,wasmurderedinA.D.40onthe orderoftheRomanCaligula,butitdidnotdestroytheBerberspiritofindependenceandtheynevercompletelygave uptotheRomans.Thedromedary,one-humpcamelsrstwerebroughttotheSaharainthiscenturybuttheywerenot usedtoanygreatextentforanothersevenhundredyearswiththeArabinvasion.Ref.260[29] InWestAfricaontheinlanddeltaofthegreatNigerRiverthereexistedatthistime,andprobablyithadexistedforover twohundredyears,thevillageofJenne-jeno,whichhasjustrecentlybeenexcavated.Situatedonlyabout300miles upriverfromTimbuktuitisprobablethateveninthisearlytimetherewerebeginningtraderelationshipsbywater. PotteryinusethroughthisperiodwasofadesignseenseveralcenturiesearlierinthesouthernSahara,indicatingthat theoriginalpopulationmayhaveoriginatedthere.Weshallhearmuchmoreaboutthiscommunitywhichdidnot reachitspeakofdevelopmentuntilaboutA.D.100.Ref.268[189] MadagascarhadprobablybeenunknowntomenuntilaboutthetimeofChrist,whenIndonesiansarrivedwithoutriggercanoesandeventuallysails.Beginninginthiscenturythesesea-farersbrought"wet-zone"cropsliketheAsian andCocoyamsandbananatoMadagascarandthustoEastAfrica 7 .Madagascarhadprobablybeenunknowntomen untilaboutthetimeofChrist,whentheIndonesiansarrivedwithout-riggercanoesandeventuallysails.Withtheirnew cropstheNegroesfounditpossibletostartmovingintothehumidforestsandlow-lyingrivervalleys,thusbeginning thesettlementofmorecentralAfrica.TheBantu-speakingpeoplecontinuedtheirslowmigrationdowntheeastcoast ofAfrica.TherewasironsmeltinginKenyabyA.D.100.Ref.222[296] ForwardtoAfrica:A.D.101to200Section16.2 ChooseDifferentRegion 1.IntrotoEraSection15.1 2.CentralandNorthernAsiaSection15.5 3.EuropeSection15.4 4.TheFarEastSection15.7 5.TheIndianSubcontinentSection15.6 6.TheNearEastSection15.3 7.PacicSection15.8 NOTE :Fromthiscenturyonuntilthe19thcenturyrsttheAksumiteandthentheChristianAmharawere expansionist,seizinglandandincorporatingpeople.Ref.311[40] 15.3TheNearEast:0toA.D.100 8 15.3.1THENEAREAST BacktoTheNearEast:100B.C.to0Section14.3 7 HallettRef.83[123]putsthisatthe4thcenturyC.E. 8 Thiscontentisavailableonlineat.

PAGE 240

228 CHAPTER15.0TOA.D.100 AsdirectvoyagesacrossthefullwidthoftheArabianSeahadbecomeroutine,tradeacrossthepeninsulaincreased, linkingAlexandriawithIndia.TheHimyariteArabsabsorbedOatabanaboutA.D.50andtheHadramautaboutA.D. 100,whilefarthernorththeNabateanEmpirewasconqueredbyRome.AcrossthegulffromEthiopiatheKingdom ofAxumdevelopedasapartofitsEthiopiancounterpart,butonArabicsoil.AttheendofthecenturyChristianity graduallylteredintothepeninsula.Ref.136[187] RomeformallyannexedPalestineinA.D.6andinA.D.44JudeawasnallyplacedunderdirectruleofRoman procurators.TheearlycenturyistheperiodofJesus'teachingofuniversalloveandforgiveness,butingeneralthe Jewswerenotwonover.TherstoftheRomano-JewishWarsoccurredinthelastthirdofthecenturyA.D.66when theJews,underJohnofGiscala,revoltedagainstRomanmisrule.ItendedinagreatbattleA.D.70with600,000 to1,000,000Jewskilled,theirtempledestroyedandthesurvivorsforcedtoundergoanother"dispersion".Whenthe newChristianshadfailedtosupportthisJewishuprising,anti-Christianriotsalsobrokeout.AftertheRomanvictory, theSadduceesdisappearedentirelyandthePharisees,previouslyasortofpriest-eldergroup,nowbecametheRabbis, orteachersofthepeople.OverallatthattimetherewereintheRomanpopulationJewsintheratioof7%,anumber twicethatoftheJewsintheUnitedStatesintheMid-twentiethcentury.Ref.8[14],222[296] ThiscenturywasoneofrelativestabilityalongthefrontierdividingtheParthianandRomanEmpires.Syriaalthough perhapsitwasEgyptwasprobablythesiteoftheinventionofatechniqueofglassblowingsothatsoonglassutensils wereingeneraluseallovertheMediterranean.ChristianitycametoMalulainthemountainsjustnorthofDamascus andstilltodaysome1,500Christianslivethere,speakingWesternAramic,thelanguageofJesus.Adjacentcavesmay havebeenusedinthisrstcenturyasplacesofrefuge.Ref.136[187],118[95] PersiawasthehuboftheParthianEmpire.ThepeoplespokePahlaviandwroteinAramiconparchment,butunfortunatelynotalineoftheParthianliteraturehasbeenpreserved.Theywereeithertoorichortoopoortoindulge inliterature,buttheydidexcelinself-adornment,withbothsexescurlingtheirhairandenjoyingelaborateclothing. Theyhunted,ateanddrankabundantly,werebravewarriorsandusuallyhonorablefoes.Polygamywaspracticed andwomenwereveiledandsecluded,withdivorceeasyforeithersex.Theywereperhapslesscivilizedthanthe AchaemenidPersiansbutmorehonorablegentlementhantheRomans.Theyweretolerantofreligionswhilethey worshippedthesunandthemoonandpreferredtheGodMithrastoAhuraMazda,muchaslaterChristianspreferred ChristtoYahveh.TheArsacidDynastyruledfromjustbeforethebeginningofthiscenturyfortwohundredyears. Ref.48[72] MostofAsiaMinorwasrmlyunderRomanrulewithCommagenefallingtothembyA.D.17.Armeniawasdivided andactuallywasanotherfrontierbetweentheRomansandtheParthianswhiletheculturalorientationofthatcountry wasdenitelytowardPersiaandParthia.Inthemiddleofthecentury,inNero'sreigninRome,hislegionshadaten yearwarwithParthiaoverArmenia.ThisendedinA.D.63withascionoftheParthianroyalhouserecognizedasking ofArmenia,althoughunderRomansuzerainty.SevenyearslaterVespasianmovedsomeeasterntroopsfromSyriato fortsontheupperEuphratestoconsolidatetheeasternfrontieragainstArmeniaandParthia,thuspavingthewayfor laterexpansionbyTrajan.Ref.176[242],136[187] ForwardtoTheNearEast:A.D.101to200Section16.3 ChooseDifferentRegion

PAGE 241

229 1.IntrotoEraSection15.1 2.AfricaSection15.2 3.AmericaSection15.9 4.CentralandNorthernAsiaSection15.5 5.EuropeSection15.4 6.TheFarEastSection15.7 7.TheIndianSubcontinentSection15.6 8.PacicSection15.8 15.4Europe:0toA.D.100 9 15.4.1EUROPE BacktoEurope:100B.C.to0Section14.4 Aninterestingbitoftriviaisthatwhilefermenteddrinkshadbeenknownandusedbymankindforthousandsof years,theprocessofdistillingwasdiscoveredonlyinthisrstcenturyoftheChristianera.TheGaelic uisgebeatha wascorruptedto"whiskey"andtheGermanic Gebrannterwein or Brandewin meaning"burntwine"waseventually Anglicizedto"brandy".Ref.211[284] ApartoftheRomanEmpire. Thecity-statesofGreececontinuedtogovernthemselvesalthoughtheoreticallytheywereunderRomanrule.They werepoorbyvirtueofRomantaxationandwerealmostdestitutemorally,spirituallyandphysically.ThiswasthetimeofPlutarchandofEpictetus,theslavephilosopherwhocombinedtheconceptsoftheStoicsandCynicsinto manyideasparallelingtheattitudesofearlyChristianity,includingtheGoldenRule.ThusStoicism,originallythe proudandscornfulphilosophyofaristocrats,founditsnalandmosteloquentvoiceinaslave.Itsdoctrineofanal conagrationoftheworld,itsrejectionofallpleasuresoftheesh,itshumblesurrendertothehiddenwillofGod, allwerepreparingforthetheologyandethicsofChristianity.TheageoftheCyricspavedthewayfortheChristian monks. CorinthbecamethewealthiestcityofGreecewhileAthensremainedanintellectualcenter.Eleusis,acrosstheAegean Sea,becameareligiouscenterofsacramentsand"mysteries".Ref.48[72] TheRomanprovinceofPannonia,themostsouthernportionofwhichcomprisespresentdayYugoslavia,wasestablishedinA.D.9afterdefeatofthenativeIllyrians. Moesia,whichhadneverbeenpenetratedbyGrecianinuence,wasorganizedasaprovinceinA.D.44.Theupper Balkansnowshowedincreasedactivitiesofallkinds.Therewasconsiderableagriculture,miningandherding,aswell ascommercewithAsiathroughtheportofSalonikainMacedonia.Greatcitieswerebuiltandroadsconstructed,such astheViaEgnatia,thatranacrosstheAlbanianalpstoSalonikaandConstantinople.InDaciaRomaniatherewas astrongtribeofthesamenamewhowereneversubduedbytheRomansinthiscentury.InA.D.85theysurgedout acrosstheDanubeintoMoesianowSerbiaandpartofBulgariabutwerepushedbackbyDomitian.TheRomans 9 Thiscontentisavailableonlineat.

PAGE 242

230 CHAPTER15.0TOA.D.100 couldgonofurther,however,astheMarcomanniandQuadi,whohadoccupiedBohemiawestofDacia,joinedthe frayanddefeatedDomitian.ApeacewassignedwiththeDacianking,Decebalus,andhesubsequentlyturnedonthe Germanictribesanddefeatedthem.IazygianswerealsosqueezinginbetweenQuadiandDaciansandRoxolaniwere approachingDaciafromtheeast.Intheareathattheydidcontrol,theRomansfoundThraciansusefulassoldiers, slavesandespeciallyasgladiators.Ref.206[83],48[72],136[187],171 ThiswasacenturyofsomegreatandsomelesseremperorsofRomeinwhathasbeencalledthe"SilverAge"toindicatethatitwasnotquiteasgoodastheprevious"GoldenAge"underOctavian.TheJulio-ClaudianDynastycontinued underTIBERIUSClaudiusNerowhoreformedthegovernmentandlaw,advancedconstructionofpublicworks,elevatedthelegalstatusoftheprovincesandre-subduedandRomanizedGaulandBritain.Tiberius'reignhadbeen savedfromanyseriousParthianthreatbecauseofdynasticquarrelswithinParthia.InA.D.37whenTiberiuswasdyingheindicatedashissuccessorshisyounggrandsonTiberiusGemellusandthesurvivingsonofGermanicus,Gauius CaesarGermanicus.Thelattersoonputtheformertodeathandruledaloneas"CALIGULA",aprobablyinsane, megalomaniacgiventoexcessesandobscenitiesofallkinds.Hewasassassinatedin41andTiberiusCLAUDIUS Drususbecameemperor.Hisfourwiveswerehisundoingbutheactuallywasafairlyablemanandinstitutedsome deniteadministrativeimprovements. HewasfollowedbyNerowhobeganhisreignwellundertheguidanceofSeneca,butinspirithewasanactorandhad toplaythemonarchinthegrandmanner.Hewasrecklesslycrueltothearistocrats,butgeneroustothepoor,withthe possibleexceptionofthenewChristianswhowererstpersecutedaboutA.D.64,whenRomewasburned. ThereafterfollowedtheFlavianDynasty.Vespasianwasamanofsense,abilityandhonorwhodirectedthewar againstJudeaandestablishedtherstsystemofstateeducation.ThelastofthislinewasDomitianA.D.81-96who managedtheourishingempirewellduringagreatageofconstruction.Attheend,however,likemanyothers,he becameverycruel,deiedhimself,indulgedinsexualdiscrepanciesandbecameparanoidaboutpossibleconspiracies againsthim.ThroughoutthisagetherewasadecayofthenativereligioninRomeandthemultiplegodsofJove,Mars, Mercury,JupiterandothersbegantogivewaytotheStoicphilosophy.SeeGREECE,above Weshouldmentionsomeofthenon-politicalguresofthiscentury.SenecawasborninSpainin4B.C.andbecame acopiouswriter,tutortoandlaternancialbackertoNero.PlinytheElderA.D.23-79wasagreatmindofthe day,buthisbookNaturalHistorywithdissertationsonhumans,animals,metals,chemistry,medicineandastronomy, wasactuallyamonumenttoRomanignorance.Healsocompiledanencyclopediaciting150Romanand400Greek scholars,beforehewaskilledintheeruptionofthevolcanoVesuviusinA.D.79.OfinterestalsoisDeMateria Medicabya-Greekbotanist,PedaniosDioscorides,whohadservedasamilitarysurgeoninNero'sarmy.Hedetailed thepropertiesofsome600medicinalplantsinthistext,whichremainedanauthoritativeguidefor1,500years.Ref. 222[296]Ataboutthesametimeapatricianlayman,Celsus,triedtosummarizeallknowledge.Onlyeightofhis manybookshavesurvived,theDeMedicina,andeventhesewerelostforcenturies.Ref.125[173] Asnotedaboveitwasintheyear79thatMt.VesuviusontheBayofNapleseruptedafter16yearsofviolent surroundingearthquakes.ThecitiesofHeraculaneumandPompeiiwereburiedandthousandswerekilled.At95a severeformofmalariaappearedinthefarmingareassurroundingRomeandbecameendemicthereforthenext500 years.AtthattimetenaqueductssuppliedRomewith250milliongallonsofwaterperday.Ref.125[173],222 [296] ThroughoutthiscenturyRomanlegionscontinuedtoprobethefrontiersinGaulandintheeast,graduallyextending theempireboundaries.Commentsaboutsomeofthebattleswillbefoundintheparagraphsconcerningtheregions involved.ThepopulationoftheRomanEmpireatthistimewasabout54million,whilethatofHanChinawasan estimated57,600,000.RomenowbegantobreaktheArabmonopolyonspicesfromtheeastbybuildingshipslarge enoughtosailfromtheEgyptianSeatoIndia.Thejourneywasstillhazardousandatonetimepeppercost$125,000 per12ounces.AsthesecretofthechangingmonsoonwindsintheIndianOceanwassolved,however,pepperbecame cheaper.GoldwastakentoMalabartobeexchangedforpepper.PlinywrotethatRomanshipsofthisperiodsailed

PAGE 243

231 fromthemouthoftheGangestoCeyloninsevendays.Thesailingshipswereupto420feetlongwith50footbeams. Onecommercialshiphadroomfor200sailors,1,300passengersand93,000bushelsofwheat.Winesmadefromthe veryprolicItalianvineswerenowgenerallypreferredtotheGreekproduct.Ref.48[72],28[48],211[284], 95[140],185[253] AdditionalNotesp.233 InthiscenturytherewerethreetofourmillionpeoplelivingintheareaofmodernGermanywiththreemaindivisions oftheGermanictribes;TheeasternGermansontheOderandVistulawhoweretheVisigoths,Ostrogoths,Burgundians andVandals;thenorthernGermansofthesouthernpartofScandinavia,theBalticislandsandJutland;andthewestern onesbetweentheElbe,theNorthSea,theRhineandtheMain.ThelastgrouppreservedtheirancientGermanictraits andarethepresentdayGermans,Dutch,Flemings,Anglo-Saxonsand,inpart,theFrench. TheearlyGermanicpeopleslivedsimply,eatinghorsemeatandlivinginloghouses.Theyweremonogamousand heldslaves.Super-individualmotivationssuchaspatriotismorreligiousidealismwerestrangelylackingasthese peoplewerehighlypersonalistic.TheboundarylinebetweentheRomanEmpireandtheGermaniclandsbecame fairlywellestablishedattheRhine,butbattlesragedbackandforthfromtimetotime.DomitiancrossedtheRhineat MainztocampaignagainsttheChattiandearlyvictoriesallowedhimtoconstructaseriesoffortswhichwerelater extendedalongthecentralRhineandthenacrosstotheupperDanube.Wherethisjoinedanolderlineoffortsonthe Danubepartofthisforticationlinebecameknownas"thelimes". TheEmperorTiberiusstartedasearlyasA.D.25tostrengthenthefrontierfortsoftheDanubelimestokeepout thenorthernbarbarianhordes.VindobonaViennawasoneofthreeimportantmilitarybasesoftheDanubeValley andwatchtowerswereerectedallalongtheriverandboatswereonconstantpatrol.Attheendofthecenturythere wasacompletelyfortiedmilitaryroadfromtheBodenSeeLakeConstantinetotheDanubelimes.Thesouthern portionofwhatisnowAustriaandHungary,alongwiththewesternBalkans,wasincludedintheRomanprovinceof Pannonia. CZECHOSLAVAKIA Aswenotedearlier,theMarcomanniandQuadiGermanictribeshadoccupiedtheareaofBohemiaandthenwent southtohelptheDaciansdefeatDomitian,slowingdowntheRomanadvanceinthisarea.TheDaciansthenturnedon theGermans,however,anddrovethemfromtheterritory. AllunderRomancontrol. AllofthisareaalsowasRomancontrolled.Inadditiontoslaves,therewereseveralgroupsoffreemeninRoman Spain-landholdingaristocrats,amiddleclassofmerchants,professionalpeopleandbureaucrats,manualworkers, soldiersandsmiths.TheSenecafamilyofRomehadoriginallycomefromCordoba.Ref.196[269]

PAGE 244

232 CHAPTER15.0TOA.D.100 TheGaulsofFranceprogressivelyreachedhigherlevelsofcultureandwereenfranchisedasaprovinceoftheRoman Empire.ThomasRef.213[288]saysthataboutA.D.100theCeltsinventedthemetal-hooped,woodenbarrel whichchangedthewineindustrygreatlysincethedrinkcouldbestoredmuchbetterinbarrelsthaninemphorae.He doesnotsaywhichCelticgroupmadethisprogress,butweknowthatadvancesintheGaulicwineindustryoffered suchachallengetotheItalianvineyardsthatDomitianorderedhalfthevinesintheRhoneregionuprooted. TheBatavioftheNetherlandswerealliedwiththeRomansuntilA.D.70whenachieftaincalledCivilisrevolted, buildingalineoffortsalongthesouthernbankoftheRhinetomarkoffhisownempire.TheFrisiansstayedinthe northina"no-man'sland".Ref.175[241] RomeconqueredBritaininthiscenturybutitwasnoteasy.IttookaboutfourdecadestocompletelyRomanize EnglandaftertheA.D.43invasionbythearmyofClaudius,usingfourRomanlegionsoutof29intheentireempire, eachlegioncontainingabout5,600men.Ref.18[31]BoadiceaorBoudicca,awidowedqueenoftheIceni tribebecameafamousheroinebyleadinghertribeagainsttheRomansinEastAngliaasshemovedagainstvarious RomanizedtownsinA.D.61andmassacredall,atotalofabout70,000people,including30,000to40,000inLondon alone.ShewasnallydefeatedinaterriblebattlebySuetonius,whohadonly10,000fullyarmedmenagainstsome 80,000Britons,buttheseincludedwomenandchildren.EmperorClaudiusnallymanagedtohaveelevenBritish kingssurrendertohimatColchester. AtthisperiodtheCelticBritonsstillfollowedtheirDruidphilosophersinareligionthatapparentlyinvolvedhuman sacrices.TheCeltshadthreegroupsoflearnedmen: 1.Bards,whocomposedandpreservedpoetryandmusic 2.Vates,whowerepriestsresponsibleforcarryingoutsacricestothegods 3.Druids,whostudiednaturalscienceandphilosophy MylesDillon,whowasaprofessorofCelticattheUniversityofDublin,contendedthattheDruidsshouldbelikened totheBrahminsinIndia,sincetheycarriedouttheirprofessionsincludingteaching,study,poetryandlawinasimilar way 10 JuliusCaesarwrotethattheCelticDruidshadknowledgeofthestars,theuniverse,thedimensionsoftheearth andotherrelatedmatters.Standingstonesinlinearorcirculargroupingsservingasastronomicalmarkingsarefound inallCelticlands.Ref.65[96] PerhapsitwasinthiscenturythatthePictsnallygroupedthemselvesintwodominanttribes;oneinthenorthto becalledinthenextcentury"Caledonii"bytheRomans,andsecondlyasoutherntribeofthesouth,latercalled "Maeatae".TheRomanhistorian,Tacitus,saysthatinthiscenturytheRomansfoughtagreatbattleofMons Grampius 11 againstheavylegged,tall,red-hairedmenwhofoughtsavagelywithlongswordsandroundshields, ledbyamancalled"Calgacus,theSwordsman" 12 EarlyCelticIrelandhadnotwritinguntilthe4thcenturyC.E.,andtheearlyhistorythatdescendedorallythroughthe centuriescontainssomuchmythandlegendinthesagasthatitisdifculttoseparatefactfromction.Apparentlyin oldCelticfashion,youngmenofupperclasswereconsideredtobemenat16or17,inessence"knights",andtheyhad todemonstratetheirmaturitybyraidingenemyterritoryforcattleandhumanheads.ItissaidthatthemenofUlster didnotkeeptheskullsofvictimsastrophiesbutonlytheirbrains,formedintolittleballswithgypsum.Themenliked tosit,eatanddrinktogetherinlargebanquethalls,withthewomenlookingonfromabalconyabove.Irelandhadve 10 AsrelatedbyHermRef.91[135],page146. 11 MountainsofcentralScotland. 12 AsrecordedbyPrebbleRef.170[234],page1.

PAGE 245

233 mainareas,eachcalleda"fth"-Ulsterinthenorth,Munsterinthesouth,Con-naughtinbetweenontheAtlanticside andMideandLeinsterontheeastside.Ref.91[135] PrinceCaradoc,called"Caractus"bytheRomans,wasaWelshleaderwhowasnotdefeateduntilA.D.50afterhewas betrayedbyQueenCartimandusoftheBrigantesRef.18[31]andhewastakenprisonertoRome.InWales,the Romansputinroadsandworkedcopperandgoldmines,buttheycouldnotpacifytheWelshwhowerenotactually consideredwonforRomeuntilA.D.78. TherewasaproliferationofvariousGermanictribesthroughoutNorwayandDenmark.TheSwedishpeninsulawas dominatedbytheSuionetribe,whiletheislandofGotlandandotherBalticislandswereprobablyinhabitedchiey byGoths.SnorreSturlasson,alearnedIcelandicscribe,describedtheoriginandancestralhomeoftheScandinavian kingsasontheborderbetweenEuropeandAsiaalongtheeasternshoresoftheBlackSea. ThisworkhasbeentranslatedbyHoltsmarkandSeip 13 Snorregivesadetailed,geographicalaccountoftheearly migrationthroughEurope,passingfromSaxonyintoDenmark,SwedenandNorway,havingbeenchasedoutofthe CaucasusbytheravagingRomanarmiesandledbytheVikingKingOdin.Snorrenamedthirtykingsbeforereaching thegenerationofHaroldFairhair,ofwhichweshallhearmorelaterinthe9thcentury. RichStoneAgendsshowthatfromprehistorictimestheFinnishpeninsulahasbeenthemeetingplaceofpeoples fromRussia,ScandinaviaandcentralEurope.AncientLappandNordicstockswentnorth,asFinno-Ugrianspeaking peoplescameinfromtheeast. Inthecenturyunderconsiderationtherewerethreegroupsofpeople:TheKarelians,whowereadark,short,brachycephalicpeopleenteringfromthesoutheast;theTavastians,withhighcheek-bonescomingacrosstheGulfofFinland; andtheFinns,proper,fromthesouthernshoreoftheGulfofFinland.Ref.95[140],61[90]Allofthesenorthern peoplewereprobablyexcellentseamen.Aforty-twofoot,slender,rowingcanoehasbeenfoundinDenmarkdatingto thiscentury. EstonianshadalreadysettledonthesouthernBalticcoast,whileGothsinhabitedtheBalticislandsandperhapssome ofthesouthshore,particularlyintheVistulaRiverbasinofPoland.EastwardweretheBaltsLetts,whoeventually becametheLatvians,LithuaniansandthenowextinctOldPrussians.Thelanguagewasanindividual,separateIndoEuropeangroupentity,neitherGermanicnorSlavic.TheRomanTacitus,writinginthiscentury,calledtheEstonians the"Aesti".Ref.48[72],175[241] MostofRussiawasstillsparselyinhabitedbutinthecentral,westernpartwerechieySlavsandfarthereastandsouth therewereHuns.IntheCaucasusanewSarmatianpeople,theAlans,mayhavebeenpushedtherebythewestern expansionoftheKushans,whomwehavemetinCentralAsia.TheseAlans,inturn,pushedthewestwardlying lazygiansentirelyoutofRussiaintotheTheissplainofmodernHungaryandYugoslavia.Ref.136[187] NOTE :TheBayofNapleswasabeautifulresortareawithpalatialsummervillasfortheemperorsandother highofcials.Becauseoftheseveregeologicalinstabilityoftheregion,however,earthquakesandadjacent volcanoeshavesubsequentlyresultedinasinkingofthelandandmarkedshiftingofthecityofNaples.Ref. 281[113] 13 TakenfromThorHeyerdahlRef.118[95],page127.

PAGE 246

234 CHAPTER15.0TOA.D.100 ForwardtoEurope:A.D.101to200Section16.4 ChooseDifferentRegion 1.IntrotoEraSection15.1 2.AfricaSection15.2 3.AmericaSection15.9 4.CentralandNorthernAsiaSection15.5 5.TheFarEastSection15.7 6.TheIndianSubcontinentSection15.6 7.TheNearEastSection15.3 8.PacicSection15.8 15.5CentralandNorthernAsia:0toA.D.100 14 15.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:100toB.C.Section14.5 TheSilkRoadtradereacheditspeakinthiscentury,sustainingastringofstatesextendingalongthecaravanroads fromRomanSyriatothenorthwestborderofChina.InBactria,aunionofveYue-chitribestooktheKabutValley, drivingoutthePahlavasandsoonestablishinganempirewhichcomprisedallofAfghanistanaswellasnorthwestern India.TheKushanswereapparentlyoneclanoftheYue-chiwhichincludedorwassynonymouswiththeTocharians, buttheyweredominantinthisexpansionistdriveandtheentireempiresoonboretheirnameonly.TheseKushans evensentanembassyacrosstheCaspianSeaandintoArmeniatomeetwiththeRomansinA.D.58.Theempirewas ameltingpot,withIndian,Chinese,centralAsianandHelleno-Romancultureandtheircoinsshowedawiderangeof deities,someHellenisticHeliols,Hephaistos,IranianMithra,NanaandIndianSiva,Buddha.Ref.140[190], 8[14],19[32] TheKushanspushedtheiradministrationonintoIndiasubjugatingtheSurensandSakas.Theythenreversedtheir armiesandturnednorthwardtowardChina,butweredefeatedbythegreatChineseGeneralPanCh'aowhowasona campaigntocontrolSinkiangTarimBasininA.D.90.PanCh'aothenledhisarmyacrossthePamirMountainsto reachtheCaspianSea. Inthemeantime,theTibetianshadattackednorthwestChinawithoutmuchsuccess.Inthefarnorth,thenorthern Hsuing-nuHunsweredefeatedbythesouthernHsuing-nuinA.D.85andthenwerefurtherbeatenbytheMongol Sien-piin87andbytheChineseGeneralTouHsienin89.Itisnowonderthatalthoughpartofthemsubmitted tooverlords,agreatpartofthesurvivorsmigratedwestward,leavingtheirlandstotheMongols.Thiswestward migrationoftheHunswasfurtheredbyfamineandanthraxamongtheircattleandhorses.Alongthesteppeadjacent toChinatheywerejoinedbyIranianherdsmen,MongolsfromtheforestsofSiberiaandevenChineserenegadesand captiveEuropoidsofvarioustribes,allofthemsubsequentlycalled"Huns"astheygraduallyheadedtowardEurope. AgreatpartoftheHsuing-nuconfederacy,however,consistedofMongoloidsoftheBaikaltype,butthisdoesnot meanthatallMongoloidsofthistypewereHsuing-nu.Ref.127[176]Theery,black-browedhorsemenofthe steppe,normallywellnourishedonanimalproteinfoods,couldeasilyovercometheirmoreslated,carbohydratefed Chineseneighbors,exceptwhenstrongdynastieswereinpowersuchastheHan,incontrolatthattime.Ref.222 [296] ForwardtoCentralandNorthernAsia:A.D.101to200Section16.5 ChooseDifferentRegion 1.IntrotoEraSection15.1 14 Thiscontentisavailableonlineat.

PAGE 247

235 2.AfricaSection15.2 3.AmericaSection15.9 4.EuropeSection15.4 5.TheFarEastSection15.7 6.TheIndianSubcontinentSection15.6 7.TheNearEastSection15.3 8.PacicSection15.8 15.6TheIndianSubcontinent:0toA.D.100 15 15.6.1THEINDIANSUBCONTINENT BacktoTheIndianSubcontinent:100B.Cto0Section14.6 InthersthalfofthecenturyforabriefperiodthegreattradingcityofTaxilainnorthIndianowPakistanwas controlledbyIndo-Parthians,andthesurroundingSakaareahadpredominantlyaGreekcultureinspiteoftheIranian genealogy.AllthisendedaboutA.D.60astheTochariansandthemightyKushantribestookoverthisarea.The KushansreachedBenaresmileswestofPatnadestroyingtheSakasastheywent.Inthefareast,aBuddhist civilizationourishinginBengalwasforcedtoabandonthatfaithbyaHindudynastywhichsubsequentlyoppressed thenativepeople.Ref.8[14],19[32],37[58] TheDeccanofIndiawasruledbytheBuddhistSatavahanaDynastywhiletheMundakingscontinuedtocontrol southernIndia.ThesoutherncoastnowassumednewimportancebecauseofthesealinksbetweenChina,Indiaandthe Mediterraneanworld.PlinycomplainedthatIndia'sspices,jewels,muslinsandexoticanimalswerecostingRomans 550millionsestercesayear.Alsoshippedoutwereturquoise,diamonds,spikenard,indigo,silkyarnandtortoise-shell, whileimportswerewine,pearls,copper,dates,goldandslavesfromEthiopia,ArabiaandtheMediterranean. ChristianitymayhavereachedIndiaeventhisearlyinthattheapostleThomasissupposedtohavefoundedtheSyrian ChurchinMalabarbeforebeingkilledinA.D.68.ThisisusuallygivenasthetimeofCharaka,thegreatIndian physicianwhocomposedanencyclopediaofmedicinestillusedinthatcountry,buthemayhavelivedmuchearlier. Helisted500medicinalplantsanddevelopedaratherunsystematiccatalogueofdiseasesandcures.Hisdescription ofwhatconstitutedagoodhospitalwoulddocredittoanytoday.ThePrakritlanguagebecamethechiefmediumof theBuddhistsandJainsandSanskritfadedexceptintheprofessionalwritingoftheBrahmins.Ref.213[288],19 [32],8[14],125[173] ForwardtoTheIndianSubcontinent:101A.D.to200Section16.6 ChooseDifferentRegion 1.IntrotoEraSection15.1 2.AfricaSection15.2 3.AmericaSection15.9 4.CentralandNorthernAsiaSection15.5 5.EuropeSection15.4 6.TheFarEastSection15.7 7.TheNearEastSection15.3 8.PacicSection15.8 15 Thiscontentisavailableonlineat.

PAGE 248

236 CHAPTER15.0TOA.D.100 15.7TheFarEast:0toA.D.100 16 15.7.1THEFAREAST BacktoTheFarEast:100B.C.to0Section14.7"Former"HantoA.D.9,HsintoA.D.25,then"Later"Han AtthebeginningofthiscenturyChina'spopulationwasjustshortof60,000,000.InterruptingtheHanDynasty,the Wangclanwasactingasregentsforaboyemperorandthelastoftheseregents,WangMang,graduallyoutmaneuvered alloppositionuntilbyA.D.9hecoulddeclaretheHanDynastydefunctandtakethethronehimself.Evenso,hewas thehighesttypeofChinesegentlemanandpromotedmanyimprovementsforthecountry,includingtheabolitionof slaveryandtheredistributionofsomeverylarge,landedestatesamongthepeasants.Hecontinuedstatemonopoliesof saltandironandaddedotherstateownerships.Asoftenhappenswithsuchplannedeconomies,however,somenatural calamities,includingaseriesofpoorharvests,droughtintheShensibasinandaseriesofbreaksinYellowRiverdams resultinginvastoodingwithchangesintheriver'scourseandthousandsofdrownedandhomelesspeople,upset everything,revoltsbrokeoutandhewaskilledA.D.25.Thingsrevertedtotheprevioussituationandtherulefell toascionoftheHouseofHan,inauguratingthe"Later"HanDynastywhichwastolastuntilA.D.220.Itwasthis dynastywhichhelpedtodefeattheHsuing-nuasdetailedunderCentralAsiaSection15.5.TherestorerofthisHan Dynasty,Kuang-wu-ti,movedthecapitaltoLoyanginHonanandthustheterm"EasternHan"issometimesused assynonymouswith"Later"Han.Kuang-wu-tiatthesametimeallowedagroupofsouthernHsuing-nutosettlein northernShensiandShansiprovinces.Heandhisimmediatesuccessorswerevigorous,conscientiousrulersandthe populationandeconomyrapidlyrebounded. TheHanemperorssentsoldier-farmerstothefarwesternextensionsoftheGreatWallintheregionofpresentday Jiayuguan,tosecuretheirfrontier,evenastheCommunistshavedonerecently.Theywateredthedesertbybuilding irrigationsystemstobringdownmountainsnow-waters,setupmulberryplantationsforsilkwormsandprospered. Thiswasontheoriginalsouthernsilkroute.TheChinesepreferredtoletothersdotheirhaulingandinthesecenturies silkeitherwentover-landonthesilkrouteortoIndiainIndianboatsandfromthereonineitherIndian,GreekorArab vessels.Ref.101[146],46[76] Theyear67marksthecomingofBuddhismtoChina.TherstknownmanufactureofpaperdatestoaboutA.D.100. Inthiscenturythesefareasternersusedpowerdrivebellowsandblastfurnaces,suchobjectsnotseeninEuropeuntil theMiddleAges.TheprincipleofthecompasswasalsoknowninChinaatthistimeandwasusedonChineseships longbeforeitappearedinthewest.Ref.215[290]AdditionalNotes AtaboutthetimeofChristthecurrentSunGoddessSeeprecedingchapteralliedherselfwithamaraudingpirate traderfromKarak,KoreamodernPusanandlaterarrangedforhimtomarryhergranddaughter.Asonandgrandson ofthismarriagerangedwidelyuptheInlandSea,exploringandprovisioningalongthesouthernHonshucoast. Whenthegrandson,Jimmu,becameofage,hemovedhisentirepirateeet-ships,warriors,womenandutensilsaway fromthematriarchalKyushuacrosstoHonshu,atwhatisnowOsaka.Becausethelocalsouthernaboriginesthere neededhelpagainstthehairyAinuhuntersfromthenorth,theywelcomedJimmu'swarriorswhoalsofoundaniron orewiththerightimpuritiesformakingsteel.WithinafewgenerationsJapanwasinthesteelage,makingthenest bladesoftheworld.Afterthreeyearsofcampaigning,aboutA.D.50 17 ,JimmuproclaimedhimselfEmperorofanarea whichincludespresentdayOsaka,KobeandKyoto,andhecalledthis"Yamato".JimmuwasthepresentdayEmperor Hirohito'sancestor,69generationsremoved,andpracticallyallpresentdayafuentJapanesearehisprogeneyorthat ofhisthreemostablelieutenants,Nakatomi,MononobeandOtomo.Jimmuandhisimmediatedescendantspracticeda 16 Thiscontentisavailableonlineat. 17 Thechronologyusedhere,ofJimmu's"coronation"atA.D.50,isthatofthearchaeologistEdwardKidder.OfcialJapanesedating,adopted forideologicalpurposes,placesthissome600to800yearsearlier.Ref.12[21]

PAGE 249

237 savage,spartanpuritanismwhichequatedcleanlinesswithgodliness,usingcountlessceremoniesofritualpurication. Theyseemedtobeterriedofthepollutionofdeath,andwhenanemperorpassedaway,theentirecapitalwasmoved toanewsite. OnthelocalspiritworshipJimmubuiltthebasisforlaterShintoism,addingthecontinentalworshipofancestralghosts. Heshowedhispeopleabronzemirror,abrightswordandastringofsemi-precious,half-moonshaped,smoothstones andmadethesethetalismansofhisdivinity,allegedlybestowedonhimbytheSun-Goddess.Theseobjectshavebeen protectedassymbolsofthedivineemperordowntothisday.Ref.12[21] DuringtherstfourcenturiesoftheChristianerathisimperialYamatoclanseemsgraduallytohavetakenovermost ofcentralandwesternJapaninalongseriesofwarswithotherclansandtheAinuintheeastandKumasointhewest. Thelatterappeartohavebeenofalienandquitepossiblysouthernorigin.AJapaneseembassywasestablishedin Chinain57.Ref.119[166] RecordsfromKoreankingdomsshowthatfromA.D.42to562Karak,Miniana,astheJapaneselatercalledit,and whichwenowknowasPusan,wasrecognizedasanindependentJapanesecity-state.Thismayoriginallyonlyhave beenaway-stationforraidersgoingtothefarsouthMalayanarea.Inthenorth,Koguryoandotherstatesat-tempted toasserttheirindependencefromtheChinesecolonyintheregion.Ref.12[21] TheChineseHanEmpireextendeditsciviladministrationoverChinesecoloniesinNorthVietnam.InSouthVietnam andpresentdayCambodiatherewasthestateofFunan,perhapsstartedbyKhmerswithanIndianspiritualbackground. ItprosperedbyitspositiononthetraderoutebetweenIndiaandChina.IntheMekongdeltathepeoplebuiltcanalsto controloodsandtolimittheintrusionofsaltwaterontotheland.Javaandneighboringislandswereconqueredby HinduprincesfromIndiaandthereafteranumberofHinduempiresdividedtheregion.Ref.8[14],176[242], 119[166] ForwardtoTheFarEast:A.D.101to200Section16.7 ChooseDifferentRegion 1.IntrotoEraSection15.1 2.AfricaSection15.2 3.CentralandNorthernAsiaSection15.5 4.EuropeSection15.4 5.TheIndianSubcontinentSection15.6 6.TheNearEastSection15.3 7.PacicSection15.8 NOTE :Althoughjadesuits,constructedlikeacompletesetofarmor,wereusedasburialshroudsforroyalty throughouttheHanDynastyperiod,oneofthebest,completelyrestoredsuitsisprobablythatofLiuGong, PrinceofPengchengandsonofEmperorMingA.D.58-76Ref.306[157] 15.8ThePacic:0toA.D.100 18 15.8.1THEPACIFIC BacktoThePacic:100B.C.to0Section14.8 18 Thiscontentisavailableonlineat.

PAGE 250

238 CHAPTER15.0TOA.D.100 AboriginalpeopleslivedonmostoftheislandsofthePacicatthistime,withMelanesialongpopulatedfromthe IndonesianchainandMicronesiaperhapshavingreceivedpeoplefromthePhilippines.TheeasternPacicislands wereoccupiedbyeitherMexicanandSouthAmericansorpossiblybyLibyanmariners,orboth.Themigrationoftrue PolynesianstoHawaiiwillbediscussedinthe4thcenturyC.E.Section18.8 ForwardtoThePacic:A.D.101to200Section16.8 ChooseDifferentRegion 1.IntrotoEraSection15.1 2.AfricaSection15.2 3.AmericaSection15.9 4.CentralandNorthernAsiaSection15.5 5.EuropeSection15.4 6.TheFarEastSection15.7 7.TheIndianSubcontinentSection15.6 8.TheNearEastSection15.3 15.9America:0to100A.D. 19 15.9.1AMERICA BacktoAmerica:100B.Cto0Section14.9 IntheveryfarnorththeDorsetArctictraditioncontinuedtothrive.Seeparticularlythe6thSection9.4and1st centuries,B.C.Section14.9.SomefurtherremarksabouttheIndiansonthewesterncoastandislandsofCanada seeminorder.Theirhouseswerelargeandrectangularwithwallsandroofsmadeofhandsplitboards.Theroofs weregabledandtherewerenowindows.Theshortfrontwallshadsmalldoors,usuallyhighlydecorated,sometimes withcarvings,sometimeswithpaint.Therewereplaitedamtsonthedirtoorsandnofurniture.Housescouldbeas longas70feet.Socialclassesincludedarulingaristocracy,commonersandslaves.Beingbasicallyaseapeoplethey builtsea-goingcanoes,some170feetlong,61/2feetwideand41/2feetdeep,whichcouldaccommodate100people. Theynavigatedtheopenseaseasilyandasweshallnoteinalaterchapter,someoftheirvoyagesundoubtedlywentto theHawaiianIslandswerethepeoplebecamePolynesians.Thecurrentsandwindsalonesometimescarrylargelogs fromnorthernVancouverIslanddirectlytoHawaii.Thecanoesweremadeofone-halfofalargetreetrunkandcarried onlyamatwhichcouldbeusedasapoorsail.Forseavoyagestwocanoescouldbetiedtogetherandaplatformput overboth.Onemansteeredwithapaddleinthesternandkneelingpairsofmenpaddledstrongly.Threetypesof sh-hookswereused,noneofwhichhaveeverbeenseeninIndonesiaorSoutheastAsia.ThesenorthwestIndiansdid nothavepottery. ThiswasthebeginningofthemaximumexpansionoftheHopewellCulturewithsecondaryareasofinuencein theso-calledMarksvillegroupneartheMissisippideltaandtheSantaRosagroupsatthebaseoftheFloridapeninsula.TheirratherelaboratedecorationsusuallyforthedeadincludedcopperfromLakeSuperior,micafromthe Appalachians,obsidianfromtheRockyMountains,alligatorteethandconchshellsfromFloridaandtheGulfand stonefromMinnesotaandWisconsin.Attheriskofover-emphasizingtheratherbizarrehypothesesofBarryFell, weshallmentionthathewritesthatthebuildersoftheHopewellmoundsweremainlyLibyans,assistedbyNegroid 19 Thiscontentisavailableonlineat.

PAGE 251

239 NubiancrewmemberswholeftsculpturesofheadsandAfricananimalsalongtheMississippiRiversysteminOhio, Iowa,OklahomaandArkansas.HeevensuggestthatJewishrefugeesfromtherstRomano-Jewishwarendedupin KentuckyandTennessee. 20 InhismostrecentbookFellRef.66[97]givesatranslationfromPlutarchwhichallegedlytellsofhowGreekNorth AfricansLateCarthaginianssailedwestwardfromBritainpassingthreeislandgroupsequidistantfromoneanother Orkneys,ShetlandsandFaeros?,andthentoOgygiaIceland?vesailingdaysawayandthenontothenorthern coastofacontinent,Epeiros,thatrimstheocean.SouthGreenlandwouldttheallegeddistanceanddirection.Then, saysPlutarch, 21 ifonesailssouthalongthecoastonewillpassafrozenseaandcometoalandwheretheGreekssettled andmarriedwiththenativebarbarians.TheDavisStraitbetweenLabradorandGreenlandbecomesanimpassable massofoatingiceduringthesummerseason.AsfortheplacewheretheGreeksmarried,Plutarchsaysitwasinthe samelatitudeastheCaspianSea,thusNovaScotiaandNewEngland.ItisinconnectionwiththisthatFellquotesDr. SilasRand 22 whospentalifetimeinthelastcenturyamongtheMicmacandwhowrotea DictionaryoftheMicmac Language ,asindicatingaprevalenceofGreekrootsintheirlanguage.Anillustrativelistofover50suchGreekroots aregivenbyFellalongwiththeMicmacequivalents,implyingaderivationfromtheGreekspokeninNorthAfricain Ptolemaictimes,wordsthatwereapartoftheeverydaylanguageofLibyaandEgypt.Thisconcepthasbeenreported falsebytheSmithsonianinstitute. SometimeduringtheWoodlandPeriodmaizehadmadeitswayfromSouthAmericaand/orMexicotothesouthern UnitedStatesandhadspreadfromthereevenintoNewEnglandandtheMid-Atlanticstates.Varietiesoflintcornor popcornappearedintheSouth.Ref.267[321]. InsouthernNewMexicoandChihuahua,MexicotheMogollonpeoplecontinuedtoliveintheirsemi-subterraneanpithousesandappearedtohaveselfgoverningvillagesundertheleadershipofcivilandreligiouseldersdemocratically selected.Animportantfeaturewasalargeceremonialhouseknownasthegreatkiva,threeorfourtimesthesizeof theusualdwellings.InsouthernArizonaandtheneighboringMexicanstateofSonoratheHohokampeoplebegan extensiveirrigationsystemswithdamsonriversandsomecanals30feetwideand25mileslong.Thissociety developedforover1,000years,buttheexactdateofitsoriginhaslongbeendebated,estimatesvaryingfrom300 B.C.toA.D.500.Pleaseseethe5thcenturyC.E.Section19.9.Atanyrate,theymadeexquisitejewelryand potterypyramidsandusedastronomy.ThisisanotherAmericanculturewhichBarryFellRef.66[97]believesto beofLibyanorigincarryingthetraditionandnavigationalandastronomicalknowledgeoftheOldWorldandwhich hadarrivedviaPacictravelersasmanifestedbytheoriginalmapsmadebythefamousMaui.SeeThePacic: 300to201B.C.Section12.8.ThefrontispieceonFell'slatestbookRef.66[97]isamapsupposedlydrawn byMauishowingNorthAmericaandtheeasternPacic,usingtheprimarymeridianasalinethroughAlexandria, EgyptasusedbyEratostheneswithaninternationaldatelineat180degrees,passingabout10degreeseastof Hawaii.ItshowsHudsonBayandtheisthmusofPanamaandsurvivesonrockdrawingsinNevada.Fellsaysthat additionstotheoriginalLibyanletteringhavebeenmadelaterinKucArabic,showingthatthemapwasstillinuse, probablyforeducationalpurposesaslateasA.D.750.ItishiscontentionthatpetroglyphsandwritingsfromNevada andCalifornia,carefullyrecordedandledattheUniversityofCaliforniaandotherplaces,couldnotbepreviously interpretedbecausethenatureofthewritingArabicwasnotrecognized.Thedifcultyinallthisisthatcurrent authoritiesincludingsouthwestmuseumdirectorsandsouthwestanthropologyprofessorsinrecentpublicationsmake nomentionoftheseconceptswhatsoever.Ref.66[97],210[283],269[193].,CENTRALAMERICAANDTHECARIBBEAN PeopleinthefarnorthofMexicoparticipatedintheSouthwestAmericansocietiesarerelatedintheparagraphs immediatelyabove.MuchfarthersouththerewasrapidgrowthintheTeotihuacanareaandcontinuedevidence 20 Suchconceptsarereallynotnew.EarlyAmericancolonists,particularlyoneJamesAdair,persistentlyheldthatoneofthelosttribesofIsrael hadcometoAmericaandmixedwiththesouthernIndians.OthersthoughtthattheWelshPrinceMadocorevenPhoenicianshadearlycometo America.Ref.267[321] 21 TheexactsourcesofthePlutarchmaterialarenotgivenbyFell.HesayssimplythatPlutarch,writinginthe2ndcentury,allegedlygothis materialfromoldrecordsinCarthage. 22 Similarly,wehavenosourcereferenceconcerningDr.Rand.

PAGE 252

240 CHAPTER15.0TOA.D.100 ofhumansacrice,commontoallMesoAmericansocieties.Skeletonswrappedinnets,rituallyburnedchildren's remainsandburiedheadsalltestifytothis.Ref.273[6]. TheMayancivilizationcontinuedinGuatemala,HondurasandElSalvador.TheMayascountedin20sandhadamuch moremanipulativerepresentationthantheclumsyRomannumeralsofthesametime.TheMayazero,representedby ashell-shapedsign____,wasaconceptwhichdidnotreachEuropefromIndiaforalmostanother1,000years.The numbers1,2,3and4wererepresentedsimplybythecorrespondingnumberofdots,while5wasasinglebar.Thus5 was______,7was____-,etc.,while10wastwobars.Eighteeninthissystemwas______and20,ofcourse,was fourbars,oneundertheother.Fornumbershigherthan20anewrowwasstartedabovetherst,tomarkthenumber of20sintotal.Thusthenumber234wouldbeexpressedbyonlytwoMayansymbols0ontopsignfor11meaning 11setsof20or220andunderneaththesignfor14,thus:_________ InthelastchapterwenotedtheMaytradingcenterofCerrosnearthebaseofYucatan.Inthisrstcenturyofthe Christianerathiscitywentintoasteepdecline.Itisprobablethatwithincreasinglystrongandwell-managedoverland tradingroutestheriverseanetworksdecreasedinimportance.Ref.264[105].AdditionalNotesp.240 Pre-civilizationsocietiescontinuedtobuildupinCostaRicaandPanama.Dozensofsettlementseachalmosthalf akilometerinlengthinCerroPunta.Panama,suggestconsiderablepopulationbuild-upinthevalleyssouthofthe ContinentalDivideinthisera.TheceramicsofthisstagearesimilarinbothPanamaandCostaRica.Ref.266[67], 265[270] TheearlyIntermediatPeriodofPeruvianhistorycontinuedwithadevelopedVicusCulturedominatingthenorth. Thereissomeevidencethatthetrephiningofskulls,usingknivesofhardobsidian,wasacommonpracticeinPeruat thistime,forwhateverreason.OntheairdplainbetweensouthernPeruandtheAndeanfoothillstheNazcaIndians lived,makingfeatherdturbansandnecottoncloaksembroideredinmulti-coloredwools.Manyofthesehavebeen recoveredinNazcacemeteries.EngelRef.62[91]saysthatatthisperiodtherewasnoevidenceofmaritime activityamongthesepeopleandshermenwerestilldepictedonceramicsswimminginthewatercatchingshin nets.Recentexaminationofskeletonsofthiserashowanumberofear-canalosteomas,probablysecondarytothis workinthewater.Graduallytherewasarejuvenationoftheso-calledclassicalNazcaart,afteraninitialperiodof decline.TheTiahuanacosocietycontinuedinthehighAndes.Ref.176[242],62[91],3[4] NOTE :IntheMiddleAmericalatePreclassicperiodB.C.toA.D.250,thecityofColha,Belize,was acenterforcraftspecialistswhomassproducedsuchstonetoolsasadzes,axes,daggersandhoes,aswell asspecialceremonialitems.ThesewereapparentlyexportedallovertheMayaregion.Todatesome32 work-shopshavebeenexcavated.Ref.304[138]. ForwardtoAmerica:A.D.101to200Section16.9 ChooseDifferentRegion 1.IntrotoEraSection15.1 2.AfricaSection15.2 3.CentralandNorthernAsiaSection15.5 4.EuropeSection15.4 5.TheFarEastSection15.7 6.TheIndianSubcontinentSection15.6 7.TheNearEastSection15.3 8.PacicSection15.8

PAGE 253

Chapter16 A.D.101to200 16.1A.D.101to200 1 16.1.1A.D.101TO200 Backwardto0toA.D.100Section15.1 TheworlddidnotchangegreatlyashistoricallywemoveintothissecondcenturyafterChrist.TheChristianChurch stillmadeonlyalimitedimpressionatthetimewhentheRomanEmpirewasatitsfullextent,blockedstillinthe eastbytheParthians.BeyondthelattertheKushanEmpirereacheditszenith,controllingcentralAsiaandmuch ofIndia.TheHanDynastycontinuedtoruleChinaandthereweresomegreatculturaladvancesthereinspiteof manydifcultieswhichappearedfromyeartoyear.Pleaseagainrefertomapofpage61.TheMayacivilization approacheditsClassicPeriod. Bymid-centurychurcheshadbeenestablishedinItaly,theRhineValley,northAfrica,perhapsSpainandmanyin theeasternprovincesoftheRomanEmpire.Themysticalbelief,Gnosticism,continuedtoexpand.Seepage296. Valentinius,anEgyptianeducatedatAlexandria,wasoneofthechiefexponentsofthisGnosticismandperhapswrote the"GospelofTruth",oneofthemanuscriptsrecentlyfoundatNagHammadi.Eventhoughwomenhadparticipated extensivelyinChristianityintherstcentury,bythissecondonethemajorityofchurchesbegantoopposeequality andendorsedthepseudo-PaulineletterofTimothywhichstressedPaul'santi-feministviews.ByA.D.122anygroups whichcontinuedtohavewomeninleadershiproleswerebrandedasheretical.Ref.38[59],163[222] ForwardtoA.D.201to300Section17.1 ChooseRegion 1.AfricaSection16.2 2.AmericaSection16.9 3.CentralandNorthernAsiaSection16.5 4.EuropeSection16.4 5.TheFarEastSection16.7 6.TheIndianSubcontinentSection16.6 7.TheNearEastSection16.3 8.ThePacicSection16.8 1 Thiscontentisavailableonlineat. 241

PAGE 254

242 CHAPTER16.A.D.101TO200 16.2Africa:A.D.101to200 2 16.2.1AFRICA BacktoAfrica:0toA.D.100Section15.2 ThekingdomsofMeroeandAxumcontinuedtodevelop.Seepage292EgyptwasundertheruleoftheRoman emperor,butbeyondthemouthoftheNile,thecountrywasactuallylittletouchedbyRomanization.Theroyalcustom ofbrother-sistermarriagehadbeencopiedbythelowerclasses,andithasbeenestimatedthatbythiscenturytwothirdsofthecitizensofArsinoewereoffspringofsiblingunions.Alexandriawasnowagreattradecentercontaining some500,000people,receivinggoodsfromRedSeaportsandexportingitsownmanufacturedproductssuchaslinen, processedArabiandrugs,Indianperfumes,papyrus,glass-wareandEgyptiangrain.Thiscitywhichoriginallywas oneofthegreatestoftheGreekcities,graduallybecamemoreandmoreoriental.StrifebetweenGreeksandJews resultedinmassacres;soldiersmutiniedandtaxessoared. Ptolemy,orClaudiusPtolemaeus 3 ,wasagreatscientistconcernedwiththeAlexandrianlibraryinthiscentury.InspiredbyHipparchus,whoappearedtohaveprovidedoneofthelinksbetweenBabylonianandGreekscience,Ptolemy wroteamathematicaltreatisewhichbecameknownastheAlmagest.The360degreecircleoftheBabylonianswas used,trigonometrywaspromotedandastronomyadvanced,althoughwithsomeerrors.With1,002starscatalogued theheavenwasconsideredsphericalandasrotatingaroundtheimmobileearthsphere.ThisconceptmadePtolemy's theoriesveryacceptabletothetheologiansofthelaterMiddleAges.Hedidhaveasystemshowingrelationships ofstarsandplanetswhichwaseffectivefromthepracticalstandpoint.HealsowroteaGeographicalTreatisewhich includedthegeographyofMarinusofTyre.Ref.48[72] NorthAfricaremainedthegranaryofRome,withtheMoorsasthedominantpeopleoftheareanowdevelopingconsiderablesea-powerandprestige.TheMoorswereofBerberoriginlaterwithanArabmixtureandcameoriginally fromsouthofMoroccointhecountryofpresentMauretania,onthegreatAtlanticbulgeofAfrica.InaboutA.D.125 alocustinvasiondestroyedlargeareasofcroplandandthiswasfollowedbyaplaguewhichkilledperhaps500,000in Numidiaandpossibly150,000moreonthecoast.Ref.222[296] Thechangesincentral,easternandsouthernAfricawereveryslow.Asnotedinthelastchapter,theintroductionof wetzonecropsliketheyamandbananaallowedbetterpenetrationoftheBantu-speakingblacksintotheforestand low-lyingrivervalleysandcoastalplains.TheyalsocontinuedtodriftsouthalongtheIndianOceancoast.Ref.68 [106] ForwardtoAfrica:A.D.201to300Section17.2 ChooseDifferentRegion 1.IntrotoEraSection16.1 2.AmericaSection16.9 3.CentralandNorthernAsiaSection16.5 4.EuropeSection16.4 5.TheFarEastSection16.7 6.TheIndianSubcontinentSection16.6 7.TheNearEastSection16.3 2 Thiscontentisavailableonlineat. 3 NottobeconfusedwiththepharoahsoftheB.C.centuries

PAGE 255

243 8.PacicSection16.8 16.3TheNearEast:A.D.101to200 4 16.3.1THENEAREAST BacktoTheNearEast:0toA.D.100Section15.3 TheincreasinglandandseatradebetweentheMediterranean,IndiaandChinaincreasedchancesofunfamiliarinfectionsspreadingtosusceptiblepopulationsandsevereepidemicsareknowntohavehittheMediterraneanpopulations andprobablyChinatoointhiscentury.Ref.140[190] ThetraderoutesacrosstheArabianpeninsulawereveryactiveatthistime.ThecitizensofPalmyraownedand escortedcaravansbetweentheRomanEmpirecontrollingJordanandsomeofnorthernArabiaandthePersianGulf portsofCharaxandApologos,thusaccumulatinggreatwealthwhichpermittedthenancingofspectacularpublic buildings.PetraperformedthesamefunctionsfarthersouthbetweenthePersianGulfandtheRedSeaports.Ref.8 [14] TheindustryandtradeofJudeaandtheareaofLebanonwereintimatelyconnectedwiththewholeofSyriaand Iraq.AlthoughtheentireregionremainedunderRomancontrol,thebasicpeopleoftheselandsremainedJewishand Phoenicianinderivation,asalways.Thedyeindustry,inheritedfromoldPhoeniciacontinuedtofunctionalongwith schoolsofmedicineandlawatBeirut.TheupperclasseswereofHelleniccultureandtheGreeklanguagewasused inliteratureandgovernment,whilethelowerclassesremainedorientalandspokeAramaic. InA.D.132undertheleadershipofSimeonBarCocheba,whoclaimedtobetheMessiah,theJewsmadetheirlast effortinantiguitytorecovertheirfreedomandtheirhomeland.InthelastoftheRomano-JewishWarstheyfought desperatelyforthreeyearsagainsttheRomanlegions.One-halfmillionmenwerekilledandmorestarved.Afterthe Jewishdefeat,HadrianforbadeanyJewishritualandthevanquishedwereshutoutoftheirHolyCityandscattered again. InthenextfourcenturiestherewerewrittentwoTalmuds,onefromJerusalemandamuchlongerBabylonianversion containingarichcollectionofmedicalloreamongtheotherauthoritativeJewishtraditions.Someofthemedical materialcamefromAlexandriawhereJewshadockedinthe4thcenturyB.C.Althoughdeadbodieswereavoided asunclean,RabbiIshmaelissaidtohaveboiledandthenstudiedthebodyofaprostitute.InsurgerytheTalmud discussesmeansofreducingdislocationsandperformingcertainotheroperations.Ref.48[72],125[173] AtthebeginningofthiscenturythereweretenmillionpeoplelivinginGreaterSyria,whichprobablyencompassed modernLebanonandIraq,andtherewasgreatprosperityduetothedyeandglassindustries.Todaythereareonly threemillionpeoplelivinginthesamearea,mostndingonlyaprecariousexistence.InA.D.114theEmperorTrajan exploitedamomentofParthianweaknessandadvanceddowntheTigresandEuphratesriverstothePersianGulf,thus puttingtheruleofRomeoverthisentireancientland.IntheHadrianPrincipatetofollow,however,A.D.117-138, theRomantroopswerewithdrawntotheEuphrateswhichthenbecametheeasternboundaryoftheempire.Inthearea betweentheRedandtheBlackSeas,ahundredcitiesourishedinthiseraofrelativeRomanpeace.Thepoliticaland militaryreversesoftheJewsinJudeainnowayaffectedthelargenumberofthemlivinginBabyloniaandelsewhere intheempire.Ref.8[14] 4 Thiscontentisavailableonlineat.

PAGE 256

244 CHAPTER16.A.D.101TO200 EmperorTrajanalsoinvadedpartofIranandbetweenA.D.115and117allofMediaandpartofParthia,itself, belongedtoRome,butasnotedintheparagraphabove,HadrianwithdrewalltroopstotheEuphrates,freeingthe mainareasofPersiaandtheParthianEmpireremainedprettywellintact.LateinthecenturyRomangeneralsagain attemptedtoinvadethisregionand198butwithnolastingeffect.Ref.8[14] EvenundertheyearsofRomanrule,theIonianGreekculturestillourishedalongthecoastofAsiaMinor.Soranus ofEphesuswroteatreatiseondiseasesofwomen,birthandcareofchildrenA.D.116,aworkwhichmarkshimas agreatgynecologist.OnlyHippocratesandGalenrankabovehiminthemedicineofancienttimes. Armeniawasasiteofalmostconstantwarfare.JustbeforethebeginningofthiscenturythatcountryandParthiawere allied,butwhentheParthianKingChosroessetupapuppetgovernorinArmenia,Trajandeclaredwar,claiminga treatyviolation.In114,onthedeathoftheParthianpuppet,Trajanannexedthecountry.Afterhisdeath,however, HadrianwithdrewthetroopstoalessadvancedpositionandArmeniawasagainleftaloneuntilMarcussentGeneral Verusbacktotheareain162.VeruscruisedthroughSyriaanduptoArmenia,whereheputaRomanpuppetonthe throne.TheArmeniansmaygavegottentheirrevenge,however,becauseuponVerus'returntotheWest,histroops broughtwiththematerribleplaguewhichseriouslydepopulatedtheempireinA.D.166and167.Ref.119[166] ForwardtoTheNearEast:A.D.201to300Section17.3 ChooseDifferentRegion 1.IntrotoEraSection16.1 2.AfricaSection16.2 3.AmericaSection16.9 4.CentralandNorthernAsiaSection16.5 5.EuropeSection16.4 6.TheFarEastSection16.7 7.TheIndianSubcontinentSection16.6 8.PacicSection16.8 16.4Europe:A.D.101to200 5 16.4.1EUROPE BacktoEurope:0toA.D.100Section15.4 PartoftheRomanEmpire. 5 Thiscontentisavailableonlineat.

PAGE 257

245 ThehomeplaceoftheHellenicworldenjoyedan"Indiansummer"whichwasmistakenfora"GoldenAge".A thousandcity-stateslivedpeacefullytogetherbutanimpalpablecensorshipfromtheRomanoverseerswasalready slowlyeliminatingintellectualandartisticvitality.AttheendofthecenturytheGermanicCostobiiraideddown throughGreecetowithin14milesofAthens.Ref.48[72] AlmostallofthepresentdayBalkansbelongedtotheRomanEmpire,includingDaciaorRomania,MoesiaorBulgaria,ThraciaandDalmatia.TheverynorthernportionsofRomaniaandBulgariamayhavebeenoutsidetheRoman jurisdiction,inthelargeareaknownthenasSarmatiaandextendingoverintoRussiaonthenorthshoreoftheBlack Sea.IntheupperBalkanarea,however,onlyRomaniacanbesaidtohavebeentrulyLatinized. Thersthalfofthecentury,underEmperorsTrajanandHadrianandtheirimmediatesuccessors,wasoneofthegreat periodsoftheempire,withgeneralprosperityandwithlimitedexceptions,suchastheRomano-JewishWarsand Armeniansquabbles,aperiodofpeace.TheMediterraneanworldhadafullnessoflifenotseenbeforeorsince.The GreekspiritruledthemindandtheEast,whiletheRomanspiritruledthestateandtheWest.UnderTrajantheempire reacheditsgreatestgeographicalextent,asindicatedonthemapandinthesummaryoftheempireatA.D.117to follow. 1.AFRICA.AllofEgyptandthenorthAfricancoast,includingMauretania,SyrticaandMarmarica. 2.THENEAREAST.AportionofArabia,alloftheeasternMediterraneancoast,allofSyria,Iraq,Mediain Persia,AsiaMinor,includingBithynia,PontusandCappadocia,Cilicia,Lycaonia,GallatiaandArmenia. 3.EUROPE aSOUTHERNEUROPE.GreeceandmostoftheBalkanarea,includingDaciaRomania,MoesiaBulgaria,ThraciaandDalmatiasouthernBulgaria,EuropeanTurkey,YugoslaviaandCroatia,andallof ItalyandSicily. bB.CENTRALEUROPE.TheAustrian-Hungaryarea,knownthenasPannonia,NoricumandBaetia,and thosepartsofpresentdayGermanywhichliewestoftheRhineandsouthoftheDanube,includingBavaria, SwitzerlandandthepartsofGermanyabouttheBlackForest. cNOTE:InsertMap29.THEROMANEMPIREATTHEDEATHOFTRAJANA.D. dWESTERNEUROPE.HispaniaSpainandPortugal,BrittanicaEnglandandWales,GalliaandBelgica, etc. TheempirewassurroundedbyGermania,Sarmatia,ParthiaandtheremainderofArabia. Afewwordsabouttheemperorsthemselvesseemsindicated.Trajanwastherstemperortohavebeenbornoutside Italy,comingfromaRomancolonialfamilylivinginSpain.Helivedsimplyandwasatirelessadministratorwho completedextensivepublicworksincludingroads,buildings,bridgesandaqueducts.Heawarded5,000scholarships toneedystudentsandhenancedsecondaryschoolsandpensionsforteachers.Romaniawasconqueredbecauseit wasontheroadtoByzantiumattheBosporus.WhenhisarmiesreachedtheIndianOceanandTrajanwenthome, revoltsspreadandhisnephew,Hadrian,incommandinSyria,withdrewtotheEuphrates.Tacitusdidhishistorical writingduringthisreign. Hadrian-138wasthemostbrilliantoftheRomanemperorsandhisreignthemostprosperous.Underhimthe Pantheon,whichhadpreviouslyburned,wasreconstructed. LaterinthecenturyA.D.161MarcusAureliuscametopowerandbroughtthousandsofGermansintotheempire, bothassettlersandassoldiers.Theultimateeffectwasthatthe"barbarians"graduallybegantodominateRome. MarcuswasoneofthegreatestexponentsoftheStoicphilosophyandagoodpublicservantandadministrator.Itwas

PAGE 258

246 CHAPTER16.A.D.101TO200 duringhisadministrationthatagreatplaguewasapparentlybroughtbackbyarmiesfromtheEast.AlthoughRome hadepidemicsasfarbackas387B.C.theoneofA.D.165wastheworst.Thedisease,perhapssmall-pox,remained epidemicinvariouscitiesforfteenyearsandinsomeareas25to35%ofthepeopledied.Thepopulationofall Mediterraneanlandssubsequentlydecreasedoverallforthenext500years.FollowingMarcus'death,Romebeganto visiblydecay.Atthelastofthecenturythebarbariantribesbegantoattackagaininvariouspartsoftheempire,with theChatti,ChauciandLombardsraidingItalyfromGermanyandotherGermanictribesraidingthroughtheBalkans intoGreece.Ref.48[72],136[187],185[253],140[190] Overallthereweresome54,000milesofRomanroads,makinganetworkforcommunicationsthroughouttheempire. Themiddleofeachroadwasraisedandcoveredwithgraveltoallowdrainage.Therewerepoststationsevery10to 12milesonmainroadsandeachstationhadhorses,veterinarians,surgeons,cartwrights,carriagesandwagons.Inthe outerempiredonkeysandcamelswereavailable.Still,thebulkofinternaltradewentbywater.Ref.213[288] Onthemedicalscene,Galen,borninPergamum,AsiaMinorpracticedmedicineinRomeandwasphysicianto EmperorMarcus.HedissectedtheBarbaryApeandleftsomegoodanatomicalandphysiologicalknowledgefor posterity.Hisworkswereconsideredasanunimpeachableauthorityfornearly1,500yearseventhoughmuchwasin error. GalenusedanoldAsiaMinorcombinationofmedicinalscalled"theriac"FOREIGNrelatedtoGreekwordfor"wild beast"andheincreasedthenumberofingredientstoover70.ThisalsopersistedasatreatmentwellintotheMiddle Ages,butatleastsomeofitspopularitymayhavebeenduetothepresenceofopiumamongitsingredients.Other2nd centurycontributorstomedicineincludedSoranus,writingespeciallyondiseasesofwomen,andRufus,alsofrom Ephesus,whomadeimportantanatomicalobservationswhileinRomeparticularlyabouttheeyeandbrain.Celsus,a Roman,wroteDeMedicinawhichactuallycodiedGreekmedicineofthepreviouscentury.Ref.125[173] AdditionalNotesp.247 NorthernGermanyseethedwithamultitudeofGermanictribes.BorderingontheBalticweretheGepidsandfarther westtheGoths,whilejustsouthofthemweretheBurgundians,borderedontheeastbytheencroachingSlavs.On theNorthSeacoastwereFrisians,thenSennones,Hermanduri,MarcomanniandQuadi,inturngoingeast.Thelast twonamedtribeswereactuallyintheregionofBohemia.AnIraniantribe,abranchoftheSarmatians,nowoccupied mostofpresentdayHungary.TheRomanshadtheirfarthestadvanceagainsttheGermanictribesinA.D.110,under Trajan,whentheyfortiedboundariesfromHollanddowntheRhinetonearMainzandtheneasttonearFrank-onMain,andthendowntheDanube.AllareassouthofthislineweredominatedbytheRomansforfourcenturies,and wereeventuallylledwithcitiesandroads.AfterChristianitydominatedthearea,thefewregionsofGermanyand AustriabelowtheabovementionedlinelaterremainedCatholic,whilenorthofthislinecivilizationdevelopedmuch slowerandChristianityappearedmuchlaterandthenoftheArianvarietyfromtheEast.Thesenorthernareasarenow essentiallyProtestant.Toreturntothe2ndcentury,however,theFranks,asalooseconfederacyofGermanictribes, developeduptoA.D.200betweentheWeserandtheRhine.Ref.136[187],45[66] EmperorMarcusdiedatVindobonaViennainA.D.180after8wintersofcampaignsonthefrozenbanksofthe DanubeghtingagainsttheMarcomanniandQuadi.TheywerenallydestroyedaskingdomsinA.D.165aboutthe timethattheLombardsalsoLongobardsbegantheirrstraidsdownintoRomanterritoryandtheyneverwerequite conqueredbytheRomans. InSpain,althoughRomansbuiltroadsfortheirlegionnaires,itwasstillfarcheapertocarrywheatbyshipfromSyria toAndalusiathantocarryitoverlandfromsouthtonorthSpain.Thesouthofthiscountrywasthemostprosperous, growingwheat,grapesandolives.AttheendofthecenturySpainwasinvadedbyMoorsfromnorthernAfrica.

PAGE 259

247 GaulFrancewasruledcompletelybytheRomansbutagainattheendofthecenturytherewererumblingsof GermanictribespushingagainsttheeasternbarriersintoGaul.Ref.196[269],213[288] AllofwesternEurope,includingEnglandandWales,enjoyedaneraoflawandorderandpeaceunderRomanrule. TheHadrianicfrontierwasgenerallymaintainedinBritainbythelegions,modiedonlybytheconquestofsouthern ScotlandinA.D.142.ThecompleteannexationofScotlandwasattemptedfromtimetotimebutalwaysfailedbecause thelegionscouldnotsupplythemselvesinsuchasparselypopulatedcountry.InadditionthePictshadbecomeaforce tobereckonedwith.Inthelastfewyearsoftheirindependencetheyhadnallyunitedunderthestimulationofsavage battlesagainsttheScotsandNorsemen.EmperorHadrian,feelingthatCaledoniawasnotworththepotentiallossof menifitwastobeconquered,builthisgreatwallA.D.12270milesfromseatosea,withacausewayofstone, forts,campsandsignaltowers,fromtheSolwayrthtothenortheast.Becauseofconstantbarbarianattacksonthe wall,however,theRomanslateradvancedtheirfrontierandbuiltstillanotherwall,Antoninus'A.D.140,between theForthandtheClyde.Thisonewas39mileslongandhad20forts.Ref.170[234]TheRomanportofDover, protectedbytwogreatlighthouses,helpedkeepimmensetradegoingtofromEngland.Vesselsbringingjarsofwine, oilandsh-pastecamefromSpainandItaly,whiletablewarewasbroughtfromGaul.Ref.136[187],43[64], 175[241],222[296] InIrelandtherulerofConnacht,Conn,formedalargekingdomaboutA.D.150butneitherhenorhissuccessorscould managetounifytheentirecountry. SCANDINAVIA TheScandinaviantribeshadconsiderabletradewiththeRomanworld,chieythroughtheMarcommanickingdom inBohemiaandaftertheannihilationofthelatterlateinthecentury,thequalityandquantityofgoodsimportedinto thenorthdeclinedconsiderably.InA.D.150Ptolemy,theEgyptianscientistwroteaboutseveralfarnortherntribes, includingtheGoestoialsoGautorandGeatasandtheChaideinoi,whowereprobablytheNorwegianHeidnir.Ref. 34[54] AnoldernamefortheBaltswasAistrians,takenfromAestiorumgentes,mentionedbyTacitusA.D.98.Sometime nearthis2ndcenturytheseBaltsseparatedintoLithuanians,LettsLatvians,OldPrussians,Curonians,Semigallions andSelonians.TheeastGer-manGothswhohadbeenbuildingupapopulationpressurealongtheBalticfortwoor morecenturiesparticularlyaboutthemouthoftheVistula,aboutthistimemovedsouthtotheCarpathiansandthe BlackSea,dominatingallthepeoplewithwhomtheycameincontact.OnceinsideRussiathesepeople,thencalled "Ostrogoths"EastGoths,soonformedakingdomoftheirownandrapidlybegantospreadstillfartheralongtheriver systems.AlongtheBlackSeatheyabuttedagainsttheIranianRoxolanialsoRhoxolanibranchoftheSamartians, whowerethesuccessorstotheScythiansinthisarea.Ref.61[90],8[14],136[187] TheterritorybetweentheBlackandCaspianSeaswasoccupiedchieybytheIraniaAlans,closelyrelatedtothe Samartians.JustsouthoftheseAlanstheoldCaucasiankingdomofIberiaremainedasaRomanprotectorate,although thoseancientpeoplewereonlynominallysubservienttoRome.Otherwise,inmorecentralRussia,theSlavicpeople continuedtoliveandexpandunobtrusively,whileinthefarnorththeFinns-Lappscontinuedtheirsparseexistence. Ref.136[187] NOTE :Eveninthisearlytime,inFlorencecreditwascentraltotheentirehistoryofthecityand,infact,to thewholeMediterraneanworld.Ref.292[28] ForwardtoEurope:A.D.201to300Section17.4 ChooseDifferentRegion 1.IntrotoEraSection16.1 2.AfricaSection16.2

PAGE 260

248 CHAPTER16.A.D.101TO200 3.AmericaSection16.9 4.CentralandNorthernAsiaSection16.4 5.TheFarEastSection16.7 6.TheIndianSubcontinentSection16.6 7.TheNearEastSection16.3 8.PacicSection16.8 16.5CentralandNorthernAsia:A.D.101to200 6 16.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:0toA.D.100Section15.5 InfareasternandnorthernAsiaMongoliannomads,perhapswithsomeadmixtureofTurkish,Europoidelements,all ofwhicharetraditionallyconsideredasancestorsoftheHuns,livedasharsh,bow-leggedmenwithlargeheadsand massivechestswhichapparentlyhelpedthemtowithstandtheblazingdaysandfreezingnightsoftheGobidesert. Theirchiefmeatwasmutton,butoccasionallytheyatebeef,horseorcamelandthehumpsofthelatterwereconsidered agreatdelicacy.Ingeneral,inthewilderareasthecattledidnotadaptwellandcamelswerenotsufcientlyproductive, havingonlyasinglefoaleverythreeyears.Theyakwasusedformilk,ratherthanfundamentallyformeat.Ref.211 [284] AspackanimalsthehorseandBactriancamelwerethemeansofopeningthegreatcommercialroutesacrossthe centralAsiansteppe,withmanychange-overpointsalongtheway.StoneTower,somewherenorthofthePamirs,was thegreatmeetingplacewhereexquisiteChinesesilksandexoticspiceswerebarteredforRomanglassware,pottery, asbestoscloth,coralbeads,gems,grapewinefortheemperorofChina,silverandgold. ThedrainofgoldfromtheWestwasfantasticinamount.InthedesertatthenorthoftheTarimBasinatpresentday TurpanorTurfanabout950undergroundcanalscalled"Karez"wereconstructedtobringirrigationwaterfromthe TianShanCelestialMountainstothedesert,whereamelonandgrapegrowingoasiswasthusdeveloped.TheHan ChineseruledTurpanatthistime,butthroughthecenturiesitwascontrolledbynumerousCentralAsianpeoples. The"blue-print"forsuchanundergroundwatersystemwasbroughtalongthesilkroutefromPersia,wherethecanals werecalled"Qanats".Ref.211[284],73[112] Asnotedinthelastchapter,theTochariansandotherYue-chitribeshadcombinedtocreatethevastKushanEmpire whichinthiscenturycoveredalmosttheentirecentralAsianlandmassinitssouthernportion.Theirgreatestking, Kanishka,ruledthisempirefromIndia,andmoredetailswillbewritteninthatsectionofthischapter.OntheTurkistan frontierwithChina,MongolHsiung-nu,TibetansandothertribesmenlivedsidebysidewiththeChinese,whostill ruledatleastthemosteasternportionofthisarea,althoughtheirprotectorateovertheTarimBasinhadlapsedinA.D. 106.Ref.136[187] toCentralandNorthernAsia:A.D.201to300Section17.5 ChooseDifferentRegion 1.IntrotoEraSection16.1 2.AfricaSection16.2 3.AmericaSection16.9 4.EuropeSection16.4 5.TheFarEastSection16.7 6.TheIndianSubcontinentSection16.6 7.TheNearEastSection16.3 6 Thiscontentisavailableonlineat.

PAGE 261

249 8.PacicSection16.8 16.6TheIndianSubcontinent:101A.D.to200 7 16.6.1THEINDIANSUBCONTINENT BacktoTheIndianSubcontinent:0toA.D.100Section15.6 Undertheirgreatestking,Kanishkaca.120-160,theartsandsciencesourishedamongtheKushans.After experimentingwithmanyreligions,thekingnallychosethenewmysticalBuddhismandcalledagreatcouncilof Buddhisttheologianstoformulatethiscreedforhisrealm.ThecouncilloweredBuddha'sphilosophytotheemotional needsofthecommonsoulbutraisedBuddhatoadivinity,thuslayingthebasisfortheMahayanaorGreaterVehicle BuddhismwhichlaterhelpedtowinChinaandJapan.ItisavariationofBuddhismwhichshowsdeniteinuence fromtheGreekreligions.TheKushanruleextendedfromBenaresandKabuttotheVindhyas,withacapitalat Peshawar. SomefurtherdiscussionoftheconfusionswhichsurroundthehistoryoftheKushansseemsrelevant.Ithasbeen mentionedpreviouslythattheywereamixtureofYu e-chitribessomesayvetribes,buttheChinesenameis misleadinginthattheyspokeavarietyofIranianlanguages.WellswrotethattheYue-chihadoriginallybeenpushed overintowesternTurkistanbyHunpeopleswhoconqueredtheBactriansandthenmixedwithAryanelementsthereto createthefusionknownasIndo-ScythianswhothenwentovertheKyberPassdownintoIndia.Thisisnotthecurrent conceptwhichisthattheKushanswereentirelyIndo-European.Afterthemiddleofthecentury,foreignkingdomsin thenorthbegantofadeandindigenousIndiangroupsemerged.Ref.229[307],8[14] Buddhismnowbecamedividedintotwoschools,themysticalMahayana,orGreaterVehicle,mentionedabove,and theHinayanaorLesserVehicle,alsocalledTheravadaBuddhismorWayoftheElders,whichretainedmuchof theprimitivesimplicityoftheoriginalphilosophy.TheparticularbranchofthisreligiondominantinKashmir,the Sarvastivadin,wasoneoftwomainoff-shootsoftheHinayanabutHindufaithsexistedatthesametime,withSiva asthemostfavoreddeity.KanishkaestablishedacityinhisownnameinKashmirinthiscentury.Throughoutall theseearlycenturiesoftheChristianera,theregionofKashmirwassubjecttoincursionsofSakas,Kushans,Tibetans andHunsfromthenorthaswellasmigrationsofGujarasfromthesouth.KashmirkeptcontactwithGandharain presentdayPakistanandsharedsomeoftheartisticblendingofHellenicandParthianinuences.Ref.114[162], 275[99] TheDeccanwasstilldominatedbytheMundakings.InMalwatherewasadynastyofSatrapsofUjjain,acommunity whichbecameacenterofSanskritlearningandwastakenasthebasicmeridianbyIndianastronomers.Inthefarsouth ofIndiaitwasHinduismwhichourished.SanskritinuenceisclearintheTamillanguagegrammaralthoughnot muchelseofAryanIndiapenetratedTamil.ThebasicdevotionwastotheHindugodsofVishnuandSiva.Indianart wasinuencedbyGreeksculptureandtheirsciencewasinuencedtosomedegree.SriLankawasbrieyoccupied bytheTamilsinthiscentury.Ref.8[14] ForwardtoTheIndianSubcontinent:A.D.201to300Section17.6 ChooseDifferentRegion 1.IntrotoEraSection16.1 2.AfricaSection16.2 3.AmericaSection16.9 4.CentralandNorthernAsiaSection16.5 5.EuropeSection16.4 6.TheFarEastSection16.7 7 Thiscontentisavailableonlineat.

PAGE 262

250 CHAPTER16.A.D.101TO200 7.TheNearEastSection16.3 8.PacicSection16.8 16.7TheFarEast:A.D.101to200 8 16.7.1THEFAREAST BacktoTheFarEast:0toA.D.100Section15.7 IntheentirersthalfofthecenturytherewereaseriesofHanDynastyempressesrulingweaklyforthemselves and/orvariousinfantsandyouths,withthehelpofsomeveryclevercourteunuchs.ByA.D.157thepopulationhad reachedapeakofalmost55,000,000.HancourtrecordsrefertoRomanambassadorswithdatesofvisitsandthe namesofcurrentRomanemperors,butconverselytheseembassiesarenotmentionedinanyknownRomanrecords. TheChinesegovernment'sreturntolaissez-fairepoliciesallowedthegreatland-ownerstoagaindominatetheserfs andavoidtaxes.Thenaseriesofnaturaldisastersoccurred,beginningwithmassiveoodsandlocustinfestationsat A.D.175.Ataboutthesametime,inatleasttwodifferentyears,thereweregreatpestilenceswhichbrokeoutinthe armyghtingonthenorthwesternfrontier,withthreeorfouroutoftendying.Thisplague,whateveritmayhave been,apparentlyseepeddownallthroughAsiatosomedegreeinthenext20years.Peasantsbeganseekingrefugein Taoistinspiredreligiouscults,whichofferedfaithhealingandalchemicalprescriptions.Ref.65[96],101[146], 140[190] Itwasthemassivereligiousuprisingofthe"YellowTurbans"againstthepalaceeunuchsinA.D.184whichnally begantobringdowntheHanDynasty.TheremainingeunuchswerenallymassacredbyYuanWarLordShaoin 189andthecapitalLoyangwassizedbyGeneralTungChoin190.Some700otherofcialsandsome1,000students werethrowninprisonandtorturedandcannabalismhasevenbeenalleged.InthisLaterHanperiodthestudentbody ofthenationaluniversityhadswelledtosome30,000youths,manyapparentlyevadersofmilitaryandotherstate service.Localmilitiaswerenowabolishedtolessenlocalwar-lordismandalthoughthedynastycontinuedofcially onintothenextcentury,inactualitythelastfewyearswereaneraofchaosanddividedstates.Ref.8[14],119 [166],101[146] Chineseart,astrologyandastronomyappropriatedsomeHellenisticelements,butitisofinterestthatinmanysimple itemstheChinesewerefaraheadofthewesternworld.Forinstance,inthiscenturytheChineseusedwheelbarrows, cranks,objectsmountedingimbalstokeeplevelasshipboardlamps,treadlesandrotatingfans,noneofwhichwere usedinEuropeuntilvariouslythe9thtothe18thcenturies.PaperwasinventedbyTshaiLuninA.D.105andwas madefromdecayedvegetablematter,althoughtheprocesswaskeptsecretbytheChineseformanycenturies.The chairwasintroducedinthisorthenextcenturybutdidn'tcomeintogeneraluseforseveralhundredyears.Mostof southernChinaremainedinthehandsofaboriginalpeoplesforcenturiestocome.Ref.215[290],8[14],213 [288],260[29]AdditionalNotesp.251 ForvegenerationsafterJimmu,theYamatoemperorswereverycarefulnottomixtheirbloodwiththeaborigines andtheyimportedwomenoftheirownracefromthehomeefinKorea.Eachprinceandvassalhadasmanywives ashecouldaffordandtheoldrecordstelloffamilieswith100children.Aftertherstvegenerations,Jimmu'scourt descendantsbegantomarrytheirowncousinsandalthoughtheinbreedingwasgreat,thestockwashealthyandalarge percentage,probablymorethanone-half,ofmodernJapanesearedescendedfromit.AtA.D.200theEmpressJingu issaidtohavesentavasteetofmulti-oaredshipstodominatetheKoreansandexacttribute.Ref.12[21],222 [296] 8 Thiscontentisavailableonlineat.

PAGE 263

251 Koguryocontinuedasanindependentstate,andtherewerenowothercommunitieswhichcouldbreakawayfromthe weakenedHancontrol.AttheendofthecenturypartofKoreawasforcedtopaytributetoJapan.Ref.222[296] WenotedinthelastchapterthatChinahadoccupiedNorthVietnamandChampa.InthiscenturytheHinduinuenced stateoftheChamsaroseintheareanowknownasSouthVietnam,butnorthofSaigon.Forthenext1,200yearsthey struggledtoremainindependentoftheexpandingVietandKhmerkingdoms.Funanexistedasaprosperousstatein theCambodiaandextremesouthernVietnamareas,developinganetworkofirrigationandtransportationcanalsthat madethehugeMekongRivervalleyfertileandthecountryrichwithcommerce.Burma,Thailand,Cambodiaand LaosbecamethechieflandsfortheHinayanaorLesserVehicleBuddhism.Ref.8[14],176[242],114[162] AdditionalNotesp.251 NOTE :Althoughtheexacttimeoftherstuseisunknown,thecross-bowwasinuseinChinaatleastby Hantimes,whenitbecametheprincipalweapon.Thisexcellent,lethalinstrumentwasaboutaseasytouse asahandgunandneedednospecialstrengthtocockit,whilethelongbowrequiredyearsofpracticeto developsufcientthumbandngerstrengthtodrawthebowtoitsfullarc.Technically,manufactureofthe cross-bowinvolvedamostdifcultlaminationprocedureusingwood,bone,hornandsinew,aswellasthe skilledconstructionofametaltriggerapparatus.Ref.279[191] NOTE :TheChinesemetresistanceintryingtoconquerVietnamcompletelyand,nolongerabletofeed theirarmiessofarfromtheirbases,theyhadtoretreat,allowingVietnamitshistoricalindependence.Inthe Mekongdeltaaninlandcentercalled"Oc-eo"wasasmallscaleVenice.Ithadmanygoldartifacts,including asealringwithSanskritinscription,alife-sizedHindustatueandgoldmetalfromRome,datedA.D.152. Ref.297[232] ForwardtoTheFarEast:A.D.201to300Section17.7 ChooseDifferentRegion 1.IntrotoEraSection16.1 2.AfricaSection16.2 3.AmericaSection16.9 4.CentralandNorthernAsiaSection16.5 5.EuropeSection16.4 6.TheIndianSubcontinentSection16.6 7.TheNearEastSection16.3 8.PacicSection16.8 16.8ThePacic:A.D.101to200 9 16.8.1THEPACIFIC BacktoThePacic:0toA.D.100Section15.8 Theknowntime-framesforchangesinthePacicaresoindenitethatwecannotmakeacentury-by-centuryaccount inthislargeareaoftheworld.Pleaseseeadjacentcenturies. ForwardtoThePacic:A.D.201to300Section17.8 ChooseDifferentRegion 9 Thiscontentisavailableonlineat.

PAGE 264

252 CHAPTER16.A.D.101TO200 1.IntrotoEraSection16.1 2.AfricaSection16.2 3.AmericaSection16.9 4.CentralandNorthernAsiaSection16.5 5.EuropeSection16.4 6.TheFarEastSection16.7 7.TheIndianSubcontinentSection16.6 8.TheNearEastSection16.3 16.9America:A.D.101to200 10 16.9.1AMERICA BacktoAmerica:0toA.D.100Section15.9 Inthefarnorththerewasverylittlechangefromthepreviouscenturies.Seeparticularly6thSection9.4and1st centuriesB.C.Section14.9.AboutthecentralandeasternUnitedStatesthereissomedisagreement.BrianFagan, theDistinguishedProfessorofAnthropologyattheUniversityofCaliforniaatSantaBarbara,writesthattherewas continuedHopewellexpansionwithincreasedculturaldevelopmentevenupuntilthe5thcenturyC.E.Ref.215 [290],butthe EncyclopediaofArcheology Ref.45[66]statesthattherewasarapiddeclineoftheHopewellat aboutA.D.200.WeknowthatthesoutheasternUnitedStateswasinhabitedbutwehaveavailableonlyverylimited informationatthisearlyperiod.FellRef.66[97]describesndingofwhathebelievestobeHebrewshekelsdating fromtheSecondRevoltofA.D.132invariouspartsofKentuckyandanearbydistrictofArkansas. TheMogollon,HohokamandAnasaziculturescontinuedtodevelopinthesouthwesternUnitedStates.Pleasesee adjacentmodules.TheMogollonpeoplelearnedtogrindandpolishsmallstoneslabstomakeusefularticlessuchas paintpalettes,dishesandstonesmokingpipesfortobacco.Theirspearpointswereusedwitharudethrowingstick calledtheatlatl,anancientweaponoftheAmericas.Ref.210[283],CENTRALAMERICA,ANDTHECARIBBEAN TheTeotihuacanpeopleofMexicoincreasedtheircitysizetoaneightsquaremilearea,inthecenterofwhichrose thetruncatedpyramidofthesun-210feethighand750feetsquare.Itwasaslargeatthebaseasthegreatpyramidof CheopsinEgypt.Attheheightofitsprosperity,whichwassometimeintheseearlyChristiancenturies,Teotihuacn hadapopulationof120,000withanaddednetworkofvillagessurroundingthemaincity.Over5,000buildingshave beenexaminedinthisarea,including400work-shopsformakingobsidiantoolsandweaponsandsome300potteries. Irrigationchannelsweredugforbothcityandfarmwater.Thiscenterwas30milesnortheastofpresentdayMexico City. AtIzapaontheMexico-Guatemalaborder,therewasadistinctiveartstyleresemblingtheearlierOlmecCultureand itmayrepresentaconnectinglinkbetweenthatandthelaterclassicMayaCulturewhichdevelopedtotheeast.In approximatelythissametimeframe,ElTajin,locatedintheVeracruzareaafewmilesinlandfromSantaLouisa, emergedasamajorHuastecadministrativeandreligiouscenter.TheHuastecswere"cousins"oftheMayaandEl Tajin,astheirmajorcity,sooncountedapopulationinthethousands,withhundredsofbuildings,temples,palaces, ball-courtsandcountlessindividualdwellings. OntheclassicaldatingscaletheMayancivilizationwasnearingitspeakwithmanygreatscalecitiesintheforests, particularlyinPetenandtheregionoftheceremonialcenterofTikal.Forthemostparttheywereapeace-loving 10 Thiscontentisavailableonlineat.

PAGE 265

253 peoplewhofarmed,wovecottonandmadepaperfromthebersoftheg-tree 11 .Theydevelopedasystemofwriting whichwaspartlyphoneticandbelievednowtohavebeeninheritedingreatpartfromtheOlmecs.Onthenewdating systemsthispeakperiodoftheMayasmayhavebeenabout250yearslater.PleaseseeAmerica:300to201B.C. Section12.9Ref.146[199],176[242],215[290],45[66],236[314] ItisinterestingthattheprominentBritishhistorian,HughThomasRef.213[288],deniesthattheMayahad signicantwriting,apparentlybasinghiscommentsonasinglegivenreferenceina1978 ScienticAmerican article. Buthisreference,inthe"ScienceandtheCitizen"departmentoftheMay,1978 ScienticAmerican Ref.193 [263]givesmeanentirelydifferentconcept.AlthoughadmittingthatmuchMayawritinghadbeendestroyed bytheinvadingSpanishconquistadorsinthemid-16thcentury,thearticlelistsseveralsourcesofremainingMayan hieroglyphics.Therearemanuscriptspaintedondeerskinwhichareapparentlyinmuseumsscatteredacrossthe world,astheyareknownastheDresden,MadridandPariscodexes;thenthereare64hieroglyphsthatwerewritten downin1566fortheBishopofMeridabyasurvivingMayascribe;andnallythereisalonginscriptionfound insidethreestructuresatPalenquedated7thto9thcenturiesC.E.,consistingofsome600glyphs,thetranslationof whichisstillproceedingunderanthropologistsandepigraphersfromYaleUniversity.Thepartthathasbeentranslated describestwelvesuccessiverulersofthepastanddetailsofacurrent13thrulerwithbirth,pedigree,accession,military achievements,ritualacts,etc.ofall.Moreinscriptionsturnupeveryyear,onpottery,monumentstones,buildings, etc.Thewrittenlanguageinvolvedatleast600individualglyphswhichcouldstandaloneorbeusedincombinations oftwoormore. ThiswasamajordevelopmentalperiodinCostaRicanhistorywithadramaticincreaseinsitesandpopulationalong withatrendtowardsocialstratication.Manynewartifactsappearedincludingelaboratelysculptedmetatesofvolcanicstone,ceremonialstonemace-heads,carvedjade,gurines,ocarinas,whistles,stampsandrattles.Panama developedsimilarlyandtherewereundoubtedlylongdistanceMesoamericantradenetworks.Ref.265[270] SometimeinthisorthenextcenturyParacasinthemiddleofsouthPeruwasabandoned,perhapsbecauseofasevere tidalwaveorothernaturaldisaster.SomeNazcavillages,however,survivedforseveraladditionalcenturiesandthe TiahuanacoCultureofthehighAndesremaineduntouched.ThepotatowasusedasdecorationonPeruvianpotteryas earlyastheendofthiscentury.Ref.213[288] ForwardtoAmerica:A.D.201to300Section17.9 ChooseDifferentRegion 1.IntrotoEraSection16.1 2.AfricaSection16.2 3.CentralandNorthernAsiaSection16.5 4.EuropeSection16.4 5.TheFarEastSection16.7 6.TheIndianSubcontinentSection16.6 7.TheNearEastSection16.3 8.PacicSection16.8 11 IncontrasttherewasnopaperinEuropeatthistime.Chinainventedapaperbutkeptitsecretforcenturies.SeeTheFarEast:A.D.101to200 p.250.

PAGE 266

254 CHAPTER16.A.D.101TO200

PAGE 267

Chapter17 A.D.201to300 17.1A.D.201to300 1 17.1.1A.D.201TO300 BackwardtoA.D.101to200Section16.1 Thethreegreatempires-Roman,KushanandHan-whichwedescribedinthelastcenturyallshowedsignsofdecay inthis3rdcenturyoftheChristianera.Althoughstillmaintainingitsextensiveborders,Romehadevenmoretroubles withPersiaandthelocalsituationinItalydeterioratedrapidly,sothatbytheendofthecenturytheEmperorDiocletian eventransferredhiscapitaltoNicomedia,neartheBosporusStrait.AlthoughsomeoftheKushanEmpireremainedin CentralAsia,itlostterritorybothtothePersiansandtovariousfactionswithinIndia.TheHanDynastydisappeared in220andChinaagainbecamedivided.ThegreatMayaCulturedominatedCentralAmerica. EpidemicswerewidespreadinthiscenturyandtheChristiandoctrineofcareofthesickandthefaiththatmade lifemeaningfulevenamidsuddenandsurprisingdeathgavethisnewreligionagreatboostoverpaganism,inthese difculttimes.Tertullian,oneofthegreatbelieversinthevalueofmartyrdom,asexempliedbyJesus'crucixion, eventuallylefttheOrthodoxChurchtojointheMontanists,aradical,propheticcircle,andthenevenformedhisown "church"scorningtheCatholicgroupas"thechurchofanumberofbishops".TheGnosticsneveracceptedmartyrdom asabasisofChristianbelief.Ref.163[222],140[190]Continueonpage354 ForwardtoA.D.301to400Section18.1 ChooseRegion 1.AfricaSection17.2 2.AmericaSection17.9 3.CentralandNorthernAsiaSection17.5 4.EuropeSection17.4 5.TheFarEastSection17.7 6.TheIndianSubcontinentSection17.6 7.TheNearEastSection17.3 8.ThePacicSection17.8 1 Thiscontentisavailableonlineat. 255

PAGE 268

256 CHAPTER17.A.D.201TO300 17.2Africa:A.D.201to300 2 17.2.1AFRICA BacktoAfrica:A.D.101to200Section16.2 ThekingdomofKushfellpreytodesertnomadsbutinEthiopiaAxumcontinuedasapowerful,welldevelopedentity. CoinsweremintedandmuchoftheSudantothewestwasconquered.Ivory,rhinoceroshorn,hippopotamushides andslaveswereallexportedthroughtheRedSeaharborofAdulis.Unfortunatelyevenatthisearlyperiodexcessive rainswithooding,alongwithforestclearingandcultivationofhilltopsandslopeshadstartedsoilerosionthatwas toeventuallybepartofthedownfallofthisunusualkingdom.Ref.175[241],270[36] Egyptianprestige 3 begantodeclineunderdestructivefactionalism,amassacreofalladultmalescapableofbearing armsbyEmperorCaracallatopreventrevolt,hightaxes,listlessforcedlaborandRome'sannualexactionofgrain. SeatradefromtheMediterraneanwentprincipallyuptheNiletoThebes,thenovertotheRedSeaandonbyboat.The refurbishedNile-RedSeacanalwasadisappointmenttotheRomansasithadbeentothePtolemiesandthePersians becausewindsinthenorthernRedSeawereunreliableandmerchantsdidbetterwiththeNiletoThebesroute.Atthe lastofthecenturyto272,QueenZenobia'sconqueringofEgyptandsiegeofAlexandriaresultedinthedeathof halfthepopulationandhelpedEgypt'sdecline.SeeIRAQANDSYRIA,belowInA.D.272Egyptwasreconquered byRome.Ref.136[187] RomecontinuedtodominatethecoastlineofnorthAfrica,butinthefarnorthwestMoorishchieyBerberculture andactivityincreasedwithexpansionoftheterritorytheycontrolled.ThecitiesoftheSaharahadaourishing commercewithcoastalcities,probablysendingpreciousstones,slavesandivoryfortrade.Ref.83[123] AtthistimetherewasthebeginningofthedevelopmentoftheEmpireofGhanaatthenortherncurveoftheNiger River.ThevillageofJenne-jeno,whichwehavepreviouslymentioned,mayhavebeenapartofthisprocess.Onthe easttheironandcattleculturesspreadalmostcompletelytothesoutherntipofAfrica.Blackburnwasestablished inA.D.105andtheuseofironspreadfromtheFunaRiverofftheCongotoKatangaandtheLakesregion.In thesouthwest,theKhoikoipeoples,speakingtheKhoisanlanguage,onlyslowlygavewaytotheaggressiveBantuspeakers.Indonesiantradersappearedinincreasingnumbersalongtheeastcoastinthisandthefollowingcenturies. ForwardtoAfrica:A.D.301to400Section18.2 ChooseDifferentRegion 1.IntrotoEraSection17.1 2.AmericaSection17.9 3.CentralandNorthernAsiaSection17.5 4.EuropeSection17.4 5.TheFarEastSection17.7 6.TheIndianSubcontinentSection17.6 7.TheNearEastSection17.3 8.PacicSection17.8 2 Thiscontentisavailableonlineat. 3 Diophantus,aGreekofAlexandria,wroteatreatiseofalgebra,solvingdeterminantquadraticandindeterminateequationsuptothe6thdegree, inaboutA.D.250.

PAGE 269

257 17.3TheNearEast:A.D.201to300 4 17.3.1THENEAREAST BacktoTheNearEast:A.D.101to200Section16.3 JordanbelongedtotheRomans,butmostofArabiawasuntouchedbytheRomanarmies.Inthesouthofthepeninsula thecitiesbegantodeclineandthenomadsagainassumedrule.BytheendofthecenturytheAksumitekingsof EthiopiawereincontrolofYemenandtheSassanianKingShapurannexedOmanontheArabianGulfshoreabout A.D.260.Ref.8[14] LebanonwasapartofRomancontrolledSyriaandevenJudeawasnon-existentasaseparateJewishstate.The commonpeopleofmostoftheseareastendedtoremainunchanged,centuryaftercentury,however,andbasicallyonly thegovernmentsshifted. AtthebeginningofthecenturytheRabbiJudahcodiedJewishlaw,bothcivilandreligious,inaworkcalledthe "Mishnah"whichbecamethebasisofcontinuousstudyintheMiddleEastandwaslaterpreservedintheTalmud. Ref.8[14] AsthecenturyopenedthisentireareawasdominatedbyRomebutintheoldareaofMesopotamiainwesternIraqthe PersianKingArdashirinvadedaboutA.D.230,butshortlywithdrewagain.ThiswasfollowedinA.D.260byShapur IwithcloudsofcavalrythatraidedthroughoutallofSyriaandreturnedtoPersialadenwithspoilsandthe RomanEmperorValerian.whowascapturedatEdessa,whereSyriajoinsAsiaMinor.Itwasonlyafterthisthat OdenathusoftheSeptimiitribe,governorofPalmyrainSyria,crownedhimselfapuppetkingundertheRomans andpromptlydrovethePersiansbackacrossMesopotamia,defeatingthemnallyatCtesiphon,theancientPersian capitalnearpresentBaghdad.HethendeclaredhimselfkingnotonlyofSyriabutofCilicia,Arabia,Cappadocia andArmenia.AfterhisassassinationinA.D.266hissontookhistitle,buthiswidow,Zenobia,tookhispower.She beautiedthecapitalandbroughtscholarsandartiststohercourt,butalsofoundtimetoleadanarmyintoAsiaMinor, conqueringCappadocia,GalatiaandmostofBithynia.Then,withagreateetandarmysheconqueredEgypt.The RomanEmperorDomitiusAurelianussoonreconqueredthisland,however,andthenhisarmiesproceededtobeat PalmyrafromagreatcentralSyriancityof30,000peopletoadesertvillageasithadbeenbeforeandremainsyet today.Ref.48[72],136[187] PersiancitiessatonthesilkroutefromChinatotheRomanEmpireandregardlessofthelocaladministrationand anyhostilities,thePersianscontrolledthistrafc.RayynearmodernTehranaswellasHeratnowovertheborder inAfghanistanbecamemajorcitiesandenjoyedgreatprosperity.InaboutA.D.224,ArdashirI,originallyafeudal lordofPersia,overcametheweakenedParthianArsacidDynastyandbecamekingofallthePersians,foundingthe SassanianorSassanidDynasty.ThisfamilystronglyidentiedwiththeoldAchaemenianEmpireandZorastrianism wasrestoredasthestatereligion.NewconquestswereundertakenasArdashirinvadedSyriaalthoughhismain purposewastodethroneandkilltheArsacidkingwhowasrulingArmenia.Ardashir'ssuccessor,ShapurI,-271 builtanewcityinhishomeprovinceofFars,theSassanian"Versailes",andhealsopromotedagricultureandseveral irrigationsystems.Asmentionedabove,however,heismostfamousforhisextensivecavalryraidsthroughoutSyria andhiscaptureoftheRomanEmperorValerianatEdessa.ThousandswerekilledinAntiochandTarsuswasabout 4 Thiscontentisavailableonlineat.

PAGE 270

258 CHAPTER17.A.D.201TO300 destroyed.VictorymayhaveresultedastheresultofthePersiancavalry'suseofdamasksteelsabres,superiorto anythingmadeintheWest.SeeSUBCONTINENTOFINDIA,thischapter.Shapureventuallywentdowntodefeat atthehandsofOdenathus,anArabprincefromPalmyra,whosetroopschasedthePersiansbackanddefeatedthemat Ctesiphon,aswehavenoted.Ref.48[72],18[31] InA.D.242Manibeganhisreligiousteachings,takingZorasterismasabasebutacceptingMoses,JesusandBuddha asprophets.HetraveledtoTurkistan,IndiaandChinaandhisideasspreadwidely,becomingafruitfulroot-stock ofChristianheresiesforalmostathousandyears.Ref.229[307]AtrstShapurfavoredMani,butlaterhewas banishedandwhenShapur'ssecondson,VarahranIbecamekingin272Maniwasexecuted.Ref.119[166] TheentireAnatolianpeninsulawaspartoftheRomanEmpire,butthiswasaneraofmultipleraidsfrombothnorth andsouth,withtheGothsandotherRussiantribescomingdowntoravagethecitiesoftheBlackSeasuchasPontus, Chalcedon,Nicomedia,etc.,whilethePersianslateroverranCiliciaandCappadocia.ItwasinEdessa,thenpartof Syria,butnearthemoderncityofUrfa,TurkeythatthePersiankingShapurcapturedValerian.Thiswassomewhat nulliedastheQueenMotherZenobiatemporarilytookoveradditionalterritoryinthisregion.Bytheendofthe centuryRomanrulehadbeenprettywellrestoredandtheEmperorDiocletianestablishedhiscapitalfortheentire empireatNicomedia.GreekwaswrittenandspokeninthiseasternRomancapitalexceptforpurelyadministrative andoccasionalliterarypurposes.Thegreatplaguewhichreachedmostoftheempireinthemiddleofthecentury struckPontusparticularlyviolently.Ref.136[187],127[176],222[296] Thepuppetking,Chosroes,wasoftheIranianArsacidline,andasnotedabove,hewasmurderedbythePersian ArdashirIandArmeniacameunderthePersianwing.InA.D.284,afterQueenZenobiahadnallybeendefeated, EmperorDiocletianhelpedTiridates,thesonofChosroes,toagainascendthethroneofthiscountry. ForwardtoTheNearEast:A.D.301to400Section18.3 ChooseDifferentRegion 1.IntrotoEraSection17.1 2.AfricaSection17.2 3.AmericaSection17.9 4.CentralandNorthernAsiaSection17.5 5.EuropeSection17.7 6.TheFarEastSection17.7 7.TheIndianSubcontinentSection17.6 8.PacicSection17.8 17.4Europe:A.D.201to300 5 17.4.1EUROPE BacktoEurope:A.D.101to200Section16.4 5 Thiscontentisavailableonlineat.

PAGE 271

259|GREECE|UPPERBALKANS ThisentireareawasanintegralpartoftheRomanEmpireandwasadministeredinthreeparts:TheDaciandiocese, comprisedofeasternYugoslavia,westernBulgaria,MoesiaSuperior,Daciaandsomesmallerareas;theMacedonian dioceseconsistingchieyofGreece;andtheThraciandiocese,whichwasmadeupofeasternBulgariaandthe EuropeanpartofTurkey,whichinturn,includedLowerMoesia,Scythia,Thrace,etc.OftheseonlyDaciausedthe Latinlanguage,whiletheothersallspokeGreek.TheGothsarrivedintheBlackSeaareabyA.D.214andsoon occupiedalltheregionwestofthissea,splittingintotwodivisions,tobeknownasOstrogothsEastGothsand VisigothsWestGoths.TheybattledtheRomansinthisareathroughoutthecenturyandtheRomanEmperorDecius wasslainbytheminDaciaastheRomanswithdrewinA.D.275tosafetysouthoftheDanube.ManynativeDacians tooktothehillswiththeirLatinlanguage,toreappearcenturieslaterasancestorsofthemodernRomanians.Gallus,a formerlegateofMoesiachieytheareaofBulgaria,becameemperorofRomein251.In268ClaudiusIIGothicus becametherstofaseriesofemperorsfromIllyria.TheywereacapablegroupandpreparedthewayforDiocletian. Ref.127[176],206[83],48[72] Althoughalreadydiminishedbysomeseverepestilence,thepopulationofRomeatthebeginningofthis3rdcentury wasatleastonemillion.Anepidemichitagainbetween251and266,with5,000dyingeachdayatitspeakinRome andwiththeruralpopulationsalsoheavilyaffected.Thediseasemayhavebeeneithermeaslesand/orsmallpox.Civil disordersandbarbarianinvasionssimplyaddedtotheproblem.VacancieswithinthelegionsontheRomanfrontiers, causedbydeathsfromdiseaseandmutinies,resultedininvitationstothebarbarianstobothenterthelegionsandsettle thelands.Rapiddie-offaroundtheentireMediterraneanhamperedcommerceanddiminishedtheowofcashtothe imperialtreasuryandthisresultedinnopayforthesoldiers,thusfurthermutinies,militaryuprisingsandcivilwars inoutlyingareas.Ref.140[190]Armiesindifferentprovincestriedtosetuptheirowncommandersasemperors the"ThirtyTyrants",butthissituationwaseliminatedbetween268and284.Ofcoursealmostconstantwarwiththe powerfulPersiansintheeastdidnothelpandasuccessionofemperorsofanarchycameandwent,usuallybymurders. Theresourcesoftherichwereconsumedbywarandbythegovernment.ThemenialworkofRomewasperformed byabout400,000slaves,withevenmiddleclasscitizensowningabout8andtherichfrom500to1,000.Ref.222 [296] Theeasternpartoftheempirewasmomentarilysavedinname,ifnotintruth,byOdenathusandZenobia,aswehave reportedinthesectiononTHENEAREAST.GaulhadrevoltedandassumeditsownautonomyunderrstPostumus andthenTetricus.Aurel-ian,emperorfrom270to275,however,temporarilyrestoredGaul,SpainandBritainto thefoldandbuilttheexistingwallsofRomeasaprotectionagainstfutureincursionsbybarbarians.Tokeepthe expandingpoorofRomereasonablyhappy,Aurelianaddedfreepork-fatandwinetothe"Annona",aswellasgiving breadinsteadofjustgrain.Inordertopaytroops,thegovernmentgraduallydebasedthesilvercurrencyandalong withdevaluationthisculminatedinrapidination.Increasinglyslaveswereusedinallcapacities,eveninpositionsof dependentmanagementoffarms,shops,shipsandbanks.Ref.8[14] ThewholeRomanrealmhadashortperiodofpeaceunderoneoftheBalkanemperors,Probus,untilhistroopsmurderedhimin282.ThenDiocles,orDiocletian,amanofgeniusandstatesmanshipbecameemperorandreorganized theempire.AnativeIllyrianandDalmationsoldier,heabandonedRomeandmadehisheadquartersatNicomedia,a fewmilessouthofByzantiuminAsiaMinor.Hedelegatedcontrolofthewesternhalfoftheempiretohisgeneral, Maximian,asco-rulerinthecityofRavenna,Italy,andthenmadeextensivepoliticalreformsincludingthedivisionof theempireintofourmajorprefecturesandthenformingfurthersubdivisionsasdiocesesandnallyprovinces.Ref. 28[48]Atthattimetheempirewassaidtohave435,000menunderarms,chieyinfantry.FinallyDiocletian, fallingpreytothecommoncurseofancientmenofpower,claimedthathewastheearthlyembodimentofJupiter, whileMaximianconsentedtobeHercules.Thisidenticationofgodandkingmeantthenalfailureofrepublican institutionsofantiquityandareversiontotheformsandtheoriesofAchaemenidandEgyptiancourts.FromthisorientalizedmonarchcamethestructureandformofByzantineandtheEuropeankingdomsuntilthetimeoftheFrench

PAGE 272

260 CHAPTER17.A.D.201TO300 Revolution.Allthatwasneedednowwastoallytheorientalmonarchinhisorientalcapitalwithanorientalfaith. ByzantinismbeganwithDiocletian.Ref.48[72],127[176] AstheGermanictribesmigratedwestward,behindthemtheSlavsbegantocrosstheElbeandlterintomodern Bohemia,MoraviaandpartsofeasternGermany.TheMarcomanni,whowerealreadyinthisarea,raidedwestward andsouthward,evenintoItalyitself.TheFrankishtribesinvadedacrosstheRhineandalongwiththeAlemannialso attackeddirectlyintoItaly.InbattlesfromA.D.270to275theEmperorAureliannallystoppedtheseinvasions andheldtheGermanictribesessentiallyattheRhineonceagain.InthePannoniandiocese,whichincludedmostof Austria,HungaryandthewesternedgeofYugoslavia,theAsdingbranchoftheVandalshadreplacedtheIazygiansas thedominantelementinthesouthernportion,whiletheGepidsrelatedtotheGothsoccupiedthenorth.Ref.136 [187],127[176] Spainbecamealargescaleproducerofwine,oliveoilandotherproducts,includingadelicioussh-paste.Some insurrectionsinthiscountry,asinotherpartsoftheempire,wereeventuallyputdownbyAurelian.Revoltleaders PostumusandTetricusinGaulwerealsoeventuallydefeated.InBelgiumtheFranksswepttheGaulicCeltsinto thesouth,givingrisetotheoriginallanguagebarrierwiththenorthernGermanictonguedominantatthattime.In England,lateinthecenturythepiratesweresonumerousaroundthecoaststhatCarausius,whohappenedtobea Belgiansailor,wasassignedbytheRomanauthoritiestocleartheNorthSeaandthechannelofthesebrigands.He didso,usingmercenariesofGermanicandFrankishorigin.ButhemadeenemiesinRomeandwasmurderedin A.D.293byhisnanceofcer,Allectus,whothenkeptEnglandindependentofRomancontrolforthreeyears,until ConstantiusChlorusre-conqueredtheareausinganewnavyandfreshtroops.Ref.8[14],43[64],136[187], 24[44] InthisareathemostsignicantchangefromrecentcenturieswasthereplacementofallLappsandFinnsinDenmark byGermanictribesbyA.D.250.IncludedinthelattergroupwerethedenitiveDanes.Romancoinsofthe3rd centuryhavebeenfoundonIceland,presumablytakentherebytheRomanEmperorConstanswhosailedinpursuit ofCelticpirateswhohadraidedWalesandthenledtheirpursuertoanarcticisland. Ref.175[241],66[97] Travelingfromnorthtosouthinthisregion,wewouldndFinnsinthesparselysettledfarnorth,butsouthofthem goingfromwesttoeastalongtheBaltic,wewouldndrsttheBalts,thenalargeareaofSlavsandnally,justnorth oftheBlackSea,variousIraniantribes,includingtheRoxolaniandAlans.ByA.D.300theOstrogothshadexpanded eastwardacrosstheUkrainetodominatetheRoxolani,butotherwisetherewasnotmuchchangethroughoutthis centurywiththepossibleexceptionthattheremayhavebeensomeTurkish-speakingHunnishpeoplealreadydrifting intothisarea.Ref.136[187],127[176] ForwardtoEurope:A.D.301to400Section18.4 ChooseDifferentRegion 1.IntrotoEraSection17.1 2.AfricaSection17.2 3.AmericaSection17.9 4.CentralandNorthernAsiaSection17.5 5.TheFarEastSection17.7

PAGE 273

261 6.TheIndianSubcontinentSection17.6 7.TheNearEastSection17.3 8.PacicSection17.8 17.5CentralandNorthernAsia:A.D.201to300 6 17.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:A.D.200to301B.C.Section16.5 IntheregionsofAfghanistanandwesternTurkestantheKushanEmpiresplitintoseveralprincipalitiesandthePersian Sassanidsappeartohaverapidlyestablishedsomedominanceoverthenearestofthese,buttheirclaimtohavemade theOxusandtheIndustheirfrontiersseemsover-stated.TheKushanstatescertainlycontinuedtoexistaspolitical entitiesuntilthe5thcentury.WiththefalloftheHanDynastyinA.D.220,ChinalostcontrolofeasternTurkestan, andtheKushans,withsomePersianinuence,onceagaingainedcontrol.StillfarthernorththeHunnishtribeswere ourishing. Bytheopeningofthiscenturyallpartsofthe2,500miletraderoutefromSyriatotheTarimBasinwereunderpressure bybarbariansandagreatdealofthetradehadalreadyshiftedtosealanesintheIndianOcean.Alongthesilkroute, however,artourishedfromthiscenturyforthenext700yearsasaremarkablecombinationofstylisticelements drawnfromIndia,PersiaandChina.Stonewasscarce,butdecoratedwoodpiecesandtemperapaintingonwoodwas common.Ref.136[187],8[14],19[32] ForwardtoCentralandNorthernAsia:A.D.301to400Section18.5 ChooseDifferentRegion 1.IntrotoEraSection17.1 2.AfricaSection17.2 3.AmericaSection17.9 4.EuropeSection17.4 5.TheFarEastSection17.7 6.TheIndianSubcontinentSection17.6 7.TheNearEastSection17.3 8.PacicSection17.8 17.6TheIndianSubcontinent:A.D.201to300 7 17.6.1THEINDIANSUBCONTINENT BacktoTheIndianSubcontinent:A.D.101to200Section16.6 TheKushanruleinIndiafadedaway.Ujjain,inMalwa,continuedasacapitalandcenterwithacontinueddynastyof WesternSatraps.TheBuddhistcommunitywasnowdenitelydividedintoHin-ayanaandMahayanagroups,butin thefarsouthHinduismwasthemoreimportant.BrahmancolonieswithHinduismandthecastesystemwereimported fromtheGangesValleyatvariousperiodsandendowedbylocalrulers.ThiswasdoneinBengal.About225in Maharashra,thebreak-upoftheSatakaniEmpireledtotheestablishmentoftheTraikutkaDynastyfromlocalpastoral tribes.TheyeventuallyeventookoverthethroneatUjjain. 6 Thiscontentisavailableonlineat. 7 Thiscontentisavailableonlineat.

PAGE 274

262 CHAPTER17.A.D.201TO300 Sanskritnowbegantoberevisedasamorecommonlanguage,afterseveralhundredyearsofpartialbanishment.This attestedtheprestigeoftheBrahminicaltraditionandprovedtheeffectivenessofthenumerouseducationalinstitutions oftheland.Itmightbeappropriatetoinserthere,thatnotalloftheBrahmancastewerepriests.Althoughtheywere, inHindutradition"borntwice",onceatdeliveryandonceatagesixwhenadoublestrandedgutofsacredthread wasloopedaroundtheirnecks,theirprivilegeswerenotnecessarilyeithereconomicnorpurelyreligious.Somewere poorfarmers,somemailmen,someworkersofothertrades,butallsupposedlylivedbymanydailyrituals.Ref.119 [166],37[58] PossiblyoriginatinginIndiainthiscenturyotherwiseinChinawasahighqualitycarbonizedsteelmadebyacrucible smeltingprocessunknowninEuropeuntilthe19thcentury.ThiscametobeknownasDamascusordamasksteelin Europeandwasusedparticularlytomakeswordsofamazingsharpness.IngotsofthiswereexportedfromIndiato theFarEast,Arabia,Syria,RussiaandPersia.Ref.260[29] ForwardtoTheIndianSubcontinent:A.D.301to400Section18.6 ChooseDifferentRegion 1.IntrotoEraSection17.1 2.AfricaSection17.2 3.AmericaSection17.9 4.CentralandNorthernAsiaSection17.5 5.EuropeSection17.4 6.TheFarEastSection17.7 7.TheNearEastSection17.3 8.PacicSection17.8 17.7TheFarEast:A.D.201to300 8 17.7.1THEFAREAST BacktoTheFarEast:A.D.101to200Section16.7,ThreeKingdomsto280,thenChin AtthebeginningofthecenturythecapitalwasatLo-yangandnortheasternChinagrewinimportance.TheHan EmpirenowreachedasfarsouthasHaiphong,but"Theforceoftheimperialunityplayeditselfoutin220,when thelastoftheHanemperorsofciallyabdicatedatthebiddingofageneralwhohadalreadykepthimincustodyfor severalyears."Therefollowedaperiodofdisorderedlifeandastalematedcivilization,duringwhichtimethere werethreekingdoms:Wei,inthenorth,directlyfollowingtheHanDynasty,underTs'aoP'ei;Wu,inthesoutheast, basedatNankingunderSunCh'u an;andShu,controlledbyLiuPeiandbasedatChengtuinthesouthwest.Liu Peiandhisfamily,originallylieutenantsofGeneralTs'aoTs'oa,protectorofthelastoftheHans,thenbecamethe greatestenemyoftheWei,givingrisetolegends,ctionanddramainChinaforcenturiestocome.Evenso,ShuHan wasabsorbedbyWeiinA.D.263andWugavewayin280,endingtheThreeKingdomsera.Inthemeantime,the Ssu-mafamilygeneralshadtakenoverWeiandchangedthenametoChin,andforagenerationafter280Chinaagain hadafragileunity.Thepopulationatthattimewasonly16,163,0009adropfrom55,000,000inthemiddleofthe 2ndcentury.Aseverepestilencewasamajorfactorinthispopulationdecline,asinEuropeatthesametime,butat leastpartofitwasduetowide-spreadcannibalism.Chinahadenteredherfourcenturiesof"darkages".Thesouthern Hsiung-nulivedonthefrontierasahostileminorityandthelongdelayedclashwasabouttooccur.Ref.8[14],139 [192],68[106],101[146] 8 Thiscontentisavailableonlineat.

PAGE 275

263 MoChingwrotethePulseClassic,anintensivemethodofdiagnosisfromstudyofthepulse,aprocedurestillused inChinaandwhichhadoriginallybeendescribedinthe6thor5thcenturyB.C.ChangChung-chingwroteaclassic treatiseon"TyphoidandotherFevers"anditwasperhapsinthiscenturythatKoHungdescribedberiberi,hepatitis, andplagueandgaveanearlyreportonsmall-poxwithanaccuratedescriptionofthepustules.Chinesemedicine continuedtoprogressfromthistimeuntilthe10thcentury,whenitbecamestatic.Althoughsugarcanewasknown nearCanton,itwasnotcommutedtosugar,proper,andhoneyremainedtheuniversalsweetener.Ref.136[187], 125[173],213[288] SometimebetweenA.D.200and250the10themperor,Sujin,hadtheroyalbronzemirrorandtheswordp.237 enshrinedoutsidethepalaceforalltoseeandadmire.Themirror,called"themirrorofknowledge"washousedat ashrinecalled"Ise",whicheventodayisaprimeholyplaceofJapan.TheYamatoCultureofKoreanoriginwas introducedwithironimplementsandmegalithicburials.Handicraftsweresoonorganizedintoguilds.Beneaththis artisanclasswasaslaveclass,recruitedfromprisonsandbattle-elds.Socialorganizationwaspartlyfeudal,partly tribalandeachclanhadasovereignhead.Governmentwasprimitivelylowandweak,althoughitwasaperiodof geographicalexpansionandvictoryovertheAinu.Ref.12[21],19[32] Thiswasaperiodofsometurmoil,withearlycenturyinvasionsbyKungsunManchuriansandlatecenturyconquests bytheChineseoftheWeiDynasty.AboutA.D.250northerninvadersestablishedthestateofPaikche,inthesouthwest. BurmawasunderIndianinuenceandbythiseraHindupeopleshadestablishedcommercialsettlementsonthe coastandrivermouths.ThesesettlementsdevelopedintosmallkingdomsincontactwithTibeto-Burmesetribes. Champa,Funan,VietandKhmerkingdomscontinuedrivalries.TheChinesecontrolledHaiphonganditisprobable thatChineseandIndiantradersmetatGoOcEoinsouthernCambodia,fromwhencetheIndianscarriedtheChinese goodsonacrosstheMalayPeninsulaandontoIndia.FromA.D.200ontheislandkingdomsofIndonesiaderived theircivilizationfromIndia,throughcontactswithHindutradersandBuddhistmonks.Ref.8[14],176[242] REFERENCEQuotationtakenfromMcNeillRef.139[192],page324. ForwardtoTheFarEast:A.D.301to400Section18.7 ChooseDifferentRegion 1.IntrotoEraSection17.1 2.AfricaSection17.2 3.AmericaSection17.9 4.CentralandNorthernAsiaSection17.5 5.EuropeSection17.4 6.TheIndianSubcontinentSection17.6 7.TheNearEastSection17.3 8.PacicSection17.8 17.8ThePacic:A.D.201to300 9 17.8.1THEPACIFIC BacktoThePacic:A.D.101to200Section16.8 9 Thiscontentisavailableonlineat.

PAGE 276

264 CHAPTER17.A.D.201TO300 Pleaseseetheseveralprecedingandthefollowingcenturies. ForwardtoModuleThePacic:A.D.301to400Section18.8 ChooseDifferentRegion 1.IntrotoEraSection17.1 2.AfricaSection17.2 3.AmericaSection17.9 4.CentralandNorthernAsiaSection17.5 5.EuropeSection17.4 6.TheFarEastSection17.7 7.TheIndianSubcontinentSection17.6 8.TheNearEastSection17.3 17.9America:A.D.201to300 10 17.9.1AMERICA BacktoAmerica:A.D.101to200Section16.9 ForinformationconcerningtheDorsetInuitsofthefarnorth,pleaseseethe6thSection9.4and1stcenturiesB.C. Section14.9andthe9thcenturyC.E.Section23.9ForthenorthwestcoastalIndiansseetheprevioustwoorthree centuriesunderthissamecategory.BarryFellRef.66[97]insiststhatthroughoutthelastpre-Christianandthese earlyChristiancenturiestheNewEnglandCelts,whichhehasdescribed,graduallymigratedwiththeirIndianwives andchildrenacrossCanadawestwardeventuallyreachingBritishColumbia.Hereportsthatmuchofthevocabulary andgrammaroftheTakhelnelanguageoftheFraserLakesareaspokenyettoday,isaCreoleCeltictonguerelated toGaelicandderivedfromGodelic.InAmericaRef.66[97]helists54wordsstillusedtodaybytheTakhelne peoplealongwiththeGodelicandGaelicwordsandtheirmuchdifferentEnglishequivalents 11 .Thetableisquite convincing,butwhyisthisnotevencommentedonelsewhereintheliterature? SometimeintheseearlyChristiancenturiesthe"EfgyMound"CulturedevelopedintheupperMississippiValleyasa regionalvariationoftheHopewellCulture.TheretheIndiansbuiltgiganticmoundsintheformofanimals-panthers, lizards,deer,bearsandbirds.Mostofthemoundshadburials,oftenatcriticalpartsoftheguresuchasattheheart, hiporknee.Althoughprobablyofreligioussignicance,noonereallyknowswhattheseMinnesotaandWisconsin moundsactuallymean.Ref.215[290]ThesoutheastIndianswillbediscussedatmuchlengthinlaterchapters. InthesouthwesttheMogollon,HohokamandAnasazipeoplescontinuedtheirdevelopment.Amoredetailedlookat theircultureswillbegiveninlatercenturies,correspondingtothetimeoftheheightsoftheirdevelopment.,CENTRALAMERICA,ANDTHECARIBBEAN WehavementionedpreviouslyrdcenturyB.C.Section12.9thatrecentexcavationsnearCobaontheYucatan peninsulahaverevealedmuchoftheLatePre-ClassicMayaperiod.Thepeakofthiscivilizationappearstohave beenreachedinthis3rdcenturyC.E.andthendinghaveincludedtheNohosmulpyramid,rising157feetoutofthe 10 Thiscontentisavailableonlineat. 11 Ref.66[97],page198.

PAGE 277

265 jungle,5.4squaremilesoftemplebuildings,streetsandplazas,187milesofroadsandstreets,some80feetwide withtrafccirclesandunderpasses 12 .Thisdevelopmentapparently followed theGuatemalaMayaSociety,although itisknownthatbyA.D.250therewasatrueurbanMayanzonepersistingatKaminaljuyuatthesiteofpresent dayGuatemalaCity.ThiswasthebeginningofthegreatesteraofMayacivilization,withoneoftheearliestlarge, ceremonialcentersatTikal,datingtoA.D.292,inwhatiscalledtheearlyClassicperiod.Therewasastrongcentral MexicanTeotihuacnpresence,asthatcitywascontinuingdevelopmentwithobsidianminingasamajorenterprise. Ref.215[290],45[66] TheMayas,evenforgenerationsaftertheirpeak,spokeoftwodistinctcultureheroes,ItzamnaandKukulcan,both bearded,althougharrivingatdifferenttimesandfromoppositedirections,leadingtheMayastoYucatan.Their legendssaidthatthelargestandmostancientimmigrationwasfromtheeastthroughtheoceanandledbyItzamna, guide,instructorandcivilizer.Kukulcan,alaterarrival,wasdifferent-arrivingwith20menwearingowingrobesand sandals,withlongbeardsandbareheads,orderingthepeopletoconfessandfast 13 .HeallegedlyfoundedMayapan andcausedmuchbuildingatChichenItza,andtaught"peace".Hishumanitarianteachingscoincidecompletelywith thoseofQuetzalcoatl,ofthelaterAztecs."Kukul"istheMayawordforquetzalbirdand"can"isaserpent. AcoloredpaintingfromaninteriorchamberofapyramidatChichenItza,copiedbyMorris,CharlotandMorrisin 1931andnowdestroyedbyhumidityandtouristsshowedaseashorebattleinvolvingtworacialtypes,onewith whiteskinandlong,owingyellowhairarrivinginboats,andtheothertypedark-skinnedandwearingfeathered headdressesandloincloths.AreedvesselonthepyramidpaintingrecallsthereedboatsusedatLuxusinMorocco andtheoldEgyptianpaintingsofreedboatsoftheNile.Wheredidtheseblondmencomefrom?Wedoknowfrom writtenaccountsofthediscoveryoftheCanaryIslandsbyEuropeansafewgenerationsbeforeColumbus,thatthose islandswereinhabitedbyamixedpopulationcalled"guanches"-somesmall,swarthyandnegroid,otherstall,whiteskinned,blondandbearded,alljustliketheMayapyramidatYucatan.TheBerbersofNorthAfricaweresimilarly mixedandremainsotoday.Blondandred-hairedpeopleareknowntohavebeenintheCaucasianplainseastofAsia MinorandnowhereonthecontinentisredhairmorecommonthaninLebanon.Ref.95[140]So,dowetakeour pick?AsfurtherconrmationofthepresenceofbeardedmeninthisCentralAmericanarea,wehaveStephensRef. 203[277]accountofhisexplorationofCopan,Honduras,inthe1830s.Hedescribesndingmultipleidolswiththe malesallidentiedbybeardsandsomewithmustaches.ThebeardswerelikethoseonEgyptianstatuesbutthelatter didnothavemustaches.Oneoftheat-toppedaltarsdescribedhadornamentssuggestingthetrunksofelephants!All ofthemonumentsatCopanhadsculpturesandhieroglyphics. InsouthernPerutheremainingNazcaIndiansmadefancifulbirdsandanimalsofgoldmetalsheetsanddecorated theirpotterywithanimals,demonsandgeometricformsinmultiplecolors.Theirtextileworkwasalsointricateand colorful.WeassumethattheTiahuanacopeoplecontinuedtoliveinthehighcountryalthoughnoparticulardatings fromthiscenturyhavebeenrecorded.AcrockofcoinsofalltheRomanemperorsoftherstthreecenturiesafter ChristhavebeenfoundburiedonthecoastofVenezuela.Nooneknowsthesourceofthesecoins.Ref.176[242],66 [97]AsthisisbeingwrittenanewspaperitemreportsthendingofhundredsofpiecesofRomanamphoraeatthe bottomofaBrazilianbay.TheunderwaterarcheologistresponsibleanticipatesndingasunkenRomanship,soon, andtheamphoraewillbedatedwithsomeaccuracybythepotteryluminescencemethodinthenearfuture,butheis condentthatthedatewillbethe2ndor3rdcenturyC.E. ForwardtoAmerica:A.D.301to400Section18.9 ChooseDifferentRegion 1.IntrotoEraSection17.1 2.AfricaSection17.2 12 OneofthestrangefeaturesofallearlyCentralAmericansocietiesisthefactthatnoneofthemusedthewheel.Children'stoycartswithwheels havebeenfound,butnowheelswereusedotherwise.Oneexplanationhasbeenthatthejunglesandmountainsmadewheelsuseless,andyetwhy weretheynotusedincitieswithmilesandmilesofroadsasjustdescribed? 13 Thislegendfrom LasCasas'HistoriadelasIndias of1559,asrelatedbyHeyerdahlRef.95[140],pages113and114.

PAGE 278

266 CHAPTER17.A.D.201TO300 3.CentralandNorthernAsiaSection17.5 4.EuropeSection17.4 5.TheFarEastSection17.4 6.TheIndianSubcontinentSection17.6 7.TheNearEastSection17.3 8.PacicSection17.8

PAGE 279

Chapter18 A.D.301to400 18.1A.D.301to400 1 18.1.1A.D.301TO400 BackwardtoA.D.201to300Section17.1 Althoughthebeginningshadbeenseenearlier,thiscenturyisusuallylistedasthecrucialoneforthefallofRome. CentralandwesternEuropebecamemoreandmoreimportantasbothCelticandGermanicpeoples,nowmoreorless "civilized",begantodominatetheirrespectiveareas.TheNearEastslowlydeclinedastheRomanEmpirewaned, withonlyByzantiumshowingsignsofvigorouslife.EvenChinawasindisarrayandIndiawasprobablythemost stableandprogressiveofalltheOldWorldareasatthistime. ThenewlyorganizedChristianChurchbegantomakeitselffeltinworldaffairs,eventhoughtherewasalreadya splittingoftheChristiansintomanyfactions.TheCouncilofNicaeain325condemnedArianismasheretical,tobegin oneofthemajordivisions.ThepriestAriushadsubordinatedthe"Son"tothe"Father".Otherheresiesincludingthe Manichists,DonatistsandMonophysiteswillbementionedbelow.Inthemainlineofthechurch,the"elders"were alreadybeingsupersededbyahierarchyofbishopsandnowafull-scalediocesanframeworkappeared,modeledon thatoftheRomanEmpire.Threeofwhathavebeencalled"thefourfathers" 2 oftheLatinchurchlivedinthiscentury: St.Jerome-400,translatoroftheBiblefromGreektoLatin;St.Ambrose-397,ArchbishopofMilan, whowroteDutiesoftheClergy;andSt.Augustine-430,BishopofHippo,whointroducedanessenceofGreek philosophyintoChristianity.Thefourth"father",PopeGregory,weshallmeetinthe6thcentury.Ref.213[288] InA.D.367Athanasius,thepowerfulArchbishopofAlexandriaorderedallapocryphalbookswith"heretical"tendenciestobepurgedanditisprobablethattheGnosticGospelsreferredtoinpreviouschapterswerehiddenatthistime. InthesectiononASIAMINORinthischapter,weshallexaminetheeffectoftheEmperorConstantinetheGreaton Christianity. ThusfarwehavelimitedourdiscussionsoftheJewsandtheirreligiontothesectionsonISRAEL,butsincemany werewidelydispersedaftertheRomano-JewishWars,itseemsappropriatetorelatethefateofthesepeopleonan internationallevelfromthischapteron.TheadoptionofChristianityintheRomanEmpireinthiscenturymade 1 Thiscontentisavailableonlineat. 2 Reference213[288],page143 267

PAGE 280

268 CHAPTER18.A.D.301TO400 achangefortheworseforthemanyJewsdistributedthroughout.Itwasnotlongbeforetheywereforbiddento proselytize,buildnewsynagogues,ownChristianslavesorholdpoliticalofceinmanyareas.Ref.68[106] ForwardtoA.D.401to500Section19.1 ChooseDifferentRegion 1.AfricaSection18.2 2.AmericaSection18.9 3.CentralandNorthernAsiaSection18.5 4.EuropeSection18.4 5.TheFarEastSection18.7 6.TheIndianSubcontinentSection18.6 7.TheNearEastSection18.3 8.PacicSection18.8 18.2Africa:A.D.301to400 3 18.2.1AFRICA BacktoAfrica:A.D.201to300Section17.2 IntheregionofSudantheoldKushiteKingdomhadbeenreplacedbytheKingdomofMeroi,althoughthebasicpopulationremainedaKushpeople.ThenewkingdomhadauniqueAfricancharacterbutitdidnotthrivelong,apparently conqueredsometimebetween320andtheendofthecenturybyneighboringAxumofnorthernEthiopia.Thename "Kush"nowdisappeared,tobereplacedby"Nubia".TheNobatae,comingfromKordofanandtheBlemmyesBela comingfromtheNileValleytotheeast,blendedwiththeoldKushitestoformthepopulationofmedievalNubia. BeforeChristianitycametothisareathereareindicationsthatthiswas,inmodernterminology,a"swingingplace". RemnantsofalargetavernconstructedinthemiddleofthecenturyatIbrimindicatethatthewineowedfreelyup toaboutA.D.500.Ref.271[7],83[123]ThepopulousAxumhadadoptedtheMonophysiteChristianfaithand thisnewreligionwasthefoundationofthekingdomwhichwassoontobecalledAbyssinia.By362thiskingdom alsoincludedaportionofthesouthernArabianarea.AdistinguishingfeatureofAxumwastheuseofstone-masonry withoutmortar.Thereisstillstandinga23meterhighobelisk,simulatinganine-storypalace,constructedinthis4th centurywhenthisstatewasconsideredoneofthefourworldpowers.Ref.270[36]TheAxumemperor,King Ezana,hadbeenconvertedtoMonophysitismbytheSyrianFrumentiuswhohadoriginallybeenshipwreckedonthe RedSeacoast. TheresultingEthiopianOrthodoxChurch,actuallyabranchoftheEgyptianCoptic,spreadoverthehighlandofnorth Ethiopia.Ref.8[14],175[241] InEgypttherewaspoliticalandculturaldecline.ChristianitymademanyconvertsalongthecoastbutoftheMonophysitevariety.ThissectbelievedthattherewasonlyonenatureinGodandJesus,withacompletedenialofthe Trinity.Thisfaithsurvivestodayinsomeeasternareasand,assuggestedabove,particularlyinEthiopia.Arianism, anothergreat"heresy"whichwasmentionedabove,alsooriginatedinAlexandria.Incontrasttothedogmaofthe Monophysites,AriuspreachedthatChristwasnotonewithGodbutrathertheLogosSeePhilo,page297,therst andhighestofallcreatedbeings.TheSonwasneithercoeternalwithnorconsubstantialwiththeFather.Politically, EgyptremainednominallyundertheRomanEmpire,evenasitbegantocollapse.ApopularliteratureintheCoptic languageappearedinthiscentury.Ref.48[72],127[176] 3 Thiscontentisavailableonlineat.

PAGE 281

269 ThecoastlineofNorthAfricaremainedsubjecttoRomancontrolastheChristianfaithspreadacrossthearea.As inthelastcentury,inthewesttheBerber-Moorsbecamemoreandmoreprolicandindependent.Althoughcamels hadbeenpresentinAfricapreviouslytheynowcameintoextensiveusebytheBerbers,afeaturewhichhelpedthem tobecomeformidableopponentstoallforeignersalongthecoast.Inthe370sFirmus,aMoorishchieftain,rebelled againsttheRomanValentianIandwasstoppedonlyafteraseriesofmassacres.Ref.127[176],83[123] Therewasverylittlesignicantchangefromthelastcentury.InthewesttheEmpireofGhanacontinueditsdevelopment,whileallalongtheeastcoasttheBantu-speakersexpandedandmoreIndonesiantradersappearedbringingthe AsianyamandtarofromSoutheastAsia.ThelatestestimateofthetimeoftheestablishmentofGreatZimbabweby Bantu-speakingblacksisA.D.320years.TheseweretheGokomerepeopleandtheymayeitherhavelivedthere orsimplyuseditasacamp.Thereissomeevidencethattheyhadiron.Ref.176[242],8[14],83[123],222 [296] ForwardtoAfrica:A.D.401to500Section19.2 18.3TheNearEast:A.D.301to400 4 18.3.1THENEAREAST BacktoTheNearEast:A.D.201to300Section17.3 ARABIAANDJORDAN TheAbyssinianshadconqueredthesouthernangleofthepeninsulaby362andtherewerestillsomefairlyprosperous townsalongtheRedSea.Inthenorththerewasanincreasinglevelofcivilizationwithmoreandmorecontactwith Syria,whileinthedesertthenomadtribesgraduallyencroachedonthetowns.Ref.8[14] TheeasternportionofSyria,comprisingessentiallypresentdayIraqandancientMesopotamiawasunderthedominationandactuallyapartofthenewPersianEmpire.ThewesternpartofSyria,includingtheareasofLebanonand Judea,werepartofByzantium,theeasternrealmofthefadingRomanEmpire.MonophysiteChristianity,whichbegan aperiodofextremeascetismamongmanymonksoftheEast,becamewidelyacceptedinSyriaandparticularlyinthe Lebanonregion.Judgingfromtheirrigationsystems,thepopulationofMesopotamiamaywellhavereacheditspeak atthistime,whileepidemicsandotherproblemswerecuttingtheItalianRomanpopulationRef.140[190]The BibleandvarioustheologicalworksweretranslatedintoSyriacandthenacopiousoriginalliteraturewasdeveloped. IncentralSyria,sincethecitiesofPalmyraandHatrahadbeendestroyedinthepreviouscentury,thesilkroutenow wentfarthernorthfromAntiochonthecoastthroughnorthernSyriatoSeleucia,anancientcitynowgone,whichwas locatednearpresentdayBaghdad.Ref.127[176],137[188] IRAN:PERSIA IntherstdecadeofthiscenturyPersiawasinvadedbyArabsfromMesopotamiaandBahrainandCtesiphonwas sacked.At17yearsofageShapurIlbecameemperorandheimmediatelyinvadedArabiaandexactedaterrible revengeupontheArabs.Thenbetween337and376heengagedinthreewarswithRome,withneithersidegaining anygreatadvantage.WhenShapurIIdiedin379thePersianEmpirewasatitspeak,controllingallterritorythatDarius Ihadruledathousandyearsbefore.Zorastrianism,tiedupwiththepoliticaldestinyoftheempire,waswinningagainst bothJudaismandHellenization. 4 Thiscontentisavailableonlineat.

PAGE 282

270 CHAPTER18.A.D.301TO400 IraniansocietyinthisSassanianperiodconsistedessentiallyofthreeclasses: WARRIORS.Thelandowners,greatandsmall,furnishedtheheavycavalryandthemountedarcherswhowere theeffectivestrengthofthearmy.Theinfantryconsistedoftheirvassalsandserfs.Atthetopofthisclasswereseven greatfamiliesdatingbacktotheAchaemenidtimesandholdinghereditaryrightstovariousofces.Thekingwas amemberofoneofthesegreatfamiliesandtheinternalhistoryofIrancontinuedtobeoneofnoblesjockeyingfor power. PRIESTS:MAGI.TheAvesta,writtensometimeduringSassaniandomination,orderedeveryaspectoflifein Persia.TheMagihadgreatauthority,includingsomejudicialfunction.Theyownedlargeestatesandhadconsiderable politicalinuencewhenMazdaismnallybecamethedominantreligioninthenextcentury. PEASANTSANDCRAFTSMEN.Thiswasthemostnumerousgroupbutithadnopowerandnochancetorise inrank.Thegreatmajoritywerepeasants,almostatthelevelofserfdom. Intherulingclasstherewasmuchfamilyintermarriage,father-daughterandbrother-sistermarriagesbeingcommon. AfterShapurII,therebeganadeclineinroyalpowerandmanydynasticdisputes,ragingover11/2centuries.In additiontherewerefrequentwarswiththeByzantinebranchoftheremainsoftheRomanEmpireandin395large hordesofHunscrossedtheDon,thentheCaucasusandenteredPersia,drivenperhapsbyfamine.Theytookthousands ofprisonersforlatersaleasslavesanddroveoffmanyherdsofcattle.OnegroupcrossedtheEuphratesandwere beatenbackbyRomans,anotherretreatedfromCtesiphonasthePersianarmyapproachedandathirdgroupravaged AsiaMinorandSyria.Ref.119[166],48[72],127[176] ASIAMINOR:ANATOLIA InthisandthenextcenturyitisofvaluetothereadertostudythesectionsonASIAMINOR,THEBALKANS, AUSTRIA,HUNGARYANDITALYalltogether,astheinteractionsbetweentheseareasisalmostcontinuous. OurparagraphaboutByzantiuminthelastchapterclosedwiththeascensionofDiocletiantothethroneoftheeastern portionoftheRomanEmpire,ashegaveMaximiancontrolofthewesternportion.Bothofthesemenabdicatedin A.D.305.TheRomanpoliticalandmilitaryscenesbecomeverycomplicatedfromthispointon,withthetwohalves oftheempireruledsometimesbyoneman,butatothertimestwoorfoursharedthepowerasco-emperors,westand east.ThedesignationofvariousgeneralsasCaesarsandprefecturesdoesnothelpintheclarication.Weshalltry togiveonlythesalientpoints,andavoidgettingboggeddowninminutedetails.ConstantiusandGaleriussucceeded DiocletianandMaximian,butConstantiusdiedayearlaterandhisson,Constantine,wasproclaimedemperorby histroops,whilejustshortlythereafterMaxentius,sonofMaximian,seizedpowerinItaly.Constantineoverthrew MaxentiusjustoutsideRomein312,makinghimselfmasteroftheWestandelevenyearslaterhetookovertheEast, also.Thus,by323hehadbecomethesoleemperorandhisinaugurationwasgiveninConstantinoplein330afterhe hadspentfouryearsconstructingitonthesiteofancientByzantium.KnownsubsequentlyasConstantinetheGreat thismaninthemeantimewagedwarallacrosssouthernEurope,inGreeceandtheEastandsincemanyofhissoldiers werealreadyChristians,heusedtheircrossesashisbattleensignia.FinallyhebecameanavowedChristianalthough heattendednoritualsanditispossiblethathisconversionwasmoreofapoliticalmaneuverthanaspiritualone.Its effectswereneverthelessfarreachingandpromotedthespreadandorganizationoftheChurchthroughouttheRoman domain.Ref.137[188],48[72],127[176],222[296] ConstantinegavetheChurchvastestatesandbuildings,empoweredbishopstomakeslavesofRomancitizensand permittedcivilsuitstobetransferredtobishops'courtsifeitherpartysodesired.Ref.213[288] BesidesbeingconstantlyatwarwithPersiaunderShapurII,ConstantineIhadtoputupwithbitterbattleswhich developedovercreedsinhisnewlyrecognizedChristianhierarchy.Heattemptedtoresolvethesedifferencesby callingacouncilofNicaeawhichproceededtoestablishtheorthodoxcreedthatinessencesaidthattheLordJesus Christ,theSonofGod,begottennotmade,beingofoneessencewiththeFather,wasmadeeshforthesalvationof men.Ofsome318bishopspresent,onlytwoplustheunrepentantArius,refusedtosigntheformula.Thesewere exiledandanimperialedictorderedthatallbooksbyAriusshouldbeburned.AllChristianswereagreedthatpagan

PAGE 283

271 templesmustbeclosedbutArianismremainedinAsiaMinorandthroughouttheNearEastand"paganism"inthe formofMithraism,Neoplatonism,StoicismandCynicismwaswidespread.Constantinealsohadseriousnancial troublessothathehadtoconscatepropertiesofcitiesandtemplesandnallyimpoverishedthemiddleclassand thepeasantsbytremendoustaxationandlandtransfers.ByA.D.350,someyearsafterhisdeath,therewere80,000 peoplegettingfreebreadinConstantinople.Ref.48[72] Afterafewmurdersofotherclaimantstothethrone,Constantine'sson,ConstantiusII,becameemperorin337but heruledforonlynineyearsandaccomplishednothingexcepttochooseasCaesaratopgeneralthehalf-brother ofGallus,FlaviusClaudiuslulianus,soontobeknownasJulian.HewasgivencommandagainsttheAlamanniand theFranks,butafterveyearsheapparentlysoughtgreaterthingsandmarchedagainstConstantius.Thelatterdied beforeJulianreachedhimsohebecameemperorin361withoutfurtherdifculty.KnownasJulianus,theApostate, hereversedthetrendtoChristianity,upholdingpaganismwhileattemptingtomakeMithraismthesupremereligion. Hewasalearnedmanwhodevotedmuchtimetobooksandthestudyofphilosophies,whileallowingfullfreedomto Christians.Athisdeathin364whileghtingwithhisarmiesinPersia,Hellenismanditsphilosophiesdisappearedfor 11centuries.Aftersomefurtherjugglingofeastandwestemperorselectedbytheirtroops,ValentinianusIbecame emperorinthewestin364andhenamedhisbrotherValensasco-Augustusintheeast.Hehadhishandsfullbattling VisigothswhowonindependencenorthoftheDanube.Alloftheemperors'mostdangerousenemy,however,still remainedtheSassanidDynastyofPersia,andthissqueezingeffectwiththeGothsinthenorthandthePersiansin thesouthresultedinByzantiumgivinguppartofArmeniaandGeorgiaintheCausasustoPersia.Finallyin378the VisigothscrossedtheDanube80,000strong,engagedtheeasternco-Augustus,Valens,inagreatbattleatAdrianople andthelatterwaskilled.GratianusappointedTheodosius,astrongChristianandsonofasuccessfulgeneralin Britain,tosucceedhimasco-emperoroftheEast.Heimmediatelybannedthepracticeofallcurrentreligionsexcept ChristianityalthoughitwasstillinaminorityatthetimeandhandedoverallChristianchurchestotheTrinitarians Athanasiasts,beinggreatlyinuencedbySt.AmbroseofMilan.WhenTheodosiusmassacred7,000peopleat ThessalonicainGreeceinrevengeforaninsurrection,however,BishopAmbroseforcedhimtodopenance,thereby emphasizingtheindependenceofthewesternchurchfromimperialdomination.WhentheFrankCountArobast murderedthewesternemperor,ValentinianII,andsetupthepaganEugeniusasRomanEmperorin392,Theodosius, withGothicauxiliaries,ledbyAlaric,defeatedandkilledbothArbogastandEugeniusatFrigidusinnortheastern Italy.Theodosiusdiedsoonafterthisvictoryandhewasthelastemperorservingjointlywithawesterncounterpart. FollowingthedeathofTheodociusin396theeasternandwesternemperorswerecompletelyseparateandserved onlyintheirownregions.TheEastbenetedfromthissplit,retainingthetaxesandtributethathadpreviouslybeen remittedtoRome.EgyptianwheatwasreroutedtoConstantinopleandthenewcapital,whichincorporatedthecityof Byzantium,soongrewtometropolitansize.Theodocius'son,Arcadius,governedtheEastundertheprefectRuna, butontheirreturnfromItalyTheodocius'easternarmyassassinatedRunusandeffectiverulefelltotheeunuch, Eutropius,whointurnwasmurderedin399inpartbyaconspiracyofGothsinPhrygia.H.G.WellsRef.229[307], page414wrotethatthisnewByzantiumwasadamagedresumptionoftheHellenicEmpireofAlexander,although themonarchhadaRomantitle.Ref.48[72],8[14],221[295],229[307],213[288] AtthebaseoftheAnatolianpeninsula,Armenia,underTerdat,apro-Romanruler,becametherstentirelyChristian stateasitadoptedtheMonophysitevariationinA.D.303.ChosrovIIreignedfrom330to338butbyatreatyof 386followingoneoftheinnumerableRoman-Persianwars,ArmeniawasdividedbetweenByzantiumandPersia,the lattergettingthelargershare.TheArmenianalphabetwasintroducedbySt.MesropaboutA.D.400,suchalphabet containing38lettersanddesignedtohandletheArmenianvariationoftheIndo-Europeanlanguage.Ref.8[14] ForwardtoTheNearEast:A.D.401to500Section19.3 ChooseDifferentRegion 1.IntrotoEraSection18.1 2.AfricaSection18.2 3.AmericaSection18.9 4.CentralandNorthernAsiaSection18.5 5.EuropeSection18.4

PAGE 284

272 CHAPTER18.A.D.301TO400 6.TheFarEastSection18.7 7.TheIndianSubcontinentSection18.6 8.PacicSection18.8 18.4Europe:A.D.301to400 5 18.4.1EUROPE BacktoEurope:A.D.201to300Section17.4 AttheendofthecenturyCreteandmostoftheCycladespassedfromRomantoByzantinecontrol.Ref.38 GreeceremainedanintegralpartoftheByzantineEmpireandinthisperiodwasintimatelyconnectedwiththeactivitiesoftheupperBalkans.AftertheVisigothswerevictoriousatAdrianoplein378theysubsequentlytriedtosettlein Greece-399butaftertheAthenianspaidthemalargeransom,theywanderedbacknorthandwesttowardItaly.,thischapter Therewasmuchmigratoryactivityandinter-tribeghtingintheBalkanarea.TheOstrogothshadsufferedamilitary defeatontheDniepnerbytheHunsandastheyretreatedwestwardtheyinturnpushedtheVisigothsaheadofthem. Onegroupofthelatter,underAthanaric,wentonintoPannoniaHungarywhileasecondgroupunderFritigens appearedonthelowerDanubeandaskedEmperorValen'spermissiontoenterDacia.Therequestwasgrantedbut faminein377resultedintheGothsraidingsouth. JoinedbysomeOstrogoths,some federati 6 ,renegradesandlaterevensomeHunsandAlani,theycrossedtheDanube in378,killedValensandannihilatedtwo-thirdsofhistroops.TheGothsthenravagedtheBalkansfromendtoend. SeparatepeacetreatieswithvariousGothicgroupswereforgedbetween380and381andmanyotherGothsindividuallyoringroupseventuallyjoinedRomanforces.TheoriginalVisigothictroopshadbeenthinnedbyepidemicsand desertions.In384or385HunscrossedthefrozenDanubeandraideddownthewestshoreoftheBlackSeaandin 386struckbotheastandwestoftheGoths'areaontheDanube.TheOstrogothsdeedtheirHunoverlords,striking violentlyingreatnumbersfromtheeast,butevenso,by392theHunswereraidingthroughtheBalkans,notundera singleking,butasindividualtribes. AttheendofthecenturytherewerethreepowerfulgroupsprowlingthroughtheBalkans.Wehavementionedinan earlierparagraphthatasthedeadTheodocius'troopsreturnedfromItalytheyraidedthroughthisareauptothewalls ofConstantinople.TheVisigoths,afterraidingGreecewenttoEpirusontheAdriaticandrenewedanalliancewith theeasternRomangovernment,andasjustnotedabove,theHunswereforagingintotheareafromtheeast.Ref.229 [307],127[176] Althoughaproto-GermanictonguewasprobablyspokensimultaneouslywithSanskrit,earlyGreekandotherearly languages,theGothictranslationoftheBiblebyBishopUllasinthiscenturyistheearliestsatisfactoryrecordofa Germaniclanguage.HavingbeentakentoConstantinopleinhisyoungeryearsasahostage,hemasteredLatinand Greek,inventedaspecialalphabetontheGreekpatternandreturnedtohisVisigothicpeopleonthelowerDanube preachingtheAriancreedwhichthenspreadthroughouttheGermanictribes.HisBibleisvirtuallytheonlysourceof knowledgeoftheoriginalGothiclanguagewhichsiredalltheGermanictongues,includingRunic.Ref.168[229] 5 Thiscontentisavailableonlineat. 6 Gothmercenariespreviouslywithimperialunits

PAGE 285

273 InthewesternRomanEmpiretherewasacomplexpictureofrecoveryanddecline,literaryactivityandsterility, politicalpompandmilitarydecay.Gaul's20,000,000peopleprosperedandthreatenedItalianleadershipinevery eld.Therewere6,000,000Italianswhileintheempiretherewereanother44,000,000Greek-speakingorientalsand Rome,itself,wasanorientalcitywithagreatmiddleclassnowweakenedbyeconomicdeclineandrisingtaxes. AmongbothpagansandChristiansaliketherewasanimmoralityrarelyknowninhistory.Untilthelastthirdofthe centurythewesternemperorsweremilitarymenwhokeptstrongholdschieflythroughtheirarmies.Theseincluded Julian,whoasaCaesar,hadfoughttheAlamanniandFranksin355andthenmarchedagainstEmperorConstantius oftheEast,tobecomeemperoroverallin360.HewassuccededalmostimmediatelyinthewestbyValentinianIand thenbyGratian-383,abookishadolescentwholostcontrolandthebarbarianssooncrashedthroughtheborders. InitiallyGratianhadservedasco-emperorwithhisfatherValentinianbutuponthedeathofthelatterhewasjoinedby hishalf-brother,ValentianII. MagnusMaximususurpedtheemperor'sarmyandmurderedGartianin383andthenruledthewesternempirewiththe childemperorValentianassistedbytheboy'smother,Justina,andapagangeneralBauto,aFrank.In387Maximus' armywasneededtorepelbarbarianinvadersfromPanonniaandhetooktheopportunitytoalsoswoopdownandtake Italyitself,runningValentianIIandhismothertotheEast.ThiswasthetimewhentheeasternEmperorTheodosius marchedwithaneasternarmychieyofGothicmercenaries,anddefeatedandkilledMaximusin388.Arbogast, aGermanandpaganwasthenthechiefministertotherestoredValentinianII,butconictsoondevelopedandthe emperorwaskilledorcommittedsuicide.Thus,in392FlaviousEugenius,anominalChristian,buthavingpagan sympathies,becameemperor.HealsowasdefeatedinnorthernItalybyTheodosiusin394andpaganismasapolitical forcealmostdisappeared.ThesonofTheodocius,thechildHonorius,wassetuptoruleundertheadministrationof Stilicho,thesonofaGermanofcerandhusbandofTheodocius'niece. AllhistoriansareprettywellagreedonacertainsequenceofeventswhichledtothefallofthewesternRomanEmpire, thisincludingthewesternmovementoftheHuns,whointurn,putgreatpressureontheGermanictribes,whointurn, theninvadedtheempirewhichwasalreadydecayingfromitsowninadequaciesandproblems.Buteachhistorian mayhavehisownconceptoftherelativeimportanceofeachofthesefactorsinthedown-fall.Therearethosewho thinkthatthe"barbarian"advancewasthemajorfactor,andthereisnodoubtthattheGermanshadalreadyheavily inltratedtheranksoftheRomanarmy,particularlythecavalryunitsandthelesserofcialdom.Furthermore,the Germansoldierhadabettersword,madeofbettersteel.RichardLewinsohnRef.122[170]insiststhatthehorse broughtthecollapseoftheempire.CavalryhadalwaysbeenaneglectedpartoftheRomanarmyandinRome,the horsewasmoreasymbolofafuencethanofrealpower.ThemountedtroopsofthebarbarianscuttheRomanlegions topiecesandcavalrymenbecametheconquerorsandfor1,000yearsretainedmasteryoverEurope. OthersweremoreconcernedwiththeinternalproblemsofRome,itself.Throughoutitshistory,theimperialfrontiers werecloselyalignedwiththebordersofthewheatgrowingregionsoftheclassicalworldandnowmuchofthiswheat growingareawasotherwiseoccupied.EgyptianwheatnowwenttoConstantinople;southernItalianagriculturewas decliningandlosingouttoAfricanandSpanishcompetition,sothatthewestwascaughtinthespiralofdwindling revenueandincreasingexactions.Inationwasatremendousfactor.EveninA.D.302Diocletianhadinictedthe deathpenaltyforanyinfringementofxedpriceswhichhehadestablishedinanattempttopresentfurtherination. Ref.213[288]Evenso,ameasureofwheatforwhichtheRomanshadpaidsixdrachmainEgyptintherst centuryC.E.costtwomillionshortlyafterA.D.344.Thisresultedinasubsequentdriftbacktoabartereconomyofa thousandyearsearlierandhelpedtoruinnotonlyinternationaltradebutthewesternempireaswell.AboutA.D.350 therewere120,000peoplewhoreceivedsixhalf-poundloavesofbreadfree,daily,fromthegovernment. BythistimeRomehad12aqueducts,largelyunderground,feeding352fountains.Onetunnel,takingwaterfrom LakeFucinointheApennines,was31/2mileslong.Astheempirefell,however,therewerenolongerslavestocare forthissystemandthefountainsbecamedry.Ref.213[288]Perhapsscarcityofbothfoodandwaterwerevery importantinthedeclineofRome'ThereisstillanotheremphasisbyKennethClarkRef.33[55]-"Soifoneasks whythecivilizationofGreeceandRomecollapsed,therealansweristhatitwasexhausted.""Thelateantiqueworld wasfullofmeaninglessrituals,mysteryreligionsthatdestroyedselfcondence.Andthenexhaustion,thefeelingof

PAGE 286

274 CHAPTER18.A.D.301TO400 hopelessnesswhichcanovertakepeopleevenwithahighdegreeofmaterialprosperity. 7 OfcoursetheGreek-speakingeasternrealmsurvivedtobecomethe-EmpireofByzantium.Partofthesuccessofthis easternpartwasduetoitsurbanizationandtheWest'sfailuretourbanizehadmadethatarealesseasytotaxandmore expensivetoadminister.Failingtocollecttaxes,themilitarycouldnotbepaid.Furthermore,thegovernment'spricexinghadmademanyprofessionsprotlessanditsattemptstoavoidtheeconomicconsequencesofsuchbymaking thepracticeofsuchprofessionsobligatoryandliabilityhereditarymusthavecreatedmanywhite-collaroutlaws.We havealreadymentionedthatasizeableportionofthemasseswereslaves 8 whohadalowreproductionrateandthere wasahighdeathrateintheurbanpeoplefrompestilence.Aplaguewhichmayhavebeenanthraxreducedtheempire's populationby5%earlyinthecentury.Caughtinthespiralofdwindlingrevenueandincreasinglydemandingexactions andination,theWestwasdoomed.Ref.48[72],229[307],122[170],211[284],137[188],213[288], 222[296] Bytheendofthiscentury,althoughwrittenLatinhadnotchangeditsappearance,spokenLatinhaddevelopedanew soundpattern.Stressedvowelsweredrawled;unstressedvowelsweredulled,weakenedandoftendropped.Asthe greatcivilizationwhichhadbeenuniedbytheLatinlanguagecollapsed,whatFreemanDysonRef.56[81]callsa "clade"ofnewLatin-derivedlanguages-French,Spanish,Italian,Portuguese,Romanianandafewlesserones,grew anddevelopedinrelativelyrapidfashion.Atmost,20generationsseparateuniedRomanEuropefromtheEuropeof well-establishedlocallanguages.Ref.168[229],56[81] Thiscenturysawthebeginningof"DieVolkerwanderungen",meaning"peoples'migrations".TheAlemanswereon theupperRhinewhiletheAngles,Saxons,JutesandFrisianswerealongtheNorthSea.TheVandals,relatedtothe Goths,wereontheupperreachesoftheOderRivermovingorperhapsbeingpushedbyGothsfromtheareaof modernPrussiaandpossiblyDenmark,southtotheDanubeintheareaofPannonia,aportionofmodernHungary. TheLombardslivedbetweentheOderandVistulainmodernPolandandalsoonthelowerElbeinGermany.The BurgundiansdriftedwestwardtotheMainRiverandtheThuringiansheldtheirancient,centralpositioninBavaria andnorthward.Allthesetribesforthemostpartwereantagonistictoeachother. Intheearly370sOstrogoths,ledbyAthanaric,migratedfromtheBalkansintoPannoniaandaftertheFritigenled OstrogothshadtheirgreatvictoryatAdrianople,theyalsoplunderedPannonia.TheHunswerefollowingcloselyand theysetupcampsinPannoniaalsoby378,enslavingtheGepidsrelatedtotheGothsintheprocess.TheHunswith theirocksnowoccupiedpasturelandextendingfromtheCaspianSeatoHungary.In383JuthungiGermansinvaded Austria,perhapswithpermissionofMaximus,butin384HunnichorsemenrodethroughthemontheirwaytoGaul. GeneralBauto,oftheRomanforces,persuadedtheHunstoattacktheGermansandtheyobliginglycrushedthem inonegreatsweepbeforecontinuingontowardGaul.Bautothenapparentlygotnervousabouttheiradvanceand boughtofftheHunswithgoldandtheyretreatedtotheirbaseinHungary.ThereafterindividualHuntribespillaged Hungaryatwill.By396agroupofVisigoths,headedbyAlaric,hadsettledinIllyrium,thewesternpartofpresentday Yugoslavia.Ref.139[192],127[176],136[187]InBohemiatheGermanictribeswereslowlybeingpushed westthroughoutalltheseearlyChristiancenturiesbytheSlavs,movinginfromRussia.Switzerlandremainedquiet undertheRomanyoke. TheIberianPeninsularemainedunderRomanrule,butsomewhatrestlesslyandoccasionallytheemperorhadtosend outexpeditionaryforcestoputdownuprisingsofrebelliouspeasants.TheCatholicchurchwasrecognizedtobeon equalfootingwithotherreligions,butthereweremanylocalheresies.Bytheendofthecenturytherewereabout 9,000,000peopleinthisarea.Ref.127[176],196[269] 7 QuotationsfromClarkRef.33[55],page4 8 Christianemperorsstillorderedtheexecutionbycrucixionorburningofslaveswhobroughtaccusationsagainsttheirmasters,withouttrial. Ref.249[98]

PAGE 287

275 TheGaulsofFrancenownumberedabout20,000,000andhadreachedahighlevelofcivilizationandscarcelyrated thetitleof"barbarian"atthistime,althoughmanyhavelabeledthemassuch.They,inturn,werenowhavingpressure putuponthembynewbarbariansoftheTeutonicvariety.Acompetentgeneral,EmperorJulian,haddefeatedthelast Franco-AlemannicinvasionofFrance,althoughheallowedsomeoftheFrankstosettleinBelgium,keepingtheir tribalorganizationwhilebowingtoRomeA.D.358.Theterm"foederatii"FOREIGNwasusedtodescribesuch tribes.BytheendofthecenturytheSalicFranksexpandedoutofBelgium,movingtothesouthwestandoccupying theregionbetweentheMeuse,theoceanandtheSomme.Theoriginofourword"enfranchised"isfromthisancient tribalnameofFrank,whichmeant"free".TheFrisians,whowerethemainpowerontheNorthSea,werefriendlyto theRomansthroughthisperiod.Ref.137[188]AdditionalNotesp.276 OfallwesternEuropeonlyIrelandandPictishScotlandremainedcompletelyfreeoftheRomanyoke.Thepopulation ofRomanizedBritainwas1,000,000ormore,withlittlenumericalchangesincethetimeofCassivellaunus.The BritishlivedbetterasRomancitizens,however,thaneveragainuntilabout1900.Thewealthyhadcentralheatand warmbaths,bothofwhichwerenearlyabsentagaininBritainfromA.D.400to1900.Inthis4thcenturycitieshad beguntodecline,butcountryvillasstillourished,asdidtheRomancapitalofLondon.Therewasnonewscience,no newthrustofpoweruntilA.D.367whenPicts,Scots,FranksandSaxons,asthegreat"barbarianconspiracy"joined inamaritimeraidonsouthernEngland,ataboutthesametimeasotherPictsat-tackedandankedHadrian'swall innorthEngland.FinallyCountTheodosiusdefeatedtheraiders,usinglargedetachmentsofGermanicmercenaries, aswellasmodifyingbothcoastalandinlanddefenses.ArcheologicalndingsnowindicatethatastheGermanic mercenarieswerebroughtin,therewerealreadyseparateSaxonforces,perhapslivingamongthelocalsasasortof peasantmilitia,andthusgraduallythedefenseofBritainbegantorelyupontheseforeigners.Attheendofthecentury, Ninian,aBritishchieftain'sson,wenttoRomeandwasmadeabishop,after15yearsofstudy.Ref.136[187],29 [50],43[64],91[135]InIreland,after700yearsofBelgicandotherBrythonicCelticmigrationstheBrythonic kingdomofTaraMidewasnowsupreme,butbytheendofthecenturyalltheIrishhadrelapsedtotheolderGaelic dialect.Itwasatthistime,probably,thattheIrishstartedtousetheprimitiveOgamalphabetoflinesanddashes. HermRef.91[135]saysthattheseIrishinventedOgam,butothersseemtohavedemonstratedthatitwasinusein SpainandPortugalmanycenturiespreviously.Ref.119[166],122[170] ArcheologistshavecalledtherstfourcenturiesoftheChristianerainScandinaviathe"RomanIronAge"even thoughnoRomansappearedinthenorth.Thepeoplewerechieyagriculturalistsorseamen,illiterateandpaganbut theyalreadyhadextensivetradewithRomansandtheMediterranean,exchangingfurs,skins,robesofseal-skin,dairy produceandcattleforsilks,gold,wine,jewelry,glassbowls,etc.Theylivedinlargehallsorhouses,raisedsummer wheat,barleyandrye.Theirboatswereofallsizesupto75feetlongandtheywerepropelledbyoars.Theareasof Swedes,Norse,Danes,JutesandAngleswerealreadyquitewelldelineated.Ref.237[316],136[187] TheGothiclanguagewaswellestablishedandwritingbegantoappearinthesystemofrunes,with24clumsycharactersbroughtfromthecontinentandchangedbyedgingtoadaptthecharacterstowood.Seealsonextchapter,please. AfterConstantinoplebecametheRomancapital,Denmarkfoundhertradeinthesouthhadbeentransferredeastward totheBalticandviaRussianriversontothesouth.IslandsintheBaltic,suchasGotlandandBornholm,thusbecame tradingstationsenrouteandatthesametimeworthplundering.Ref.237[316]AdditionalNotesp.276 WehavejustmentionedthenewimportanceoftheBalticislandsintradebetweenScandinaviaandtheByzantine Empire.OnthesouthshoreoftheBaltic,theGermanictribesmigratedandchangedpositions.Forexample,the

PAGE 288

276 CHAPTER18.A.D.301TO400 LombardswerepartiallyineasternGermanyandpartiallyinPoland,butlateinthecenturyalmosttheentireareawas atleastgovernedbytheOstrogothsundertheirgreatleader,KingErmanarich,whoextendedhisrealmbackfrom theBlackSeatotheBaltic,largelyattheexpenseoftheSlavs,someofwhomednorthwardamongtheFinnsand preservedtheirfreedom.Ref.137[188] InthefarnorthsomeFinnsremainedwithalargecontingentofSlavscrowdingnorthwardinthewesternportion. VisigothsTervingiandOstrogothsGreutringilivedonbothsidesoftheDniestr.ThelatterwereruledbyKing ErmanarichinanorganizedgroupwhiletheVisigothshadalooserpoliticalsituationandanalliancewithRome, after332.LargenumbersoftheseGothshadalreadybeenwonovertoArianChristianitybythehereticalmissionary, Ullas.TheDonRiveroriginallyseparatedtheOstrogothsfromtheIranianAlanstotheeast,butsometimeinthe earlypartofthecenturytheseAlansattackedtheOstrogoths,startingtheircollapseasapoliticalentity.Fromthe easttheHunshadadvancedintoRussianorthandwestoftheCaspianSea,crossingtheDonandovercomingmany oftheAlansandattackingthealmostcivilizedOstrogothsintheUkraine.AlongwithmanyoftheAlans,partofthe OstrogothsjoinedtheHunswhileothersedwestandsouthtojointheircousins,theVisigoths.Thelatter,under Athanaric,foughttheHunsontherightbankoftheDniestrbutcouldnotholdandretreatedwest,tenthousandstrong, encampingeventuallyjustnorthoftheDanube.TheHunsnowruledalargeareaofsouthRussiaandstoodatthe mouthoftheDanube,aboutA.D.370.AfragileHunno-Alanicalliancelastedabout30years.Judgingfromthe namesofsomeofthetribesoverrunbytheHunsatthenortheasternshoreoftheBlackSea,otherTurkishtribesmust alreadyhavebeeninthisareaandsomeofthesemayalsohavejoinedtheHunhordesastheywentwest 9 .Ref.127 [176],8[14] IntheCaucasusregionLaziliaandIberiaweretwokingdomsoftheancientGeorgianswhichhadbeenprettywell ChristianizedunderRomansuzeraintybutthemoreprimitiveAbasgians,alsoofGeorgianstock,remainedheathen andoutsideRomanjurisdiction.Asdetailedonpages358and369theHunswentthroughtheCaucasusonraidsto PersiaandMesopotamiaandontheirreturntheymayhavebroughtsometwo-humped,Bactriancamelswiththemto theUkraine.Ref.8[14],137[188],127[176] NOTE :InsouthernFrancetheRomansdemonstratedampleengineeringinventivenessinthiscentury.Using thewaterintheMassifCentralofthearea,theyusedovershot,verticalwatermills,usingwaterchanneled intobucket-likecontainersbuiltintothecircumferenceofwheels2.2metersindiameter,withtheweightof thatwaterturningthewheel.Sixteenwheelsusedinpairsoneightterracesproducedatotalofabout8Horse Powerfortheadjacentourfactory,whichinturn,producedenoughourforArles,withapopulationof 80,000.Ref.307[102] NOTE :Tradewiththesouthwasquiteactivewithglassbowls,silverandbronzeladlesandjewelry,ne pottery,andweaponsreceivedinexchangeforamber,fursandleather.Thelargestpieceofambersentto Romeweighed13pounds.EvenafewLatinwordsfoundtheirwayintotheScandinaviantongues.One wasleather,therewereseveralmeaning"trader"and"caupo",whichwastheultimatesourceofKobenhavn andLinkoping.BeforetheRomanIronAgethechiefmethodofdisposalofthedeadwascremation,but graduallythischangedinsomeareastoinhumation.Inthis4thcenturyvillagesbecamelarger,aswellas theindividualhouses.Inone500squarekilometerareaofnorthJutlandtherewereatleast46settlements. Forestswerereducedaswoodwasusedforbuildingsandfuel.Itwasaperiodofremarkableexpansionin DenmarkaswellasinsouthwestNorway,southernSwedenandGotland.InDenmark,easternSjaelland seemstohavebecomeanimportantcenterofpower-achiefdom.Ref.301[258] ForwardtoEurope:A.D.401to500Section19.4 9 ForcommentsconcerningtheoriginalgroupofHuns,seepage331,andfordetailedinformationconcerningtheirlivesandcharacteristics,see thesectiononHUNGARY,5thcenturyC.E.

PAGE 289

277 18.5CentralandNorthernAsia:A.D.301to400 10 18.5.1CENTRALASIA BacktoCentralandNorthernAsia:A.D.201to300Section17.5 InthiscenturythePersianscontinuedtoruleandpopulatebothAfghanistanandTurkistan,introducingZorastrianism tothearea.In371theEphthalitesWhiteHuns 11 invadedtheupperOxusancientBactriabutthePersianShapurII cametoanunderstandingwiththemandsubsequentlythesepeopleactuallyguardedthispartofthePersiandomain. Itwasapparentlyasharpeningoftheclimateinthispartoftheworldwhichforcedthenomadictribestootherpastures towardtheendofthis4thcentury.RatherthangoeastagainststrongChina,evenafterthefalloftheHanDynasty, manyoftheHunsturnedwest,ridingbony,roughhaired,smallheadedhorseswithshort,stronglegs,needinglittle waterandcoveringover60milesaday.Seefootnoteonpreviouspage.Aswehaveseenintheparagraphsabove, otherpeopleswereaheadofthem,inthegreatestmassmigrationsknown,beforeorsince.Ref.33[55] UpthroughthiscenturyTibetwasdividedinto13principalitieswithwarcontinuallyragingbetweenthem.Ref.272 [292] ForwardtoCentralandNorthernAsia:A.D.401to500Section19.5 ChooseDifferentRegion 1.IntrotoEraSection12.1 2.AfricaSection12.2 3.CentralandNorthernAsiaSection12.5 4.EuropeSection12.4 5.TheFarEastSection12.7 6.TheIndianSubcontinentSection12.6 7.TheNearEastSection12.3 8.PacicSection12.8 18.6TheIndianSubcontinent:A.D.301to400 12 18.6.1THEINDIANSUBCONTINENT ThepoweroftheKushanscontinuedtofadeandalineofnativekingsappearedintheGuptaDynasty,beginningwith ChandraguptaIinA.D.320,basedinMagadha.Hissuccessor,Samudragupta,ina50yearreign,becameoneof theforemostmonarchsinIndia'slonghistory.HeconqueredBengal,Assam,NepalandsouthernIndiaandwiththe wealththusgainedpromotedliterature,science,religionandthearts.ItwastheGoldenAgeofIndia,whileEurope andChinawerefallingintowhatmanyhavelabeledthe"DarkAges".Buddhistartreacheditszenith.Thedecimal systemwasusedherelongbeforetheArabsandSyriansusedit.Chemistrydevelopedfromtwosourcesmedicine andindustriessuchasdyeing,soapmaking,tanningandthemanufactureofglassandcement.Themakingofsolid sugarbyboilingcanejuicewasbeguninthiscentury.TheIranianfrontierstandingbetweenthesteppesandIndia securedthelatteragainstinvasionandthusindirectlycontributedtotheoweringoftheIndianculture.Toynbee Ref.220[294]considerstheGuptaDynastyasaresumedIndianuniversalstateaftertheHellenicinterruptionof Alexander'sconquests.Ref.46[76],229[307],220[294],213[288] ThegreatHinduepicpoems,theMahabharataandRamayana,werewrittendowninSanskritinthisperiod.Therst ofthesewasthreeandone-halftimesaslongastheentireBible.TheBrahmans,thepriestlyclassoftheHindus, 10 Thiscontentisavailableonlineat. 11 SeefootnoteunderIRAN,5thcenturyC.E. 12 Thiscontentisavailableonlineat.

PAGE 290

278 CHAPTER18.A.D.301TO400 wereagaingrowinginwealthandpowerandbytheendofthecenturytheynallywonoutovertheBuddhists andestablishedauniversalreligionofHinduism.ThisemergedfromolderBrahminismthroughre-evaluationofa multiplicityoflocalworships. SushrataalsoSusrataorSusrutawasagreatIndiansurgeonwhodidmanyadvancedsurgicalprocedures,including cataractoperations,herniarepairs,lithotomiesandCaesariansections.Cataractwastreatedbycouchingdisplacing thelensdownward;amputationswerecommonandseveraltypesofplasticsurgeryproceduresweredone.Since cuttingoffthenosewasanofcialpunishmentforadultery,Indiansurgeonsdevelopedelaborateapoperations turningskindownfromtheforeheadtoreconstructanose.Sushrataalsoexcelledatplasticrepairoftornearlobes. Hisarmamentariaincluded121surgicalinstruments.Herecommendedtheobservationsofcorpsesasameansof learninganatomybutdemandsofritualpuritypreventeddissection.Some1,120diseasesand760medicinalplants wereclassied.Physiciansweretaughtinapprenticeshipsandthensubjectedtocerticationbytheruler.Theneophyte nallytookanoath,notunliketheHippocraticoathofGreece.Ref.46[76],125[173]Continueonpage400 18.7TheFarEast:A.D.301to400 13 18.7.1THEFAREAST BacktoTheFarEast:A.D.201to300Section17.7,thennorth-southdivisionwithWei WeendedthelastcenturywiththenewChinDynastyrulingasomewhatuniedChinabutthiserawasdominated bygreatlandowningfamilies,eachwithhundredsofserfsandprivatesoldiers.InA.D.304asinicizedHsiung-un chieftainestablishedastatecalled"Han"laterChaoinShansiandfromtherehesackedtheChincapitalatLoyang sevenyearslater.Atthissametimeagreatpestilence,precededbylocustsandfamine,leftonlyoneortwopeopleout ofahundredaliveinthenorthwesternprovincesofChina.In322anotherepidemic,whichmayhavebeensmall-pox, hitwiththreeoutofeachtendying.Maximalpoliticalfragmentationcoincidedalmostexactlywiththearrivalofthis diseaseandthepopulation,overall,wasnearlyhalved.Thepoliticalupheavalsinvolvedseveralshort-liveddynasties offoreignersfromthesteppes,someHsiung-nu,someproto-MongolianHsien-pei,someTurkicandAvarandeven someTibetantribes.ItwastheShansiHsiung-nuwhoagainoverwhelmedthenewChincapitalatCh'ang-an.They wereledbyLiuYuanwhowassixfeettallandhadredstrainsinhislongbeard 14 .Subsequentlythisareaofnorthern Honan,incentralChina,wasruledbytheChieh,oneofthe19tribesoftheHsiung-nu.TheseChiehhadhighnoses andfullbeardsandweredenitelynon-Mongolian,perhapsTocharian,inorigin.Theywerenallymassacred,all 200,000ofthem,inA.D.349byJanMinwhothenbecamelordoftheregion.Ref.101[146],140[190],8[14], 127[176] RefugeesfromthenorthsetupanewEasternChinDynastyatNankingandin347theyreconqueredSzechwanbutin thelatterhalfofthecenturyaTibetangeneral,FuChien,temporarilyconsolidatedthenorth.Hisplantoaddthesouth waswreckedatafamousbattleoftheFeiRiverin383whenhewasdefeatedbytheEasternChin.Finallyin386a powerfulTurkicpeople,theTobaNorthernWeiwhobecameavidBuddhists,succeededinre-unifyingnorthernChina onceagain.TheirkingdomactuallyincludedalargepartofSiberiaandManchuria,carryingtheabsorbedChinese civilizationtotheArctic.ThishasbeencomparedtoCharlemagne'sEmpireinthatinboththebarbariansbecame civilized-"Chinicized"or"Romanized"respectively.TheBuddhistartofnorthChinawasprofoundlyinuencedby CentralAsiaforthenext200years,althoughinthesouth,astheChineseachievedsomemasteryoftheconceptsand termsofIndianBuddhism,theybegantodevelopschoolsoftheirownRef.8[14],19[32],101[146] 13 Thiscontentisavailableonlineat. 14 Maenchen-HelfenRef.127[176]givesthisasadditionalevidencethattheHuns,whichpresumablydescendedinpartfromtheHsiung-nu wereamixedgroup,probablyincludingsome"Europoid"elements

PAGE 291

279 SouthernJapanwasstillintheGreatTombsorKofunPeriod,inwhichthenoblesusedpotterycofns,high-red stoneware,ironandbronzeimplementsandweapons.Ref.19[32]Thevictoriesofthehalf-legendaryPrince YamatodakeovertheKumasoandtheAinuseemtoreectaperiodofrapidexpansionintheearlydecadesofthis century.ThereweremanyJapanesecampaignsnowontotheKoreanpeninsulabythearmiesoftheEmpressJingo, withtheestablishmentofaJapaneseprotectorateoveragroupofminiaturestatesknownasKaraorImna,insouthern Korea. The12themperor,Keiko,whoreignedprobablyfromA.D.280to316returnedtoKyushuandaftergettingridofthe queensoftheancient,savagetribep.236henegotiatedapermanentmergerofYamatoandKyushu. AsYamatogrewingeographicalsize,chieybydrivingtheAinufartherandfarthernorth,thepopulationincreased andtheemperors,liketheEgyptianpharaohs,begantoconstructvastmausolea.Eachsuccessiverulerwanteda biggertumulusandalargercompanyofvictimvassalstobeburiedwithhimandconveyhimtothespiritworld. Forcedretainersacricewaspracticedroutinelyinthisandthenextcentury.Ref.12[21] ByA.D.313thelastremnantsofChinesecolonieswereextinguishedbythenativestatesofKorea,althoughChinese cultureremaineddispersedthroughoutthepeninsula. Threekingdomsemerged:Koguryointhenorth;Paekcheinthesouthwest;andSillainthesoutheast.Allhadhighredpotteryofgreatexcellence.TheJapanesefoothold,mentionedinthesecondparagraphabove,wasestablished betweenthetwolatterkingdoms.Ref.19[32] Tibeto-BurmesetribesmenmigratedfromthenorthintopresentdayBurma,formingthePyuKingdom.Chenlawas thecountryofKhmerpeopleoccupyingwhatisnowThailandandLaos.Funan,underitsKhmerrulers,continuedas aprosperousagriculturalandtradingcountryontheCambodianplateau.ActivecivilizationsexistedintheIndonesian areawithsea-faringmentradingwithAfricaandEurope.CinnamonfromMalayaandIndonesiawassentalltheway toRome.Ref.176[242],211[284] ForwardtoTheFarEast:A.D.401to500Section19.7 ChooseDifferentRegion 1.IntrotoEraSection18.1 2.AfricaSection18.2 3.AmericaSection18.9 4.CentralandNorthernAsiaSection18.5 5.EuropeSection18.4 6.TheIndianSubcontinentSection18.6 7.TheNearEastSection18.3 8.PacicSection18.8 18.8ThePacic:A.D.301to400 15 18.8.1THEPACIFIC BacktoThePacic:A.D.201to300Section17.8 15 Thiscontentisavailableonlineat.

PAGE 292

280 CHAPTER18.A.D.301TO400 ClassicalhistoriesrelatethatwhileLapitapotterywasdisappearinginMelanesia,prehistoricSamoansventuredeastwardincanoestosettletheMarquesasandfromthispoint,inthenext450years,thePolynesianstooktheirplants, animals,adzes,shinggearandornamentsalloverthePolynesianworld.Thistraditionalviewisprobablynolonger tenable.Exceptforrootvestigesinabout1%ofthetotalvocabularytherearenotracesofPolynesianlanguageties toanyregioninthewestPacicandbybloodtypingstudiesitisapparentthatthetruePolynesiansarerelatedtothe aboriginalpeoplesofAmerica,nottotheMelanesians.Ref.45[66]Wehavechosenthismoduletodiscussthe probablemigrationoftheNorthwestAmericanKwakiutl-Haida-SalishpeopletoHawaii,althoughthetime-frame hasnotbeendenitelyestablishedanditmighthaveoccurredanytimeintheearlyChristianerauptotheclassicaldate ofA.D.750,whichhasbeenacceptedbymanyforthetimeofthesettlementofHawaii.Asstatedonpages269and 270,theCanadiancoastalIndiansandthePolynesiansallseemidenticalphysically,andneitherofthesegroupshave anyrelationshiptotheinhabitantsofpresentdaySoutheastAsiaand/orIndonesia.GeneticallybloodgroupBhasa maximumoccurrenceinIndonesia,MelanesiaandMicronesiabutitistotallyabsentamongpure-bloodedPolynesians andNorthAmericanIndians.Thebloodsub-groupsofthePolynesiansalsofollowthoseoftheaboriginalAmericans. Thesestudieshavebeenrepeatedbyseveralinvestigatorsandconrmedbyaninternationalworkgroupin1972. SuperciallythegutturalpresentdaylanguagesoftheNorthwestIndiansdonotresemblethesofterspeechofPolynesia,butsomelinguistshaveconrmedarelationshipofthelatterwiththeHaidalanguageofthecentralnorthwest Canadiancoast.Thehouses,mats,sh-hooks,stoneadzes,poipounders,warclubsandinsomeinstancesthetotem polesareidentical,withinnarrowvariations,inthetwogroups.Thelegendsofthesepeoplegivefurtherclues.A legendaryherofromwhosebrotherthechiefsoftheKwakiutlgottheirdivinedescentwascalled"Kan-e-a-ke-luh" 16 Similarpronunciationsareusedbyadjacenttribes,alwayswiththebeginning"Kan-e".Thelegendcontinueswith thestoryofKaneakeluhmarryinga"womanofthesea"andthetwodisappearing,leavingthesuntorepresentthem. TribalmemoriesofHawaiidescribethediscoveryoftheirislandsbyawanderingchiefwhocamefromavastisland ormainlandinthenorthcalledthe"losthomeofKane".KanewasthechiefHawaiiangodandconsideredthedirect ancestoroftherulingfamilies.WhiletheKwakiutlclaimeddescentfromtheyoungerbrotherofKane.Itisfeltthat thenewlyarrivingPolynesiansonHawaiitendedtoabsorbthebeliefsandcustomsoftheformerinhabitants,rather thanexterminatingthemandthatthemixtureoftheracesbeganatthattime.Ref.95[140]AdditionalNotesp. 280 Ithasbeenestimatedthatinthiscenturystone-masonswereatworkmakinggiantstatutesinthemid-southPacic onEasterIsland.ThorHeyerdahlbelievethatthereisarcheologicalandethnologicalevidencethatthesepeoplehad migratedbyraftsfromapre-IncancivilizationinPeru.Wehastentosaythatonlyafewothersacceptanyofthis theory,althoughbloodfactorsinSouthAmericaandonEasterIslandsuggestthatthepeopleontheislandresemble theAmericansmorethaneitherofthesegroupsresembleAsianMongoloidsandthattheyhaveprobablyreceived genesfromboththeEastandtheWest. Recentarcheologicalexcavationsandcarbon-datingonthatislandbyHeyerdahlandhisassociateshaveestablished threeculturalperiodswiththerst,orEarlyPeriod,datingfrombeforeA.D.380toaboutA.D.1100.Byisland traditionthepeopleofthisperiodarrivedfromtheeastunderKingHotuMatua,afterasixty-dayjourneyonthesea. These"long-ears"peoplehadraisedmoaiorstatuesandmadetheirhomesfromstone,althoughwoodwasplentiful ontheislandatthattime.TheyalsobuilttotorareedboatsidenticalwiththoseofinlandTiahuanacowaterwaysand thedesertcoastregionofPeru.Whathappenedtothisearlyculturebyabout1100isunknown,butthesubsequent historyofthisislandwillbetakenupagain,then,inalatermodule. NOTE :SinotoRef.300[267]saysthatmostauthoritiesdenythesetheoriesofThorHeyerdahl's,which havebeenputforwardinthetext.HeinsiststhatPolynesiawassettledfromthewest,buthedoesnotseemto considerthepossibleJapanesecurrent-CanadianIslands-Hawaiiatall,andhedoesnotmentionanything aboutbloodtypes,whichwouldseemtoprovethatthePolynesiansdidnotcomethroughthewestern Pacicislands.SinotogivestherouteatamuchearlierperiodeastfromTongatoSamoatotheMarquesas andshortlythereaftertotheSocietyIslands.AslateasNovember,1983,theNationalGeographicSociety 16 Phoneticalspelling,asgivenbyHeyerdahl,Ref.95[140],page177,quotingG.M.Dawson,wholivedamongthesepeopleinthe1880s.

PAGE 293

281 apparentlystillsubscribestotheideathattheHawaiianIslandsweresettledbytravelersindoublecanoes going2,000milesnortheastfromtheMarquesas.Ref.309[286] ForwardtoThePacic:A.D.401to500Section19.8 ChooseDifferentRegion 1.IntrotoEraSection18.1 2.AfricaSection18.2 3.AmericaSection18.9 4.CentralandNorthernAsiaSection18.5 5.EuropeSection18.4 6.TheFarEastSection18.7 7.TheIndianSubcontinentSection18.6 8.TheNearEastSection18.3 18.9America:A.D.301to400 17 18.9.1AMERICA BacktoAmerica:A.D.201to300Section17.9 Pleaseseepreviouschapters,particularlythe6thSection9.4,4thSection11.9and1stcenturiesB.C.Section14.9 andthe3rdcenturyC.E.Section17.9,aswellasThePacic:A.D.301to400Section18.8. ItisapparentthatIndianpeopleinhabitedmostoftheAmericancontinentthroughoutalltheseearlyChristiancenturies.MostAmericanchiefdomswereagriculturalHopewell,Mogollon,HohokamandAnasazibutalongthe northwestcoasttherewereunusuallyrichshinggroundswithwhalesandsealswhichsupportedlargevillagesand acomplexceremoniallife.InthesouthwestitwasneartheendoftheEarlyBasketMakerperiodoftheAnasazi.In theirexcavatedgraves,alongwiththebasketshavebeenfoundskeletalremainsoftheseancientpeople,burieddressed instringapronsandloinclothsmadeofhair,fursandfeathers.Noclayvesselsorredpotteryhavebeenfound.Ref. 8[14],210[283],CENTRALAMERICA,ANDTHECARIBBEAN Atthistime,thebeginningoftheClassicPeriodinMiddleAmerica,Teotihuacnhadbecomethelargestoftheancient Mexicanempires,extendingfromtheValleyofMexicotoGuatemala.InadditionanewempireoftheMayasappeared inYucatan,withpavedroadsextendingthroughouttherealm.Althoughthecitywasancient,therewerenowprobably 1,000peoplelivingaroundCuella,innorthernBelize.Atwelvefoothighplatform,spreadovermorethananacre, hasbeendatedtothis4thcenturyinthatplace.Increasinglytallerpyramidselevatedtemplesashighas30feetabove theground.NormanHammondRef.263[127]whohasrecentlyexcavatedmanyarchaeologicallayersatCuello, saysthathehasdemonstratedanindependentMayaculturaltraditionthereatleast4,000yearsold,andhebelieves thatthisareawasthemainspringofMayacivilization-nothighlandMexicoorhighlandCentralAmerica,assome haveclaimed.TheentireMayanCulturewasmarkedbyadistinctiveartstyle,theuseofthecorbelledvaultand advancedmathematicalconcepts,includingtheuseofzero,acomplexcalendarandtheNewWorld'smostadvanced 17 Thiscontentisavailableonlineat.

PAGE 294

282 CHAPTER18.A.D.301TO400 writingsystem.SeealsoAmerica:300to201B.C.p.192,America:0toA.D.100Section15., CENTRALAMERICAANDTHECARIBBEANandAmerica:A.D.101to200p.253.Mayanastronomers calculatedtheexactlengthofthesolaryear,thelunarmonth,therevolutionofplanetVenusandwereabletopredict eclipses.ForthelattertheyusedmonumentssimilarinfunctiontoStonehengeinEngland.Theirsistercivilization inPetenalsocontinuedonahighlevelandtheskilledHuastecbuildersofElTajunatVeracruzdivertedfresh-water canalstofertileterracesbetweentidalriversandbrackishestuaries.Thiscivilizationourishedfor800to900years. Ref.8[14],39[60],236[314] MoreinformationabouttheinterestingMocheCultureofPeruiswarrantedatthistime,eventhoughtheymayhave livedatamuchearlierperiod,andtheaccomplishmentsweshallmentionnowmaybeconfusedwiththelaterChan ChanSociety.Ahistoryoftheirraceandcustomsseemstohavebeenleftintheirceramicart.Portraitceramicsshow theroundface,highcheekbonesandhookednose,witharingnostrils.Theguresfrequentlydepictvividmovement. Theirlandscapeshadunusualdetailandtheirgoldworkemphasizedmosaicsofturquoiseencrustedongold.Using silverandcopperinsmeltingtechniques,theyhadthe"lost-wax"methodofcastingandtheirownformsofwelding, soldering,hammering,gildingandrepousse.Althoughtheiroriginanddateofappearanceishighlydebated,the societyapparentlyexistedforabout1,000years. InthehighcountryofthePeruvian-Bolivianborder,theTiahuanacocivilizationpersisted.InthesouththeNazcasmay havehadacloserelationshipwiththeParacas,andaplaceknownasNecropolismayhavebeenusedasacemetery forchiefsandpriestsofbothtribes.Morethanfourhundredmummies,allwrappedinshroudsandelaboratecloaks havebeenfoundthereinabuildingunderthesands.Someoftheembroiderydesignsshowstrange,maskedpeople whoappeartobedescendingfromabovewiththehelpofmanyribbons,thesignicanceofwhichremainsunknown. Ref.10[18],176[242] FowardtoAmerica:A.D.401to500Section19.9 ChooseDifferentRegion 1.IntrotoEraSection18.1 2.AfricaSection18.2 3.CentralandNorthernAsiaSection18.5 4.EuropeSection18.4 5.TheFarEastSection18.7 6.TheIndianSubcontinentSection18.6 7.TheNearEastSection18.3 8.PacicSection18.8

PAGE 295

Chapter19 A.D.401to500 19.1A.D.401to500 1 19.1.1A.D.401TO500 BackwardtoA.D.301to400Section18.1 Theclassicalworldexperiencedanextensivecrisisinthiscenturyasnomadpeopleseruptedallalongtheedgesfrom ChinatoEurope.Thelattercontinentwasthrown-intowhathasbeencalledthe"DarkAges"andonlyChinacoped successfullywiththeinvaders,althougheventhereaperiodofpoliticalfragmentationoccurred.Thenewinvaders werenotbasicallyIndo-European,asinpreviouscenturies,butchieyAsiaticslinkedbycommontraditionsand sometimeskinshipsoftheirleaders.MostwereMongoloid,withAltaiclanguagesnowbestrepresentedbyvarieties ofTurkish.SomesmallgroupsofIndo-Europeansdidaccompanythemeitherassubjectsorallies. ChristianitywasalmostcompletelytriumphantintheNearEastalthoughmuchdissensionregardingcreedremained. Fromthisperiodonthisreligionbecamethedominantpoliticalandsociologicalfactorintheprogressofwestern civilization.ThefollowingquotationfromDurant 2 statesthesituationatthistimeveryeloquently. "TounderstandtheMiddleAgeswemustforgetourmodernrationalism,ourproudcondenceinreasonandscience, ourrestlesssearchafterwealthandpowerandanearthlyparadise;wemustentersympatheticallyintothemoodof mendisillusionedofthosepursuits,standingattheendofathousandyearsofrationalism,ndingalldreamsofutopia shatteredbywarandpovertyandbarbarism,seekingconsolationinthehopeofhappinessbeyondthegrave,inspired andcomfortedbythestoryandgureofChrist,throwingthemselvesuponthemercyandgoodnessofGod,andliving inthethoughtofHiseternalpresence,Hisinescapablejudgment,andtheatoningdeathofHisSon." SomeoftheaspectsofpaganismsurvivedintheformofancientritesandcustomstransformedintoChristianceremoniesandsomeofthepagangodswerereplacedbysaints.StatuesofIsisandHoruswererenamedMaryandJesus; theRomanLupercaliaandthefeastofthepuricationofIsisbecametheFeastoftheNativitywhiletheSaturnalia werereplacedbyChristmascelebrations.TheFloraliawasreplacedbyPentecost,thefestivalofthedeadbyAllSoul's DayandtheresurrectionofAttisbytheresurrectionofChrist.Theharshslaughterofalivingvictimwassublimated inthespiritualsacriceoftheMass. Magic,astrologyanddivinationweredenouncedbythechurchbutmedievalliteraturewasstillfullofthemandsoon peopleandevenpriestswouldusethesignofthecross-asamagicincantationtoexpeldemons.Thechurchcreed 1 Thiscontentisavailableonlineat. 2 DurantRef.49[73]page74 283

PAGE 296

284 CHAPTER19.A.D.401TO500 becameverydogmaticandanydoubtwasasin,sothattheredevelopedanunendingconictwithuentintellectand changeableideasamongmen. ThedecayoftheWestandtheresultinggrowthofpovertyandviolencegavecauseformentoseekconsolationin theirsufferingwiththeresultthattheageofpowergavewaytoanageoffaith.ThusintheseearlyChristiancenturies menturnedfromscience,knowledge,powerandprideandtookrefugeforathousandyearsinhumblefaith,hopeand charity.Ref.49[73]SeealsoadditionalmaterialunderAFRICAandTURKEY,intheparagraphstofollow. AfterthedeathofJulianinthelastcenturythefateoftheJewsintheByzantinelandstookaturnfortheworse. Theoldrestrictivelawswerere-enactedandmademoresevere.TheJews,excludedfromPalestine,returnedtothe villagesandthereremainedonly10%oftheformerJewishpopulationinPalestine.In425TheodosiusIIabolished thePalestinianpatriarchateandGreekChristianchurchesreplacedthesynagoguesandschools.SomeJewsmoved eastintoMesopotamiawheretheybecameprosperousfarmers,brewersandtradersandsomewenttoPersiawhere theexilarch,orheadoftheJewishcommunity,wasrecognizedbythePersiankings.OtherswenttoNorthAfrica, Italy,Sicily,SardiniaandSpain,wheretheyprosperedundertheVisigoths.Alwaystheykepttheirreligionandstudied theTalmud.WhilethelanguageofworshipwasHebrew,theyusedAramaicfordailyspeechintheEast,Greekin EgyptandEasternEurope,butelsewheretheyadoptedthelanguageoftheirhostpopulation.LikemostMediterranean peopletheJewsslippedbackintovariousmedicalsuperstitionswhichfoundtheirwayintotheTalmud.Ref.49 [73] ForwardtoA.D.501to600Section20.1 ChooseDifferentRegion 1.AfricaSection19.2 2.AmericaSection19.9 3.CentralandNorthernAsiaSection19.5 4.EuropeSection19.4 5.TheFarEastSection19.7 6.TheIndianSubcontinentSection19.6 7.TheNearEastSection19.3 8.PacicSection19.8 19.2Africa:A.D.401to500 3 19.2.1AFRICA BacktoAfrica:A.D.301to400Section18.2 EthiopiacontinuedtobeaChristianareaincommunicationwithsouthernArabiaandEgypt.Axumexpansioninthe rsthalfofthecenturywasfollowedbyaperiodofstagnationinthelasthalfalthoughByzantinemissionariesand traderscontinuedtovisittheregion.NominallyunderAxumitecontrol,NubiaapparentlywasnotreallyChristianized inthiscentury.Thereligiousandpoliticalconfusionofthisperiodisapparentinfourpapyrirecentlydiscovered atQasrIbrim.ThreewerewritteninSahidicCopticandthefourthinprovincialGreek.TheCopticoneswereall addressedtoTantani,GovernorofNubiaandapparentlyChristian.TheGreekdocumentisfromapagankingofthe BlemmyestothekingofNoubadesandreferstoaformersupremekingofNubia,calledSilco.Ref.270[36],271 [7] 3 Thiscontentisavailableonlineat.

PAGE 297

285 NominallystillundercontrolofRome,EgypticSociety,accordingtoToynbeeRef.220[294],becameextinctin thiscenturyleavingno"off-spring"inanysubsequentsociety,todate.Thelittleintellectualactivitythatremainedin theremnantsoftheRomanEmpirewasnowcenteredinByzantium,butconsiderablereligiousmaneuveringcontinued inAlexandria.Cyril,PatriarchofAlexandria,andlateroneofthetwoorthreeSt.Cyrils,ledagreatstruggleagainst NestorianismwhichnallyculminatedintheCouncilofEphesusin431.CyrilpresidedandhadthesupportofPope Celestine1.Hisdoctrines,althoughconsideredorthodoxatthetime,wereactuallyinpartthoseofMonophysitism andafterhimthisbecamethenationalfaithofEgypt-eventuallytheCopticChurch.Ref.220[294],48[72] IncontrasttoEgyptthispartofAfricawasaverybusyplace.InthefarwestMoroccowasinvadedandconquered byBerberscomingfromthesouthwest,andthentheyevenattackedtheRomanholdings,usingnewlydomesticated camels.In427Bonifatius,RomanmilitarycommanderinnorthAfrica,wasabouttobecutoutofcommandby enemiesintheemperor'scourtinRavenna,soherebelledandcalledupontheVandalsofSpaintocometohisaid.In thefollowingyear,AsdingVandalsfromSpaindidgotonorthAfrica,sailingwithalargeeetunderKingGaiseric whoproceededtoconquermostofnorthAfrica,eventuallyevenCarthageA.D.455andthenSardinia,Corsicaand thewesternpartofSicily.ThetotalnumberofVandalsleavingSpainwasprobablynotover80,000buttheyhadthe advantageoflocalsocialunrestandthecooperationofBonifatiusandthusmetlittlelocalresistance.ManyBerbers andtheDonatisthereticgroupofChristianswithaboutone-halfoftheirbishopsalsohelpedtheinvadersagainstthe Romans.TheDonatistswerethefollowersoftheonceBishopofCarthage,Donatus,whodeniedtheefcacyof sacramentsadministeredbypriestswhowerethemselvesinastateofsin,andtheChurch,willingtorisksomuchon thevirtuesoftheclergy,repudiatedtheidea. AsaresultoftheirpersecutiontheDonatistsbecamebandsofrevolutionists,atoncebothChristianandcommunist, condemningpovertyandslaveryandendinginfanaticism,happytohelptheVandals,whowereArianChristians. OnceGaiserichadobtainedCarthageheusedthefacilitiestheretogreatlyaugmenthisnavyandsubsequentlywas abletoactuallysackRome,itself.BarryFellRef.66[97]believesthatsomeorthodoxChristiansactuallysailedto NorthAmericaatthistimetoescapetheVandals.AccordingtoHerodotus,theGaramantesofFezzaninthedeserthad horse-drawnchariots,probablyobtainedfromEgypt.Ref.206[83],8[14],127[176],137[188],83[123] AmongthemoreorthodoxChristiansofNorthAfricawasSt.Augustine,whohadbecomeconvertedfrompaganism andsinasayouthandwholaterwroteextensivetheologicaldissertationsrationalizingthereligionandestablishing manyCatholicdoctrines,asheintroducedsomeelementofGreekphilosophyintoChristianity.Itwasmentionedin thelastchapterthatThomasRef.213[288]considershimoneofthefourgreat"fathers"oftheCatholicchurch. HewaskilledduringoneoftheVandals'sieges. IntheSudan,therootsofthegreatAfricanKingdomofGhanamaydatebacktoA.D.400.Certainlythetownof Jenne-JenowasprosperingattheinlanddeltaoftheNiger.Theerodedfoundationofahousehasbeenexcavated alongwithpotteryandurnsforburialandremainsofawallaboutthreemeterswideandfourormoremetershigh thatgirdedthecity.Allofthesethingshavebeendatedtothisorthenextcenturyortwo.IncentralAfricatherewas continuedproliferationoftheblackpeople,particularlytheBantu-speakers.Ref.268[189],154[212] ForwardtoAfrica:A.D.501to600Section20.2 19.3TheNearEast:A.D.401to500 4 19.3.1THENEAREAST BacktoTheNearEast:A.D.301to400Section18.3 4 Thiscontentisavailableonlineat.

PAGE 298

286 CHAPTER19.A.D.401TO500 ArabiawasprimarilyaBedouinland,withsocialorganizationpivotingaroundthetribe.BothByzantineandPersia triedtoprotectthemselvesbysupportingnewbufferArabborderstatesandthroughthesebufferzones,foreigncustoms andideaslteredintotheworldofthenomads.FarsouthArabiaremainedacivilized,Christiancommunitywithclose tiestoEthiopia.InNorthYemenrepairswereattemptedonanoldearthendamstretchingsometwothousandfeet acrosstheWadiDhana,using20,000men,14,600camelsand12,000donkeyteams.Thedamdivertedoodwaters toirrigateabout4,000acresoflandbutitlastedforonlyaboutacentury.Ref.82[121] ThisregioncontinuedaspartoftheByzantineEmpire.MonophysitismdominatedinwesternSyriawhileNestorians wereprominentintheeastuntilexpelledinthelaterpartofthiscentury. TheSassanidEmpirecontinuedtoourishandafteratreatywithByzantiumtherewasrelativepeaceandtoleranceof Christians.TheNestorianswereparticularlyprevalentinIraninthelatterpartofthecenturyaftertheyhadbeenrun outoftheByzantinearea,proper,andlateroutofSyria.ThecityofBandorShahpuronthePersianGulfwasthesite ofagreathospitalandtranslationcenterofGreektextstoArabic.TheNestorianswereactiveinthesetranslationsand infoundingthehospital.ParticularlyfamouswasJurgisBukht-Yishu,rstofsixgenerationsoftranslators. ThecenturybeganwithZorastrianismcontinuingasthemajorreligionwithtaintsofHellenismstillremaining,but nowappearedMazdak,anewpreacher,revivingakindofManicheandoctrine,whichwastranslatedintoakindof communism.ItcausedmuchpoliticaltroubleforKavadhI,whooriginallyhadsupportedthedoctrine.Thisking marriedaHepthalitealsospelledEphthaliteandsometimescalled"WhiteHun",probablyerroneously 5 princessof thetribethathadtakenovertheoldKushanterritoryandwhowerebeginningtoabsorbmuchlandfromPersia.These people,aswellasChionitenomadswerethreateningfromthenorthmostofthiscentury.Oneofthemostfamous oftheSassaniankingswasVahramValsoVarahran,surnamedGor,greathunter,poetandmusician,wholeftthe administrationofthecountrytohischiefmagus,MihrShapurA.D.420-440. InA.D.484thePersianarmywasnallyannihilatedandtheirkingkilledbytheHepthalites.Duringtheirperiodof controlofPersiaintheremainderofthecenturyanexiledPersian,Kobad,whohadbeenlivingamongtheinvaders, tookthethrone,onlytobedrivenoffagainbyhisownnoblesin489,perhapsbecausehesupportedthepriestMazdak's theories.Ref.137[188],8[14],38[59],119[166] 19.3.2ASIAMINOR:ANATOLIA Asinthepreviouschapter,thereaderisadvisedtostudythesectionsonTHEBALKANS,CENTRALEUROPEand ITALYalongwiththissection.Forthetwocenturiesjustpreceding,theByzantinemonarchyhadkeptupRoman institutionsandhadcontinuedtouseLatininitscourts,butinthiscenturythecentraladministrationstoppedtheuse ofLatininfavorofGreek.Littlewasaccomplishedfromthepoliticalandsocialstandpointduringtheentirecentury. Forthesakeofcompletenessonly,therulersofByzantiumarelistedasfollows: 5 Theoriginandethnicafnitiesofthesepeopleisunknownbuttheyprobablyhavenorelationshiptothe"Attilic"Hunswhichwillbedescribed laterinthischapter.TheEphthalitesmayhavebeenofTibetanorTurkishorigin.Ref.38[59],127[176]

PAGE 299

287 TheDynastyofTheodosius TheDynastyofLeo 395-408Arcadius 457-474LeoI 408-450TheodosiusII 474-LeoII 450-457Marcian 475-491Zeno 491-518Anastasius Table19.1 AsthiscenturybeganGoths,underaformerRomanarmygeneral,Gainas,occupiedConstantinople.Theyweresoon eliminated,however,bymobsandtheimperialarmyandthereafterGothswerenotallowedtoserveintheimperial forcesasunits,butonlyasindividuals.WhenTheodosiusIIbegantorulehewasyoungandweakandtheempire wasactuallycontrolledbyhisEmpressEudoxia.Thereignwasatranquilperiod,however,andeventhewarswith Persiaceased.AnofcialcollectionofimperiallegislationwaspublishedastheCodesTheodosianus.Thegreat issueoftheadministrationwasNestorianismversusMonophysitism.In428TheodosiusmadeNestoriusthepatriarch ofConstantinopleandthelatterthenstartledtheChristianworldbypreachingthatMarywasnottobeconsidered theMotherofGod,butonlyMary,motherofthehumanChrist,andthusanotherheresywasstarted.Atthethird EcumenicalCouncilofEphesusof431MonophysitismtriumphedandNestoriuswasexcommunicatedandbanished totheLibyandesertwherehesubsequentlydied.HisfollowersestablishedtheNestorianChurchandedtoeastern SyriaandlatertoPersia,eventuallyfoundingcommunitiesinBalkhandSamarkand,inIndiaandevenChina.Scattered throughAsiaafewsurvivetothisday,stilldenouncingMariolatry.Ref.127[176],8[14],49[73] TheonethornofTheodosius'otherwisepeacefulreignwastheinvasionoftheBalkansbyAsiaticHunswhichhad beguninthewinterofA.D.404-405undertheleadershipofUldin.By408theywereterrifyingtheBalkanpopulation. WhenmanyoftheHunsdefectedtotheByzantinetroopsinthearea,however,Uldinretreatedforthemoment.Periodic invasionsofThracerecurred,however,throughthefourthdecadeofthiscentury,requiringlargetributepaymentsfrom theByzantinegovernment.Therewerestillmoreanattackin441and442andtheeasternRomanarmy,underaGoth GeneralAspar,wasbeatentimeandagain.TheHunsbrokeofftheengagementonlyafterarrangementsforlarge tributepaymentsbyTheodosius.AftertheHunsretreatTheodosiusstoppedtheagreeduponpayments,probablynot becauseofalackoffunds.IthasbeenestimatedthattheaverageyearlyrevenueoftheEasternEmpireatthattime wasabout170,000poundsofgold,withonly45,000poundsofthisspentonthearmy.Atanyrate,becauseofthelack ofpaymentthegreatestHuninvasionofallinThracewaslaunchedin447withAttilaatitshead.Theodosiusbegged fortermsandAttilagot6,000poundsofgolddueasbackpaymentaswellasapromiseof2,100poundsannuallyin thefuture.Attoday'svalue,thiswouldbeintheneighborhoodof$29,000,000andover$10,000,000respectively.In addition,therewastobea"demilitarizedzone"fromPannoniatoSistovanorthBulgaria.Ref.127[176] ThefourthEcumenicalCouncilmetatChalcedonin451underTheodosius'successor,Marcian,andthistimeMonophysitismwascondemnedaswellasNestorianism,settingthestageforcontinuedreligiouscontroversyforanother twocenturies.OnMarcian'sdeath,thebarbarianGeneralAsparwasinuentialingettingamilitarytribune,LeoI,as emperor.He,too,hadHuntroubleasAttila'sson,Dengizic,ledaninvasionintoThraceagain.Thistime,however, manyoftheHunsdidnotjoinhimandin469theeasternarmydefeatedhim,killedhimandtookhisheadtoConstantinople.ThiswasthelastorganizedHunexpeditionbutmanyofthosemensubsequentlyjoinedtheeasternarmy forceswheretheybecameknownas"Massagetae".Ref.127[176] WhenZenobecameemperorin474hefollowedpolicieswhichincreasedtheschismbetweentheeasternandwestern domainsoftheoldRomanEmpireandthewesternpositioncompletelycollapsedin476. TheMonophysiteChristiansofArmenianowformedtheirownchurch,independentofConstantinople,andcalledit simplytheArmenianChurch.WhereastheyhadformerlyusedtheGreeklanguage,theynowgotanationalalphabet

PAGE 300

288 CHAPTER19.A.D.401TO500 andhadtheBibletranslatedintoArmenian.Thiscountryhadafullydevelopedfeudalsystemfromroyalfamilies downtopeasants,butatthistimethenationwasnominallysubservienttoPersia.ThepeoplerevoltedagainstPersia whenheavytaxeswereleviedandthereweresomereligiouspersecutions,buttherevoltwasnotsuccessful.In455 and456thePersiansforciblyconvertedArmeniatoZorasterismbutneartheendofthecenturytheArmenianleader, Vahan,helpedthePersianKingVolagasesinacivilwarandinanEdictofToleration,theChristianswereagaingranted freedom. ForwardtoTheNearEast:A.D.501to600Section20.3 ChooseDifferentRegion 1.IntrotoEraSection19.1 2.AfricaSection19.2 3.AmericaSection19.9 4.CentralandNorthernAsiaSection19.5 5.EuropeSection19.4 6.TheFarEastSection19.7 7.TheIndianSubcontinentSection19.6 8.TheFarEastSection21.3 9.PacicSection19.8 19.4Europe:A.D.401to500 6 19.4.1EUROPE BacktoEurope:A.D.301to400Section18.4 ThisisusuallyconsideredthebeginningoftheEuropeanMiddleAgesanditwasaperiodofwarmingclimaticchange. Ref.215[290]ThetownsoftheRomanEmpirehadbeendecliningevenbeforethearrivalofthe"barbarians",but now,withtheendoftheempire,theWesttrulylostitsurbanframework.Ref.260[29] MostoftheseislandswereunderByzantinecontrolandbothscienceandliteratureourished,particularlyonRhodes, intheseearlyChristiancenturies.Ref.38[59] GreecewassubmergedintheaffairsofConstantinople.TheonlyuniquefeaturewasaraidonthecoastlinebyVandals fromtheirbasesinAfricaattheendofthecentury. IntheearlypartofthecenturytheareaofpresentdayYugoslaviawaspartoftheVisigothkingdomandaftertheGoths weredefeatedwhileinvadingItalyin402and403byStilicho,theyretiredagaintothatregion.Inthissamearea andinnorthernpresentdayAlbaniathelastrealwesternRomanEmperorlivedfrom476to480,isolatedintheold RomanprovinceofDalmatia.MeanwhileinthewesternpartoftheupperBalkans,Slavictribesrstsettledinwhatis nowBulgariawiththeBulgarsprobablyamixtureofHunsandothernomadsrightbehindthem.TheBlackHuns, probablyencouragedbythewarmingEuropeanclimatewhichmadenepasturelandfortheirhorses,raidedthroughouttheBalkansandruinedtheareaforsomethreecenturiestofollow.TheyhadarrivedaboutA.D.400undertheir 6 Thiscontentisavailableonlineat.

PAGE 301

289 ruler,Uldin,whoproceededtoleadthemintoThraceonraidsinthewinterof404-405.Thishappenedagainin408, 422andseveraltimesinthe430s.In441Illyriumwasthetarget.ResumptionofBalkanraidsin442broughtbig tributeconcessionsfromtheByzantineemperor,Theodosius.WhenhelaterrenegedonthepaymentsAttillahimself ledagreatHunnicinvasionofThracein447anditcosttheemperorstillmoreingoldpayments.SeeTURKEY, above AheadoftheHunshadcomeSlavicpeoples,somefromtheso-calledeasternSlavgroups,butchieflyfromthe westernSlavtribesandthesesettledtobecometheancestorsoftheSerbs,Croats,SlovenesandMacedonians.The Huns,themselves,hadactuallysettledinHungary,butmadetheirperiodicraidsbackintotheBalkansasnoted.During theirvariousinvasionsandraids,manyoftheHunsoldierstooknativewomenaswives,thusputtingAsiaticblood fromtheBlackSeatoBavaria.AfterA.D.455therewereonlytwopocketsofHunsremainingintheBalkans-oneina portionofmodernBulgariaalongthewestshoreoftheBlackSeaandthesecondinDacia,-somewhatwestoftherst group.In465theseHunsattackedtheGothswhowereinPannonia,buttheyweredefeated.AsecondGothic-Hunnic WardevelopedsouthoftheDanubein465.Ref.137[188],175[241],215[290],127[176],THEBALKANS,andCENTRALEUROPE AtthebeginningofthecenturytheweakRomanEmperorHonoriusputtheVandal,Stilicho,incommandofthe armyoftheWestandhewasimmediatelyputtotestbyinvadingAlansandVisigoths.Stilichodefeatedthemusing VandalsandevensomeAlanicmercenariesintwogreatbattlesin402.TherewereseveralotherinvasionsbyAlani, VandalsandGothsinthenextfewyears,duringwhichtimeHonoriusmovedhiscourttoRavenna,supposedlyout ofharm'sway.Intheearlybattles,StilichohadtostriptheRhinefrontieroftroopssothatinthefollowingyears anewcoalitionofOstrogoths,QuadiandAsdingVandals,alongwithaclanofAlanswhohadedfromtheHundominatedCaucasus,movedwestalmostunopposedandcrossedthefrozenRhineintothenowalmostdefenseless France.Stilichowasexecutedbyhisownemperorin408,thusopeningthegatestoKingAlaricandhisVisigoths, whonowleftYugoslavia,enteredItalyandby410hadsackedRome 7 .AlaricdiedshortlythereafterandAthaulf becamekingoftheVisigothsastheymovedtoGaulinA.D.411. UponthedeathofHonoriusin423theEmperorTheodosiusIIofConstantinoplebecamethesolerulerofbothEast andWest.TheusurperJohnwasproclaimedWesternemperorbytheRavennacourtin424butEasternarmiesunder theAlanGeneralArdaburandhissonAspar,defeatedtheforcesatRavenna,executedJohnandmadeValentinian IIItheemperor.Johnhadexpectedhelpfrom60,000HunswhohadbeenrecruitedinPannoniabyAetius,butthey arrivedtoolateandweresentback.Fromthistimeonthemilitaryhadthegreatestpowerandusedincreasingnumbers ofGermanicandHunnicauxiliaries.Aetiusbecametheseniorgeneralin430.UnderEmperorValentinianIII,LeoI, surnamedtheGreat,becametheBishopofRomeandinessencethePopeofWesternChristendom.Bycourageand statesmanshipheraisedtheApostolicSeetonewheightsofpoweranddignityandweshouldnotethatthis,ineffect, marksthebeginningoftheverydeniteseparationoftheheadofthewesternChristianChurch,soontobeknownas thePope,fromthefewremainingweakWesternRomanemperors.Fortherecordtheseemperorsareasfollows: 455-PetroneusMaximus 456Avitus 457-461Majorian 461-465LibiusSeverus 467-472Anthemius 472-Olybrius 473-474Glycerius 474-475JuliusNepos 475-476RomulusAugustulus.EndoftheRomanEmpire,West Toreturntoournarrative,in440theVandalslandedinSicilyandin452AttilainvadedItalywithhisHuns.After plunderingEtruria,however,heretreatedbecauseoffamineandepidemicandapparentlysomegoldpaymentfrom 7 ItisofinterestthatAlariccaptured5,000poundsofpepperinRome.Ref.260[29]

PAGE 302

290 CHAPTER19.A.D.401TO500 Rome.GeneralAetiuswasmurderedin454byValentianIIIandhisassociates,butthentheemperorhimselfwas murderedayearlaterandtheVandalsattackedRomeagain,plunderingthecityfortwoweeks.Noaidcamefrom theEast,andthenewEmperorPetroniusMaximuswaskilled.Thenextemperor,AvituswithsomealliesfromGaul wonsomevictoriesovertheVandalsinSicilyandoffCorsica,butthenAvitus'general,Ricimer,revoltedanddeposed theemperor.ButRicimerwasaGermanandcouldnotbecomeemperor,soMajorianusassumedthatrole.Hebuilt anavyandbeefedupthearmywithOstrogothsandrestoredsomevestigeofimperialprestigeinGaul.Buthewas decapitatedbythewilyRicimerafterlossofaseabattleoffthecoastofSpain.TheWesternRomanEmpirewas nowinpoverty.InthisonecenturyRomeshrankfromapopulationof1,500,000to300,000asItalywasinvadedsix times.FinallyinthesixthdecadeofthiscenturytheEasternemperor,LeoInottobeconfusedwiththeBishopof Rome,decidedtohelpdefendItalyagainsttheVandalsandsentalargeeasternarmyandeettojoinwiththewestern EmperorAnthemius'forces.In468anarmyof100,000andnavyof1,100shipsstilllosttotheVandals. Asindicatedabove,thelineofWesternRomanemperorscametoanendandZenoinConstantinoplehadjurisdiction overall.TheGermanswhohadbeenbroughtintoItalyineverincreasingnumbersnow,asaresultoftheirmultiplicationandintermarriage,becameaveryprominentfactioninItaly.Within20yearssouthernGaul,DalmatiaandItaly wereallGermankingdoms.Odoacer,thesonofEdecon,aministerofAttilabuthimselffromGermantribeunder Attila'srule,governedItalyas"Patricius",underthedistantEmperorZeno.Thelattersoonbecameafraidofthepower ofOdoacerandactuallyencouragedtheOstrogothKingTheodorictoinvadeItaly.Afterfouryearsofwar,from489 to493,TheodoricbecamemasterofanenlargednewGothic-ltaliankingdomwithacourtatRavenna.TheOstrogoths wereAriansandthisreligiousheresysituationbecameapartofthecivilwarsthatdisruptedthepoliticalunityofthe empire.Ref.137[188],127[176],136[187],8[14] Stillunconquered,theVandalscontrolledwesternSicilyandSardiniaaspartoftheirnorthAfricankingdomthroughout theremainderofthecentury.,THEBALKANSandITALY "Germanic"isadesignationofagreatmanytribeswhospokerelatedGermaniclanguages.Several,suchasthe Saxons,EastFranksandAlemannieventuallysettledintheregionbetweentheAlpsandtheNorthSea,theRhineand theBohemianmountainsandtheirlanguagesgraduallyevolvedintomodernGerman.Others,settlinginScandinavia, EnglandandalongthechannellaidthefoundationforsuchmodernlanguagesasSwedish,Norwegian,Englishand Dutch.Germany,inthis5thcentury,wasaseaofslowlychangingandmigratingpeople.TheHunswerepushingin fromtheeast,drivingaSlavicpeoplebeforethemwhosettledinwhatisnoweasternGermany,asWendsandPoles. TheHunsthemselvesveeredtothesouththroughwhatlaterbecameAustria-HungaryandthenpushedonintoBavaria andtotheRhine,engaginginatremendousbattlewithRomanizedVisigothsatTroyesin451.Theeffectofthese migrationsandraidswastopushtheoriginalGermanictribeswestandsouthwiththeVandals,SueviandAlaniending upinSpain.TheHunsdecimatedtheBurgundianswiththeremnantssettlingas"federates"nearGeneva.Ref.177 [243],180[246],137[188] Bythelastofthecentury,theFrankswerewellestablishedonbothsidesoftheRhineinalargeareaincludingparts ofbothmodernFranceandGermany.In481ClovisbecamekingofalltheFranksandformedtherstofthelarge, centralEuropeanmonarchies.WhenheadoptedChristianityaboutA.D.500hiswesternFrankishfollowersreadily joinedhisconversion,buteastoftheRhinetherewasnotapre-existinglocalChristianpopulationandtheRhenish Franksremainedpagan.AtthissametimetheMarcomannileftBohemiaandinvadedBavaria.Ref.177[243],180 [246],222[296] ForawhileAustriawasonthemarchrouteoftheHunsandweshalldiscussthesepeoplemoreindetaillater.After OdoacerSeeITALYaboveannihilatedtheRugiertribein488theLombardsmoveddownintonorthernAustriaand southernMoravia.Vindo-bonaViennaremainedasafortressandapparentsanctuarytoallofCeltic-Romandescent.

PAGE 303

291 RomehadcompletelywithdrawnfromtheDanubeareaby488andthevacuumwaslledbytheHuns.Ref.181 [247] By406theHunswereineasternHungarywithOstrogothsjusttotheirwestandLombardsandRugiersintheCzech areajustnorthwest.AtthistimeUldinwasruleroftheHunsinRomaniaandaftermakinganalliancewithStilichoin 406togethertheydefeatedawaveofGothsinvadingVenetiaandLombardy,withthecaptivestakentobesoldlater intoslavery.TherewerenoAlansinHungaryafteraboutthisdateandthereaftertheHunsdominatedthearea.Very littleisknownabouttheminthe2nddecadeexceptthattheyhadaKingCharatonwhoreceivedgiftsfromHonoriusof theRomanEmpire.TheclimaxofHunnicpowercameafter420butin427theywereattackedbyRomansandsome wereconqueredsothatasapeopletheylostcohesionandhadnocentralauthority.By432Rugawaskingofsomeof theHuns,buthisexactterritoryisunknown.TheEastRomanswagedwaragainsthimuntilhisdeathinthelate430s. TheHunsthenhadtwokings-BledaintheeastandAttilainthewest.Thesemenwereapparentlybrothersandtheir forcestogetherbrokeintoIllyriumin441.In445Attilamurderedhisbrother,however,andbecamethesoleruler. FouryearslaterhemetwithEastRomanambassadorsjustovertheIllyriumborderonItaliansoilandAttilawasmade a"militarymagistrate"andgivenlandalongtheSavaandayearlysalary.InspiteofthisheraidedItalyin452aftera relativelyunsuccessfulinvasionofGaultheyearbefore.HewasboughtoffbeforehecrossedthePo,butMilanwas takenandmuchbootyfound.Diseasewasprobablyabigfactorinpreventingfurtherforays.Attiladiedin453and whilehissonswerequarrelingovertheestateacoalitionofGermantribesledbyArdaric,kingoftheGepids,revolted againsttheiroverlordsandafterseveralbattles,defeatedtheHunsatNedaoRiver 8 ,withallegedlysome30,000Huns slain,includingEllac,Attila'soldestson.ThusendedtheheightoftheHunpowerandalthoughtheymadeafewmore raidsoftheEasternEmpire,theynallyreturnedtotheRussiansteppeabout470andsettledontheshoresoftheSea ofAzov.Atabout444AttilahadbeenthemostpowerfulmaninEuropeandacontemporaryofValentianinRome andTheodosiusIIofConstantinople.Hewasnotentirelyasavagebutactuallyhadsomesenseofhonorandjustice, inspiteofthefactthathismenattimesdidpillageandravageandthathemurderedhisownbrother.Suchatrocities asthelatter,however,werecommonamongallrulingfamiliesofthattimeandevenmuchlater,inhistory.Ref.137 [188],38[59],127[176] SomefurtherdescriptionoftheHunsandtheirlivesiswarrantedatthistime.Theorigin,raceandlanguageofthese peopleisstillinsomedispute.Paleo-anthropologicalevidenceindicatesthattheywerearaciallymixedgroupwith bothMongoloidandEuropoid 9 elements.Upuntilthe1940stheclassicalconceptwasthattheEuropeanHunswere oneandthesamepeoplewiththeHsiung-nuoriginatinginMongoliaonthenorthernborderofChina.Thesedenite MongoloidsallegedlymovedrsttomiddleAsiaandthenspreadwestward.ButtherewereEuropoidsineastern AsiaandwesternChinaalso,someofwhichwereconqueredandenslavedbytheHsiung-nu.Someskeletonsonthe bordersofChinadatingto450-230B.C.showfeaturesofbothgreatraces-atfacesoftheMongoloidandyetthe wideopeneyesoftheEuropoid.OneofthenineteenHsiung-nutribes,theChieh,wasmassacredinnorthernHonan inA.D.349andthegreatmajorityofthemwerefoundtobeEuropoids.TheWu-sunpartoftheJungneighborsof theHsiung-nuhadceruleaneyesandredbeardsandwerepredominantlyEuropoids.Wemustconcludethatatsome pointintimeagroupofthesemixedpeoples,partMongoloidandpartEuropoid,startedwestthroughthesteppearea tobecomeknownasHuns. WehavenowrittenlanguagefromtheHuns-theirscribeswereborrowedorenslavedRomans,writinginLatinor Greek.ButtheHunaristocracyhadchieyTurkishnames,withsomeGermaniconesapparentlyborrowedfrom theirsometimesallies,theGothsandGepids.ManyoftheirnamesandplacenameswereLatinizedbytheirLatin chroniclers.ManylanguageswerespokeninAttila'skingdom-Hunnish,Gothic,Alanic,LatinandGreek,butitis probablethattheirnativetonguewasTurkic,fromtheEurasiansteppes.Thename"Attila"comesfromtheGepid "Atta"meaning"father"andhisbrother'sname,BledasisalsoGerman.Othernamesandparticularlytribalnames, however,weredenitelyTurkish. 8 ThisriverwasapparentlyinsouthernPannoniaHungary,southandwestoftheDanube 9 Theterms"Mongoloid"and"Europoid"asusedherearebasedonaclassicationbyRussiananthropologistsRef.127[176]

PAGE 304

292 CHAPTER19.A.D.401TO500 TheHunsweresemi-nomadic,keepingallkindsofdomesticanimals,butessentiallylivingontheirhorsesandoff theirsheep.Fromthelattertheyhadmutton,milk,cheese,felt,tents,shoesandcapscurvedandpointed.They spunthesheepwoolandmadelinenbutagriculturewasapparentlyataminimum.ByAttila'stime,Hunnobles hadhouseswithwallsofwell-planedplanksandpanels,containingseats,bedsanddraperies.Theylovedgoldand extractedextremelylargesumsatregularintervalsfromtheRomans.Inthe440sEastRomanspaidtheHunsabout 13,000poundsofgoldandtheyalsoreceivedsomeforauxiliarieslenttotheRomansandasransomforprisonersand throughthesaleofslavesobtainedasprisonersofwar.Tradewasbriskattimes,involvingnotonlyslavesbuthorses inexchangeforgold,wineandsilk,whichwasgreatlyprizedbyallthe"barbarians".TheHunshadanaristocracy andtheyhadslaves,althoughmostofthelatterwerequicklysoldtotheRomans.Theirwharfarewasrathertypicalof allbarbariansfromthesteppes-connedprincipallytowildcavalryattacks,accompaniedbymuchterrifyingnoise, lightlyequippedbutwithaccuratebows,lances,swordsandshields.Thereissomeevidencethatthenobleshadsome typesofarmor,chieyscalearmormadefromhorseshoofs,butthecommonersoftenfoughtnaked,afeaturewhich addedtotheterrorexperiencedbytheir"civilized"enemies.Theyappearedtobegluedtotheirshort-legged,bigheaded,shaggy,long-bodieduglyhorses.Theyhadnospurs,butdidusewhips.Thequestionofwhetherornotthey hadstirrupsisstillnotsettled.Somenomadbarbariansdenitelyhadwoodenorevenmetalstirrupsasthelater MagyarsandtheHunsworesoftshoesadaptabletoround,woodenstirrupsanditispossiblethattheyhadthem. Accuratebowshootingisdifcultandlanceghtingwithoutstirrupsisalmostimpossibleunlessthelanceismore orlesstiedtothehorse.Saddleswithawoodentreehavebeenidentied.Horseswerebrandedandear-markedfor identicationandthewarriorhorseswerealmostallgeldings.Althougharcheologicalevidenceisscant,itisassumed thattheHunsusedhorsedrawncartsforsuppliesandloot.Thestoriesoftheiratrocitiesarelegionandmostmustbe lookedatsomewhatskepticallyandtheywereprobablynotmuch,ifany,worsethananyofthenomadicinvadersfrom thesteppesoreventheRomans,themselves. Theirbowswerereex,composite 10 types,140to160centimetersinlengthandveryaccurateupto50to60meters, withaneffectiverangeupto160to175meters.AnunusualweaponoftheHunswasthelasso,withwhichthey entangledthearmsandlegsoftheenemysothathecouldnotrideorwalk.TheHunnicshieldswereprobablyof wickerwork,coveredwithleatherandtherearenoarcheologicalremainsofthese.Theydidhavesomeartworkand manydiademsofgoldsheetoverbronzeplaqueshavebeenexcavated,alongwithgoldandsilverearrings.Hunnic bronzecauldronsareplentifulfromHungaryandtheupperBalkans. ThecontemporarydescriptionofthephysiognamyoftheHunsareundoubtedlyinuencedbytheextremeterrorthey producedinthoseabouttobeattacked,butthereisnoquestionbutwhattheywereashort,thick-limbedpeoplewith atnoses,thelatterhavingbeenproducedininfancybybinding,todeformthedevelopingskull.Ithasbeensurmised thatthisallowedthewearingofaspecialhelmutwithaatnose-pieceextension,inlaterlife.Inaddition,themale's faceswereearlyscarredbyintentionalknifecuts,sothatbeardscouldnotgrowinthemature,scarredfaces.These oldhealedcutsandscars,withtheirresultingat,uglyfacescertainlydidnotdetractfromtheoverallimpressionof thedevilincarnate.Ref.127[176] AboutA.D.400theLombardsLangobardsdrovefromtheElbeeastwardandsouthward,appearingabout430in BohemiaandlatermovingintoMoraviaandAustria.TheRugianscrossedtheDanubesouthfromBohemiabutwere annihilatedbyOdoacerwhohadtakenoverDalmatiaonthedeathoftheWesternEmperorin480.Aconfederacy ofSuevicbands,theBavariansandMarcomanninowoccupiedBohemia.Ref.136[187]TheBavarians,of course,werelatertomovewestintoGermany,buttheSlavswhostayedandsettledpermanentlyinBohemiawerethe ancestorsoflaterdayCzechs,VlachsandSlovaks.ItwasonlyaftertheretreatoftheHunsthatthefullextentofthe Slavmigrationwouldberealized.Ref.137[188] 10 Abowwithlaminatedconstruction,usingwood,sinewandhorn.ThesehadbeenexcellentlycraftedandusedinAsiaandChinaformany centuries

PAGE 305

293 InthiscenturySwitzerlandwasinvadedbythemigratingAlemanniandBurgundiisothatnallythedomainofthe latterstretchedfromSwitzerlandsouthtotheMediterranean.TheHunsthenalmostannihilatedtheseBurgundiansin theirwestwardraidsinthemiddleofthecenturywiththeremnantsremainingunderRomandominationnearGeneva. Ref.137[188],127[176] TheFranks,BurgundiansandAlemanniwhohadannexedtheleftbankoftheRhine,allowedtheAlans,Vandalsand SuevitocrossthePyreneesandseizelandalongtheAtlanticseaboardofSpain.TheywenttotheStraitsofGibralter andsomeevencrossedtotheAfricanCoastandtheoldRomano-Hispanicrulingclasseswereoverthrown.Laterin thecentury,afterhavingmadeatreatywithEmperorHonorius,about100,000VisigothsunderKingWallia,successor toAlaricandAtaulf,enteredSpainandnearlyexterminatedtheAlansandtheSilingVandals.TheSueviandthe AsdingVandalsretiredtothenorthwestcornerofthepeninsulaandthenorthernareasoftheBasqueswasnevertaken. Ref.136[187]SomeoftheVandalsretreatedtoAndalusiainthesouth,fromwhichtheylatercontinuedtheir conquestofNorthAfrica.Finallytherewereabout200,000Visigothsagainstanativepopulationofsome6,000,000, buttheformerweremuchmoremobileanddynamicandeasilycontrolledSpain.Ref.211[284],127[176], 196[269]UnderTheodoricII-466theVisigothsnallydefeatedtheSueviatOportoandthenbrokewith theRomanEmpire.Euric-484,brotherofTheodoricII,completedtheconquestofthepeninsula,butlostthe originalVisigothichomebaseinGaultothesurgingFrankswhodetestedtheVisigothsbecauseoftheirArianism. Ref.196[269] WehaveseenaboveSeeITALYthatStilicho,ineffectKingofItaly,withdrewtroopsfromtheRhinetoghtvarious GermanictribesincentralEuropeandthentheMarcomanni-Quadigroup,collectivelyknownasSuevi,easilycrossed thedefenseless,frozenRhineintoFrance.Ref.137[188]MeanwhiletheFrankshadsettledonthewesternslope oftheRhine,hadcapturedCologneandwereinFranconiaontheeast.By430GaulwasabouthalfFrankishand halfGothicandCeltic,anditwasthemostprosperousandintellectuallyadvancedofthewesternprovinces.The agricultureoftheGermanictribeswasbettersuitedtothatclimatethantheRomanMediterraneanstyleofagriculture soaGermanstyleoflifetookitsplace. Asrecordedabove,inA.D.451AttilaandhisGermanauxiliaries,possiblyattherequestofGaeseric 11 ,theVandal king,movedfarintoFrancetoOrleansandafterabattlenearbyagainstamixtureofBurgundians,Romans,Franks andVisigoths,AttilanallywithdrewtoHungaryaftermassivecasualtieshadbeenexperiencedbybothsides.Only theSalianFranksinthenortheastofFrance,escapedtheHunsdominationintherstsurge.In470theVisigoths againexpandedtotheLoireandtheRhoneandthenagainconqueredSpain,exceptforafewnorthernareas,aswe havementionedabove.ClovisstartedhiscontroloftheFranksbyconquestin481andhisconversiontoChristianity occurredin496.TheCeltsonthewestsideoftheRhinehadbeenexposedtothisreligionforalongperiodandClovis' conversiononlysolidiedhiscontroloverthem.Althoughhisoriginalterritoryincludedonlythenorthernareasabout Cologne,Hesse,Tournai,CambraiandTreier,hesoondestroyedotherchieftainsoftheRhine,MoselleandMeuse valleys.HisnalmasteryoverallGaulbeganwithhisdefeatofSyagrius,"KingoftheRomans"atSoissonsin486 andhethenbecametruly"KingoftheFranks"-Ref.137[188],8[14] BRITISHISLES 11 Maenchen-HelfenRef.127[176]saysthisideais"grotesque"Page130andsaysthereasonAttilawentintoGaulinsteadofItalyis unknown

PAGE 306

294 CHAPTER19.A.D.401TO500 RomanevacuationofEnglandwasprobablycompleteby407,andin410theRomanEmperorHonoriuswrotetothe leadersofBritishtownstellingthemtolookaftertheirowndefence.Thiswasalmostsimultaneouswiththerevoltof peasants,rampantdiseaseandraidsbyPicts,Irish,Angles,Saxons,JutesandFrisians.Ref.136[187]Inthe420s Vortigern,oneoftheBritishtyrants,rosesomeinpowerandusedthepreviouslytriedRomanpolicyofusingGerman mercenariestoswellhisarmies.OtherssoondidlikewiseandthefateofCelticEnglandwasprobablysealed.There wasacontinuousinuxofnewSaxonimmigrantsandfrom440ontheyoccupiedtheeasternandsoutherncoastal areasofEssex,KentandSussexandcontrolledthemouthoftheThames.TheAnglescamefromSlesvigandbrought withthemtoEnglandaknowledgeofNordicmythology,asfoundinthe"SongofBeoweulf".Inthesouthwestthe BritonskeptouttheSaxons,undertheleadershipofKingAmbrosiusandtheshadowyKingArthur.InA.D.500these BritonswonapitchedbattleatMountBadon,somewhereinthesouthwest.Ref.43[64]SomeBritonsescapedthe GermansbygoingtotheBrestpeninsulaofFrance,subsequentlybecomingknownasBretons.Ref.137[188],222 [296] InScotlandtherewerenowfourpoliticalnuclei;Picts,Dalreada,WelshrefugeesandIdaofBernicia'srealm.Atthe endofthecenturytheGaelicScottimigratedfromthenorthofIrelandtoScotland,givingthecountryitsnalname. ThekingdomofthePictsandScotsresultedfromthefusionoftheseIrishraidersandthePictishtribes-men.Bythe endofthecenturytheIrishhadtakentheHebrides,theretocontestwiththeVikings,andmanyhadbeachedtheir shipsonthewesternPictishcoast.Ref.65[96],170[234] Apowerfulnewfamily,theUiNeillsonsofNiallburstoutofMidetotakevirtuallytheentirenorthernhalfofthe islandundercontrol,includingalargepartofConnaughtanddemolishingUlster.TheiroriginalhomenearTarain Mide,nearmodernDublin,appearstohavebeenanearlysacredplace,andperhapsusingthisasalever,theUiNeill laidclaimtokingshipovertheentirecountry.Whethertheirclaimwasgenerallyrecognizedisnotknown,butcertainly theEoganachtafamilydidnot,astheysetuptheirownstateinMunsterandpartofLeinster.TheUlsterremnants crowdedintoasmallareaontheIrishseacoastofDalRiataandfromtheretheymigratedontoPictishterritoryof Scotland,calledArgyll.TheRomanscalledtheseIrish"Scotti"andsothisnameandtheirGoideliclanguagewas giventothisneighboringisland.Ref.91[135] IrelandstartedtobecomeChristianizedabout431andshortlythereafterPatrickbecametheIrishbishop.Hewas originallyaslavetakenfromaChristianhomeinRomanBritainIrishraiders,butheescapedandwenttoFrance,where hereceivedmonastictrainingbeforereturningtoIreland.Pioustraditiontellsofhundredsofmiraclesperformedby Patrickandthenun,St.Brigid,includingrestorationsofsighttotheblindandhearingtothedeaf,raisingpeoplefrom thedeadandsimilarprocedures.Ref.29[50] WaleswasnowbecomingoccupiedbyIrish.CelticpeoplerelatedtotheFeniofcentralIrelandgaverisetothe GwyneddinnorthWalesandtheDesiofsouthernIrelandbecametheDyfedofsouthWales.ButtheseIrishwere laterexpelledbytheP-CelticspeakingCymruandtheformerleftbehindonlyOgammonumentsintheGaelictongue. Ref.65[96] TheSveasorSviarestablishedtheirkingdomonthewestsideofSwedenandlegendhasitthattheGothsdeveloped theircivilizationinsouth-centralSweden.Helgo,anislandinLakeMalar,becameatradingpostinthecenterofthe SviarKingdom.

PAGE 307

295 Archaeologicallythiseraiscalledthe"TeutonicIronAge"inDenmark.Ref.117[164]ANydamboatover60 feetlongwithanoutwardresemblancetobigboatsoftoday,withoarsandperhapssailandverylittlekeelhasbeen foundthere,datingtothisperiod.TheseboatsweresimilartotheonestheAnglessailedtoEnglandfromSlesvig throughoutthecentury.TherewerenumerousinternecinewarsandwarsbetweenNorwegiansandDanesandSwedes. Itwasawealthyperiodfortheregionbutalsoatimeoftroubles,withconstructionoffortsforeachcommunity.At theendofthecentury,eachcommunityhoardedgold.Theuseoftheruniccharacters,theScandinavians'ownsystem ofwritingtoshowthesoundoftheirlanguages,hadbeenquitefullydevelopedbythistime.Asmentionedinthe previouschapter,therunes,orletters,wereedgedandparticularlyadaptedforwritingonwood. TheancestorsoftheFinns,aFinno-Ugrianfamilyofpeoples,mayalreadyhavebeeninFinlandbythistime.They wereatleastdenitelyintheregionoftheBaltic. AdditionalNotesp.295 AsmentionedpreviouslytheFinno-UgrianpeopleswerespreadfromtheBaltictothemiddleUralsandwereprimitive huntersandshermen.SomeofthesepeopleweretheancestorsofthepresentdayFinnsandthoseintheUralarea werenowcalledMagyars.Inthiscentury,forsomeunknownreason,thelatterstartedtomigratewestward. TheoriginalhomeofatleastpartoftheSlavsseemstohavebeenthemarshesofthewesternUkraineinsouthwestern Russia.Originallytheywereadrunken,unclean,cruelpeoplewithapassionforpillagebutneverthelessagood naturedfolklovinggames,dancesandsongs.TheyfelleasypreytotheHunswhodrovethemaheadwestward,much asonedrivescattle,usingthemasavanguardandinasense,asslaves.Ref.49[73]ByA.D.420almostall ofPolandwasSlavic.RelatedtotheSlavsweretheBaltsonthesoutheasternshoreoftheBalticbutbyA.D.450 alloftheseweresubservienttotheHuns.Ref.137[188]Afterthelatter'sdefeatinthePannoniaarea,mostof themretreatedtotheRussiansteppeA.D.470wheretheysettleddownwithrelatedtribesonthenorthoftheBlack SeaalongtheshoresoftheSeaofAzov,wheretheybecameknownasKutrigursandUtigurs.OntheCrimea,there remainedasmallpocketofOstrogoths. Inthelastquarterofthecentury,thefullextentoftheSlavsinRussiaandwesttotheElbeRiveranddowntothelower DanubeineasternEuropecouldbeappreciated.TheAntesofsouthRussiawerethewealthiestandmostpowerfulbut politicallyallSlavsaswellastherelatedBaltswerenaiveandeasilydominatedbyothers.Ref.137[188] NOTE :WiththecollapseofRomanauthorityinthewest,therewaslesstradeoutofScandinavia,although largequantitiesofRomangoldstillseemedtoreachthere,includingtheislandofGotland.Perhapsthegold waspaidtosoldiersorfrontiertribes.Asthelandrouteswerecuttherewassomeincreaseinseatrade,so JutlandandNorwaybeneted.Norwegianboatsofthiscenturywere20to37meterslong,butarcheologists havebeenunabletotellhowtheywerepropelled.InSwedenthecityofHelgobegantoourishandit remainedanimportantcenterforthenext500years.Ref.301[258] ForwardtoEurope:A.D.501to600Section20.4 19.5CentralandNorthernAsia:A.D.401to500 12 19.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:A.D.301to400Section18.5 BythiscenturytheKushanshadbecomecompletelyPersianizedandbyA.D.440theyweresweptawaybythe EpthalitescomingdownfromtheAltaicregioninrepeatedraids.AfterterrorizingthePersiansandconquering 12 Thiscontentisavailableonlineat.

PAGE 308

296 CHAPTER19.A.D.401TO500 AfghanistaninA.D.460thesemisnamed"WhiteHuns" 13 leftPersiaaloneandwentontoIndia.Thecenterof poweroftheAltaicnomadswasthecountryalongtheGreatWallofChinaandinMongolia,northoftheGobidesert andfromtheretheystruckbothsouthwardandwestward.ThisgreatnomadpowerhadbegunwiththeHsiung-nuwho, afterbeingdefeatedbytheChineseHaninthe1stcenturyC.E.hadre-establishedthemselvesincentralAsiaandhad takensomeIraniansandMongoloidtribesfromtheforestsofSiberiaintotheirfold.Ref.137[188],8[14] ForwardtoCentralandNorthernAsia:A.D.501to600Section20.5 ChooseDifferentRegion 1.IntrotoEraSection19.1 2.AfricaSection19.2 3.AmericaSection19.9 4.EuropeSection19.4 5.TheFarEastSection19.7 6.TheIndianSubcontinentSection19.6 7.TheNearEastSection19.3 8.PacicSection19.8 19.6TheIndianSubcontinent:A.D.401to500 14 19.6.1THEINDIANSUBCONTINENT BacktoTheIndianSubcontinent:A.D.301to400Section18.6 TheGuptacivilizationcontinuedtoourishinnorthernIndia,butatthecloseofthecenturyanewbarbarianeruptionshatteredthepeaceastheEphthalitesoverranandinvadednorthwesternIndiafromcentralAsia.Thereisstill apparentlysomeconfusionaboutthemake-upandoriginoftheseinvaders.McNeillRef.139[192]callsthema branchoftheMongolJuan-JuanbutotherauthoritiesRef.8[14]insistthattheywereofawhite,Turkishrace,not Mongoloid.Atanyevent,althoughtheyhadmadesomeraidsasearlyas455by480theyhaddestroyedtheGupta Empire,nevertoberestored,andtheyhaddemolishedtheBuddhistmonasteries. InwesternIndiamanyimpregnablefortressesinRajputanakepttheAsianinvadersoutandthelocalpowerwasdivided amongseverallocaldynasties.APallavawarriordynastycontrolledtheDeccanandthereweremanylocalaltercations withtheadjacentChalukyas. IndividualaccomplishmentisoftenindependentofexternalruleandsoinspiteoftheturmoilofthisperiodinIndia, AryabhataA.D.499wroteamathematicalworksforuseinastronomicalcalculations.Muchwasborrowedfromthe Greeksbutsomeinnovationsappeared,includingauniquesystemofnumericalnotation.Hewasfamiliarwiththe decimalsystemandwithzero,althoughhedidnotactuallyusethelatter.Hetaughtthetheoryoftherotationofthe earthandgavethevalueofPiat3.141. ForwardtoTheIndianSubcontinentA.D.501to600Section20.6 19.7TheFarEast:A.D.401to500 15 19.7.1THEFAREAST BacktoTheFarEast:A.D.301to400Section18.7 13 SeefootnoteonCentralandNorthernAsia:A.D.301to400Section18.5 14 Thiscontentisavailableonlineat. 15 Thiscontentisavailableonlineat.

PAGE 309

297 TherulingTobaWeihadbecomecompletelySinicizedbythistimeandhadcarriedoutaredistributionoflandto bringmoreundercultivationandrehabilitatetheeconomyinnorthernChina.Thesoutherndynasty,theEasternChin, pushednorthwardregainingaccessthroughKansutothecentralAsiantraderoutesbutthroughcourtintriguesand usurpationstherewasaneverincreasinglyweakerseriesofdynasties,includingSung?-429andsouthernCh'i -502.Evenso,thesesoutherners,consideringthemselvesthesaviorsoftheoldHancivilization,absorbedmost oftheaboriginalpeoplesofthesouthChinaareaintotheChinesemainstream,asBuddhismbecamethepredominant intellectualandreligiousforce.Ref.101[146] Therewasalsointenseactivityinphilosophicalaswellasreligiousthought.Taoismbrokeintosectsandneverbecame auniedreligion.Ch'anBuddhismsimilartoJapaneseZenwasbroughttoChinaallegedlybyBodhidharama. ChinesejunkssailedregularlytotheheadofthePersianGulfwithcargoesforBabylon,althoughlittleornoapparent exchangeofideasandtechniquesoccurredbetweeneastandwest.Thejunks,formanycenturies,hadhadsingle rudders,watertightcompartmentsandstaterooms,allfaradvancedinventionsnotusedbywesternersforupto1,600 yearslater.Theshipscarriedfreshgingergrowinginpotsandthusunknowinglypreventedscurvy.Ref.8[14],215 [290],211[284] ThemausoleumconstructedforEmperorNintoku,whomayhavediedin427 16 ,isamoat-girdedarticialmountain, 80acresinarea,morethanone-halfmilelongandafter1,500yearsofweatheringstillover100feethigh.Ittook 20yearstobuildbyconscriptionlabor.Japan'sroyalfamilyhasrefusedanyexcavationofanyoftheroyalmounds tothisday.Inthis5thcenturytheChinesesystemofideographicwritingwasbroughttoJapanbutphoneticsymbols hadtobeinventedtoexpresstheJapanesewordendingsanditwasactuallyanother200yearsbeforeitbecameareal vehicleforJapanesethoughtandrecord.Inthemeantime,duringthereignofInkyo,musicanddancewerepromoted andChineseBuddhismwasintroducedandbegantorivalShintoisminpopularfavor.Ref.12[21],46[76],213 [288] TheThreeKingdomsperiodcontinued.KingChangsubroughtKoguryatotheheightofitspowerandmovedthe capitalfromtheYaluRivertoP'yongyang.Sillacontinuedexpansioninthesouth.Ref.222[296] Noimportantchangesfromthelastcenturyhavebeenidentiedfromtheliteratureandthereaderisreferredtothose previouscenturies. ForwardtoTheFarEast:A.D.501to600Section20.7 ChooseDifferentRegion 1.IntrotoEraSection19.1 2.AfricaSection19.2 3.AmericaSection19.9 4.CentralandNorthernAsiaSection19.5 5.EuropeSection19.4 6.TheIndianSubcontinentSection19.6 7.TheNearEastSection19.3 8.PacicSection19.8 16 ThisdateisfromBergaminiRef.12[21]butthereissomeconfusionhereinthatDurantRef.46[76]indicatesthatthenextemperor, Inkyo,startedhisreignin412

PAGE 310

298 CHAPTER19.A.D.401TO500 19.8ThePacic:A.D.401to500 17 19.8.1THEPACIFIC BacktoThePacic:A.D.301to400Section18.8 Were-stateherethatintheabsenceofdenitetimemarkersforthePacicweshallnotattemptcenturybycentury documentation.Pleaseseeprecedingcenturies.TheclassicallegendofthediscoveryoftheHawaiianIslandsinthis centurybyaPolynesianchieftain,HawaiiLoa,aftersailing2,400milesfromanislandnearTahiti,asmentionedby TragerRef.222[296]isnolongertenableinthelightofrecentdiscoveries. ForwardtoThePacic:A.D.501to600Section20.8 ChooseDifferentRegion 1.IntrotoEraSection19.1 2.AfricaSection19.2 3.AmericaSection19.9 4.CentralandNorthernAsiaSection19.5 5.EuropeSection19.4 6.TheFarEastSection19.7 7.TheIndianSubcontinentSection19.6 8.TheNearEastSection19.3 19.9America:A.D.401to500 18 19.9.1AMERICA BacktoAmerica:A.D.301to400Section18.9 Pleasesee6thSection9.4and1stcenturiesB.C.Section14.9and1stSection15.9,3rdSection17.9and9th centuriesC.E.Section23.9regardingArcticCultures.AtUngavaBay,750milesnorthofQuebecCity,therearerock wallsdatingtoA.D.500.Eskimolegendsaystheywerebuiltbyaraceofgiantswithastrangelanguage-Vikings? Ref.176[242]ProfessorFellRef.66[97]andLibyancolleagueshavefounda5thcenturyinscriptionatFigiug Oasis,eastMorocco,recordingaightofChristianmonkstoNorthAmericatoescapetheVandals.Thescriptwas Libyan,thelanguageLibyanArabic.AnearlyChristianinscriptioninLibyanArabicdialecthasallegedlyalsobeen foundbyFell'sassociatesatOakIsland,NovaScotia. InthiscenturytheHopewelltradingnetworksbrokedownforsomeunknownreasonandtheHopewellinuencedeclinedsharply.Itispossiblethatapopulationexplosionstrainedthelimitsoftheeconomicsystemandthebreakdown resulted.ButalongtheMississippitheMoundBuildersappeared,andtheseweretheantecedentsoftheChoctaws Chickasaw,Natchesandothers.PerhapsthegreatestIndianmonumentofalltimewasconstructednearChillicothe, Ohio.ThisGreatSerpentMound,representingaserpentwithopenjawsclaspinganegg,is1,254feetlong,winding alonghilltopswithacoiledtail.Itdoesnotappeartohaveanyconnectionwiththeefgymoundsfarthernorth.See alsoAmericainthe3rdcenturyC.E.Section17.9Ref.215[290] 17 Thiscontentisavailableonlineat. 18 Thiscontentisavailableonlineat.

PAGE 311

299 InthesouthwestthiswastheBasketMakerIIIorLateBasketmakerperiodoftheAnasaziIndianswhowereusingred earthenwarepottery,thetechniqueprobablylearnedfromtheMogollonstothesouth.Thewatersupplyfortheircrops hadbecomeinconsistentdroughtalternatingwithoods,buttheAnasazisolvedthisproblembyspecialterracingand thebuildingofsmalldamswithirrigationchannels.Onewater-wayinsouthwesternColorado,however,wasfour mileslong.Thesepeoplehadbecomeskillfulbuilders,usingstoneandbeginningtoconstructcomplexhomeswhich wenowcallpueblos.Ref.45[66],210[283] Onceagainwemustreportsomealmostunbelievable,unconrmedstatementsofBarryFell.InhislatestbookRef. 66[97]hewritesthatmathematicalnotationwasrevolutionizedinthiscenturywhenNevadavoyagersbrought backthedecimalsystemfromIndia.SinceEuropeandecimalcipherswerenotuseduntilthe11thcentury,this,iftrue, wouldplaceAmericanmathematiciansfaraheadoftheirMediterraneancontemporaries.Thedecimalsystemrequired anewtypeofabacus,tothebaseten,andsuchhasallegedlybeenfoundinIndianaandisnowintheEpigraphic Museum.AbacifromNevadahavepreviouslybeenmistakenforgamingboards,accordingtothissameauthor.Itis verydifculttoacceptalltheseconceptsatfacevalueatthistimewithoutmorecorroboration,butFelldoespresent hisevidenceinaconvincingmannerandwhoknowsbutwhattimemayyetprovehimright? ThepioneeringphaseoftheHohokamendedaboutA.D.500.InterchangewithMexicohadcontinuedthroughthe centuriesandnowthebloody,Mexicanballgameassociatedwithreligiousritualwasintroduced.Platformmounds similartothoseinMexicowerealsoerectedforuseofdancersandmusicians.AfavoritedesignonHohokampottery wasthesnake,oftenshownbeingattackedbyabirdfeatheredserpentmotive.Aftertheendofthiscenturythe Hohokambegantospreadoutfromthedesertvalleys,movinguptheriversnorthandnortheast.Ref.210[283] TheMogollonCulturefarthertotheeastcontinuedaspreviouslyanditisapparentintheliteraturethatnotallwriters separatethisfromtheHohokamand/orAnasazicultures,butinsomerespectsitisdenitelyunique.Ref.210[283],CENTRALAMERICA,ANDTHECARIBBEAN ThismayhavebeenthezenithoftheTeotihuacancivilizationwhichwasthespiritualmetropolisofMexico.Despitea centuryofmodernresearchnoonestillisabletosayforcertainwhobuiltthisgreatcity,whatlanguagetheyspokeor whytheysuddenlyseemedtovanish.Itoverlookedafertilevalleywithplentyofwaterandgreatsuppliesofobsidian, therawmaterialforutensilsandweaponsofgreatsharpness.Nine-tenthsofthecityisstillburiedtoday.Ref.176 [242] TherewasalsocontinuedgrowthoftheMayacentersofYucatanwithextensivetradingincludingtheimportationof salt,obsidianandothermineralssuchashematite,pyriteandjade.Craftsmen,accountants,commercialdiplomats andotherexpertswereneededtorunthisnetwork.Ref.215[290]AccordingtoPrincipalEpochsoftheAncient HistoryofYucatan,writtenintheMayalanguagefrommemorybyanelderlyIndianandtranslatedbythe19thcentury DonPioPerez 19 theMayasthoughtthattheyweredescendantsoftheToltecsofMexicowhohadarrivedinYucatan between144and217ofourera,butBacalarandChichenItzewereapparentlynotestablisheduntilbetween360and 432.AfewpeoplecontinuedtoliveindispersedsettlementsaroundtheoldcenterofCerrosuntilabout450,butthis wouldneveragainrecoveritsplaceinthegreattradenetwork. ThiscenturymarkedtheendofthePeriodIVinCostaRicanhistoryandwasmarkedbytheprolicjadecarvings. ThebestqualityjadeitemayhavebeenbroughttoCostaRicafromthenorth,indicatingmoreandmorecontactwith otherMesoamericancultures. Perhapsceremonialmetates,maceheadsandjadeswereusedtherebyanelitegroupwhoheldtheseitemsasbadges ofofce.Mostofthejadestaketheformoftheaxe-godinwhichaforestclearingtoolmakesupthelowerhalfofa pendant.Ref.265[270] 19 AsquotedintheAppendixofStephensbookRef.205[276].

PAGE 312

300 CHAPTER19.A.D.401TO500 IntheheartofthecentralcoastofPeruthereisalongarcheologicalgapfromthetimeoftheChavinSocietytoabout A.D.450whentheEarlyLimaortheMarangaSocietyappearedwiththebuildingofanumberofzigguratsonalarge hacienda.Marangaterritory,asrevealedbypotteryremains,stretchedfromtheChillontotheLurinvalleys.The peopleprobablyusedlateralcanalsforirrigation.Bythebeginningofthe20thcenturytherewerestillabout75of theirgreatpyramidalmounddwellingsinandaroundLimabuttheyaregonenow.InthelowerChillonValleythere aretheruinsofavastrectangularenclosure700feetlong,madeoftrapezoidalclayblocks,eachweighingseveral hundredpounds.Theyalsomadelong,high,straightwalls,mileslong,runningobliquelytotheriverbank.These peopleapparentlycamefrom"nowhere"anddisappearedagainafterafewcenturies. DuringthissameperiodtheTiahuanacoSocietyourishedinthehighAndes.Seemultiplepreviouscenturies. InthesouththeNazcasmayhavereachedtheirapexwiththeconstructionofthepuzzlinggiantgeometricshapes andoutlinesofanimalsandplants,madebyarrangingstonesinlinescoveringsome200squaremilesandactually identiableonlyfromtheair.Tonsofsmallstonesweresousedandstringswerestretchedfrompoststokeepthelines straight.CarbondatingofsomeofthepostremainsindicatesA.D.500.MariaReiche,whohasspentheradultlifein thesedesertdrawings,believesthattheyareformsofagiantcalendar.Anotherpossibilityisthattheywerepartofa fertilitycult. InColumbia,250milessouth-westofBogata,inadenseforesttherearemorethan300largestonestatues,some14 to21feettall,somewithteethlikecatsandsomewhichseemtobefeedingonthechildrentheyareholding.Carbon -14datingindicatesthattheseweremadebetweenthis5thandthe12thcenturies.Acertainafnityofthesestatues tothoseofEasterIslandgivessomefurthercredencetoThorHeyerdahl'stheoriesofSouthAmericanmigrationsinto thePacic.Ref.62[91],176[242] ForwardtoAmerica:A.D.501to600Section20.9 ChooseDifferentRegion 1.IntrotoEraSection19.1 2.AfricaSection19.2 3.CentralandNorthernAsiaSection19.5 4.EuropeSection19.4 5.TheFarEastSection19.7 6.TheIndianSubcontinentSection19.6 7.TheNearEastSection19.3 8.PacicSection19.8

PAGE 313

Chapter20 A.D.501to600 20.1A.D.501to600 1 20.1.1A.D.501TO600 BackwardtoA.D.401to500Section19.1 Ingeneralthiswasacenturyofcontinuedwars,jockeyingofthevarious"barbariantribesforpostsandattempted consolidationoftheirvariouspositions.Thechiefconsequencesofthemigrationsofthe3rdtothis6thcenturyhave beenlistedbyMcNeillRef.139[192]asfollows: 1.Thebarbariansassimilatedcivilizedstylesoflife 2.ThecivilizedcommunitiesofEurasiaexceptingChinawereimpelledtomodifytheirmilitary,politicaland socialsystemsbyintroducingfeatureswecallbytheterm"medieval".Theseincludedcataphractsheavily armoredcavalrysupportedbyvarioussubsidiesandthedevelopmentofapeculiarmilitaryclass,oftenmercenaries,whichsoonlessenedthecentralauthorityoverthose"knightsinarmor".TheByzantinescontrolledthis lesseffectivelythanthePersians 3.Theriseofreligiontoacentralplaceinpersonalandpublicaffairsgavearadicallynewcharactertothehigh culturaltraditionsofbothRomeandPersiaandaffectedChinesecivilizationinasimilar,althoughlessdrastic fashion 4.Thefactorswhichnallyresultedintheoverthrowofthenewbarbarianempiresarediscussedinaseparate sectionattheendofthischapter.LeprosyrstappearedatthistimeinEgypt,FranceandBritainalthoughitis probablethatmany,moreancientdisguringskindiseaseshadbeendescribedunderthisheading,inerrorRef. 140[190] Inthiscenturytwogreatnames,oftencalledtheFathersoftheWesternChristianSociety,appeared.OnewasSt. Benedictwhoestablishedamonasteryin529whichwastoguidemostlatermonasteriesinthewest.Theother, livinginthelatterhalfofthecentury,wasPopeGregoryI 2 ,asuperstitious,credulousmanwithaterrifyingpiety whoneverthelessgavelawtomonasticismandspreadtheChristiangospelthroughEurope.Hedevelopedparish organization,arrangedorderlyfestivalsandprocessionsandstandardizedsacerdotalclothes.Ifoneconsidersthe European"DarkAges"tohaveexistedatthistime-aperiodwhenlearningandscienceandartandliteratureseemed tobeatastandstill-onemustcreditthemonasteriesasbeingagreatrepositoryforthestorageofsomeofthat previouslyhard-earnedknowledge.CassiodoruswasamonkcontemporarywithBenedictandGregorywhotriedto 1 Thiscontentisavailableonlineat. 2 Thisisthe"4thfatheroftheChurch"mentionedbyThomasRef.213[288]asmentionedonpage354 301

PAGE 314

302 CHAPTER20.A.D.501TO600 preserveeducationandsomescience.Hisinuenceinmakingmonasticismintoapowerfulinstrumentforrestoration ofsocialorderwasperhapsevengreaterthanthosecontemporaries.Ref.49[73],213[288] IntheearlydevelopmentofChristianityrationalmedicalpracticepracticallydisappearedastheoldJudaicconceptof diseaseasbeingequatedwithakindofsinwaspromoted.Thecorollarywasthattheonlypossiblecurewasthrough Grace,theunpredictableinterventionofGod.Thisinterpretationofcauseandcureofdiseasewasexpoundedindetail byPopeGregory.Ref.125[173] FromthiscenturyontheJewsbecameparticularlyidentiedwithinternationalandregionaltrade.Thereasonsfor thisincludedthewidespreaddispersionofthesepeopleinbothIslamandChristianEurope,withgroupsolidarity, linguisticcommunicationandauniformcommerciallaw,basedontheTalmud.Ref.8[14] ForwardtoA.D.601to700Section21.1 ChooseDifferentRegion 1.AfricaSection20.2 2.AmericaSection20.9 3.CentralandNorthernAsiaSection20.5 4.EuropeSection20.4 5.TheFarEastSection20.7 6.TheIndianSubcontinentSection20.6 7.TheNearEastSection20.3 8.PacicSection20.8 20.2Africa:A.D.501to600 3 20.2.1AFRICA BacktoAfrica:A.D.401to500Section19.2 TherewerethreeseparateChristiankingdomsintheregionofNubiainthemiddleNile.AtIbrimanoldtemple,which wasoriginallybuiltprobablyduringtheEthiopianDynastyofEgyptinthe7thcenturyB.C.andthenmodiedlater withtypicalMerioticgraftiandvotiveinscriptions,wasnowmadeintotheearliestofIbrimChristianchurches.A defensivewallaroundthechurchisnowpartiallycoveredbyLakeNasser.Ref.271[7] EarlyAbyssinianswereactivemilitarily,invadingtheYemenikingdomsontheArabianPeninsula.Inthemiddleof thecenturyAxumwasattheheightofitspowerwithasplendidcourtboastingroyalelephantsandgold.Thecapital cityfunneledmaterialsfrominnerAfricatoamaritimenetworkreachingasfarasSpainandevenChina.Axum coveredanareaof75hectaresandcontainedmanymultistorystonebuildingswith10,000to20,000inhabitantsanda fringeofsuburban,elitevillages.Ref.270[36]ButthedownfallofthiscountrystartedwhenthePersiansexpelled theAxumitesfromsouthArabiaasapartoftheByzantine-PersianWars.ThiswasfollowedbyraidsbypaganBela onthefarmlands,sothatgraduallythepeoplemoveddeeperintothehighlands,mergingwiththepaganandJudaized peoplethereandbecomingtheAbyssiniansproper,thenucleusoflaterEthiopia.Ref.82[121],83[123] Egyptcontinuedtodecay,politicallyandintellectually.Partofthiswaspromotedbythedeclineintheincensetrade whichhadpreviouslycomefromthesouth,inpartthroughEgypt.Thecountryremainednominallyunderthecontrol oftheByzantineEmpire. 3 Thiscontentisavailableonlineat.

PAGE 315

303 TheVandalkingdomofNorthAfricawasreconqueredfortheByzantineEmpirebyJustinian'sGeneralBelisariusin 533.OtherwiseNorthAfricaremainedmuchasinthelastcentury.Ref.8[14] InthetropicalregionstheavailabilityofironafterA.D.500ledtothedevelopmentofkingdomswhosechiefweapons wereironspears.AfewNegroidBantu-speakerslteredintotheBushmanandHottentotdomainsinSouthAfrica. Ref.213[288],83[123] ForwardtoAfrica:A.D.601to700Section21.2 20.3TheNearEast:A.D.501to600 4 20.3.1THENEAREAST BacktoTheNearEast:A.D.401to500Section19.3 By525JudaismhadgainedsuchafootholdintheHimyaritekingdominthesouththattherulersthemselvesbeganto persecutetheChristianpopulation.ThiswasthejusticationwhichtheAbyssiniansEthiopiansusedtoinvadesouth Arabiabetween525and530,conqueringtheHimyaritesandleavinganAbyssiniangovernor.Byabout570,however, thePersiansconqueredandcontrolledthewholeofArabia.Ref.82[121],222[296],&IRAQANDSYRIA ThewesternportionofthislargeareacontinuedtoshareinthefateofByzantium.Christianvandalismagainstthe JewsandSamaritans 5 ,whichhadstartedintheprecedingcentury,nowincreasedwithdestructionofsynagoguesand temples.Anearthquakeof526didnothelpmatterswhenitkilled200,000to300,000peopleinAntioch.Ref.222 [296]TheJewsandSamaritansrevoltedin529andagainin560andnallywelcomedtheinvasionofthePersians astheyextendedtheirempireonceagainabout570.TheJewstookthisopportunitytodestroyafewchurchesand Christiansinrevenge.Ofcourse,theentireeasternportionofthisSyrianarea,thatis,mostofpresentdayIraq, belongedtothegreatPersianEmpirethroughoutthisperiod. KingKobad,previouslyexpelledbyhisownnobles,returnedtothethronein501andwagedtherstwarwith Byzantium.Buthispreviousfriends,theEphthalites,raidedfromthenortheastandhehadtosueforpeacewiththe ChristiansbeforehecouldnallyexpeltheAsianinvadersfromPersiainA.D.513.The2ndByzantine-PersianWar followedfrom524to531andattheendofthatconictKobad'sson,ChosroesIorKhosruorKhosrau,becamethe greatestofthePersiankings.Toinsurehisdynasty,likemanyanotherAsianmonarch,heexecutedallofhisbrothers andtheirmaleoffspringwithoneexceptionandincludedMazdakandallofhisfollowers.Itwashewhonally completelydefeatedtheEphthalitesincentralAsiain557. Pahlavi,theIndo-EuropeanlanguageofParthianPersia,wasstillinuseandZorastrianismwastheofcialreligion, withtheGodOrmuzdandthedevilAhriman.Chosroes'reignwastolerant,however,toNestorianandotherbrandsof ChristiansandtoJews.HeactuallyhelpedtheNestorianstoestablishalibrary.ThegreatPersianMedicalSchoolat GondishapuralsohadafamousmedicallibrarycontainingworksfromByzantiumandperhapssomeofHippocrates' 4 Thiscontentisavailableonlineat. 5 TheSamaritanswereremnantsofBabyloniansandSyrianswhoseancestorshadmigratedtoPalestinenearlyathousandyearsbefore.They werenotJewsbutusedthePentateuchastheirholybook,withoutacceptinganyotherpartoftheBible

PAGE 316

304 CHAPTER20.A.D.501TO600 workscamethroughheretotheArabicworld.Inthishey-dayofthePersianEmpire,theUniversityofJudi-i-Shapur becamethegreatestintellectualcenteroftheworld,withteachersandscholarsfromalloverEuropeandAsia.Roads andvillageswererebuiltandtherewasreformofthescalsystemandtaxationmethods.Manyirrigationsystems werecompletedandthefamousmetal-workersofAntioch,SyriawerebroughttoIran.Ref.15[26],8[14] AfterthePersianshaddriventotheMediterraneancoastandtakenalloftheArabianpeninsula,Byzantinealliedwith theTurksdriftingdownfromtheEurasianborder,-buttheystillcouldnotdefeatthePersians.Attheendofthe century,however,thePersianEmpirebecamedividedintofourgreatsatrapies:theeast,comprisedofKhosasanand Kerman;thewest,includingIraqandMesopotamia;thenorth,madeupofArmeniaandAzerbaijan;andthesouth, whichcontainedFarsandKhuziasan.Warscontinuedonallbordersuntiltheendofthecentury. ThezenithoftheByzantineEmpirewasreachedundertheEmperorJustinianwhowasborninSoa,possiblyofSlavic peasantparents.Heencouragedtheorientalconceptionofroyaltyasdivine,butlaboredtoreunitethewesternand easternChristianchurches.Hewasstronglyinuencedbyhiswife,Theodora,awomanalsoofhumbleorigins.The JustinianCodeofLawshaveremainedinhistoryaspartoftheCanonicalLawsoftheCatholicChurch.Constantinople remainedthegreatestmarketandshippingcenterintheworld,withcompanionharborsontheBlackSeaandadirect searouteestablishedthroughtheRedSeatoIndia.AlthoughthesecretofsilkwasjealouslyguardedintheFarEast,by variousmeansJustinianintroducedsilkworms,whitemulberries,themethodofunwindingcocoonsandtheweaving ofthethread,intoByzantiumsothathealsobecametheemperorofsilk.FromthisthewesternChristianempire earnedafortunewhichitguardedforcenturies.Ref.260[29] Onthereligiousfrontthechurchwasunrelenting,theJewish deuterosis wasoutlawedandtherewereexpulsions ofJewswithsomemassacresinAntiochin592andinJerusalemaftertheturnofthecentury.Justinian'sGeneral BelisariusreconqueredNorthAfricaandsouthernSpainfromtheVandalsandmostofItalyfromtheGoths,bringing theempiretoitsgreatestgeographicalextent.Ref.49[73]ManyoftheunitsoftheByzantinearmyofthis6th centurywereremnantsoftheHunscalled"Massagetae".Theywereintemperatedrinkersandoftendifculttocontrol, althoughercewarriors.Ref.127[176] Intheyears542and543agreatepidemic,oftencalledthe"PlagueofJustinian"hitAsiaMinor.Thiswasdenitely bubonicplague,penetratingfromanoriginalfocuseitherinnortheasternIndiaorcentralAfricaandspreadingaround theMediterraneanbyship.NecessarytothisspreadwastheappearanceoftheblackratfromitsnativeIndia,along withitseas.Procopiusreportedthat10,000peopledieddailyinConstantinopleatthepeakoftheepidemicandthe diseaseragedforfourmonths.Thepoliticaleffectwasgreatandtheimperialpowerwasweakened.Anotherepidemic in655andfaminein569,alongwithattacksbyBulgarsandAvarsfromtheBalkanarea,allcontributedtodissolution oftheempiresoonafterJustinian'sdeath.Ref.140[190],213[288] ArmeniawascaughtupinmostofthewarsbetweenByzantiumandPersia.Forthemostofthiseraitwassubservient toPersia,butlateinthecenturybothGeorgiaandArmeniawereagainpartitionedwithByzantiumgettingalarge partofthelatter.BecauseofByzantinehelptothePersianKingChosroesIIinaninternalght,thismonarch,once reestablishedonthePersianthrone,cededIberiaandnearlyallofArmeniatothe EasternRomanEmpireinA.D.591,thusallowingByzantinetroopsstationedtheretoreturntodefendtheBalkans againsttheAvars.Ref.49[73] ForwardtoTheNearEast:A.D.601to700Section21.3 ChooseDifferentRegion 1.IntrotoEraSection20.1

PAGE 317

305 2.AfricaSection20.2 3.AmericaSection20.9 4.CentralandNorthernAsiaSection20.5 5.EuropeSection20.4 6.TheFarEastSection20.7 7.TheIndianSubcontinentSection20.6 8.PacicSection20.8 20.4Europe:A.D.501to600 6 20.4.1EUROPE BacktoEurope:A.D.401to500Section19.4 AninterestingmapshowingtheextentandlocationofthevariousbarbarianmigrationsandtheirkingdomsaboutA.D. 526willbefoundonthenextpage. All,includingMaltaremainedapartoftheByzantineEmpire. GreecewasanintegralpartofByzantium.TheEmperorJustinianclosedtheUniversityofAthensandsomeofthe professorsedtothemoreenlightenedPersiatocontinuetheirworkthere.Allpaganswereorderedtobecome Christians.AboutA.D.600SlavtribescrossedtheDanubeanddescendedintoGreece,drivenbyAvarsbehindthem andsoononlyafewsoutherncoastalcitiesremainedGreek,intheoldsense.Ref.8[14] NOTE:InsertMap32:TheBarbarian,MigrationsandKingdomsAD.526 Formostofthecentury,theOstrogothickingofItaly,Theodoric,alsoreignedovertheBalkanareaborderingthe AdriaticintheregionknownasDalmatia.Attheendofthecentury,however,theBulgars,Avarsandamixtureof southernandwesternSlavsenteredtheareaandremainedtobecometheCroats,SerbsandnallytheYugoslavians. TheAvarswereaMongolianpeopleofmixedTurkicbackgroundwhohadmovedfromTurkistanthroughsouthern Russia,enslavedmassesofSlavs,astheHunshadaheadofthemandmovedonintoEurope,ravagingtheBalkanson therouteandalmostwipingouttheLatinspeakingpeoples.ExceptforSalonica,Macedoniawaspermanentlysettled bySlavsinthiscentury.TheiroccupationofancientDaciacutthelandcontactbetweenRomeandConstantinople. TheBulgars,whomovedinfrombeyondtheDanube,controlledtheSlavsintheirareabutgraduallytookoverthe Slaviclanguageandculture.Ref.49[73],137[188],125[173] Attheendofthelastcentury,theByzantineEmperorZenohadcommissionedtheArianOstrogothKingTheodoric toconquerItalyandhehadpromptlydoneso.HethenreignedoversouthernItaly,Sicilyandaportionofthe southernBalkans,Dalmatia,whichwasnominallyundertheByzantineemperor.Inaddition,earlyinthecentury TheodoricdefeatedsomeoftheFranksandkepttheFrenchMediterraneanstripaswellaslaterincreasinghisholdings inProvence.Hewasarelativelyjustandprogressiverulerencouragingarevivaloflearningandliterature.Hisminister 6 Thiscontentisavailableonlineat.

PAGE 318

306 CHAPTER20.A.D.501TO600 ofstate,Cassiodorus,aRomanofGreeklineage,triedtoreconciletheGermanicandRomantypesofcultureand failing,hewithdrewtofoundamonastery.HecomposedahistoryoftheGoths,writteninLatin. Theoriginalhasbeenlost,butexcerptsbyJordanes,anotherGothicofcial,aretobefoundinhisGetica.Cassiodorus wasresponsibleforsavingsomebooksfromthegreatRomanlibraries,includingsomeworksofHippocratesand Galen,whichhestoredwithotherclassicmanuscriptsinhisultimatemonastery.Ref.49[73],15[26],137 [188],127[176] ThelongGothicwarsruinedItaly.Theproblemsincludedtheexistenceoftwodistinctraces-RomanandGothandtworeligions-CatholicandArian,tryingtolivesidebyside,eachpracticingitsownlawsandtraditions.The easternEmperorJustinian,throughhisGeneralBelisarius,retookSicilyin535andinvadedItalyproperin536but didnotcrushtheOstrogothsuntil563whentheGermanicLombards,perhapsoriginallyfromScandinaviaandnow drivenwestfromBohemiaandGermanybytheAvars,arrivedtoconquerthenorthernhalfoftheItalianpeninsula. TheseLombardswerethelastinvadersofItaly,andtheyruledtheirhalffortwocenturies.Anoutbreakofbubonic plaguehadweakenedthedefenseofItalyandsomesaythattheseGermanicpeoplecameintowhatwaspractically anemptycountry.ThisplagueragedinRomeinA.D.590andinthatsameyearaByzantinecounter-attackcutthe newLombardKingdomintotwoparts,acrossthewaistofItalybuttheLombardvitalitycontinuedinspiteofthis.In theareaattheheadoftheAdriaticSea,theVenetitribeandrefugeesfromotherregionsformedanislandempireof sea-farers.Ref.8[14],137[188] ThroughoutthepeninsulatheoldRomaninstitutionswereratherquicklyabandonedandamongthersttobedispensedwithwerethoseoflawandmedicine.Forsomereasonnotentirelyclear,non-clericalphysiciansjustceasedto exist.TheBenedictinemonksencouragedcareofthesickbutonlythroughprayercouldcurecome,soSt.Benedict forbadethestudyofmedicine.Ref.49[73],125[173] TheSlavicWendshadpushedintoGermanyasfarastheElbeRiver.WestoftheElbeandSaalriverswerethe survivingGermantribesinthefollowinglocations,eachretainingitsownidentity: aSaxonsinthenorthcentralregion. bEastFranksalongthelowerRhine. cThuringiansbetweentheSaxonsandFranks. dMarcomanniBavariansalongthemiddleDanube.TheyhadmigratedfromBohemiainthis6thcenturyintoan areaofcollapsingOstrogoths. eSueviSwabiansalongandbetweentheupperRhineandupperDanubeandalongthenorthernAlps. Ofthesetribes,theFrankswereculturallyofthegreatestsignicance.ReinhardtRef.177[243]saysthatthis culturestandsoutasthefountainheadandpatternofthefutureGermancivilization.Thereissomedisagreement concerningthelanguagechanges.WellsRef.229[307]writesthattheFrankswereakintotheAnglo-Saxonsin speakinga"lowGerman"whichlaterdevelopedintoDutchandFlemish,butReinhardtdoesnotagree,statingthat theFranks,AlemanniandBavariansfromA.D.500to800hadthehighGermansoundshift"p"to"pf"or"f";"t"to "ts","z"or"s";and"k"to"ch",whileAnglo-Saxon,Dutch,FlemishWalloonkepttheoriginallowornorthGerman sounds.ClovisruledtheFranksuntil511andmoreaboutthisdynastywillbefoundbelowunderFRANCE. ByA.D.560,Clovis'sonsandgrandsonshadextendedFrankishruletotakeoverdominanceofThuringia,Bavaria, RhaetiaandAlamanniainGermanyaswellastheBurgundiankingdominSwitzerlandandsouthernFrance.There waslittledisplacementofthenativepopuIations,however,andGermanandFrenchdevelopedasseparatelanguages

PAGE 319

307 whilethegovernmentremainedinthehandsofbishopsandcountsfromtheoldGallo-Romanaristocracy.Thereal power,however,remainedwiththeFrankisharmy. ThemigratingandraidingAvarsSeeHUNGARYandCENTRALANDNORTHERNASIA,thischaptercamein contactwiththeFranksontheElbein562atwhichtimetheAvarKhanatewasperhapsone-halfaslargeinnorth-south andeast-westdimensionsasthepreviousHunEmpire,butbyA.D.600theAvarsdomainwasalmostasgreatasthe Hunnishone,astheytookoverHungaryandmostofAustriafromtheGepidsandtheLombards.Bythistimethe MarcomannihadalsoreachedlowerAustria. Itisofsomeinterestthatfalconry,althoughknownfromthePersiancourtasfarbackas400B.C.,wasreallyperfected inEuropebytheVisigothsandFranksandbecameanimportantpartofthehuntingcultureaswellasanaristocratic pastime.Ref.122[170] HistorydoesrepeatitselfinHungary.JustastheHunshadpreviouslysetupheadquartersinHungarynowanewwar band,eeingfromupheavalsincentralAsiaandknownas"Avars",establishedthemselvesontheHungarianplain andlaunchedraidsfarandwide,pushingtheLombardsintoItaly,theSlavsintotheBalkansandallowingtheBulgars anothernomadtribetocomealongthelowerDanube.TheseAvars,whoraidedConstantinopleaswellaswestern Europefromthisbase,wereamixtureofMongolianJuanJuan,pushedwestbytheBlueTurks,andvariousnomad TurkishorHunnishtribeswhichtheyhadpickedupontheirjourneythroughnorthernIranandtheRussiansteppe. Ref.8[14] AstheBavariansmovedwestoutofBohemia,theSlavsmovedinandthenalsospreadtoMoravia. ThislandwasstilloccupiedchieybyBurgundiansunderFrankishsuzertaintyandinthiscenturytheywerejoined bySuevi. TheregionsofbothSpainandPortugalwereruledbyVisigothsbutunderRomansupervision.Throughtheinuence ofthechurch,whichusedLatininherrituals,theVisigoths,withinacenturyaftertheirSpanishconquest,forgot theirGermanicspeechandcorruptedtheLatinofthepeninsulaintoSpanish.Thiswasagraduallanguagechange andSpanish,asweknowitnow,didnotactuallymatureuntilthe19thcentury,atleastinwrittenform.Ref.168 [229]InthisSpanishsociety,greatgulfsremainedbetweenChristiansandJewsandbetweenrichandpoor.The earlyVisigothicaristocracywasincloseculturalcontactwithRomeandByzantiumandlivedlivesofafuenceand taste.Ref.180[246] EarlyinthecenturytheVisigothickingdomwasruledbyaboykingwhoactuallyleftthepowertotheOstrogothKing TheodoricofItaly.ThecombinedGothicpowerwasgreatandwassuchthattheVandalsevengaveupthewestern endofSicily.Ref.137[188]Anintra-Gothicwaroccurredin554,however,allowingEmperorJustinian'sGeneral BelisariustooccupysouthernSpain.Asiftomakeupforthis,theSuevikingdominGalaciawasabsorbedintothe Visigothickingdomin585.Ref.8[14]AseriesofEastRoman-Visigothicwarsfollowed. ForawhiletwolegalsystemsexistedinSpain,oneawrittenGermanlawandtheotherRomanlaw.Althoughmanyof theVisigothnobleswerepubliclyconvertedfromArianismtoRomanCatholicismin589,religiousdivisionpersisted andtheproblemwasaugmentedbytheprosecutionofJewsbyorderofEmperorHeraclius,earlyinthenextcentury.

PAGE 320

308 CHAPTER20.A.D.501TO600 Architecturewaspoor,librariessmall,commonschoolsnon-existentbutahospitalundernon-clericaladministration wasestablishedforthersttimeatMeridainsouthwesternSpaininthiscentury.Ref.196[269],125[173] ThearmyoftheFrankKingClovisdefeatedtheVisigothsatVoluilleinA.D.507andthentheremainderofGaul fellquicklytotheFranksastheGothswithdrewtoSpain.ThisconquestofGaulbytheFrankishtribesmarksa milestoneofGermanandEuropeanhistoryandtranscendsinimportancetheothermigrations.Allothergroupswere soonabsorbednumericallyandculturallybythenativeRomanpopulations,buttheFranks,underClovis,asfounder oftheMerovingianDynasty,andhissonsestablishedamilitarykingdomwithstrongagriculturalunderpinningsand itpersisted,withacapitalatParis.Ref.222[296]WellsRef.229saysthatthoseFrankswhodidnotbecome LatinizedbecametheFlemishandDutchmenofSouthHollandbutthatNorthHollandisAnglo-Saxoninorigin. ThedevelopmentofvariousGermaniclanguagesfromtheoriginalFrankishtonguewasdiscussedunderGERMANY above. AlthoughClovisbecameanorthodoxNiceneChristian,muchoftheconversionofhispeoplewasaccomplishedby IrishandAnglo-Saxonmonks.HemadeGaulintoFrancebutafterhimthedynastydegenerated.Hissonsconquered theBurgundiansabout532buttheBurgundianstatestillremainedseparateunderMerovingianprincesthroughoutthe remainderofthecentury.ProvencewasacquiredfromtheweakenedOstrogothsin536.Frankchieftainsintermarried withremnantsoftheGallo-RomansenatorialclassandgeneratedthearistocracyofFrance.InspiteofChristian conversionseldomhasanupperclassshownsuchcontemptformoralityasthisone.Ref.229[307],49[73],8 [14],137[188] AsatMeridoinSpain,Lyonshadanon-clericalhospitalinthiscentury.Ref.125[173]HughThomasRef.213 [288]writesthatleprosyapparentlyarrivedinFranceandEnglandinthiscenturyandthatleperswereisolated, declaredlegallydeadandoftenexcludedfromthechurch. AftertheCelticvictoryofMountBadenwhichwasdescribedinthelastchapter,therewasaperiodofsecurityinsouthernEnglandforabouttwogenerationsbutthentheSaxonsbegantoadvanceagainsothatby577theconfrontation lineextendedtotheBristolChannel,BathandGloucester.By600onlyDevonandCornwallofsouthern EnglandwerenotSaxon.Thelaw,languageandeconomyoftheRomanprovincehaddisappeared.WhiletheSaxons werevalleyliversandfarmedandformedvillages,theremainingBritonswereinthehillsandhighlands.Thushill, woodandstreamnamesareoftenCelticinorigin,whilelowlandsandvillageshaveAnglo-Saxonnames.TheSaxon villageswereinopenareasandthehouseswerelittlemorethanwattleanddaubstructureswithasingleridgepole, sunkenoorandatotalspaceofabout10'by15'.Theyusedhorse-drawnploughs,milledwheat,barleyandoatsand grewcattle,sheep,goatsandpigs.Ref.29[50],43[64] ThetransplantedSaxonswereconvertedtoChristianityinthelastofthecenturychieythroughtheeffortsofthe FrankishQueenofKingEthelbertofKentandthepapalenvoy,St.Augustine,originallyfromNorthAfrica.North EnglandreceivedChristianityfromnorthIrelandviaSt.Columba,whosucceededPatrick. BritonsandafewAnglesmigratedintoScotlandatthisperiodandshortlyafter525theIrishcolonizedwestern Scotland.Soontheword"Scot",originallyanalternativeto"Irish",becamereservedforthesenorthernsettlersonly. InScotland,proper,al-thoughthedesertedAntoninewallhadcrumbleditstillformedtheloosesouthernborder ofPictland.SouthofitthenorthBritonsofStrathclyde,relatedtotheWelsh,hadorganizedanaristocraticsociety withmanors,townsandfarms.TounderstandtheBritishIslesinthoseearlydaysonemustconsiderIreland,Scotland,

PAGE 321

309 WalesandcertainlynorthernEnglandasaninter-relatedgroupofcommunitiesanditisdifculttocompletelyseparate theirhistories.Ref.137[188],170[234] St.ColumbaSeeIRELANDbelowcarriedChristianityfromIrelandtoIonainwesternScotlandin543.Thisreligion wasseparatefromcontroloftheVaticanpopeandwasnotrelatedordescendeddirectlyfromLatinChristianityinEngland.ForfourcenturieslonawasthecenterofCelticChristianityandsomebeautifullydecoratedCelticmanuscripts survivefromthatera.Ref.33[55] ColumCille,latertobecalledSt.Columba,wasborninDalRiataofthefamilyUlNeillandwhenforty-twoyears old,setoutasapilgrim,accompaniedbytwelvedisciples,towardthelandofthePicts.Helandedonthetinyisland oflona,theretoestablishhisowntypeofChristianmonastery.WhilestillmaintainingsometiestoIre-land,lona developedintoaspiritualcenterforallthetribesofcoastalScotland.TheIrishspiritshonewithitsstrongestlight atthattime,withcultureandknowledgeatahighpeak.Manylearnedmenfromthecontinent,eeingtheinvading barbarians,endedupontheshoresofIreland.Aboatloadof50scholarsarrivedatCorkin550,bringingwiththem theircraftsmenanditwasthesewandererswhosubsequentlytaughtthetechniqueandmadeprincelyornamentsas wellasweapons.ThenlearnedmenfromIrelandbecamemissionariesbacktoEngland,GermanyandGaul.Ref.91 [135],33[55] MonksfromtheIonamonasterysailedtotheOrkneys,Shetlands,theFaroesandIceland.Ref.33[55]Itiseven possiblethatSt.Brendan,thepatronsaintofCountyKerry,sailedtothecoastofNorthAmericainaleathercurragh withgoatskinsails,inthiscentury. ThereismuchofthisinIrishlegendandthe10thcenturybook,NavigationSanctiBrendani,ofunknownauthorship,as wellassomematerialevidenceacceptedbysomeestablishedscholarsincludingsuchthingsas10thcenturyVikings' accountsofpreviousIrishnavigators,possibleancientIrishDruidalphabetmarkingsonNewfoundlandrocksand"100 recognizableCelticrootsinwordswhichwereusedbypre-EuropeaninhabitantsofsomeoftheplaceswhereIrish monksaresupposedtohavelanded." 7 FellRef.86[129]concursinthis. In590ColumbatheYounger,alsowithtwelvecompanions,wentfromhishomeinLeinstertoFrancewherehe confoundedtheMerovingiankingandfoundedmonasticcommunitiesatLuxeilandFontaineandthenwentonto SwitzerlandandItaly.Athome,theIrishkingswerenallyconvertedtotheIrishversionofCatholicism,afterthe wholeofIrelandwasdevastatedbytheyellowplagueinthemiddleofthecentury.Ref.91[135] FleeingbeforetheinvadingGermanictribes,thousandsofBritonswenttoWalesandmingledtherewiththeWelsh CeltsandIrishtoformtheCymripeopleandthecountrythenbecameknownasCymru.Thefamilyandclanwerethe basisofthesocialorder.Christianitycameinthis6thcenturythroughDewiDavid,whowascanonizedasthepatron SaintofWalesinA.D.1120.Ref.222[296]ThiswasalsotheeraoftheMabinogen-TalesoftheBardsofWales. AboutA.D.600theGothsandtheSveaofSwedenunitedtoformthekingdomofSweden.Fromthattimeonthe Goths,asanentity,ceasedtoexistinthenorth,althoughastrongracialheritageisstillseenthroughoutSwedenand especiallyontheislandofGotland.ThiswasthetimeofthebeginningofScandinavianartwithanimalornamentsas thechieffeatureandwhichwastocontinueuntiltheVikingAge. TheDaneshadgoldandsilverandRomanmoney.Graduallyitbecamethecustomtoseekone'slivingonthesea.With apopulationsurplusandtheotherGermanictribesblockingmigrationsouthbyland,theysoughtpathsofexpansion ontheopensea,althoughthetrueVikingAgewasfarinthefuture.AdditionalNotesp.310 7 Quotationfrom"St.Brendan'sFantasticVoyage"byGeraldSchomp,Ref.126[175]

PAGE 322

310 CHAPTER20.A.D.501TO600 Thenorth-southexpansionofdisplacedeasternSlavsbetweenthisandthe8thcenturycuttheeasternBaltsofffrom theirwesterncore,andinthewesttheBaltswereconfrontedbyGermanicexpansion.JustsouthoftheGulfofFinland, someoftheeasternSlavstooktotheforests,wedgingbetweentheFinnsandtheEstonians.Ref.61[90]Most ofPolandwasoccupiedbyvariousSlavictribeswhohadnotbeendisturbedbytheGoths,AlansorAvarsandtheir villageswerenotfortieduntilneartheendofthecenturywhentheybegantoquarrelwitheachother.Ref.244 [177] AstheGermanictribesmovedwest,theSlavscameoutofthePripetmarshes,forested,swampyregionabout38,000 squaremilesinareaextendingalongthePripetRiver,whichisabranchoftheDnieper.Ref.8[14]Earlyinthe centuryonthenorthshoreoftheBlackSeatherewereKutrigurorUtigurHuns,alongwithasmallpocketofGoths stillontheCrimea.IntheCaucasustherewereAlansandnorthofthemonthenorthshoreoftheCaspianwerethe SabirianHunsandeastoftheAralSeaweretheEphthalites. In559theAvars,defeatedbytheTurksineasternAsia,movedtotheRussiansteppewhereJustinianpaidthemto controltheresidentHunsandSlavswhohadbeenraidingtheeastRomanBalkanareas.TheseAvars,soonruling fromtheVolgatothelowerDanube,turnednorthandwestuntilin562theycameincontactwiththeFranksonthe Elbe,establishinganextensiveAvarKhanate.Ref.136[187],137[188]TheWesternTurks,comingbehindthe Avarsin576,tookpartoftheCaucasusjustwestoftheCaspianandthereknownastheKhazar,althoughAlansstill controlledmostofthewesternpartofthisregionbetweentheBlackandCaspianseas.NorthoftheKhazarandthe nowseparateWesternTurkishKhanatewereprincipallyFinnishpeople,sparselysettled,whiletheSlavswerestill fartherwestanddominatedbytheAvars. TheBlackBulgars,originallyamixtureofHuns,UgriansandTurks,livedatthistimeinthevalleysoftheDonand Volgarivers.Inthis6thandthe7thcenturiestherewere12majorSlavonictribesinRussia,includingthePolinians livingonthemiddleDneipnerintheKievregion.Theylivedincommunities,heldslaves,andwerefamilyorientedin atypeofdemocraticsocietybasedtosomeextentoncommunalownershipofproperty.Manygroupsweregoverned by"elders"ratherthanbychieftains.TheymayhavetradedsomewithByzantium,butthechiefeconomydepended onagricultureofthecutandburnprinciple. NOTE :TheSveartribestradedsapphirecoloredskinsthroughvariousintermediatetribestoRome.Thereis somesuggestion,though,thatthiswasatimeofcrisis,possiblyinvolvingclimatedeterioration,soilexhaustion,deciencydiseaseincattle,violentinvasions,internalconictsandpossiblyplague.TheSwedishcity ofHelg o ,however,apparentlywasnotaffectedbythedeclineseenelsewhere..Frisiansettlementsalongthe mainlandcoastwerekeycentersforcontactoftheScandinavianswithwesternEurope.Ref.301[258] ForwardtoEurope:A.D.601to700Section21.4 20.5CentralandNorthernAsia:A.D.501to600 8 20.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:A.D.401to500Section19.5 IneasternAsiathesuccessorsoftheHsiung-nuweretheKokTuruk,alsocalledtheBlueorCelestialTurksandthese werethepeoplewhoby550weredrivingtheJuan-JuanoutofMongolia.SeealsoCHINA,thischapter.Their 8 Thiscontentisavailableonlineat.

PAGE 323

311 successorsinMongoliaweretheTurks,proper,calledT'u-Chu ehbytheChinese.ThisTurkishEmpirewasan exceptionalonewhichcouldbearonwesternChinaandtheEurope-NearEastareasallatthesametime.Itnow advancedrapidlyandcrushedtheEphthalitesin553,allowingthePersianstoagainoccupythelandssouthofthe Oxus.TheamalgamatedremnantsoftheJuan-JuanandtheEphthaliteswereknownintheWestastheAvars.Previous tothisthelatterofthetwopeopleshadlivedinBactriaandhadcontinuouslyraidedPersia.InthiscenturytheAvars hadalreadyreachedtheBalkansandHungary.Someplaceinthismassofmigrating,nomadicpeoplesthestirrupwas developedandthismadeitpossibleforhorsementoridefastandmeetashock,aswithalance,andstillsurvive.Ref. 8[14],101[146],137[188],213[288] ForwardtoCentralandNorthernAsia:A.D.601to700Section21.5 20.6TheIndianSubcontinent:A.D.501to600 9 20.6.1THEINDIANSUBCONTINENT ChaoscontinuedfromtheEphthaliteinvasionsthroughoutthefailingGuptaEmpireinthenorth.Theinvaderswere nallydefeatedbyaHinduconfederationin528buttheyhadprofoundlyaffectedthecastesystemanddisruptedthe heirarchyofrulingfamilies.SomeEphthalitesstayedinIndiaasadistinctgroup.Inspiteofthewarfare,greatscientic progresswasmadeinthisnorthernIndiaarea,withadvancesinchemistrysuchascalcination,distillation,sublimation, productionoflightwithoutheat,themixingofanestheticandsoporicpowdersandtheformationofmetallicsalts, compoundsandalloys.Brahmagupta,theastronomer,livedneartheendofthecenturyandsystematizedrulesof arithmetic,algebraandastronomyanddevelopedanintegralsolutionofanindeterminateequation.Ref.38[59], 46[76] ThethirdbranchofBuddhism,Tantric,appearedintheHimalayanlands,interlacingMahayanaBuddhismwithold TantriccultsofIndiathatinvokeddeitiesbymagicandrituals.Therewasalargearrayofdivinitiesbothmaleand female,alongwithdemons.Ref.114[162] TheDeccanwasnotuniedagainuntilabout550,underthewesternCalukyaDynasty.SouthernIndiaremained essentiallyDravidian,butlittleisknownofitsdetailedhistoryandnothingofitsartuntiltheendofthiscenturywhen thePallavasruledfromnorthofMadrastothesacredriver,Kaseri,andhadsculpturesandcavetemples.Stillfarther southwerethePandyasandCeras.Ref.19[32] InCeylon,theoriginalVeddaswereconqueredbySinhaleseinvadersfromnorthernIndiaandtheVeddassurvive todayonlyasasmallgroupintheremoteinterior.Ref.175[241]Continueonpage445 20.7TheFarEast:A.D.501to600 10 20.7.1THEFAREAST BacktoTheFarEast:A.D.401to500Section19.7,thenSui TheT'o-paTurksofManchuriagavewayearlyinthecenturytoanewnomadicempireoftheJuan-Juantribes,a mixtureofproto-Turkandproto-Mongolelements.Overthrownin551theymigratedwestwardtobecometheAvars ofEuropeanhistory.ThepowerfulKoreanstateofKoguryocontrolledapartofManchuriainthisperiod. ThenorthernpartofChinacontinuedtobedominatedmostofthetimebynomadicbordertribes.Amongthesewas theWesternWeiDynastywhichinthemiddleofthiscenturyadoptedanoldMongoltribalinstitutioninthatevery 9 Thiscontentisavailableonlineat. 10 Thiscontentisavailableonlineat.

PAGE 324

312 CHAPTER20.A.D.501TO600 familythathadmorethantwosonshadtosendoneforpermanentserviceinoneofthe100garrisonsinthestate. Themilitiamenwereexemptfromtaxesandotherlaborleviesandthissystem,called"fu-ping",wasintendedto separateeliteghtingmenfromthefarmingpopulation.Insomeformitpersistedthroughseveralcenturies.There wereothernomadintrusionsandcivilconicts,buttheinvadersalwaysadoptedChinesecustomsandcultureandthe Chineseupperclass,particularlyinnorthwestChinacollaboratedandintermarriedwiththeTurksandHsien-peiwith aresultingSino-nomadaristocracy,manypeoplespeakingbothChineseandTurkish.Itwasfromthismixturethat cametherulinghouseoftheSui,whotookcontrolin581andnallyuniedallofChinaunderaChinese,YangChien, whohadpreviouslybeenaministerofthenorthernChoucourt.Ref.101[146],8[14] ThiswasthegreatageofMahayanaBuddhistsculptureinChina,asthistypeofthereligionhadsweptintothecountry fromIndiaandourishedthereasitlostgroundinitshomeland.AtthistimeChinabuiltsuspensionbridgesheldup bychains,aprocedurenotusedintheWestforsome1,200years.Therebuildingofoldcanalslinkingthecapital, Ch'ang-an,withtheYellowRiverin584contributedtostabilityandworkwasstartedonwhatwesternerscallthe GrandCanal,linkingtheYellowandYangsterivers.AllthiswasdoneunderWen-ti-604aSuiemperorwho wasaneffectiveadministratorandskilledpropagandist.Ref.215[290],101[146] UpuntilaboutthistimetheJapaneseislandsformedpartofalargeculture,nomadicinorigin,whichincluded Manchuria,easternSiberiaandKorea.WementionedinthelastchapterthatBuddhismhadcrossedoverfromChina toJapanviaPaekche,KoreaanditmaderapidconquestwiththehelpofEmperorSenka.Ref.222[296]UnfortunatelytheKoreanmissionariesalsobroughtalethaldisease,perhapssmall-pox,andepidemicsfollowedinJapan abouteachthirtyyearsthroughouttheremainderofthecentury,althoughsomemedicalhelpcamefromChina.Both thereligiousneedsofthepeopleandthepoliticalneedsofthestategaveBuddhismfertileground.Thiswasnotthe agnostic,pessimisticandpuritanphilosophyofBuddha,himself,buttheMahayanavarietyofgentlegods,cheerful ceremoniesandpersonalimmortality.Itofferedthepeoplethatunityoffeelingandbeliefwhichservesasasourceof socialorder.Withitalsocameneandusefulartssuchaspainting,sculpture,architecture,music,bronzeworks,textilemakingandmedicalarts.ThewrittenChineselanguagecontinuedtobemodiedintoacomplexsystembyadding phoneticelementstotheideographs,forwritingtheJapaneselanguage.TheperiodofHaniwasculpturesofhuman gures,generallycoil-builtcylindersofunglazed,iron-bearingclay,redtoawarmbuffcolor,hasrepresentation todayintheRockefellercollection.Ref.46[76],186[254] In587EmperorBidatsustemperorembracedBuddhismonhisdeathbedbuttheclanofcourtarmorers,the Mononobe,wouldhavenoneofthisandtheyrebelledandburnedBuddhisttemplesfarandwide.ButtheKyushu ladies'factionatthecourtexterminatedthisclan,bringingtopowerthesonofaMononobemother,PrinceShotoku Taishi,whoagreedtoaChinesetypeofprogramforstrengtheningthenation.PrinceShotokuwasachildprodigywho hadmasteredtheChinesesystemofwritingbytheageofseven.Weshallhearmuchmoreofhiminthenextcentury. Ref.12[21],222[296] Inthenorth,KoguryocontinuedasapowerfulstatewithsometerritoryalsoinManchuria.Inthesouth,Sillanally adoptedBuddhismandthenbegantomakerapidprogressincivilizationandingeographicexpansionattheexpense oftheadjacentJapanesecolony.By554SillawonanoutletontheEastChinaSeaincentralKorea,givinghereasy seacommunicationswithChina.ChinesemedicinespreadtoKoreaatthistime.Ref.119[166],125[173] AdditionalNotesp.313 Dvaravati,ThatonandPeguwereMonkingdomsappearingatthistimeinwhatisnowsouthernBurma.Theyspread Buddhismthatultimatelybecamethefaithofmostofthepeninsula.AroundA.D.550theFunanKingdomwas overthrownbytheKambujas,amountainpeoplefromChenlaLaos,afteroodshadravagedtheMekongValley.

PAGE 325

313 TheirkingwasalsoofthesameroyallineastheFunanaKhmerandthesepeoplewerecloselytiedtotheHindu traditionanddeities.Ref.176[242] NOTE :ItwastheSorabolpeopleofsoutheastKoreawhoformedSillaandPakHyokkose,supposedlyof miraculousbirth,wastherstking.Ref.305[103] ForwardtoTheFarEast:A.D.601to700Section21.7 ChooseDifferentRegion 1.IntrotoEraSection20.1 2.AfricaSection20.2 3.AmericaSection20.9 4.CentralandNorthernAsiaSection20.5 5.EuropeSection20.4 6.TheIndianSubcontinentSection20.6 7.TheNearEastSection20.3 8.PacicSection20.8 20.8ThePacic:A.D.501to600 11 20.8.1THEPACIFIC BacktoThePacic:A.D.401to500Section19.8 Onceagainthereaderisreferredtopreviousmodules,particularlythe1stand4thcenturiesoftheChristianEra.Itis assumedthatintherstChristianmillenniumtherewasagradualincreaseinthePolynesiantribesandacontinued islandtoislandmigrationviadoublecanoes,sothatthemoresouthernislandsoftheMarquesas,Samoa,Tahiti,etc., werereachedbyHawaiiantravelerssometimeinthisperiod.ThelargecanoesarestillusedbyIndians,Aleutsand othersalongtheCanadiancoastalwaters,althoughcurrentlytheymayaddasmanyasthreemastsandsailstoa thirty-vefootkayak.Ref.56[81] ForwardtoThePacic:A.D.601to700Section21.8 ChooseDifferentRegion 1.IntrotoEraSection20.1 2.AfricaSection20.2 3.AmericaSection20.9 4.CentralandNorthernAsiaSection20.5 5.EuropeSection20.4 6.TheFarEastSection20.7 7.TheIndianSubcontinentSection20.6 8.TheNearEastSection20.3 20.9America:A.D.501to600 12 20.9.1AMERICA BacktoAmerica:A.D.401to500Section19.9 11 Thiscontentisavailableonlineat. 12 Thiscontentisavailableonlineat.

PAGE 326

314 CHAPTER20.A.D.501TO600 Seepreviouschaptersand9thcenturyC.E.Section23.9,aswellasEurope:A.D.501to600Section20. IRELAND. TheMississippianCultureofMoundBuilders,whichnowreplacedthedecayingHopewellCulture,oweredalong theMississippiRiverandotherriversystemsofthesouth. Archaeologistsdonotagreeaboutitsorigin.SomeattributeittothemigrationofideasfromMexicoorCentral AmericaanditistruethatsomeofthesophisticatedartdoesresembleMiddleAmerican.Butevenmoreoftheart seemstohavehadrootsinAdenaorHopewellandcurrentthinkingtreatstheMississippianasanindigenousculture, anoutgrowthoftheHopewellblendedwithlatearrivingMexicanelements.Thecharacteristicfeatureoftheculture isthepyramidalmoundservingasafoundationforatempleorachief'shouse.Somecenterswereverysmallbut othersweregigantic,asCahokiaatEastSt.Louis,Illinois,wherethereweremorethan85moundsandavillagearea thatextendedforsixmilesalongtheOhioRiver.Oneofthelargestofthemoundswasabout100feethighandits basecovered16acres.Theimmensityofthelaborinvolved,withouttheuseofwheelsorbeastsofburden,isalmost unbelievable.Theentireenterprisemayhavetakenseveralhundredsofyears.TheMississippianpopulationwasdense inthatatleast383villagesborderedtheMississippiRiverintheshortdistanceofabout700milesbetweenpointsof entranceoftheOhioandRedriversrespectivelyandtherewerethousandsofothervillagesupanddowntheother partsoftheriversystem.Ref.64[94] IfwearetobelieveProfessorFellRef.66[97]Libyanscienceandmathematicscontinuedtoourishinthe southwest.TheHohokamcontinuedtheircolonizingmigrations,beginningtheircolonialperiodsometimeafter550, spreadingartifactsovermostofArizonaandtakingwiththemtheircustoms,includingthesacredball-game.Farther northeasttheAnasaziorPuebloBuilders,continuedadvancementwithbetterpotterydesignsandincreasedtrade, importingabaloneshellsandturquoise.Ref.269[193]Fromasourcestillunknowntheyobtainedthebowand arrowandtheydevelopedthehaftedax.Agricultureincreasedwiththecultivationofbettercorn,squashandbeans, whichaddedproteintotheirdiet.Theirpopulationthensoaredandtheirsettlementsspreadsothattheyevenhadpit housesinthecliffsoftheGrandCanyon.Ref.277[37],CENTRALAMERICA,ANDTHECARIBBEAN TeotihuacnintheValleyofMexicowasattheheightofitspowerandwaslargerthanimperialRome,someestimating thepopulationat125,000withanareaof20squarekilometers.Ref.8[14]Itwasareligiousandculturalcapital andamajoreconomicandpoliticalcenterforMiddleAmerica.Itspowerextendedwidelywithinterminglingof tribesandcultures,sothattherewasastrongMexicanpresenceevenatKaminaljuyunowGuatemalaCity.Eventhe lowlandMayaregion,asatTikal,hadTeotihuacanartistictraditions,althoughTikalwasonlyone-fthaslargeasthe Mexicancity. TheMayahadanumberoflanguages,allcloselyrelatedbutnotmutuallyintelligible.Thereweretwoprincipal divisions-thelowlandsgroups,includingYucatec,CholandChorti-andthehighlandsGuatemalanwhichincluded MamandQuiche.TheeducatedMayawereprofoundlyintellectualandwehavenotedtheirmathematicsto100 A.D.Section15.,CENTRALAMERICAANDTHECARIBBEANandastronomyA.D.301to 400p.281previously.AgreatrenaissanceofMayanCulturenowtookplaceinthecitiesofYucatan,gradually supplantingtheimportanceofPeten,inthesouth.Ref.177[243],146[199],215[290],163[222]According totraditions,picturewritingsandMexicanmanuscriptswrittenaftertheconquest,theToltecs 13 werebanishedfrom theirnativecountrynorthwestofMexicoin596andproceededsouthward.Ref.205[276] 13 ThissuggeststheprobabilityofmorecontinuityandinterrelationshipsamongtheoriginalMexicanpopulationsthanoftenstated.Modern historiesdonotmentiontheToltecsasaseparatepeopleuntilaboutthe9thcentury.

PAGE 327

315 ThiscenturymarksthebeginningofPeriodVofCostaRicanprehistory,witheachofthreearchaeologicalzones developingindependently.InGuanacaste-NicoyatherewasthebeginningofthefamousNicoyapolychromepottery traditionwhichresembledMayaceramicsoftheLateClassicperiodofHondurasandElSalvador.Theprogressin Panamaseemedtocomemoreorlesstoahaltandthiscountryneverdevelopedanytrulystate-centeredsocietiesas seenfarthernorthinCentralAmerica.Ref.266[67] AlongvariouspartsoftheMagdalenaRiverValleyinColombiaandparticularlynearSanAgustinareenormous pilesofdebris,someofwhichhavebeenexcavatedrevealingsculpturedmonolithsandthewholeindicatingagreat ceremonialcentersomethinglikeaMayacomplex.Radio-carbondatingsindicateactivityinthis6thcenturywith continuationforanother1,000years.SinceithassomesimilaritiestoboththeOlmecsandtoEasterIslandthequestion arisesastowhetherthisastonishingstatuarywaslocalinoriginorfrommigratingpeoplefromCentralAmericaor evenfromPolynesia.JusteastofPopayanontheeasternhot-landpartofAndeanColumbiaisaninterior,isolated valleycalled"Tierradentro"wherethereareinterestingmonumentsperhapsdatingtothissameera,althoughitmay beasecondarysocietyhavingexistedathousandyearslater.Accuratedatinghasnotbeenaccomplished.Tombsthere havelongagobeenlooted,probablyofgoldandjewels,butthreedimensionalstatuesreminiscentofEasterIslandand representinganthropomorphicgodsarecomparabletothoseofSanAgustin.Ref.62[91] Peruconsistedofaboutnineseparateregions,eachwithitsownlocalartstyleinthiscentury.TheMoche,ortheir descendants,andtheNascaweresupremebutotherstatesofsomeconsequencewereCajamarca,Recuary,Lima, Huarpa,Waru,TiahuanacoandAtacameno,allofwhichusedgold,silverandcopperfortoolsaswellasjewelry.In Ecuador,beginningaboutA.D.500,therewerepeopleoftheMilagroCulture,notedforelaborateworkingoldand forarticialmoundsforburialplacesandhomesites.Someofthelatterseemtobeassociatedwithridgesystemsand otherswithrectangularearth-works,probablymadetofarmlandssubjecttoseasonalooding.Thisculturemayhave beenanoff-shootoftheMocheofPeru,describedinpreviouschapters.Similarfarmingridgescovermanythousands ofacresinBoliviaandColombiaandarepresentnearLakeTiticaca,althoughthedatingofthesehasnotbeendone. Ref.9[15],62[91] TherewerefarmingtribesintheAmazonrainforest,cultivatingmanioc.FarthersouththeTuni-Guaraniatribeshad migratedfromtheAmazonbasinintotheBrazilianforestandsavannah.InwhatinnowArgentina,therewasthe AguadaCultureaboutA.D.600,characterizedbyblackandyellowpotterywithfelinemotives.Ref.8[14],45 [66] ForwardtoAmerica:A.D.601to700Section21.9 ChooseDifferentRegion 1.IntrotoEraSection20.1 2.AfricaSection20.2 3.CentralandNorthernAsiaSection20.5 4.EuropeSection20.4 5.TheFarEastSection20.7 6.TheIndianSubcontinentSection20.6 7.TheNearEastSection20.3 8.PacicSection20.8

PAGE 328

316 CHAPTER20.A.D.501TO600

PAGE 329

Chapter21 A.D.601to700 21.1A.D.601to700 1 21.1.1A.D.601TO700 BackwardtoA.D.501to600Section20.1 Thechieffeaturescharacterizingthiscenturyarethepersistenceofthe"DarkAges"inEurope,theamazingeruption oftheArabarmiesandtheMoslemreligionoutofthedesertofArabiaandtheearlydominanceofTurkishpeoplein CentralAsia,withmarkedeffectseveninChina. Wehavepreviouslymentionedthatinthese"DarkAges"educationsurvivedonlyasaluxuryoftheclergy.TheRomanChurchitselfcouldgivelittleornodirectionatthistimebecauseofchaosinItalyandtheloweringofByzantine prestige.TheEmperorHeracliusattemptedtoregainSyriaandArmeniafromPersiabyconciliatingtheirmonophysitismbyproducingacompromisecalled"monotheletism"whichsuggestedthattheunionofGodandmanin Christ,althoughnotsubmergingtheidentityofeither,wassufcientlycompletetomanifestitselfoutwardlyinone divine-humanenergy.ThisproposalonlyirritatedtherestoftheempireandwhentheArabsoverrantheregionitwas abandoned.Asalastblow,IslamappearedontheworldsceneinthiscenturytofurthermenacetheChristianChurch. Ref.137[188] MostofthepresentdaytaboosoftheIslamicreligionwerepresentatitsinception.TheKoranprohibitionsinclude: 1.Pork,asanimpurity-chieyacarry-overfromnomadlife.Onecannotdrivepigsongreatmigrations 2.Animalblood-apollutionlegacyfromOldTestamentJudaism 3.Wine,consideredanabomination.Itissaidthatsomeoftheprophet'searlylevieshadbeenfoundtoodrunkto ghtRef.211[284] Asiswellknown,theoriginalstoriesfromtheKoranaremuchliketheOldTestament,withthesameearlycharacters, includingAbrahamandhistribe.BothJudaismandIslamcamefromthesamesourcesinthedesert.Islamwas essentiallyamilitaryempireinthebeginningandonlybecameacultureafteritabsorbedameasureofPersianthought. Ref.213[288] 1 Thiscontentisavailableonlineat. 317

PAGE 330

318 CHAPTER21.A.D.601TO700 Inthisandthenextfewcenturies,Jewsbecamemoreandmoreisolatedasacommercialsect.Especiallyinnorthern Europetheywereexcludedfromowninglandandthefeudalsystemresultedintheconstantthreatofconscation ofpropertyandevenexpulsionfromthecountry.ExpulsionstartedinSpainjustafterthebeginningofthecentury withanedictfromEmperorHeraclius.TheCarolingiansinAustrasia,France,however,gavethemspecialcharters, protectionandcommercialprivileges.Ref.8[14]IntheirnativeLevant,manyJewsconvertedtoIslamandactually contributedmuchtothenalMoslemconcepts.Ref.213[288] ForwardtoA.D.701to800Section22.1 ChooseDifferentRegion 1.AfricaSection21.2 2.AmericaSection21.9 3.CentralandNorthernAsiaSection21.5 4.EuropeSection21.4 5.TheFarEastSection21.7 6.TheIndianSubcontinentSection21.6 7.TheNearEastSection21.3 8.PacicSection21.8 21.2Africa:A.D.601to700 2 21.2.1AFRICA BacktoAfrica:A.D.501to600Section20.2 TheEthopianuplandsoilshadbeenlargelydestroyed,exposingunderlyingrocks.Inthemiddleofthecentury, threatenedbyMuslimneighbors,AxumlostitsRedSeaportsandhaditsgoldsupplycutoffsoitsChristiansretreated tothehighlands,wheretheyremainedinisolationuntilthe15thcentury.Abandonedbuildingsdeterioratedand contributedtothesoildestruction.Landabandonmentcanbeasdestructiveasover-useandtherecanbelittledoubt thatallthisexacerbatedAxumiteeconomicdecline.Ref.270[36] TothewestinNubia,CopticChristiansthrived.AfteranEgyptianattackin651-652relationsbetweenChristianNubia andMoslemEgyptwereformalizedbytreatywhichincludedanagreementthatNubianswouldreturnallrunaway slavestoEgypt.AcathedralwasbuiltaboutA.D.700inQasrIbrimandtherewereplanstomakethisapilgrimage center.NubiahereafterremainedChristianforabout700years.Justnorthofthepresent-dayAswanDam,thesurvival ofpaganismintothis7thcenturyontheislandofPhilaehadbeenanotablescandalstimulatingByzantinemissions intothearea.Ref.271[7] EgyptfelltothePersianstemporarilyin616butfellagaintotheArabslaterinthecentury,withAlexandriaconqueredbythelatterin660.TheMonophysiteChristiansofEgyptactuallyhelpedtheMoslemsoverthrowtheexisting administration.Aftertheconquest,AmrruledfortheArabsanddidsowell.Ref.206[83],137[188] InthelastthirdofthecenturytheraidingMoslemseasilytookTripolitaniabutontheiroriginaldrivewestwardthey wererepulsedfromTunisiabyRomanEmpiretroops.Subsequently,however,conversionoftheindigenousBerbers 3 2 Thiscontentisavailableonlineat. 3 "Berber"isanArabwordmeaning"barbarian"

PAGE 331

319 toIslamin696gaveIslamanewpushandtheByzantineforcesinTunisiawerethenoverrunandCarthagewas destroyedagain.SoonMoroccoalsofelltotheIslamiconslaught.Shortlythereaftertraderoutesforslaves,ivoryand goldopenedupbetweenMorocco-AlgeriaandthewesternSudan.TheMurabitsalsoAlmoravidsofMoroccoturned south,shatteringtheNegroEmpireofGhana. TheBerberswereofanentirelydifferentracefromtheArabs,havingroundishheadscontrastingwiththeArabs'long heads.EvenwhensomewereinitiallyconvertedtoIslam,allowingtheMoslemadvance,mostoftheBerbersretreated tothenakedmountainsdividingTunisia'scoastalplainsfromthedesert.Evenso,theMuslimsmadeagreaterimpact onthesepeoplethanRomeorChristianityhadpreviouslydone.Ref.137[188],175[241],58[86],83[123], 222[296] From500to1,200ancientGhana,inwhatisnowMali,monopolizedthegoldtradefromwestAfricatoEurope.Itsat atthesouthernendofthetrans-Saharancaravanroutesandthusactedasthehub.KumbiSalehwasacityof15,000 people.TheexcavatedruinsoftheancientcityofJenne-Jenohadaformidablethreemeter-widewallsurrounding itwhichwasconstructedsometimebetween400and800.Delicatelyconstructedgoldjewelryhasbeenfoundunder thiscitywall,indicatingthatthiswasatradecenteroveralongperiodoftime.Thenearestgoldmineswere800 kilometerssouthofthisdevelopingcity.Ref.268[189]TheMosleminvasionofGhanafromthenorthcaused somedisruptioninadministrationcertainly,butdidnotdestroythefundamentalcultureorthedevelopingcities. InthefarsoutheastofAfricatheLeopard'sKopjepeople,aBantu-speakinggroup,wereincontrolofGreatZimbabwe fromaboutA.D.600to850.Ref.45[66]ElsewherethegreatbulkofAfricaremainedasinpreviouscenturies. ForwardtoAfrica:A.D.701to800Section22.2 21.3TheNearEast:A.D.601to700 4 21.3.1THENEAREASTANAMAZINGCONQUESTOFTHENEAREASTBYISLAMICARABS BacktoTheNearEast:A.D.501to600Section20.3 ItwasinthiscenturythatthepeopleofKurdistanwereconvertedtotheSunnivarietyofIslam.TheKurdsareapeople closelyrelatedethnicallytothePersians,whohavetriedthroughtheagestokeepthemselvesintactassheep-raising andrugweavingnomads,withoutrespecttopoliticalboundaries.Kurdistanembracesthepresentdayareasofeast TURKEY,SovietArmenia,northeastIraqandnorthwestIran.Ref.38[59] MuhammadorMohammedwasborninthesouthofArabiaofpoorparentageearlyinthecentury.Hemarried wealthandsoonbegantoteachanewreligion,takingasbasicbeliefsthemonotheismoftheJews.HeacceptedJesus asaprophetandformulatedanewcreedofbehaviorforhisfellowArabs.Hehadthevisionarypowerofaseer,the astutenessofamasterpoliticianandapoet'smasteryoflanguage.Ref.83[123]BythetimeofhisdeathinA.D. 636hisfollowershadalreadybecomealmostfanaticalintheirzealtospreadthenewfaithandtheirarmiespouredout oftheArabianPeninsulatosellthereligionbyforceofarms.TheArabs'militarysuccessapproachedthemiraculous astheysubduedthegreatestkingdomswithsmallarmiesmadeupofmountedmenonthefamedArabianhorses.Ref. 122[170] 4 Thiscontentisavailableonlineat.

PAGE 332

320 CHAPTER21.A.D.601TO700 Theearlypartofthecenturywasaperiodofsomegeneraldecayinthisentirearea,withPersiaandByzantiummore orlesssplittingcontrol.AtthedeathofEmperor MauriceofByzantiumatthehandsofhisownsoldiers,ChosroesIIofPersiawentonaconqueringspree,taking RomanMesopotamiain607-615,thenArmeniaandsomeofAnatoliaitself.Butthepestilenceswhichhadvisitedthe RomansandPersiansalikefrom542onmayexplainingreatpartthelittleresistancetheirforcesofferedtheMoslem eruptionin634.BythetimeoftheArabconquestSyria,ingeneral,wasanimpoverishedandstrickenland.Damascus, aswellasJerusalem,hadnotrecoveredfromtheeffectsofthepreviouslongandterriblesieges.Palmyrastoodempty. InMesopotamiathereissomeevidencethatmanyirrigationcanalshadbeenabandoned,probablyfromalackoflabor supplyduetotheplague,beforetheMoslemshadevenarrivedanditisdoubtfuliftheArabsactuallydestroyedmuch. Ref.137[188],140[190] TherstincursionofArabsintoIraqoccurredinA.D.633withforcesunderKhalidibn-al-Walid,althoughthemain advancewasalittletothewestintoSyria.TheydefeatedtheByzantinesinalastbattleatYarmukin636andJerusalem capitulatedin638.ThechiefadministratorofIraqandthecoastalregionfrom644to656wasOthmanalsoUthman oftheOmayyadalsoUmayyadfamily.Usinghisnepotismasanexcuse,troopsfromIraqandEgyptassassinated OthmaninMedinain656andhewassucceededbyAli,theprophet'scousinandson-in-law.Mo'awiya,anOmayyad governorofSyria,disputedthissuccession,proclaimedhimselfcaliph 5 inJerusalemin660andwentontoestablish acapitalatDamascusin661,initiatingtheOmayyadCaliphate.DescendantsofAlicontinuedintermittentwarfare withthecombatantseventuallyendingupasthenorthernOmayyadArabsagainstthesouthern.Thelatterwere chieytheShi'ites 6 andbytheendofthecenturythesepartisansweremoreorlessincontrolofArabia,Persia andMesopotamia.Inaddition,theoldlineofdemarcationbetweenRomanSyriaandPersianIraqorMesopotamia survivedthisMoslemconquest.Astrongsenseofdifferencebetweenthepopulationsatlargeinthesetwoprovinces, fosteredbythedifferencesintheirrespectiveadministrationseasilycoalescedwithlongstandingrivalriesinthetwo Arabgarrisons.Manycivilwarsresulted.Ref.2[3],119[166] AstheArabarmiesoverranMesopotamiaandIran,sizablegroupsofJewswereprettywellleftaloneasprotected minorities.AllaspectsoftheircivilandreligiouslifewereadministeredbyJewishofcialsinaccordancewiththe BabylonianTalmud.AtthistimeHindunumeralswereinuseinSyriaandlaterthesebecameknownas"Arabic numerals".Ref.49[73] AsthecenturybeganChosroesIIruledthePersianswithavarice,suspicionandcrueltyandaruinoustaxationto supporthisownsplendidliving.HisarmiesfoughttheirwaytotheBosporusandtoEgyptandcamewithinsightof Constantinoplebutsome10yearslaterEmperorHonorius,inalliancewiththeKhazarsjusteastoftheCaspian,struck back,attackingthePersianhomeland-624.ThePersiansretaliatedbyattackingConstantinopleonceagainwith Avarhelpin626buttheeastRomannavykeptthetwolandforcesapartandtheattackwasafailure.ChosroesIIwas thenmurderedbyhisnoblesandhisson,KavadhII,madethenalpeace,surrenderingEgypt,Palestine,Syria,Asia MinorandwesternMesopotamiabacktotheByzantineEmpire.ThenpestilencebrokeoutinPersiaandthousands died,includingtheking.Therefollowedaghtforthethroneandinthisatmosphereofdiseaseandgeneralmoral decayanddeclinecametheArabarmiesofIslamabout636andPersiaquicklybecamepartoftheMoslemrealm.The decisiveactionwiththeArabsoccurredatAlQadisiya,Iraq,whenthePersianarmywasliterallysmashed,allowing Arabcaptureofthecapital,CtesiphonverynearSeluciainMesopotamia,inA.D.635,thusopeningtheroadtothe mainIranianplateau.Afterthetake-overafewPersiannoblesmaintainedtheirindependenceinthemountainsof TabaristanatthesouthendoftheCaspian.Ref.8[14],137[188] 5 AcaliphisthereligiousandcivilleaderofaMoslemstateandtheregionhecontrolsisacaliphate.IncontrastanemirmaybejustanArab chieftainorafavoreddescendantofMohammed 6 TheShi'itesorShiahrepresentoneofthetwogreatdivisionsoftheMoslemfaith.TheybelievethatonlythedescendantsofAliareeligible tobecaliphs

PAGE 333

321 TheArabsdidnotforcetheirconqueredsubjectstoembraceIslambutdidrequirethemtoaccepttheKoranasdivine teachingandobligedthemtolearnArabic,thusbuildinganempireunitedbyacommontongue.Ref.137[188], 222[296]TherewereprobablymanyfactorsintheeasyfallofthegreatPersianEmpiretothesurgingArabarmies. Inadditiontothefactorslistedintheparagraphabove,itshouldberealizedthatbothByzantiumand SassanianPersiahadexhaustedthemselvesbattlingeachotherformanyyears.Buttherewasalsoaneconomiccause ofdeclineastheuseoftheSilkRoutetoChinadiminished.TheByzantineshadsmuggledsilkcocoonsfromChina andcouldnowsupplythemselveswithsilkandtheeconomysufferedallalongtheoldroute. ByzantiumhadbecometheoriginalheirofclassicalGreekmedicinebutduringthepersecutionsofanumberoflearned hereticstheyedtoPersia,where,atJundishapur,theymetSyrian,PersianandHinduscholarsandworkingtogether, theytranslatedmanyimportantworksintoSyriac,thenewlanguageoflearningintheNearEast.WhenPersiafell totheArabs,manyworksofmedicinewerethentranslatedfromSyriacintoArabic,includinglargeworksofGalen. Ref.211[284] AfterEmperorJustinian'sdeathatthecloseoftheprecedingcenturytheeasternRomanEmpirecollapsedwith nothingleftexceptafewAsiaticports,somefragmentsofItaly,AfricaandGreece.Thecapitalitselfwasbesiegedby thePersiansunderChosroesII,helpedinthenorthbyanarmyofAvars.InA.D.602the"Roman"armyghtingthe Avarsrevolted,returnedtoConstantinopleandmurderedEmperorMaurice,whiletheAvarsdevastatedtheBalkans. Thecross-bowreachedByzantiumfromcentralAsiaataboutthistime,perhapsborrowedfromtheAvars.Ref.137 [188],213[288] ThewholeoftheAsiaMinorpeninsulahadbeenploughedandfurrowedbyPersianarmiesandthegreatcitieshad beenplunderedandsacked,buttheByzantinesstillhadanunbeatennavyandafter10years,Heraclius,thenew emperor,builtanewarmy,sailedacrosstheBlackSea,marchedacrossArmeniaandattackedanddefeatedPersia fromtherearA.D.624.Thevictorywasahollowone,however,astheArabssoonadvancedintothisterritorywith Khalidibnal-WaliddefeatingaByzantinearmyatthebattleoftheYarmuk.TheByzantinefrontierswerebackedinto Turkey,proper,againandafter673theMoslemsevenblockedConstantinoplebothbylandandsea,allowingitto beattackedeveryyearforthenextve.Onlythestrengthofthecity'swallsandtheappearanceof"Greekre",an explosiveofunknowncomposition,savedtheempire. Althoughwehaveusedtheterms"Byzantine"and"Byzantium"freelyinthelastfewchapters,actuallyitwasnotuntil thesecondhalfofthiscenturythatearlierhistoriansappliedthesenamesinreferencetotheeasternRomanEmpire. "Byzantion"wastheoldGreeknameforConstantinople,andasthelanguageofthiseasternempirebecamechiey Greek,theterm"Byzantium"cameintouse.Ref.137[188] ThroughoutmostofthiscenturyArmeniawasinthemiddleofathree-corneredwarinvolvingArabs,Khazarsand Byzantines,buttheymanagedtoremainvirtuallysovereignandzealouslyChristian.Ref.137[188]Afterrst beingoverrunbytheeasternRomanarmyonitswaytoPersia,latertheArabsinvaded.Intherstseveraldecades thehigherclasseshadgreatprosperityincidenttotheexportationofmanufacturedgoodsandrawminingproducts. Itwasalsoaperiodofintellectualactivitywithphilosophical,mathematical,astronomicalandcartographicstudies. Ananias,ofShirak,wasagreatscientist.ManyArmeniansservedasmercenariesforByzantium,particularlyafterthe ArabsappearedonthesceneandbylatecenturythemainstaysofthatarmywereArmenian.Ref.222[296] ForwardtoTheNearEast:A.D.701to800Section22.3 ChooseDifferentRegion 1.IntrotoEraSection21.1

PAGE 334

322 CHAPTER21.A.D.601TO700 2.AfricaSection21.2 3.AmericaSection21.9 4.CentralandNorthernAsiaSection21.5 5.EuropeSection21.4 6.TheFarEastSection21.7 7.TheIndianSubcontinentSection21.6 8.PacicSection21.8 21.4Europe:A.D.601to700 7 21.4.1EUROPE BacktoEurope:A.D.501to600Section20.4 SlaverycontinuedinEuropethroughoutthese"DarkAges"despitetheChristianChurch,butinthiscentury,when ArabsgainedcontroloftheMediterranean,itwasdifcultforEuropeanstogetslavesfromtheLevant.Mostwere thenobtainedfromtheSlavicregions.Ref.213[288] ThecenturybeganwiththeseislandsallapartoftheByzantineEmpirebutonebyonetheArabsbegantotakethem overinthelatterdecades.Cyprus,withitscoppermines,felltotheMoslemsin648andRhodesin654.Ref.222 [296] GreecewasnowheavilyinltratedwithSlavicpeoplesandalthoughnominallyundertheeasternRomanEmpire,only someofthecoastalcitiesweretrulyByzantine. TheBulgars,whoseoriginalKaganatewasinthemiddleVolgafarnorthoftheCaspianSea,hadmigratedinthe previouscenturytotheDanuberegion.Thisgroup,includingonebranchoftheUtigurs,hadfoundedaBulgarian kingdominancientMoesia,enslavingtheSlavsalreadytherebuttheyadoptedtheSlavs'languageandcustomsand intimeintermarriedwiththem.TheybegantotakeovermoreandmoreBalkanterritoryfromByzantiumby679and wererecognizedasaseparatecountryin681whentheirrstking,Isperikh,wascrownedatthecapital,Pliska.These weretheso-called"White"or"WesternBulgars",originallyrelatedtotheHuns.Ref.180[246],8[14] Fartherwest,theSrbiSerbssettledinpartoftheoldPannoniaandChrobatiCroatssettledinIllyricum,forming eventuallythecountryofSerbia.By650theSlavs n constitutedthemajorityofthepeopleintheBalkans.Avar horsemen,operatingoutofHungary,spreadhavocintermittentlythroughtheareaandrepeatedlyappearedunderthe wallsofConstantinople. TheLombardsregainedcontrolofthenorthernplainofItaly,wheretheByzantineshaddrivenawedge,betweenA.D. 601and605,establishingaprogressivestateunderDukeAgilulf,whowasactuallyaThuringian.TheLombards maintainedintermittentrelation-shipswithRomeandeventuallybecameCatholics.Venicecontinuedasanindependentrealm,allegedlyhavingbeenbuiltupfromshingvillagessettledbyfugitivesfromtheHuns,onsome60marshy 7 Thiscontentisavailableonlineat.

PAGE 335

323 islands.Ref.222[296]RomecontinuedasapartoftheByzantineChristianEmpirealthoughitwasnolongerits chiefcity.TheremainderofItalywasapatchworkofindependentcitiesorduchies,suchastheDuchyofSpoletoand theDuchyofBenevento.Ref.137[188] TheGermanicandSlavicpeopleshadlittlediseaseandnosuperimposedimperialmacroparasitism 8 suchasthe Mediterraneanurbanpopulationsimposedonthepeasantriesthere,andsotheyhadtremendouspopulationgrowths, withtheSlavscolonizingtheBalkanpeninsula,aswehavenotedabove,andtheGermanictribesswarmingtothe RhineandnallyfarbeyondtoBritain.Ref.140[190] EveninthepreviouscenturytheFrankishkingsofGermanyhadtorewardtheirfollowersandthechurchbygranting awaytheirownlandandrevenues.Bythemiddleofthis7thcenturytwofamilieshademergedastheprincipalagents ofthekingsforthesetransactions.OneofthesewasfromAustrasia,thetraditionaleasternFrankishland,andthe otherwasfromNeustria,thenewlandsnorthoftheLoire.By687Pepin,ofHeerstalnearAachenoftheAustrasian family,hadwonout,thereafterdominatingtheFrankishkingdoms.Ref.8[14]Atthattimeseveralbasicor stemduchiesbecameprominent,includingBavarianamedfromtheBaiuoarilbranchoftheMarcomanni,Swabia borderingSwitzerland,Thuringia,Saxony,FranconiaandFrisia. BytheendofthecenturynortheasternGermanyhadquadrupleditspopulationoverthatofRomantimes,chieydue tothemoreabundantfoodsupplyavailablewiththeuseofthe"moldboard"plow,introducedbytheSlavs.Thisplow requiredeightoxentopullitbutitallowedthree-eldrotationofcropsandallowednotonlytheproductionofmore, butalsobetterfood,containingmoreaminoacidsandprotein,thusgivingthepeoplemoreenergyandgreaterstamina. Ref.211[284]SeealsoFRANCE,thischapter TheareanowknownasAustriawaspartlycontrolledbytheGermanduchiesandpartlybytheraidingAvars. ThiswasthehomelandoftheAvarswhoraidedinalldirectionsfromthisbase.Pleaseseethissectionintheprevious chapter. MoraviansgainedindependencebyholdingofftheAvarsandthentheywereabletostoptheFrankswhotriedtocome infromthewest.AfterthedeathoftheirKingSamo,however,thisrstattemptataSlavicstateincentralEurope collapsed.SamomayactuallyhavebeenaFrankbuthehadmanagedtounitetheCzechsandsomeoftheWends.The peopleofBohemiaalsorepudiatedAvarsuzertaintyandafterthattheAvarpowerdeclinedrapidly.Ref.136[187] ThiswassimplypartoftheFrankishkingdoms. BetweenA.D.612and621,Sisebut,awelleducatedVisigothmonarch,reconqueredmostofthepeninsulafrom theRomansandhissuccessor,Swintilla,completedthejob.Evenso,theVisigothsbecame"Romanized"bylegal 8 McNeill'sterminology

PAGE 336

324 CHAPTER21.A.D.601TO700 unicationthroughthe Liberjudiciorum ofReccesivinthafter649andthewarrioraristocracyoftheGothswasunited withtheplutocratic-bureaucraticaristocracyoftheRomanworld.Thecommonpeopleraisedsheep.Ref.211 [284]AlthoughtheVisigothshadnotusedslavesinanysignicantdegreepreviously,theytookovertheRoman customwithavengeanceandintheCodeofKingErwig-687therewere21provisionsgivingseverepenalties forharboringfugitiveslaves.Ref.249[98] AtthebeginningofthecenturytherewereactuallythreeseparateFrankkingdoms:aAustrasiawithacapitalatMetz, lyingtotheeast,actuallyinGermanyandhavingchieyTeutonicblood 9 ;NeustriawithacapitalasSoissonsand Gallo-Romanblood;andcBurgundy.ThelatterwasunitedwithAustrasiabyKingClotaire11in613,leavingonly two.PartlybecauseoftheFrankishcustomofrulersdividingtheirkingdomsamongallsons,theMerovingiandynasty crumbledwithaseriesofveryweakrulersandtheministers,ormajordomos,begantobetheactualadministration headsofthegovernment.Thusin639Pepin,asmayorofAustrasia,startedthereorganizationoftheFrankishstate.He andhisimmediatedescendantsgavemuchoftheoldnobles'westernlandtotheirownfollowersfromtheRhineland, sothat,ineffect,FrancewassubjectedtoanewGermanicinvasion.AdditionalNotesp.326 Intheearlycentury,theBritonsofStrathclyde,WalesandCornwallwereallseparatedbytheAnglo-Saxonkingdoms. Ref.136[187]ThiswasaperiodofadjustmentundertheAnglesandtheSaxons,thelatterbeingthemostcruelof theGermanictribes. TheyhadprobablyincorporatedtheJutesandAnglesbeforethegeneralexodusfromSchleswig-Holstein.TheCeltic Britonscontinuedresistanceontheperiphery. In655theNorthumbriansregainedleadershipoverMercia,whichhadbeenthechiefpowerfrom642on,andthen theNorthumbriansreducedtheBritonsthenallwerecalled"Welsh"inStrathclydetobondageaswellasthePicts andScots.Thebondwasshortlivedthoughasthelatterquicklybrokelooseandby679Northumbriawasagain subservienttoMercia.Ref.137[188]AugustinebecametherstArchbishopofCanterburyinA.D.601andhis earlyachievementsweregreat.Afterthenoveltyofthenewreligionhadwornoff,however,manyEnglishleaders returnedtotheiroldwayssothatby616eventhechurchinKentwasindangerofextinction.Ref.43[64] PapalChristianityspreadintonorthEnglandthroughtheincreasingpowerofEdwin,KingofEastAnglia.In664, afteraconferenceofEnglishpapalandBritonCelticbishopsattheSynodofWhitby,mostoftheislandbecame RomanizedChristianbutIrelandremainedaloof.TwoconferencesoftheRomanSt.AugustineandhisSaxonconvert Christianswiththebishopsofthe"FarWesternChristianity"ofIreland,failed,andthetwocampsremainedenemies. AfterthatSynodasevereepidemicoccurred,thenatureofwhichisunknown.Ref.140[190]Bederecordedfour epidemicpestilencesinEnglandwithinthe20yearsfrom664to683. Ofincidentalinterestisthefactthattherewasnowheel-turnedpotteryAnglo-SaxoninEnglandbeforeA.D.675. Ref.18[31] TheScots,originallyfromIreland,aswehavepreviouslynoted,pushedtheirwayuptheGreatGlenandapproached IvernessbeforetheywerenallydefeatedbythePicts.InthesouththeAngleswerepushingnorthfromEnglandwith bothcavalryandinfantrybutthePicts,underBridei,weretemporarilyunitedandabletodrivethembackinthebattle ofNechtansmerein685.Ref.170[234],222[296] 9 ThisterminologyisToynbee's.Ref.220[294]

PAGE 337

325 AtthistimetheIrishweremateriallyandpoliticallymorebackwardthantheEnglishbutinaspecialculturalway theywerethemostadvancedofallpeoplesnorthofthePyreneesandtheAlps.BothGallicandBritishscholarscame toIrelandtoescapetheGermanicinvasions.IrelandwasneverinvadedbythesetribesandwasneverRomanized. ItsChristianitywasaseparatebrandwhichwasmentionedaboveasthe FarWesternChristianity andwhich maintainedanindependentexistenceanddevelopmentformanyhundredsofyears,reachingitsapogeeinthe6thand 7thcenturies. AsinEnglandtheyellowplaguehitIrelandin664.AlthoughwementionedIrishexplorationoftheFaroeIslandsin apreviouschapter,someauthoritiesbelievethattheydidnotdiscovertheseislandsuntilabout690. ThisremainedasawesternCelticfringe. AdditionalNotesp.326 AnexcavationatKvalksund,Norway,showsthatbyaboutA.D.600sizablesailingshipswerebeingbuilt.These wereshallow-draftvesselswithplankeddecksbutnokeels.Thus,newmobilityonthesea,coincidingwithincreased hungerathome,ledtotheVikingraidssometwocenturieslater.Ref.160[219] ThiswasanageofgoldcalledtheVendelPeriod,inSweden.TheSwedeswerebeginningtopushnorthandwestto thenorthwestcoastofNorway. TheDanessea-faringwassteadilyincreasingandtheywerealreadyoccasionallyraidingthecoastsofFrance. ThiscountrywasverysparselyoccupiedbyLappswhoseearlyhistoryremainssomethingofamystery.Speakinga Finno-Ugrictongue,traditionallyithasbeenconsideredthattheyoriginatedincentralAsiabutrecentgeneticstudies indicatethattheyaretruenativeEuropeans. ThomasRef.213[288]saysthattheonecontributionmadebySlavstohumanimprovementwasthere-introduction oftheheavyplow,whichwasavariationofoneusedinnorthernItalyinthe1stcenturyC.E.Ithadaknife-likeiron bladeinfrontwhichslashedverticallyintotheground,aplowsharewhichcuthorizontallythroughthegroundanda mold-boardwhichturnedthesoilovertooneside.WehaveremarkedearlierthattheGermanputthistoverygood useinthiscentury.CloselyrelatedtotheSlavsweretheLithuanians,whotogetherwiththeLettsandtheancient Prussians,formedtheBalticbranchoftheIndo-Europeanfamily.TheylivedbetweenthepresentdayMemeland Estonia. PolandhadSlavicpeopledividedintomanytribeswithnounicationororganizationatthisperiod.

PAGE 338

326 CHAPTER21.A.D.601TO700 PartoffareasternRussiawascontrolledbythegreatTurkishConfederacywhichsimultaneouslydominatedallof centralAsiaupuntil630.TheKhazarKhanateinsouthernRussiaexpandedrapidly,defeatingtheirCaucasianneighbors,theAlansandtheBulgarsanditwassomeofthelatterwhoedtotheDanubenexttotheremainingAvars. SomewenttotheVolgawheretheyremainedunderKhazarsuzertainty.By650theKhazarKhanateextendedfrom theDniepertotheCaspianSea,withaverymoderncity,Itil,ascapitalonthenorthshoreoftheCaspian.Northward theyextendedalmosttotheheadwatersoftheVolga.TheirrulersacceptedtheJewishreligion,apparentlytoassert theirindependencefrombothMoslemsandChristians. JustnorthoftheBlackSea,theUtigurandKutrigurHunscoalescedandtookanewname-GreatBulgaria.Ref.136 [187]ElsewhereinwesternRussiatheSlavslivedmoreorlessfreelyandindependently.Intheveryfarnorththere werestillthescatteredFinnsand/orLapps.Ref.137[188]AdditionalNotesp.326 NOTE :Dorestad,IyinginaforkbetweentwobranchesoftheRhine,withgoodaccessbywateralsoto Meuse,wasestablishedbyFranksasatradecenterforcontactwithFrisians,ScandinaviaandEngland. Ref.301[258] NOTE :TheelaboratesailingshipscommonontheBalticbythe11thcenturymaywellhavebeenusedas earlyasthis7thcentury.TheshapeandconstructioncamefromalongBaltictradition,butthemastand sailsweretakenfromwesternEurope.Ref.301[258] NOTE :TheRussianarctichadattractedtradeprobablyeveninthisearlycentury.TheKamaRivervalley wasrichwithasettledpopulation,largegraveyardsandhillforts.SassanianandByzantinesilverhasbeen foundthere,apparentlyincidenttotrade.FromKama,thearcticvalleyofthePechorawasexploited.The Khazarscontrolledthesouthernpartofthattraderouteandgatheredtributefromalargeareanorthofthe BlackandCaspianseas.Allofthistradewasinterruptedinthemiddleofthecenturybytheexpansionof IslamanditsattempttoconquertheKhazars.Asaresult,ByzantineandSassaniancoinsdisappearedfrom theCaucasusby700.Ref.301[258] ForwardtoEurope:A.D.701to800Section22.4 21.5CentralandNorthernAsia:A.D.601to700 10 21.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:A.D.501to600Section20.5 TheGreatTurkishConfederationcontrolledmostofcentralAsiaandparticularlyTurkistan,atthebeginningofthe century.ChinesediplomacystartedtobreakupthisTurkishcontrolby630andthentheChinesemilitaryreconquered theTarimBasinin648andWestTurkistanin656atthepeakoftheirexpansionintoCentralAsia.Thebreak-upof theTurkishConfederationthusallowedtheMoslemstotaketheOxusregionjustafterthemiddleofthecenturywith verylittleresistance. TheChineseoftheT'angDynastyweresupportedbytheTurkicspeakingUigursalsoUighurs,whowerecalled "Yee-che"bytheChinese.ActuallytheTurksofMongoliahadmadetheChineseT'angruler,T'ai-tsung,theirGrand Khanin630'NeartheoasisofDunhuang,justwestoftheGreatWallofChinaandnowapartofChina,andnortheast oftheTarimBasin,liethecavesoftheThousandBuddhas,constructedchieyduringtheT'angDynastyA.D.618906.InsubsequentcenturiespilgrimsfromallovercentralAsiatraveledtovisitthislabyrinthofsculpturesand frescoespaintedbyBuddhistmonks. 10 Thiscontentisavailableonlineat.

PAGE 339

327 Ref.8[14],101[146],73[112] TibetwasuniedearlyinthecenturywhenrivalefdomsbegantobeconsolidatedbyKingSontsanGanboor Ganbu,whoincidentallymarriedtwoforeignqueens,onefromtheT'angDynastyofChinaandoneaprincessof Nepal.AnembassywassenttoChinain641.AlthoughtheTibetansbecameBuddhists,theymaintainedawar ethosandcontinuedatintervalstoghttheChineseoveraperiodoftwocenturies.Xenophobicpoliciesprohibiting foreigners,alongwiththeworld'shighestandmostdifcultterrain,wasthensufcienttokeepTibetisolatedfrom therestoftheworldforhundredsofyears.TheTibetansremainedindependentinessenceuntilthe20thcentury, eventhoughtheChinesehavelongclaimedsovereigntyevenbacktothis7thcentury.Tibetansretainedaseparate language,culture,borders,moneyandreligion.TheholiestshrinestillstandinginthecenterofLhasaistheJokhang, builtaroundA.D.650andservingastheBuddhist"Mecca"totheTibetanfaithful.Ref.272[292],228[304],182 [250] ForwardtoCentralandNorthernAsia:A.D.701to800Section22.5 21.6TheIndianSubcontinent:A.D.601to700 11 21.6.1THEINDIANSUBCONTINENT Harsha-VardhanaalsoSriHarsha,ascionoftheGuptaline,recapturedanduniednorthernIndiain606and,ruling fromKanauj,gavepeaceandsecuritytotheareafor42years.ArtsandlettersourishedandtheBuddhistreligion hadarevival.Athisdeath,however,chaosagainensuedandIndiahadher"DarkAges"forthenext1,000years.By themiddleofthecenturyaChinese"tourist"reportedthattherewere70kingdomsinthecountry.Thetwoprincipal dynastiesinwesternIndiaweretheMaitrakas,whocreatedaBuddhistscholasticcenter,andtheGurjara,ahordeof centralAsiatics,whohadsettledinthecentralRajputana. TheDeccan,ontheplateauinsouthernIndia,remainedindependentundertheCalukyasDynasty.Ref.19[32] Underoneoftheirmorefamouskings,Pulakeshin,thiscountrycontrolledandcommandedrespectfromagooddeal ofterritory,includingcentralIndia.ItwasthetimeofthefamousfrescoesofAjanta.AttheverysoutherntipofIndia thePandyasDynastyhadacapitalatMaduraiandthePallavasatKanchipuram.Thelattercontrolledtherichcoastal areaontheeast,whilesimilarlandonthewestcoastwascontrolledbytheCherasintheregionnowcalledKerala. Hinduismdevelopedtwosects-VaishnavismworshipofVishnuandShaivismworshipofShiva.Astheseincreased inpopularityBuddhismandJanismshrankinimportance.Thespeechofordinarypeopledivergedmoreandmore fromtheSanskritoftheintellectualandthepopulationofabout100,000,000remainedquiteconstant.Continueon page467 21.7TheFarEast:A.D.601to700 12 21.7.1THEFAREAST BacktoTheFarEast:A.D.501to600Section20.7,thenT'angDynasty TheSuiDynastyconsolidatedChinainpartthroughstatepatronageofastyleofBuddhismwhichwasacceptableby bothnorthandsouthandbyconstructionofacanalsystemlinkingtheYangztewiththeYellowRiverinthePeking region.Theydidnotdowellinforeignaffairs,however,astheyhadlosttheTarimBasin,ManchuriaandKoreaand severalearlywarstoreclaimtheselandshadfailed.SomehistorianshaveevenconsideredtherstSuiemperorofthis century,Yang-ti,acompletemadmanwhohadsupposedlypoisonedhisfathertogetthethrone.Ref.101[146] 11 Thiscontentisavailableonlineat. 12 Thiscontentisavailableonlineat.

PAGE 340

328 CHAPTER21.A.D.601TO700 CivilwarsoondevelopedandvictoriouswasthefamilyofLi,whoestablishedtheT'angDynasty.InA.D.610we ndtheearliestdescriptionofbubonicplague,whichsoonbecamecommoninCantononthesea.Perhapsthisplague wasafactorinthedemiseoftheSuiDynasty.Ref.8[14],211[284] ForashortwhilethewarlikeTurkishnomadsofthesteppesbecamealliesofthenewT'angDynastyandtheChinese evenadoptedTurkishfashions,developedTurkishChinesedictionariesandworeTurkishclothes.TheT'ang,likethe Suibeforethem,camefromamixedTurkish-Mongolian-Chinesearistocracy.Theirsecondruler,T'aiTsungAD. 627-650wasoneofthegreatestofChineseemperors.Allthearistocratsofthisperiodwereofthemixedbloodand characteristicallyhard-drinking,hard-riding,ghtingmenwhohuntedwithfalconsandwhosewomenplayedpolo. Wehavenotedthatintheprecedingcenturiesworkhadbeenstartedintheclearinganddrainingoftheluxuriant junglesoftheYangtzeValleysothatbythebeginningofthiscenturythisvalleynotonlysupportedalargepopulation butwascapableofproducinglargesurplusesoffood.TowidenthecanalbetweentheYangtzeandHuanyHoValley, about5,500,000workers,includingallcommonersbetween15and50yearsofageinsomeareas,wereconcentrated underthecontrolofsome50,000police.Theywereforcedlaborersbutnotslaves,inthetruesense.Asaresultof allthistheT'angshadadoublebase,theYellowandtheYangtzerivers,andby611theGrandCanaljoiningthetwo hadbeencompletedsothatshipmentsoflargequantitiesofriceandothergoodswaspossiblefromthesouthtothe northerncapitals.Theimperialbureaucracymanagedthecollection,transportanddistributionofsuchgoods,while theGreatWallinthenorthwasre-constructedfordefense.Thesefactorsofabiologicalmix,athrivingeconomy andthespiritualstimulationofBuddhism,withageniusruler,startedChinaonitsgreatestage.T'aiTsung,after reunifyingmuchofChinabywar,returnedtohiscapital,Ch'ang-an,andgavehimselftothewaysofpeace,spreading thephilosophyofConfucius,revisingpenallawsandbeautifyingthecity.Hewelcomedallreligionsandexempted alltemplesfromtaxation.Afterhisdeath,oneofhisharemwomen,Wu,pulledoutofanunnerybyT'aiTsung's oldestson,Lao-tsung,poisonedherwaytopower,madeherselfempressandproclaimedtheChouDynasty.Actually asubsidiaryoftheT'angthisdynastyusheredinanothercreativeage,withtheprotsofexportedrice,wheat,silkand spicesspentforunparalleledluxury.Furs,preciousjewels,statues,paintings,poemsandmoneywereeverywherein abundance.Ref.211[284],101[146],213[288],139[192] The fu-ping systemofmilitaryconscription,startedbytheWeiDynastyseepage423,evolvedtotheT'angsystem ofelite,careersoldierswhoalsoperformedagriculturalworktosupportthemselves,asfaraspossible.TheT'anghad morethan600garrisonsclusteredprimarilyaroundCh'ang-an.Theirstatuarypunishmentscameundervecategories: deathbystrangulationorbisection;exilefromhomeupto1,000Englishmiles;hardlaborforupto3years;beating withheavybamboorodsupto100blows.Commutationtoneswasoftenpossibleforpeopleofwealth.Ref.125 [173],101[146] Intheperiodoftheirforeignexcursionsinthe660sChinesearmiesintervenedinIndiaandCentralAsia,re-occupying theTarimBasin,DzungariaandAfghanistanandtheybrieysatupprotectoratesinTukharistan,Sogdiana,Ferghana andeveneasternPersia.YunnancameunderChinesesuzertaintyattheendofthecenturyandaportionofManchuria, previouslyunderKoreancontrol,wasreturnedtoChinaasEmpressWuintervenedinaKoreancivilwar.Afterthree centuriesofimportancetheuseofthearmored,greatPersianhorsesincavalryunitscametoanendinChina.Ifa cross-bowmancouldknockevenaheavilyarmoredmanoffhishorse,itmadenosensetohavetheseexpensiveunits. Ref.101[146],279[191] SunSzu-miaowrotea30volumesummaryofmedicalknowledgegaineduptothattimeandthenheadedacommittee whichproduceda50volumetreatiseonpathology.Itwasinthiscenturythatexaminationswererstrequiredto qualifyasaphysician,aprocessthatprecededtherstlicensingprogramintheWestbysome4centuries.Itwasabout thistimethatwomenofproperfamilystartedtobindtheirfeeti.e.themothersboundtheinfants'feetproducinga severelydeformed,cavusfoot.Thisgreatlyrestrictedtheiractivitiesandallowedtheirlegsandmonstoaccumulate muchfat,thussupposedlymakingthemveryattractivesexuallytotheChinesemen.Thecustomwascontinuedfora thousandyears.

PAGE 341

329 Asthecenturyopened,thechildprodigy,PrinceShotokuTaishi,hadformedgroupsofscholarswhowrotetherst histories,geographies,grammarsandlegalcodesofJapanandwhodrewuporderlyplansforacensus,landsurveys, equitableconscriptionandtaxation.HealsoworkedoutacompromisebetweenBuddhismandShintoismthatcould betolerated.Athisdeathin621,theShintoprincesandtheBuddhistprincesoftheimperialfamilyactuallycameto asmallwar,withtheNakatomifamilyeventuallywinningpowertoputCrownPrinceTenjionthethrone.Hecarried outShotoku'sideaswhichwereknownasthegreat"TaikaReforms".Ref.12[21] Despitethesecivilizingfactors,withinagenerationofPrinceTaishi'sdeathaviolentcrisisappearedwhichincluded aterriblefaminewiththousandsdying.Alongwiththisdevelopedastrangenewreligioncalled"Tokoyonomushi" inwhichdevoteesworshipedalargeworm,dranksakeanddancedinthestreets,givingawaymoney.Ref.222 [296]Apalacerevolutionproducedsuchamarkedchangethatnativehistoriansrefertoitasthe"GreatReform"of 645.TheJapanesegovernmentwasreconstructedintoanautocratic,imperialpower.Thesovereignwaselevatedfrom theleadershipoftheprincipalclantoparamountauthorityovereveryofcialinJapan,thuscreatingaclosely-knit monarchicalstate.Theemperorswereallowedasmanywivesorconsortsasdesiredandtheheirtothethronewas pickedfromanyofhisoff-spring.TheearlyemperorsweredevoutBuddhistsbutShintoismwasnevercompletely abandoned.JapanthenhadanembassyinChinaandChinesecivilizationcontinuedtobeimportedviaJapanese students,monksandphysiciansstudyinginChina.Ref.125[173] In670whentheoldNakatomireformerwhohadputTenjionthethronewasdying,theemperorsentapregnant concubineofhistocomforttheoldman.WhentheboychildwasborntheemperorgavehimthenameFujiwara,and itwasthisboy'sdescendants,theFujiwaraclan,whichtooktheplaceoftheNakotomisastheemperor'smostintimate counselorsforthenext1,275years. ChinatriedtoconquerKoreaagainin612andfailedbutdidessentiallyaccomplishthisin668astheChouEmpress WuintervenedinaKoreancivilwarandhelpedSillatoforgeaunitedKoreawhileholdingafewareasunderChinese suzertainty.AsKoguryowasdestroyedChinaalsoregainedsomeManchurianterritoryformerlydominatedbythese Koreans.WithintwoyearsSillahadpushedtheChineseoutofPaekcheandstartedtheperiodwhichwastheacmeof Sillapowerandculture.Buddhismanditsartourished,particularlyatthecapitalnearthemodernKyongju.Skilled metalworkwasoneofthespecialaccomplishments.AdditionalNotesp.329 ItisasdifculttorecordandexplainthehistoryofsoutheastAsiaasitistheBalkanpeninsulaofEurope,inthatinboth thenamesandbordersofmanysmallcountrieshavechangedalmostasrapidlyastheyears.Inthis7thcenturythere wasaCambodiawheresmallHindutempleswerebeingbuiltatAngkorBorei.ASanskritinscriptioninCambodiaof A.D.604showsadecimalposition,suggestinganadvancedknowledgeofmathematics.TheFunanEmpirecontinued undercontrolofChenlaandinPyunowBurmaaBuddhistcapitalofSrikshetranowHinawzawasfoundedsome 200milesnorthofpresentRangoon,in638.InThailandtheearliestkingdomwasofaMonpeoplefromlowerBurma, whosettledinthevalleyofRiverMenanandestablishedacapitalatDvaravati,fromwhichcomesthenameoftheir kingdomandtheirart.UnderIsaravarman-635theKhmersextendedwestwardanddevelopedgreatartisticand hydraulicengineeringprojects.Ref.8[14],175[241],19[32],45[66] IntheIndonesianarchipelago,theEmpireofSrivijaya,basedinSumatra,dominatedthestraitsofSundaandMalacca andtaxedthecommerceinthosewatersforthenextsixcenturies.Palembang,insoutheastSumatra,besidesbeingthe capitalofthatmaritimeempire,wasacenterofSanskritCulture.Ref.8[14] NOTE :ItwasinA.D.688thatSillaabsorbedPaekcheandKoguryo.Theircapitalcityhad178,936householdswith1,000,000peopleandwasoneoftheworld'sgreatestcitiesofthetime.Buildingswereroofed withtileandheatedbycharcoal.Theburialburrowsofthatperiodaregreatarcheologytreasures.Ref.305 [103]

PAGE 342

330 CHAPTER21.A.D.601TO700 ForwardtoTheFarEast:A.D.701to800Section22.7 ChooseDifferentRegion 1.IntrotoEraSection21.1 2.AfricaSection21.2 3.AmericaSection21.9 4.CentralandNorthernAsiaSection21.5 5.EuropeSection21.4 6.TheIndianSubcontinentSection21.6 7.TheNearEastSection21.3 8.PacicSection21.8 21.8ThePacic:A.D.601to700 13 21.8.1THEPACIFIC BacktoThePacic:A.D.501to600Section20.8 EasterIslandcraftsmenbeganbuildingaltarswellbefore690andthereissomeevidencethatprototypic,naturalistic statuesmayhavebeenplacedonthematthattime.AlthoughtruePolynesiansmaywellhavebeeninHawaiiand possiblytheMarquesasinthiscentury,theyhadnotyetmigratedasfarsouthasEasterIslandandNewZealand.Ref. 176[242] ForwardtoThePacic:A.D.701to800Section22.8 ChooseDifferentRegion 1.IntrotoEraSection21.1 2.AfricaSection21.2 3.AmericaSection21.9 4.CentralandNorthernAsiaSection21.5 5.EuropeSection21.4 6.TheFarEastSection21.7 7.TheIndianSubcontinentSection21.6 8.TheNearEastSection21.3 21.9America:A.D.601to700 14 21.9.1AMERICA BacktoAmerica:A.D.501to600Section20.9 SeepreviousSection20.9and9thcenturiesSection23.9 13 Thiscontentisavailableonlineat. 14 Thiscontentisavailableonlineat.

PAGE 343

331 By600A.D.theculturalprimacyinNorthAmericahadpassedfromtheHopewellareatothelowerMississippivalley, particularlyinthefertileoodplainbetweenSt.LouisandNewOrleans,thelandoftheMoundBuilders.Ref.215 [290]. InthesouthwesttheAnasaziIndianscontinuedtomultiply,withBasket-makersitesextendingfromtheregionof presentdayLakeMeadinNevada,throughsouthernUtahintothesouthwestcornerofColoradoandthendownto northwesternNewMexicoandnortheasternArizona.Bybotharcheomagnetismdatingofcharredwoodbeamsof burnedpit-houseceilingsandtree-ringdating,theirsocietycanbefollowedinthislargeareaquiteexactly.Ref.277 [37]TheHohokamColonialPeriodandtheMogollonCulturescontinuedsouthoftheAnasazi. AboutA.D.600adistinctivegroupofIndiansappearednearthelowerendoftheColoradoRiversouthwestern ArizonaandanextremeeasternsliceofCalifornia.ThesewerecalledthePatayanalsoHakatayaandwereYumanspeakingpeoplewhousedtheoodplainsoftheColoradodeltaforfarming,hadauniquepaddleandanvilpottery decoratedwithredpaintandgroundtheircornonatrough-shapedmetate.Livinginthisareafor900years,they becamethenthemodernYumas,Cocopah,Maricopa,Havasupai,MojaveandWalapai.Ref.45[66],210[283] Consistentwithhisotherclaims,FellRef.66[97]purportstoreadIslamicinscriptionsoncertainNevadarocks andfeelsthatArabicLibyansmadetheseshortlyafterA.D.650whenIslamcameintoNorthAfrica.,CENTRALAMERICA,ANDTHECARIBBEAN ByA.D.600TeotihuacninMexicohadapopulationofperhaps150,000to200,000andcoveredabout8square miles.Thecitywaslaidoutinaprecisegridpatternwithlargecitybuildingsandapartmentsforfamilies,offering amaximumofprivacyinacrowdedcity.Therestillisconsiderableconfusionastothepeoplewholivedinthis community. Asmentionedinapreviouschapter,oldIndianlegendcalledthesepeople"Toltecs"andthismaybeaccurate,even thoughcurrentusagereservesthistermforthelaterrejuvenatedcivilizationcenteredatTulainthe9thand10th centuries.Byatleast650,Teotihuacnwasbeginningtoshowsignsofimpendingcollapseandthereasonforthisis anotherthingthathasnotbeenclaried.Ref.45[66],215[290],176[242] ThelowlandMayamadeastrongcomebackinthiscentury,withseveralcentersourishing.Atleast45,000people livedatoraroundTikalanditssprawlingpyramids,templesandhousemoundscoveredsome38squaremilesinthe denserainforestofnorthernPeten. Themostelaboratestructurewastheso-callednorthernAcropolis,whichcovered2112acreswith100buildingsand atonetime16temples.AtthesametimetheYucatanMayaswerealsoactive.Ref.45[66],215[290]ThePeriod VCulturecontinuedinCostaRica,asnotedinthelastchapter. InPeruthebalanceofpowerafterA.D.600shiftedfromthecoasttothehighlandswherethecityofTiahuanacoand theHuarimilitarymachinedominatedthecentralAndesbycarvingoutempiresthatincludednotonlyallofPeruand Bolivia,butalsopartofnorthernChile.TherewerestillcoastalpeopleoftheNazcaCulture,however,andastudyof theskeletonofan8yearoldboyfromaroundA.D.700inthisareashowedclassicalPott'sdiseasetuberculosisofthe spinewithapsoasabscess,renaldisease,pericarditisandterminalmiliarytuberculosisofhislungs.Inthenorththere wasstillMocheinuence,perhapsmanifestedatthattimeintheChimuSociety,althoughdatinghasbeendifcult. Ref.8[14],3[4] ForwardtoAmerica:A.D.701to800Section22.9 ChooseDifferentRegion 1.IntrotoEraSection21.1

PAGE 344

332 CHAPTER21.A.D.601TO700 2.AfricaSection21.2 3.CentralandNorthernAsiaSection21.5 4.EuropeSection21.4 5.TheFarEastSection21.7 6.TheIndianSubcontinentSection21.6 7.TheNearEastSection21.3 8.PacicSection21.8

PAGE 345

Chapter22 A.D.701to800 22.1A.D.701to800 1 22.1.1A.D.701TO800 BackwardtoA.D.601to700Section21.1 ThiswasacenturyofcontinuedArabMoslemexpansionfromsouthernSpainacrossnorthAfricathroughtheentire MiddleEastandintoCentralAsiaandIndia.NosignicantchallengeappearedfromChristianEuropewhichwas onlybeginningtobeorganizedintorecognizablestatesandwhichwashavinginternalreligiousproblemsofitsown. After338easternbishopsagreedthatallvisiblesymbolsofChristwereblasphemous,EmperorLeoIIILeothe SyrianlaiddowntheIconoclasticpolicyinA.D.754ofnoimageryorstatuaryinthechurch,indirectoppositionto theItalian,RomanChurch'sconcepts.TheresultingcontroversyinvolvedtheentireCatholicworldandstartedthe schismbetweentheeasternandwesternchurcheswhichthenbecametheOrthodoxandtheRomanCatholicchurch, respectively.ToynbeeRef.220[294]believesthatthisisthebirthoftwonewsocieties,originatingasoff-springof theoldHellenicSociety.MeanwhilethepapacyinRometieditsambitionstothenewrealmofCharlemagne,whowas creatingaghostoftheoldRomanEmpireandinA.D.800PopeLeoIII 2 crownedCharlemagneastheHolyRoman Emperor.BeforethistheinvasionoftheLombardsintoItalyandtheinterferenceofPepininItalianaffairsmarkedthe rststepsinlimitingthepoliticalpowerofthepapacy.Ref.184[252]After750Christendomenjoyedarespite fromforeignattackandinvasion. TheMoslemboundaries,extendingfromSpaintoIndiawerefartherthantheyeverwouldbeagain.Thesplitting ofvariousfactions,whichhadbeguneveninthelastcentury,continuedinthisone.Therewasreligiousdissension againsttheOmayyadsandinA.D.744adisputedsuccessiontothethronestartedadecadeofrevolutionandcivil strife.ByA.D.750HarunalRashidemergedasCaliphofanewAbbasidDynasty.Ref.8[14] YehudaiGaonoutlawedanydeviationfromBabylonianreligioususageandraisedtheBabylonianTalmudtoquasiscripturalstatus,leavingpermanenteffectsonallJewishculture. 1 Thiscontentisavailableonlineat. 2 NottobeconfusedwithEmperorLeoIIIwhowasinElyzantium 333

PAGE 346

334 CHAPTER22.A.D.701TO800 ForwardtoA.D.801to900Section23.1 ChooseDifferentRegion 1.AfricaSection22.2 2.AmericaSection22.9 3.CentralandNorthernAsiaSection22.5 4.EuropeSection22.4 5.TheFarEastSection22.7 6.TheIndianSubcontinentSection22.6 7.TheNearEastSection22.3 8.PacicSection22.8 22.2Africa:A.D.701to800 3 22.2.1AFRICA BacktoAfrica:A.D.601to700Section21.2 InthelastchapterwetoldofthecollapseofAxum.Apparentlyasalastgasp.theAxumitesmadeanunsuccessful attackonMeccainA.D.702whichwasfollowedbyArabretaliationandButzerRef.270[36]saysthatitwas atthattimethattheportofAduliswasdestroyedandmanyRedSeaislandsseized.AtthesametimetheChristian monarchyhadtowithstandravagingattacksbypaganBeja.Ref.83[123]After765Axumwasalmostcompletely abandoned. ThehornofAfricawasnotaffectedbytheBedouinArabs,butthepeopletherestillretainedclosetieswithArabia. OfthethreekingdomsofthemiddleNilewhichhadoriginatedinthe6thcentury,thetwonorthernonesnowmerged toformtheKingdomofNubia,withacapitalatDongola,exertingitsinuencefromthe1sttothe4thcataractofthe NileandwesttoDarfur.ThecountrywasChristian,prosperousandusedahighlydecorativepotteryanddevelopeda lucrativeslavetradetoEgypt.TherewasagradualpeacefulinltrationofMoslemArabsintothearea.Farthersouth attheconuenceoftheNilewastheKingdomofAlwa,withitscapitalatSoba.ItresistedtheMoslemfaithalittle longer.Ref.83[123],271[7] EgyptwasentirelyunderMoslemArabcontrolwithsupervisiondirectfromthecaliphinDamascusandlaterBaghdad. ThisentireregionwasnowunderMoslemcontrol,subjecttothecaliphintheMiddleEast.Asmentionedinthelast chapter,theBerbersofTunisiaandMoroccoadoptedIslamastheyhadpreviouslyadoptedChristianity:withneither wasitatotalembracementandthey,inaddition,clungalsotooldertribalbeliefs.Althoughcalled"Berbers"bythe Arabstheycalledthemselves"Imazighen","MenoftheLand",andtheirtongue,totallyunliketheofcialArabic,was Tamazight,stillspokentoday.Ref.104ThegreatRomanportsallovertheMediterraneanwereallowedtodecline. AlthoughtheycouldsailtheIndianOcean,theArabsignoredMediterraneanshippingroutesandwentoverlandwith ofcentralTunisia,wastheadministrativecenterfortheArabEmpireintheMaghrib.Ref.83[123] AlthoughtheOmayyadDynastycontrolledtheentireMoslemworldinthersthalfofthecentury,aswasintimated above,theAbbasidstookoverinA.D.750withCaliphHarunalRashidestablishingacapitalatBaghdad.ByA.D. 788MoroccohaddeclareditsindependencefromBaghdadandTunisiafollowedjustaftertheturnofthenewcentury. ThenewMorocconEmpirewastolastoveramillennium.Ref.8[14],222[296] 3 Thiscontentisavailableonlineat.

PAGE 347

335 AboutA.D.700peoplefromtheupperNilemovedintoChad,justeastofNigeria,andestablishedastringofcities. AtaboutthesametimetraderswerebecomingevermoredaringincrossingtheSaharatoobtaingoldandslaves.The increasinguseofcamelsgreatlyfacilitatedthistrafcandthetrafc,inturn,seemedtomonopolizethesupplyofgold andslavesandthusdevelopedmoresystematicandlargeroperations.Ghanaseemstohavecomeunderthecontrolof anewdynastyinthiscenturyandthismayhavebeenthetransferofauthorityfromBerbertoNegrorulers. MerchantsofsouthArabia,thePersianGulfandnorthwesternIndiahadlongtradedalongtheeastAfricancoastfor palmoil,ivory,tortoiseshell,rhinoceroshornandslaves.FinallysomeoftheAsianssettledineastAfricaandthey weresoonjoinedbyreligiousrefugeesfromOmanandShiraxonthePersianGulf.TheseAsianswereresponsible forthebeginningofachainofindependentsettlementsallalongthecoast.Theybecamecity-statesandbecauseArab shippingsoonsupplantedearliertrafc,allsoonbecameMoslem.ExcavationsontheshoreofLakeKisaleinnorthern KatangabetweenAngolaandtheGreatLakesindicatethatinthis8thcenturytherewasadensepopulationusing nepotteryandelaboratecopperjewelry.ThismaybetheoriginalhomeoftheLubapeopleRef.83[123] ThepopulationonMadagascarnowincludedIndonesians,ArabsandNegroes,thelaterprobablyoriginallyslavesor concubines.TheNegroesmultipliedmorerapidly,probablybecauseofgreaterresistancetomalaria,buttherewas muchintermarriageandsoonaunique"Malagasy"peopleemerged.Ref.83[123] ThecentralrainforestofAfricaandthesemi-aridsouthremaineduntouchedbycivilizedmen,althoughtheBantuspeakingtribesmencontinuedtospreadtheirsettlementsthroughtheforestoftheCongobasinandstillfarthersouth. TheLeopard'sKopjepeoplewerestillincontrolofZimbabwe.Ref.139[192],176[242] ForwardtoAfrica:A.D.801to900Section23.2 22.3TheNearEast:A.D.701to800 4 22.3.1THENEAREAST BacktoTheNearEast:A.D.601to700Section21.3 DuringtheirthreecenturiesofcontroltheArabsspreadcitrusfruitsandalmondsacrosstheMediterranean,evento Spain,andriceandsugarcanecuttingsfromPersiaandsaffrontothewest.Ref.211[284]Inadditiontheyhad masteredtechniquesofspinningandweavingsilkandtheytransmittedseri-culturetothewestviaSicilyandSpain. Europe,however,wasslowtoacceptsilk.Ref.122[170]AboutA.D.750theArabsbroughtthedecimalsystem fromIndia,butitwasnotusedinEuropeforanother500years.Ref.21[34] ThisentireNEAREAST,includingourfourdesignatedterritoriesofARABIAANDJORDAN,MEDITERRANEAN COASTAREAS,IRAQANDSYRIAandIRAN,werenowalljoinedasthecentralareaofthegiantArabianMoslem Empire.AsaresultofmilitarymaneuversthefarmlandsofPalestinewerelaidwaste,nottobeentirelyreclaimed for12centuries.Ref.222[296]AstheMoslemarmieswentthroughSpainandintoFrancetobestoppednally atToursin732,somedissensionappearedathomeandbyA.D.749therewasopenrebellionandamassacreofthe Omayyadfamilyattheircapital,Damascus. TheOmayyadcaliphshadforgottentheirdesertoriginsandhaddegenerated.CaliphalWalidII,whodelightedin swimminganddrinkinginapoolofwine,waskilledinaYemeniterevoltin744.ThelastoftheOmayyadswas MarwanII,defeatedandkilledintheBattleoftheZab,associatedwiththegeneralmassacreofthefamily.The caliphatethenbecamehereditaryintheAbbasidfamily,beginningwithHarunalRashid,whochangedthecapital fromDamascustothenewlybuiltcityofBaghdadin763.TheAbbasidsstayedorthodoxSunni,inspiteofsupport theyhadhadfromShi'iteswhilecomingintopower.Baghdadwasacircularcity1.5milesindiameter,ringedby threelinesofwallsanditsconstructioninvolved100,000laborers.Ref.118[95],137[188],222[296] 4 Thiscontentisavailableonlineat.

PAGE 348

336 CHAPTER22.A.D.701TO800 HarunalRashidwasagreatgeneral,administratorandjudge,whoinitiatedmanychangesincludingtheabolition ofalldistinctionsbetweenArabandnon-ArabMoslems.Hisadministrationsupportedanyactivitythatwouldbind minoritygroupstightertothecentralauthority.ThemainmilitarysupportcamefromPersianconvertsofeasternIran andtheyout-foughttheArabgarrisonsofIraqandSyria.TheAbbasidscompletedtheprocessofPersianizingthe institutionofthecaliphate.Persianswhoservedunderthecaliphincreasinglylledthehighofcesofstateandthe entireadministrationwasreorganizedonPersianlines,withanefcientscalsystem,agoodpostalservicefromone endoftheempiretotheotherandtheestablishmentoftraderoutestoIndia,China,CeylonandtheMediterranean. TheIslamicworldwasunitedbyasinglereligion,singlelanguageandanearlyunitaryculture.Theadministration, cultureandgeographicallimitsintheNearEastwereaboutthesameastheoldAchaemenidEmpireofthe6thcentury B.C.PapermillswereoperatinginBaghdadandtheharem-eunuchsystemwasdevelopedalongwith purdah veiled women.ItshouldbenotedthatlargenumbersofeastAfricanNegroslaveswerepurchasedforagriculturalworkand theywereharshlytreated.Ref.49[73],220[294],213[288] Arabic,theyoungestSemitictongue,hadinthoseearlytimesahighlydevelopedoral,butvirtuallynowrittentradition. TherewasmuchpoetrydepictingthelifeoftheproudBedouin.InthenewIslamicEmpire,Arabicbecamethechief instrumentofeverydayspeechaswellasofculture,replacingAramaic,Coptic,GreekandLatin.Arabicalsohad enormousinuencesonotherMuslimlanguages,suchasPersianandTurkish.Ref.68[106] AsiaMinoristheoneportionofourchosenNEAREASTclassicationthatwasnotincludedintheparagraphsabove, astheChristianByzantineskeptatenuousholdonapartofthisregion,necessitatingaseparateconsideration. TheEmperorLeoIIIwhoannouncedtheIconoclasticpolicy,wasanIsaurian,therstorientalonthethrone. HecarvedoutabriefghostoftheoldByzantineEmpire,likeCharlemagne'sEmpireintheWest,turningtheEastern Churchintoasortofdepartmentofstate.ButthisByzantiumwasapeculiarpost-humousexistenceoftheantique civilizationanditwasalmostsealedofffromwesternEurope,partlybytheGreek456language,partlybyareligious differencebutchieybecauseitdidn'twanttogetinvolvedinthebloodyfeudsofthewesternbarbarians.Ithad itsowneasternbarbarianstodealwith.InConstantinopleandothercitiesaseriesofplaguesandearthquakeshad drasticallyreducedthepopulations.Bubonicplaguekilled200,000between732and736andthenafteraterrible earthquakein740therewerenotenoughlocalpeoplelefttorepairthedamage.IntermittentwarfarewiththeArabs addedtothedrainofmanpower.ThesecondgreatsiegeofConstantinoplebytheArabsoccurredin717-718with attacksbybothlandandsea.ThedefensesheldandConstantineVactuallytooktheoffensive,carryingthewarinto Syriain745anddestroyingagreatArabarmadaandreconqueringCyprusin746. AnothercampaignfollowedinArmeniaandtherewereninesuccessivecampaignsagainsttheBulgars,withultimate victory.Ref.222[296],119[166] Still,by771theByzantineEmpirehadshrunkdowntoprimarilythewestern2/3oftheAnatolianpeninsula,along withGreece,Sicily,afewislandsandanarrowcoastlinealongDalmatia.Intermittentbattlesalongwithpay-offsto theArabscontinuedthroughoutthecenturyandattheendtherewasmuchfamilystressintheemperor'shouse,with Irene,motherofConstantineVI,eventuallyhavinghersonkilledsothatshecouldreign,herself,asEmpress. TheByzantium-Moslemwarsandthecruelrepressionswhichfollowedeachconquestorrevolthadruinedanddecimatedthiscountry.UndertheAbbasidrulefromBaghdadthesituationbecameevenworseandthepopulationof Armeniawasreducedtopoverty. ForwardtoTheNearEast:A.D.801to900Section23.3 ChooseDifferentRegion

PAGE 349

337 1.IntrotoEraSection22.1 2.AfricaSection22.2 3.AmericaSection22.9 4.CentralandNorthernAsiaSection22.5 5.EuropeSection22.4 6.TheFarEastSection22.7 7.TheIndianSubcontinentSection22.6 8.PacicSection22.8 22.4Europe:A.D.701to800 5 22.4.1EUROPE BacktoEurope:A.D.601to700Section21.4 IntheseearlyMiddleAges,thedeadlyblackstemrustbegantoravagethewheatelds,producingfamineinvarious areasofsouthernEurope.Thediseasehadbeenbroughtin,unknowingly,withthebarberrybushbytheArabs.The barberrywasvaluedforthecurativepotionthestemandthebrilliantberries,edibleinapreserve.Ref.211[284] InthiscenturyCrete,previouslyunderByzantiumcontrol,alongwithmostoftheseislands,hadsomebasesestablished bythesea-goingVenetians.CypruswastakenbytheArabsandthenreconqueredbyByzantium.Ref.222[296] ForsomecenturiesnowthegreatclassicalandearlyChristiancentersofthelowerBalkans,-Athens,Corinth,Thebes, Salonicaandothers,hadlostallcontactwiththeworldofwhichtheyhadbeenanintegralpart.In726Greeksrevolted againsttheByzantineLeoIII,sendingaGreekeettowardConstantinoplebuttheyweredefeatedbytheimperial navyusinganincendiarymixturecalled"Greekre".Ref.222[296]AsthecenturyendedtheSlavswereonce againbeatingdownonthebordersofthiscountry. AsinthelastcenturytheBalkanswerelledwithSlavicpeoples,mixedhereandtherewithBulgarsandAvars.In thenewkingdomofSerbiatheSerbsacceptedtheGreekOrthodoxformofChristianitywhiletheCroatsadoptedthe Romanform.StressinevitablyfollowedsothatbytheendofthecenturytheCroatshadformedtheirownindependentkingdom.Ref.8[14]TheDanubeBulgarshadcontinuedtomovewestintotheBalkans,takinglandfrom Byzantium.Tervel,kingoftheBulgars,actuallyexactedtributefromEmperorJustinianII.HewasfollowedbyKing Sevar,thelastoftheDuloDynasty.Ref.206[83]PeriodsofwarandpeacebetweentheBulgarsandByzantium alternatedthroughoutthecentury. TheLombards,whonowllednorthernItaly,foughtbybowandarrowfromhorsebackandwereessentiallyawarrior people.Asapapalstateemergedwhereapopethoughnotanemperorstilllived,itwasthreatenedbytheLombards andthepopenallyrequestedtheFrankKingCharlemagnetoinvadethearea.AttheendofthecenturyCharlemagne compliedandLombardybecameaprovinceoftheFranks.InanattempttoregainprestigetomatchthatofByzantine, 5 Thiscontentisavailableonlineat.

PAGE 350

338 CHAPTER22.A.D.701TO800 PopeLeoIlleventuallyteamedupwiththeFrankkingtoextendtheChurch'sdomain,withtheresultthatthepope becamethespiritualrulerandCharlemagnethetemporalemperoroftheHolyRomanEmpire.Bythistime,Rome haddroppedinpopulationfromabout1,000,000inA.D.400tounder100,000,principallybecauseoffamineafterthe cessationofthegivingoffreebread.GraduallyacoalescenceoftheLombardsandtheRomanpeopledevelopedwith theresultthattherewasasubstantialLombardiccontributiontotheItalianlanguageandtotheartisticandliterary elds.TheLatinlanguagecontinuedtobeLatin,butfurtherandfurtherremovedfromtheclassicalstandards.Cases hadallbutdisappearedbythistimeandthelanguagehasbeencalledProto-Romance.Ref.137[188],213[288] NOTE:Map34:LombardKingdomBeforeItsConquestbyCharlemagnein774and Map35:ExpansionofthePapalStates756-817 MapstakenfromReference97 Naples,AmalandVenicecontinuedasindependentstateswithVeniceactuallyhelpingtheMoorsenslavesome Europeans.Ref.222[296]TherstEuropeanmedicalschoolwasfoundedinthiscenturyatSalerno,insouthern Italy.SardiniawasinvadedbyMoslemforcesin720andinthisandthenextcenturySicilywasexposedtosudden, devastatingraidsbyMoslemfree-booters.Ref.137[188],83[123] Theuseoftheheavyplowseepages439and443innorthernEuropeaccountedforanincreaseoffoodanda consequentincreaseinpopulation.AlthoughtherecontinuedtobeMerovingiankingsintheFrankishkingdomsof AustrasiaandNeustriaupuntil7529throughoutthiscenturytherealadministrationofwesternGermany,aswellas ofFrance,wasundercontroloftheHouseofPepin,latercalledtheCarolingianDynasty,alldescendedfromPepin ofLandenandArnulf,theBishopofMetz.AmongthesedescendantswasCharlesMartel,MayorofAustrasiaand Neustriafrom714to741SeeFRANCE,below,andPepinIII,theShort,MayorofNeustriaandkingoftheFranks from747to768.ItwasthisPepinwhorstrespondedtothepope'spleasforhelpagainsttheLombardsanddid managetoforcethemoutofPentapolisandRavenna.ThereaftertheCarolingiansmaintainedaprotectorateoverthe papacyinItaly.Ref.180[246],119[166] In768PepinIII'sson,CharlestheGreatInFrance-"Charlemagne"andinGermanymorecorrectly"Karlthe Great",becamekingofAustrasia,NeustriaandnorthernAquitaine,whilehisbrother,Carloman,ruledoversouthern Aquitaine,BurgundyandSeptimania.CharlesorKarlwasatypicalGerman,sixfeetinheight,asuperbswimmer andathlete.HemarriedaLombardiprincessbutsoonrepudiatedherandconqueredallofLombardItalyaswell asVenetia,Istria,DalmatiaandCorsica.TheBavarianduchyhadbegunaneastwardexpansionthatdroveawedge betweenthesouthernSlavsandthemainmassofSlavicpeopletothenorthby758,thusisolatingtheBalkangroups. KarlincorporatedBavariaintohiskingdomin778andinthenextyeartookCarinthiasouthernAustriaandVienna becameaCarolingian-Frankishborderfortress.SaxonyfelltoKarlin785andsoallGermany,Austria,Bohemiaand evenaportionofHungarycametobeapartofhisdomain.AsaresultthemorenorthernSlavswerepushedbackeast oftheElbeRiver,creating"NewGermany",adistinctionthathaspersistedinsomedegreetothisday.TheElbenow roughlycorrespondstotheborderbetweenpresentEastandWestGermany.ThehistoryoftheregionofBrandenburg laterPrussiabeginswhenKarltheGreatestablishedfortsalongtheElbetokeepouttheSlavs.Ref.180[246], 137[188] InHungaryKarl'stroopsreducedtheAvarstoamereremnant,astheywerecrushedbetweenthisFrankisharmy andaBulgarattackfromtheeastin796.SwitzerlandwasapartoftheoriginalpossessionoftheFrankishEmpire, includedintheregionsknownasBurgundyandAlamanniaanditwasadministeredprimarilyunderNeustria.Ref. 137[188] Charlemagne'sEmpirewasRomanChristianandGermanic,allinone.Economicallyandsociallyitneverattained tothatcohesionandunitythatcharacterizesathoroughlycivilizedstate.Beerhadbeenmadeanddrunkinlarge quantitiesintheGermanareasforseveralcenturiesanditwasconsumedthroughoutKarl'sterritoryandevenmade

PAGE 351

339 bymasterbrewersinhispalaces.Nohopswereused.ChristianizationofnorthernGermanywascompletedpartly bymissionariesandpartlybyforcedconversionbyFrankishoverlordsAfterCharlmagnewascrownedemperorby thepopeonChristmas,A.D.800,hisItalianaffairsoccupiedhimsocompletelythathelostcontrolofGermanyand theSlavsagainenteredfromtheeastinthenextcentury.TheWeserRiverrepresentedthefarthestlimitsoftheSlav expansionwestward.Ref.177[243],181[247]AdditionalNotesp.341 InA.D.709and710MoslemMoorsattackedtheSpanishcoastbutdidn'tland.AtaboutthesametimetheVisigoth nobleswerequarrelingoverthesuccessiontothedeadKingWittiza,nallyelectingayoungerson,Rodrigo.SupportersoftheeldestsonedtoMoroccotogetaid.Asaresult,amixedforceofArabsandBerbers,ledbythe BerberTariqfromMauretania,invadedSpainin711,quicklytakingthesouthernpart,helpedbothbyJewsandthe Visigothsupportersoftheeldestsonclaimanttothethrone.AnotherMoslemgeneral,Muza,landedatAlgecirasin 712,quicklytookSevilleandMeridoandthenheadednorth.ThesurgingMoslemswentontocrossthePyrenees andsweptintoFrancetobestoppednallyatTours,byCharlesMartel,in732.FallingbackintoSpain,theMoslems brokeuptheovergrownestatesoftheVisigothicnoblesanddevelopedanewsociety.TherulingAbbasidCaliphate wasneveracceptedinSpainandtheSpanishMoorsdeclaredindependencefromBaghdadin756,revivingabranchof theoldOmayyadfamilytoformtheOmayyadDynastyofCordobawhichlasteduntil1031.Nowesterncityequaled CordobainsizeorcultureandnogovernmentinthewestwasbetterthanthatofMoslemSpain.Ref.2[3],137 [188],8[14],196[269] TheunconqueredGoths,Suevi,ChristianizedBerbersofapreviousmigration,andtheIberianCeltswentintonorthwesternSpainandPortugal,wheretheGoth,Pelayo,becamekingofAsturiasandfoundedwhatwastobecomethe Spanishmonarchy.AfterPelayocameAlfonsoIandIIandduringthisperiodtheVisigothSpanishCatholicsnow broughtforthSpain'smostbrilliantandcharacteristiccreation,Mozarabicart,foundnowinliturgyremnantsonlyin ToledoandSalamancachapels.TheseCatholics,allowedtoworshipastheypleased,althoughmoreorlessconned toghettoswithintheMoslemstateandseparatedfromthemainEuropeantradition,developedboththeirownindividualbrandofCatholicismandart.Thelatterwasavividcombinationofremoteclassicism,Islamicminiaturesand theprimitiveidiomsofVisigothicfolk-art.ItisofinterestthatthisMuslimconquestofSpainalsoculminatedina GoldenAge"ofSpanishJewry'Ref.180[246],8[14] HishaI,emirfrom788to796,reversedthedoctrineoftoleranceandattackedtheChristians,althoughhepromoteda religiousandintellectualaristocracy.Thislattergroupwassuppressedwithcruelty;however,asHakamItookcontrol in796.Ref.196[269] ItisagainrecommendedthatthesectionsonGERMANYandFRANCEbestudiedtogetherinthisandadjacentcenturiessincebothwereadministeredmoreorlesstogetherundertheFranks.In732CharlesMartel,sonofadministrator PepinII,extendedhisfather'sconscationstoincludeallincomefromchurchlandsunderFrankishcontrolinorderto supportasubstantialforceofcataphractsarmoredknightswhichgavehimmilitarysupremacyintheentirearea.It washewhostoppedtheMoslemsatPoiters,nearToursin732,usingcavalryequippedwithstirrupssothattheycould ramhomelancesandusemacesandswordswhileremainingmounted.Withoutthisbattle,westerncivilizationmight neverhaveexisted.FollowingthatvictoryEuropehadtoincreaseitsnumbersofhorsesandhorsementocontinueto protectitselfand"feudalism"wastheresult.Ref.260[29],279[191] TheMerovingianDynastycametoaningloriousendandtheCarolingeanDynastybeganwithMartel'sson,Pepin ,whobegantodominateagreaterareaandpavedthewayforhisson,CharlesCharlemagne,thegreatestofthe medievalEuropeankings.Heallowedthepopetocrownhim"EmperoroftheRomans"in800A.D.Noeastern emperorhadvisitedRomeforsome300years.Ref.49[73],213[288]

PAGE 352

340 CHAPTER22.A.D.701TO800 InthefarnorthintheBelgium-Netherlandsarea,theFrisianswereontopcommercially,tradinginwine,salt,oil, glass,textilesandmetalwork.InthefarsouthofFranceafewByzantinegoodsdriftedinandinreturntheWestsent slaves,ironandtimbertotheEast.Ref.137[188],213[288]Continueonpages488and490AdditionalNotes p.342 ThescholarBedestatesthatvelanguageswerespokeninEnglandatthistime-English,Celtic,Irish,Pictand Latin.TheearlyEnglishwasthelanguageoftheAnglesanddifferedlittlefromSaxonandwasintelligibletothe Franks,NorwegiansandDanes,allofthesebeingvarietiesofbasicGerman.TheBeowulf,afamousAnglo-Saxon poem,appearedinEnglandinthiscentury.GraduallytheSaxonsdevelopedkings,asgloriedgenerals,whoprotected themselvesbygivinglandstobaronsandinthiswayalandaristocracysoondeveloped.Inthelasthalfofthecentury therewereceaselesswarsbetweensomesevenkingdoms,allnownominallyChristian.ButBede,writingtothe BishopofYork,Egbert,inA.D.734complainedthatsomebishopsweredrunkenrevelersandBonifacewroteinmuch thesameveintotheArchbishopofCanterbury,complainingofdrunkennessofbishopsandlooselivingofnuns.So Christianitywasnothavinganeasytime.Ref.43[64] Allofthis8thcenturyactivitywasfollowedinA.D.793bytherstgreatVikingsackingofthemonasticcenterat Lindisfarne,probablybyNorwegians.Anothergroup,probablyalsoNorwegian,hadcomedowntheEnglishchannel in789,landingatPortlandontheDorsetcoast.DanesfromJutlandalsostartedtheirraids.Thereisnodoubtthatall oftheseraiders,-Angles,JutesandthelaterDanesandNormansaswellastheNorth-menwhowentdownthrough Russia,andthestillearlierGoths,wereallwavesofoneandthesametypeofGermanicpeople.Ref.229[307] ButtoreturntoEngland,inspiteofalltheturmoil,therewassomeinternationaltradeandvisitationsinthiscentury. TherewereevenChineseinKingOffalI'sMerciacourtattheendofthecentury.Mercia,alongwithNorthumbria andWessex,werethelargestoftheEnglishkingdoms.Ref.8[14] Continueonpages490and492AdditionalNotesp.342 ThroughoutthelastcenturythePictshadfoughtagainsteachother,butafteralastintramuralbattlein729,Oengus becamekingofallPicts.HepromptlymadepeacewiththeAnglesandthenturnedtobattletheScots,capturing DunaddandDunolly,drowningoneDalriadickingandforcingotherstotaketothesea.Butwhenhewheeledsouth againagainstStrathclyde,hisarmywasannihilated,perhapsthroughsometreachery.Ref.170[234]Iona,the Scottishreligiousshrineisland,wasinvadedbytheNorsein794andwasburnedjustaftertheturnofthenextcentury. Ref.119[166] TheChristianworldofPatrick'sIrelandwasshatteredbyVikingsin795andraidedbythemforthenext200years.As aresultofthis,therearecurrentlygeneticsimilaritiesofpopulationsofScandinavia,ScotlandandNorthernIreland, eventhoughgeographicallyseparated.IrishmonkslandedinIcelandabout759,inhide-coveredcurraghs.Ref.143 [196],260[29]|SWEDEN|DENMARK OftheterritoryoftheGermanicpeoples,onlyScandinaviakeptoutofCharlemagne'sEmpire.InSweden,thetownof BirkabegantodominatetheareaofLakeMalar.Itwasaneconomicunitofconsiderableimportance.Evenabronze Buddhahasbeenfoundthere.JustwestofpresentdayStockholm,theislandofHelgowasthecenterofindustry, includingtheproductionofcheapjewelry,iron-working,etc.

PAGE 353

341 TherstDano-NorwegianraidtostrikerealterrorinEuropewastheattackonLindisfarne,Englandin789,wherea famousconventandseatoflearningwasattackedandtheinmateskilledortakenoffasslaves.Manyoftheraidsof theFrisianandEnglishcoastsoriginatedinthevigorouskingdomofJutelandinDenmark."Viking"probablymeans "menfromtheords",because"vik"means"alittleord"inbothDanishandNorwegian.Inadditiontoseatravel,the Scandinavianstravelledgreatdistancesbyland,asfromUppland,SwedentoTrondelag,Norway,byhorses,sledges andcarts.Therewasanox-roadfromnorthJutelandintoGermany.Inwintermenusedskatesandskiesandputspikes onhorses'hooves.Ref.117[164]AdditionalNotesp.342 InthiscenturytheFinns,comingfromthesouthandsouthwest,tookpresentdayFinlandatleastKareliafromthe Lapps,whorecedednorthward.AsnotedpreviouslytheFinnsspokeaFinno-Ugriclanguage,relatedtoLappand Livonian.Theirlanguage,althoughnottheirbloodtypes,suggestdistantrelationtotheHunsandtheMagyarswho camefromtheupperVolgaandOkarivers.Therewerethreebasictribes:theTavastians,whosettledinwestern Finland;theKarelians;andthetrueFinnswhohadoriginallysettledonthesouthshoreoftheGulfofFinland.They clearedtheforestanddrainedthemarshes,butthethreetribeswagedwaroneachother.Ref.61[90] RelatedtotheFinnsweretheBorussiansOldPrussians,EsthsEstonians,LivsLivonians,LitvaLithuaniansand LatvianswhosettledtheBalticareassouthoftheGulfofFinland.Allofthesepeopleremainedpaganforseveral centuries. ThroughoutthisandthenextcenturytheGoplaniandLendiziSlavictribescompetedforcontrolofthecentralareaof Poland,withtheGoplaniinitiallythemoresuccessful.RecentexcavationsatMietlicashowsunkenhouses,chieyof oneroom,rathertypicalofearlySlavicabodes.Fewhouseshadidentiablehearths,buttherewerehearthsandpits inthecentralareaofthetown,suggestingapracticeofcommunalcooking.Ref.244[177] Theword"Rus"mayhavederivedfromtheFinnish Ruotsi ,oldNorse rodr ,ormayberelatedtoRolageninUppland, Sweden.ThereweretwomajortraderoutesoftheVikingScandinaviansdownthroughRussia.Therstwentfrom theBalticdirectlyintoLakeNevoLadogthendowntheRiverVolkhovtothegreatLakeIlmen,toLovatandportage totheDnieper.Alongthisroute,greattownsofKiev,Smolensk,NovgorodandStarajawerefounded.Thesecondwas amoreeasterlyroute,alongtheVolgawheretherewerealreadytownsestablishedforthefurtradeandcontrolledby BulgarsandKhazarswhochargedatollontraders.FromthegreatbendoftheVolgatraderscouldstrikeoutacross thedeserttoreachtheSilkRoutesomewhereneartheAralSea.Ref.237[316] Itil,onthemouthoftheVolgaandcapitaloftheKhazars,becameoneofthegreatcommercialcitiesoftheworld.The ArabsraidedtheKhazarhomelandandputanendtothegreatnessofthisKhanate,astheVolgaBulgarstookadvantage toasserttheirindependenceinthenorthoftheareaandthesamewasprobablytrueoftheMagyars,aFinnishtribe thathadmigratedtothesteppenorthoftheBlackSeaandhadupuntilthenbeenunderKhazardomination.Their languagewasbasicallyFinnishwithaTurkishelementadded.Thesethreeorientalpowers-Khazars,Bulgarsand Magyars-remainedfriendly,withtheKhazarsstillsomewhatseniorintherelationships.Reducedinsize,theKhazar KhanatepersisteduntilaboutA.D.1,000anditspeopledidhelptore-routethelandtraderoutetotheFarEastnorth oftheCaspianasJustinianhadwantedtodo.Ref.137[188]ElsewhereinRussiabytheendofthecenturythere wasaSlavicSea,withSlavicpeoplesspillingoverintocentralEuropeandtheBalkans.AdditionalNotesp.342 NOTE :AsafewoftheveryearlyVikingraidsstartedtoseekvictimsoutsidetheBaltic,in800Charlemagne ordereddefensesconstructedonthenorthcoastofFrankia,asprotectionagainstpiratesintheGallicSea. Ref.301[258]

PAGE 354

342 CHAPTER22.A.D.701TO800 NOTE :DorestadtnowbecamethelargestandmostactivetradingcenterinnorthwestEurope,withtrade chieyinthehandsofFrisians.Ref.301[258] NOTE :Acharterof729showsthatKingOffawasorganizingdefensesagainstpaganseamenearlyinthe century.TheLindisfarneattackiswelldocumentedbyletters,butthatwasnottherstplacetoberaidedin westernEurope,justoneofthemoreextensiveandnoteworthy.Ref.301[258] NOTE :InadditiontotheprevioustradeitemsfromScandinaviatherewasnowaddedwalrusivoryfrom northernNorway.Thereweresignicantincreasesinimportsofglassbowls,beakers,pottery,mill-stones andsilvercoinsfromwesternEuropethroughFrisiatoDenmarkandHelgoinLakeMalareninSweden. Boat-gravesinthelattercountrycontainsuchglassandcoins.InDenmarktherewasbuilttheDanevirke, acomplexforticationoftimbersacrossthebaseofthepeninsula,perhapsbecauseofCharlesMartel's campaignagainsttheSaxonsin738.TheLimfjordwasopenatbothendsandthatwasthenormalroute fromtheNorthSeatotheBaltic.ThetraderoutefromDorestadtuptoLimfjordwaswellshelteredby islandsandfromtheeasternendoftheLimfjordthecoursewentdownthrougheithertheGreatorLittle Belt,wheretheexitwascommandedbytheislandofSamso.Thiswasbisectedbyacanal,eithertofacilitate tributeorprotection.Intheeast,CourlandwassubjecttotheSwedesandStarajaLadogawasestablishedin thelasthalfofthecenturyontherouteleadingtotherichfurareasofnorthRussia.TheDanesandSwedes foughteachotheralmostcontinuously.KingAnoundusofSweden,exiledinDenmark,got21shipsfrom theDanestoaddto11ofhisownandreturnedtoattackBirka.Insomewaythiswasdiverted,however,and heattackedtheSlavsinstead.Ref.301[258] NOTE :AboutA.D.770,aftertheUmayyadswereoverthrownbytheAbbasids,Persiancoinswereonce againincirculationthroughoutRussia.TheKhazarswereagainthechiefintermediaries.Ref.301[258] ForwardtoEurope:A.D.801to900Section23.4 22.5CentralandNorthernAsia:A.D.701to800 6 22.5.1CENTRALANDNORTHERNASIA BacktoCentralandNorthernAsia:A.D.601to700Section21.5 InthenorthernportionsofCentralAsia,fromtheAralSeaandtheSyrDaryaValleyeasttoManchuria,therulers weretheBlueorCelestialTurksSeepage421.TheyappeartohavedrivenotherTurkishtribeswestward,including theOgurandalsotheirformerrulers,theJuan-JuanofMongolia.InthemostnortheasternpartofMongoliathe Uigursseizedcontrolin744,establishingacapitalontheOrkhonRivernearthesiteoflaterKarakorum.Themost farungeastwardgroupofIndo-EuropeanEuropoidtribeswerethosewhoreachedChineseTurkistanandwere calledTocharians.Theirlanguagewaswrittendowninthiscentury.ThewesternregionofCentralAsia,Kashgar, wasovertakenbytheadvanceofIslamandduetotheenergyofthelocalemirgovernor,considerableadvancewas madeagainsttheTurks.TheArabscontrolledallofwesternTurkistanandAfghanistanandtheMoslemreligionhas persistedthereuntilthisday. TheArabswerehelpedindrivingtheChineseoutofwestTurkistanbytheKarlukTurks,whoattackedtheChinese fromtherear.ThisChinesearmywasnallycompletelydefeatedattheTalasRiverjustsouthandwestofLake BalkhashinA.D.751inoneofthosedecisivebattlesofhistory.ChinawasnottobeinuentialinCentralAsiaforsix centuriesandBuddhismgavewaytoIslam.Ofsomeimportance,too,isthefactthatsomeofthecapturedChinese soldiersbroughttheartofmakingpaperwiththemtotheWest.Ref.8[14],38[59],19[32],101[146] 6 Thiscontentisavailableonlineat.

PAGE 355

343 PadmaSambhava,anIndianguru,broughtBuddhismtoTibet,heretoforerifewithspirits,demigodsanddemons. CalledtothecountrybyKingTrisongDetsan,thegurubroughtwritingtothecountryandblendednativebeliefswith theHinduandBuddhistcultsofTantrism,sothatTibetwasunderIndianinuenceafterA.D.750.Ref.157[213] ForwardtoCentralandNorthernAsia:A.D.801to900Section23.5 22.6TheIndianSubcontinent:A.D.701to800 7 22.6.1THEINDIANSUBCONTINENT TheMoslemsbecameestablishedintheIndusValley,takingSindinA.D.711,andtheyalsotookoverthecentral AsianoasesnorthoftheHinduKush,whileMoslemshippingtookovercontroloftheIndianOcean,thusalmost isolatingHinduIndia.TheHimalayanborderlandsremainedbeyondMoslemreach.KashmirandBengalhadbecome powerfulstatessoonafterthe6thcenturyandcontinuedthroughouttheperiodunderreview.MagnicentBuddhist templeswereconstructedinKashmiratthistime.Ref.275[99]TherewerenopowersinthenorthofIndiaequalto thoseinthesouthbutbytheendofthiscenturytwonewdynasties,thePalasofBengalandthePratiharasofRajasthan beganastruggleforthecontrolofnorthernIndia.TheformerwereBuddhistswithstrongtiestoTibetandkepttheold religionaliveatatimewhenitwasdisappearingelsewhereinIndia.ItwasfromthisgroupthatTibetgottheirTantric formofBuddhisminthiscentury.TheGuijarasofwesternIndiaunitedwithPratiharaandtogethertheysucceededin keepingouttheMoslemsforanothertwocenturies. IntheDeccan,theRashtrakutasoverthrewtheChalukyasin753andbegana200yearrule.Theybuiltthegreatest oftheIndianrock-cuttemples.ThewarriorkingsofthePallavacontinuedtoruleapartoftheDeccan,however, astheyhadforalmost500yearsandintheirempireassembliesofvillageleaders,guildsandprofessionalgroups wereheldannually,makingauniqueformofdemocracy.Atthelastofthecentury,intheeast,theeasternChalukya DynastybegantoexertsomecontrolasaBuddhistclanwithuniqueBuddhistbronzes.Kalingawasruledbythe easternGangas.InsouthernIndia,there-wasconictbetweenJainsandtheadherentsofShivaismwhichsometimes ledtomassacres.Ref.137[188],8[14],68[106],213[288],19[32] ScienticactivitycontinuedinIndia,withadvancementparticularlyinmathematics-includingrulesforndingpermutationsandcombinations,thesquarerootoftwoandthesolvingofindeterminateequationsofseconddegree-all featuresunknowninEuropeuntilthetimeofEuler,1,000yearslater.Thestaplecropswerewheat,riceandsome millet.Exportswerecottontextilesandspices,whilethemostsoughtafterimportwasthehorse.Continueonpage 497 22.7TheFarEast:A.D.701to800 8 22.7.1THEFAREAST BacktoTheFarEast:A.D.601to700Section21.7'angDynasty AfterthedeathofEmpressWuthetrueT'angDynastyresumedcontrol.OfparticularnoteisMingHuangorHsuan Tsung-756,the"BrilliantEmperor"underwhomChinastoodintheveryforefrontofcivilization,themost powerful,enlightened,progressiveandbest-governedempireonearth.Bythemiddleofthis8thcenturytheimperial ofcersbeganexchangingexcessgrainforvariousluxurygoodsandtheeffectwastoexpandamarketforhighly skilledartisanwaressuchasnesilks,porcelains,lacquerworks,etc.Asubstantialenlargementofmerchantand artisanclassesensued,withanincreaseinurbangrowth.Sugarcane,nativetoBengal,wasimportedinChinaand 7 Thiscontentisavailableonlineat. 8 Thiscontentisavailableonlineat.

PAGE 356

344 CHAPTER22.A.D.701TO800 adapteditselfreadilyintheneighborhoodofCantonwhereawoodedhinterlandsuppliedthegreatamountoffuel necessaryforitsprocessing.Tea,knowninSzechwanforcenturies,nowspreadthroughoutthecountry.Ref.260 [29]FromtheHantotheT'angdynastiesChina'spopulationhadvariedgreatlybuthadnowbuiltbackuptoabout 50millionpeople,keptfrombeingstilllarger,atleastinpart,byinfanticide.Ref.46[76],101[146] Thearmywasprofessionalandlargelyrecruitedfromandcommandedby"barbarians".Inghtingwiththeexpanding ArabsinwestTurkistan,theArabswerehelpedbytheKarlukTurks,whoattackedtheChinesefromtherear.Inthe steppe,theUigurandGirghizTurkswerenowincontrolandthelastoftheTurkicpeoplestoresideinMongolia. InChina,proper,in754,75%ofthetotalpopulationlivednorthoftheYangtzeRiver.ThecityofCh'ang-anhad 2,000,000inhabitantswithhalfofthoselivingwithinthewalledinnercityof30squaremiles.Atotalof26citieshad registeredpopulationsofover500,000.Theoldestdatableprintedmaterialswereproducedin770when1,000,000 copiesofaBuddhistcharmwererunoffbycommissionfromaJapaneseempress.Ref.101[146],213[288] IthasbeensaidthatEmperorHsuan-tsunglivedtoolong,becausein745atage60hefellinlovewithoneofhissons' concubines,LadyYangYangKuei-fei,andsoonherfamilymonopolizedthemostpowerfulministerialposts.One ofthese,AnLu-Shan,anaudaciousTurk,hadtherunofthepalaceasLadyYang'sadoptedson.Soonthereafterwhen the"barbarians"ofAsiaagainboredownontheChineseborders,AnLu-Shan,thenageneral,roseinrebellionagainst theT'angforcesandtheyhadtoberecalledfromthefrontierstodefendtheemperor.Therebellionwascheckedin 763,buttheT'angDynastyhadbeenerodedandChinesepowerdidnotreturntocentralAsiaforsixcenturies.See alsoprevioussection,thischapter.Thistypeofrevoltbyaborder"guard"wasalwaysathreattotheChinesecentral authorityandexplains,inpart,theircontinualeffortstokeepthemilitaryundertightcontrol.Thesameparanoia determinedtheirpolicyofbreakingupundueconcentrationsofwealth.Noone-militarycommanderorrichtrader wasevertobeinapositiontochallengetheauthorityofthepoliticalruler.Ref.279[191]IntheAnLu-Shan revoltsome3,500,000losttheirlivesandthiswasfollowedin762byaplagueinShantungprovincewithmorethan one-halfofthepeopledying.Thediseaseriskinthesouthwasgreaterthantheriskofdeathonthenomadfrontier. Ref.101[146],140[190]InterventionoftheUighurTurksfromMongoliahelpedtosavetheT'angDynasty afterthetragedies,butthereaftertheT'angcourtwasessentiallyavassaloftheUighurkhan.Inthisperiodoftragedy fromrevoltanddisease,Chinesepoetsreachedgreatheights,withLiPobecomingthe"Keats"ofChina. InManchuria,theproto-Mongolianpeople,theKhitan,hadbeguntoraidtheChineseborderasearlyas695andthey continuedthroughoutthis8thcentury.AlittletotheireastweretheP'o-Hai,apowerfulkingdomsetontheChinese modelbutestablishedbytheremnantsoftheKoreanKoguryonobles.Theyremainedindependentfrom710onfor sometwocenturies.Ref.8[14] WehavepreviouslyindicatedthatforcenturiesithadbeenthecustomfortheJapaneseroyalfamilytochangeits capitaleachtimearulingemperordied.Theso-calledNaraperiodstartedwiththecapitalatthatcityin710,butthis metropoliswastoolargetobetorndownandmovedeachgenerationandthatpracticewasstopped,atleastuntilthe nalmovetoKyotoinA.D.794.BothNaraandKyotohadbeenconstructedusingBaghdadasamodel.Ref.8[14] AfterEmperorKammutransferredhiscapitaltoKyoto,Japaneseart,previouslyunderChineseinuences,developed itsownmaturestyleandtaste.Ref.19[32]AfterKammu'sdeaththeemperor'sroledeterioratedsomewhat. Throughoutthisperiod,underFujiwaraministers,courtlifehadbecomeagreatpageantofceremoniesandcostumes, andgraduallytheemperor'sperson,itself,becamesotabooandawe-inspiring,asarougedandgildeddoll,thathe begantobeveiledfromtheworldandtheFujiwarastookallresponsibilityfordecisions,goodorbad,shieldingthe throne.graduallycametobelieveinanemperorwhowasatthesametime"amortalgod,azeroinnity,animpotent omnipotence" 9 .NewcivilandpenalcodesandtheYoroLaws,whichwererevisionsoftheTaihoReforms,cameinto effectabout757andgraduallybecamemoreeffective. In752theGreatBuddhaatNara,a53footbronzegure,wasdedicatedasthecherishedprojectoftheShomas.Atthe endofthecentury,in790,Japanhadasustainedepidemicwithwomenunder30yearsandmalesofallagesaficted. 9 ThequotationisfromBergamini,Ref.12[21]

PAGE 357

345 Ref.140[190] MostofKoreawasnowunitedundertheSillaDynasty.Buddhismandartourished,particularlyatthecapitalonthe siteofmodernKyongju. TheT'ai,orShan,peopleshadbeeninltratingdownintothesoutheastAsianpeninsulaforseveralcenturiesandnow theyformedakingdominYunnanprovinceofChina. TheDvaravatikingdomofKhmerpeoplewasBuddhist,ratherthanBrahmaninreligion,andinthiscenturymigrants weresenttotheupperMenamValleywheretheyestablishedtheindependentKingdomofHaripunjaya,withacapital nearthepresentChiengmai.AllofthisoccurredinwhatisnowThailand.BurmawasunderIndianinuenceandhad HinducommercialsettlementsontheTenasserimcoastandattheprincipalrivermouths.InCambodiathewar-like courseoftheChenlaswasbroughttoanendwhenakingfromJavaenteredandbeheadedtheChenlaruler.Although theJavanesesoonwithdrew,thatkingdomdeclined.OntheAtlanticcoastwasChampa,understrongIndianinuence. Ref.119[166],37[58],8[14] ThroughouttherstmillenniumafterChrist,butparticularlyfromthe7thtothe16thcentury,Indiancultureand religiousinuencespreadthroughoutIndonesiaandinparticularitcreatedadistinctivecivilizationinJava.This society,controlledbytheBuddhistkingoftheSailendraDynasty,wassecondonlytotheKhmersinsoutheastAsia. Ref.18[31],19[32]Inthisandthenextcentury,ArabtradersbroughttheMoslemreligiontothePhilippines andthen,inturn,cametheIndians.Ref.153[210] ForwardtoTheFarEast:A.D.801to900Section23.7 ChooseDifferentRegion 1.IntrotoEraSection22.1 2.AfricaSection22.2 3.AmericaSection22.9 4.CentralandNorthernAsiaSection22.5 5.EuropeSection22.4 6.TheIndianSubcontinentSection22.6 7.TheNearEastSection22.3 8.PacicSection22.8 22.8ThePacic:A.D.701to800 10 22.8.1THEPACIFIC BacktoThePacic:A.D.601to700Section21.8 Atthistimeandinadjacentcenturies,thePacicOceanwitnessedoneofthemostremarkablehumandispersalsofall history.Remotecoralatollsandisolatedvolcaniccones,oftenseparatedbyhundredofmilesofopensea,becamesites ofhumanhabitation.ThisoccurredbyvirtueofthePolynesianseavoyagesoverlongdistanceswiththeirefcient outriggercanoes.MostofthemigrationsappeartohavetakenplacebetweenA.D.600and1,000.Wehavepreviously notedthatthespreadnowappearstohavetakenplacefromHawaiisouthward,ratherthanthereverse.EvenMcNeill Ref.139[192]notesthatoccasionalaccidentalcontactwiththeAmericasandtheAsianmainlandoccurred.The erraticandcomplexdistributionofcultivatedplantsanddomesticanimalsamongthePacicIslandsindicatesthe 10 Thiscontentisavailableonlineat.

PAGE 358

346 CHAPTER22.A.D.701TO800 rangeandvarietyofcontactslongbeforetheEuropeansarrivedinthearea.LegendhasitthatexploringPolynesians evenreachedtheAntarcticicepackinA.D.750.Evenso,throughoutallthisperiod,therewaslittleornochangein Australia,withtheaboriginalpeopleexistingapparentlywithoutsignicantchange,centuryaftercentury.Ref.139 [192],76[116] ForwardtoThePacic:A.D.801to900Section23.8 ChooseDifferentRegion 1.IntrotoEraSection22.1 2.AfricaSection22.2 3.AmericaSection22.9 4.CentralandNorthernAsiaSection22.5 5.EuropeSection22.4 6.TheFarEastSection22.7 7.TheIndianSubcontinentSection22.6 8.TheNearEastSection22.3 22.9America:A.D.701to800 11 22.9.1AMERICA BacktoAmerica:A.D.601to700Section21.9 TheDorsetArcticCulturecontinueditsmanycenturiesofexistenceinthefarnorth.Additionaldetailswillbegiven inthenextchapter.WehavelittledenitiveinformationabouttheCanadianIndiantribesatthisparticularlyperiod, butcertainlythefarwesterngroupscontinuedaspreviouslyandmaywellhavebeenthesending-offpointforthe PolynesianmigrationsintothePacic. "ThescaleandamboyanceofMississipiansocialdwarfedanythingknownbeforeinNorthAmerica." 12 Therewere enormousceremonialcenters,withtruncatedpyramidsandhugeplazasasatCohokia,MississipiresemblingMexicancenters,withbrilliantartistryandanewreligioussymbolism,reectingafascinationwithhumansacrice,sun andre.Thepeoplehadcornelds,pottery,obsidianknives,warehouses,administrativebuildings,copper,shell, stoneandwoodobjects.Coppersheetswereembossedwithhumanportraits.Therewasapparentlyanobilitywho livedinspecialhomesarrangedaboutthetemples.Thissocietyourishedforatleast8centuriesRef.215[290]. ThecentralandlowerMississippicultureswerecenteredbetweenSt.LouisandMemphisbutspreadtoWisconsin, Oklahoma,andAlabamaandwasstillinexistencewhentheSpanishcamewiththewhiteman'sdiseases. The EncyclopediaofArcheology Ref.45[66]saysthatthenewtraitsofthisculturewere: 1.Rectangular,attoppedmoundsusedfortemplebases 2.Newpottery-usingpulverizedshellfortemperwithnewshapesanddecorations 3.Maize,asthechiefcrop 11 Thiscontentisavailableonlineat. 12 Quotationfrom"WhoweretheMoundBuilders?",byBrianFagan,in MysteriesofthePast ,Ref.215[290],page131.

PAGE 359

347 Someofthetruncatedplatformtemplemoundswereupto100feettall,withstructuresforreligiousand/orpolitical purposesontop.Frequentlytherewereseveralinclusters,spreadoverseveralacres.Thetemplesareaandresidences weresurroundedbymaizeeldswiththeCornMothergoddessplayingavitalroleinthelivesoftheMississippian people.Beans,peas,squashandsunowersroundedouttheircrops.Ref.267[321]. ThehistoricIndiantribesoftheplainssuchasthePawnee,Osage,andArikara,forexample,perpetuatedthemixed horticulturalandbisonhuntingeconomyoftheprevious800to1,000years.Someoftheirancestors'largevillages havebeenexcavatedalongtheMissourianditstributaries.Ref.88[131] TheColonialPeriodoftheHohokamcontinuedinthesouthwest.Theirballcourtsvariedgreatlyinsizefrom20 meterstoover100metersinlength.SomebelievetheywereusedforthereligiousMeso-Americanstyleballgames butothersbelievetheywerestagesforadance.Ref.269[193]Accordingtotheremainingavailablearrowheads, itwassometimebetween700and900thatthebowandarrowbegantobeused,ratherthanthespear,bytheMogollon tribes.Thesepeople,rsttousepotteryinthesouthwest,developedincreasingskillinthisendeavor,astheymadeitby coilingandscraping,notwithapotterywheel.InnorthernArizonaandNewMexicotheAnasaziCulturenowshifted fromtheBasket-makerintothePuebloPeriod,withvesub-divisionsextendinguptomoderntimes.ThePueblo IperiodlastedtwocenturiesfromA.D.700to900,withtheirpotteryshowingsomestrangenewshapes,including somemadetolooklikebirds.Ref.66[97],210[283],88[131]MasonryrubbleintheChacoCanyonsuggests agradualshifttoground-levelconstructionofmulti-roomedhouseswhichweretherstpueblos.Itwasatthistime thattheAnasazimothersstartedstrappingtheirbabiestohard,woodencradleboardsproducingatteningoftheback oftheirheads.Kivasbecamefocalpointsofcommunityandreligiouspractices.Ref.252[101]. 13 LegendsaysthattheToltecsbuilttheircapitalatTulainA.D.720.About750muchofcentralTeotihucuanwaslooted andburned.Perhapsdevelopingdroughtandaridconditions,aswellasmilitarypressurefromthenorth,contributed tothedownfallofthiscivilization,whichthenshrunktoaseriesofvillagesoveranareaofonesquarekilometer.Its fallhadrepercussionsthroughoutmiddleAmerica.Ref.215[290],176[242] AlthoughitisdifculttokeepFell'sRef.66[97]chronologysortedout,heseemstoimplythatitwasinthis centurythatAmericansfromthesouthwest,perhapswithLibyaninuence,exploredthePacicandmappedHawaii. ThelowlandMayaCulturecontinuedstrongandtheNationalGeographicSocietyRef.155[214]datesextensive MayanprojectsinTikal,Guatemala,tothiscentury.Theseincludedasummittemple212feethigh.Attheheightof itspowerTikalhad40,000inhabitantsanditsnuclearareaalonehadmorethan3,000separatestructuresandsome200 stonemonuments,nottomentionreservoirs,acentralacropolisandasquarecontainingamarketarea,sweatbathand aball-gamecourt.AgreatMayaceremonialcenterwasatPalenque,Mexico,andoneofthemostbeautifulcitysites oftheClassicPeriodwasatCopan,Honduras.Ref.88[131]Somebuildings,asatUxmal,Mexico,hadcement andrubblecoresfacedwithaveneerofthin,nelycarvedlimestoneslabsandelaboratelydecoratedmoldings.Three roomsofpaintednarrativescenesofMayalifewerecompletedatBonampak,neartheQuatemalanborder.Henri StierlinRef.176[242]writesthattheMayanYucatancivilizationwasinfullbloominthiscenturyandonthrough the10th,creatingnewstylesofarchitecture.AmongtheMaya,medicinewascarriedonbytwoseparategroups: Hemenes,priestsorganizedintoamedicalsociety;andthelesser,non-priestlyhechiceros,whotookcareoftreating wounds,openingabscesses,reducingfractures,controllingbleeding,etc.Ref.125[173] InCostaRicatheNicoyapolychromepotterytraditionexpandedanddiversied,producingtherstwhite-slipped vesselswithbrilliantred,orangeandblackpainting.Theseappeartohavebeenmadealmostexclusivelyinthe northernpartofGreaterNicoya,whilebufftoorange-slippedceramicsweremadeincentersofGuanacaste.Ref.265 [270] 13 AlthoughitisdifculttokeepFell'sRef.66[97]chronologysortedout,heseemstoimplythatitwasinthiscenturythatAmericansfrom thesouthwest,perhapswithLibyaninuence,exploredthePacicandmappedHawaii.

PAGE 360

348 CHAPTER22.A.D.701TO800 Huari,capitalofapoliticalstatewhichembracedmostofPeru,wasoverthrownandabandonedaboutA.D.800and PeruwasnotuniedagainuntiltheIncaconquestofthe15thcentury.Ref.8[14]Thearcheologyofthisentire periodofA.D.600to1,000iscalledtheMiddleHorizonanditincludestheemergenceofthecharacteristicstyleof Tiahuanaco,nearLakeTiticaca.Therewascontroloffoodresourcesandpopulationmovementsoverawideareabut particularlynearTiahuanacowherethealtitudeisover12,000feet.ThisMiddleHorizonCultureshowedpolychrome potterybeakerswithhuman,animalandotherdesigns.Therewasanurbanareaofperhapsonesquaremilewithan estimatedpopulationofbetween5,000and20,000.Ref.88[131] Tiahuanacohadabird-mancultasthelaterChimuandalsoEasterIslandandthelaterIncatraditionsmaintained thatthelegendarygod-menwhobuiltTiahuanacoextendedtheirearlobesandcalledthemselves"BigEars"justas theoriginalEasterIslandinhabitants.LaterSpanishexplorers,particularlyPizarro'scompanion,JuandeBetanzos, whomarriedanIncawoman,recordedthelegendthatthewhiteandbeardedTiahuanacoleader,Ticci,stoppedover inCuzcoonthewayfromLakeTiticacatoappointalocalsuccessorandleaveordersaboutproducingthelargeears, beforehewentdowntotheocean,nevertobeseenagain.ThisTicci,wholeftthePeruviancoast,isundoubtedly thesameTiki-with-large-ears,ofMarquesanmyth,wholedhumanitytoPolynesiabutitisonlyonEasterIslandthat earextensionassumedsocialimportanceequaltothatofPeru.WhatisdenitelyknownisthatTiahuanacoidobjects madeintheupperAndesbegantoappearinthelower,centralAndesaboutA.D.750.Whetherthismerelyrepresents theraidingofwarpartiestothelowerlandsoractualdominationofthelowervalleysbytheTiahuanacoidchiefdoms isnotknown.Ref.95[140],62[91] TheremnantsoftheMochekingdomcontinuedtodeclineasthesouthernstatesdominatedthearea.Onthecoastof Surinam,inwhatlaterbecameDutchGuiana,aboutA.D.700theseaencroachedonthelandsothatthepeoplewere obligedtobuildamoundasavillagesiteandpresumablytomakeridgesfortheircrops.Thismoundedareawas occupiedcontinuouslyuntilatleastA.D.900.Ref.167[226] Ontheeasternpartofthecontinentthereweretwosettledareas-theAmazonasandOrinocoBasin-andthesouthern plains.ThechiefsettlementinthelatterwastheParanabasinwherearcheologistshavefoundsitesdatingbackto thehighHoloceneperiod.Butinthis8thcenturygreatnumbersofTupisandGuaraniscamefromBraziltosettlein thisregion.Theylivedinfortiedvillages,eatingcorn,squashandsh.EveninBrazil,ethnologistshaveobserved culturaltraitsthataretypicalofthelaterAfricanizedEcuadoriancoast.Therearemanyitemsthatspeakforcontinent tocontinentmigration.Thepracticeofcircumcision,forone,maylinkeasternSouthAmericawithAfrica,notjust SouthAsia.Ref.62[91] ForwardtoAmerica:A.D.801to900Section23.9 ChooseDifferentRegion 1.IntrotoEraSection22.1 2.AfricaSection22.2 3.CentralandNorthernAsiaSection22.5 4.EuropeSection22.4 5.TheFarEastSection22.7 6.TheIndianSubcontinentSection22.6 7.TheNearEastSection22.3 8.PacicSection22.8

PAGE 361

Chapter23 A.D.801to900 23.1A.D.801to900 1 23.1.1A.D.801TO900 BackwardtoA.D.701to800Section22.1 ThemostmemorablefeatureofthiscenturyisthegreatVikinginvasions,buttheconcurrentdevelopmentsofthe empiresofCharlemagneandtheMoslemArabsareequallyimportanttotheEurasianworld.TheFarEastcontinued tohave"barbarian"troubles,butinmiddleAmericaitwastheclimaxoftheClassicalPeriod. ThepapacyatRomesanktooneofitslowestebbswithaseriesofincompetent,immoralandirresponsiblepopes.In theeasternchurch,iconoclasm,whichhadproducedalargecropofmartyrsandexileswhileitlasted,wasofcially bannedinA.D.843.Ref.8[14] Similarly,theheadquartersoftheIslamicChurchinBaghdadhadaperiodofliquor,lechery,luxuryandslothwhich corruptedthecaliphate.InthiseraIslamtoleratedChristiansandtherewere11,000Christianchurchesinvariousparts oftheIslamicrealm.ThetwomainsourcesofIslamicknowledgeweretheKoranandtheTradition,acollectionof reportsoftheactsandsayingsoftheProphetandhiscompanions.UltimatelysixstandardcompilationsofTradition wereproducedinthiscentury.UndertheAbbasids,thedirectdescendentsofAliwereallowedspecialprivilegeas religiousleaders,knownas ulema andthiscompromisebetweenpoliticalandreligiousleadershipwasknownasthe "AbbasidCompromise"andthoseacceptingthisbecameknownasSunnites.Ref.68[106]Attheendofthe century,however,agroupofthefollowersofAli,called"Carmathians"developedthehereticalShi'itesect,whichwas togrowintoapowerfulforceinthefutureofthereligion. InlimitedrespectsthisandthenextcenturywereactuallytheGoldenAgeofIslam,particularlyinSpain,wheremany featuresweredifferentthanintherestoftheMoslemworld.Musicwasprized,intellectualactivitywasgreatand tolerancewascomplete,withmanymarriagesbetweenChristiansandMuslims.TheChristianKingAlfonsoIIIeven senthisson,thefutureOrdonoII,tobeeducatedattheMuslimcourtofZaragoza.Ref.213[288] GroupsofJewssettlinginGermanydevelopedYiddishasauniquelanguage,combiningGerman,Hebrewandother sources.Ref.222[296]AdditionalNotesp.349 1 Thiscontentisavailableonlineat. 349

PAGE 362

350 CHAPTER23.A.D.801TO900 NOTE :NetworksofJewishmerchantsstretchedoveralltheworldfromEgyptandEthiopiatoIndiaand ChinaviatheRedSea,PersianGulfandtheIndianOcean.Ref.260[29],292[28] ForwardtoA.D.901to1000Section24.1 ChooseDifferentRegion 1.AfricaSection23.2 2.AmericaSection23.9 3.CentralandNorthernAsiaSection23.5 4.EuropeSection23.4 5.TheFarEastSection23.7 6.TheIndianSubcontinentSection23.6 7.TheNearEastSection23.3 8.PacicSection23.8 23.2Africa:A.D.801to900 2 23.2.1AFRICA BacktoAfrica:A.D.701to800Section22.2 TheoldAxummonarchyestablishedanewresidencedeepintheinteriorofEthiopiaaroundLakeHayqsometime beforeA.D.870.ThiswasactuallyaChristianmonasterywithsome300clerics.TheoldAxumiteareawasgivenup entirelytoinvadingsheepherders.Ref.270[36]Nubiaremainedessentiallyasinthelastcentury. EgyptwasaMoslemstatebutindependentlyruledbytheTulunidDynasty.ThesemenwereTurkishinorigin,having beenbroughtintoIslamasprofessionalsoldiers.Oneofthem,AhmadibnTulun-884conqueredSyriatoadd tohisrealm.Egypt,astheancientgranaryforsouthernEurope,nolongrobbedofitsproductsbyforeignmasters, entereduponaminorrenaissance,withnewlearningandart,palaces,publicbaths,ahospitalandagreatmosque honoringTulun. AlloftheoriginalMoslemprovincesinnorthAfricawerenowmoreorlessindependentwithseparaterulers.After 800TunisiawasruledbytheAghlabidDynastyuntiltheendofthecenturywhentheywereoverthrownbytheKotama, aBerbertribefromKabylia.Morocco,undertheIdrisids,hadfoundedaShi'itecaliphatein789whichhadcarried onintothiscentury.Stillfartherwest,justontheMediterraneansideoftheStraitsofGibralter,weretheRostemids. Ref.137[188],8[14]PleaseseemapinconnectionwithCENTRALEUROPE,thischapter. TherewerethreemajortraderoutesacrosstheSaharaatthistime.OnewentfromFezzantoKanem,runningnorth ofLakeChad;asecondwentfromGao,ontheNigerbend,tocentralMaghrib;andthethirdranfromthewestern MaghribtoGhana.Ref.83[123] CommerceacrosstheSaharabroughtgoldandslavestotheMediterraneanandstimulatedtheearlyNegrostatesofthe sub-Saharanregions.Ghanahadfewnaturalresourcesofitsownanditswealthwasderivedfromleviesimposedon thistradeacrossthedesert.WehaveseeninpreviouschaptershowJenne-jenodevelopedasatradecenterontheNiger. 2 Thiscontentisavailableonlineat.

PAGE 363

351 By800ithadperhaps10,000peopleandanextensiveriverinetradewiththeTimbukturegion.Ref.268[189]To theArabs,therulerofGhanawasreputedtobetherichestandmostpowerfulmonarchinalltheBiladas-SudanLand ofBlacks.Around LakeChadtheempireofKanem-Bornudevelopedaboutthebeginningofthis9thcenturyandsurvivedforamillenium. Thiskingdom,foundedbyZaghawanomads,wasoriginallyonlyoneofthesevenHausacity-states,eachprotected bystrongcitywallsandexcellingasmanufacturersandlongdistancemerchants.Ref.68[106],175[241] OntheeastcoastofAfricaagreatwaveoftradingactivitysweptthecountriesborderingtheIndianOcean,resulting inastringofcity-statesalongthatcoast,mostofthemfoundedbyMuslimsfromthePersianGulfandsomefrom southernArabia.Bantu-speakingNegroessoonjoinedthemtoproduceadistinctcultureandlanguageSwahili. FarthersouthinZimbabwe,theShonaandparticularlytheKarangassub-group,continuedinthiscenturytodevelop agriculture,stockraising,goldandcoppertradingandthebuildingoflargestoneedices.Theyprobablyoriginally camefromiron-richKatangaandhadanadvancedknowledgeofironminingandmetallurgy.Theysoonbecamethe overlordsoftheindigenousGokomereandLeopard'sKopjepeopleastheRhodesianplateaubecameabeehiveof gold,copperandironproduction.TheproductswenttotheArabmerchantsonthecoast.TheShonacivilizationlasted untilA.D.1500.Ref.175[241],176[242],45[66] ForwardtoAfrica:A.D.901to1000Section24.2 23.3TheNearEast:A.D.801to900 3 23.3.1THENEAREAST BacktoTheNearEast:A.D.701to800Section22.3 TheoriginalhomeoftheMoslemswasnolongerthecenteroftheiractivity,butMuhammed'shomeareaatMecca remainedtheirreligiousfocalpoint.AttheendofthiscenturythiscitywascontrolledbythehereticalShi'itesect. MoslemstateswhichremainedseparatefromtheAbbasidCaliphateweresetupineasternArabiaandYemen.Ref. 8[14]AdditionalNotesp.352 Earlyinthecentury,withtheAbbasidMoslemadministrationatBaghdad,therewasremarkablegrowthofthatcity. By814itcoveredapproximately10by9kilometers,theequivalentofmodern-dayPariswithintheouterboulevards. Ref.8[14]ThecaliphinBaghdadwasthemostpowerfulmanonearthandtheArabdhowsrodetheIndian Oceanfromendtoend.Ref.2[3]ThereignofMamuntheGreat-833wasprobablythemostgloriousof all.DamascusandBaghdadeachhadobservatoriesandaHouseofKnowledge,witharichlibraryinthelattercity. Ref.119[166]Later,evenastheadministrationbeganadeclinetherewasstillconsiderableprogressinthearea inscience,literature,astronomyandmedicine.TranslationscontinuedtobemadefromSyriac,Greek,Pahlaviand SanskrittoArabic.Johannituswasoneofthegreattranslatorsofmedicinejustafter800.TheHellenisticheritagewas appropriatedwithsomeaddedoriginalMoslemcontributions.Themathematician,Al-Kharizmi,forexample,became thersttouseIndianourArabicnumeralstodevelopnewformsofcalculation. Inthewestofthisregion,Syriaplayeditsusualroleasaborderstatebetweentworivalempires,thistimetheeastern AbbasidsofBaghdadandtheTurkishcontrolledEgypt.Earlyinthecenturytheformerdominatedbutabout870 SyriawasconqueredforEgyptbyAhmadibnTulun,oneoftheTurkishmercenariesoriginallyhiredbythecaliphs forpersonalbodyguardsandarmies. 3 Thiscontentisavailableonlineat.

PAGE 364

352 CHAPTER23.A.D.801TO900 AstheAbbasidCaliphateeventuallybecamecorruptandweakened,itgavewayinthelastofthecenturyinPersia tothenativeSaffaridDynasty,whichalsoruledpartofCentralAsia.OnespotjustsouthoftheCaspianremained separateastheShi'iteEmir-ateofAlidDescendantofAli.Ref.137[188]ThePersianlanguagewasrevived. WindmillswithverticalsailsttedtowheelsturninghorizontallywereoperatinginPersiabythiscenturyandpossibly muchearlier.ThesemillsmayhavespreadfromIrantoChinaaswellastotheMediterranean.Ref.260[29] AdditionalNotesp.352 AlthoughtheEmperorNicephorusmadepeacewithCharlemagnein803sothattheeasternempirecouldretaincontrol ofsouthernItaly,VeniceandDalmatia,hecouldnotpacifytheArabswhoresumedraidsin804through806.Asa resulttheByzantineslostcontroloftheseasandAfricanMoslemstookCreteandinvadedSicily.TheRustook overtheBlackSeaandby860attackedConstantinopleitself.After867Byzantinefortunesimproved,however,as acapablegeneral,BasilI,foundedtheMacedonianDynasty.AlthoughborninMacedonia,Basilwasactuallyof Armeniandescent.Inthemeantime,inspiteofthemoreorlessconstantandlosingwarfare,asissooftenthecase, theGreekByzantineEmpireatthesametimeenjoyedabriefrenaissanceastheUniversityofConstantinoplewas restoredandanAlexandrianAgeofscholarshipdeveloped.Schoolsoflawandmedicine,aswellasphilosophyand mathematics,werepromoted.Auniqueandformidablereligiousartaccompaniedtheintellectualactivity,particularly aftertheCouncilofSophiahadallowedthereturnoficonoclasmandinstitutedanewperiodofpersecutionofcertain monks. TheChristiankingdomofArmenia,whichnowincludedtheoldGeorgiankingdomofIberia,keptindependentof theArabsbypayingtribute.TheBagratunifamilyestablishedadynastyunderthetitleof"PrinceofPrinces",builta capitalatAniandgavethecountryseveralgenerationsofprogressandrelativepeace.AshotIwastherstindependent sovereign,usheringinArmenia's"GoldenAge".Ref.137[188] ForwardtoTheNearEast:A.D.901to1000Section24.3 ChooseDifferentRegion 1.IntrotoEraSection23.1 2.AfricaSection23.2 3.AmericaSection23.9 4.CentralandNorthernAsiaSection23.5 5.EuropeSection23.4 6.TheFarEastSection23.7 7.TheIndianSubcontinentSection23.6 8.PacicSection23.8 NOTE :ThemostimportantearlyIslamicarchaeologicalcomplexinArabia,outsideMeccaandMedina,is themorethan600mile-longDarbZaubaida,orpilgrimroad.Actuallyitextendedevenfather,toBaghdad, inMesopotamia.Itwaslavishlyequippedwithwells,catchbasins,reststopsandhostelriesforpilgrimsto Mecca.Thename"Zubaida"wasthatofthewifeofCaliphHarunalRashid.Ref.315[125] NOTE :SlavesfromRussiawereatapremiuminPersiainthiscenturyandsoldforasmuchas600,000 dirhams.Ref.301[258]

PAGE 365

353 23.4Europe:A.D.801to900 4 23.4.1EUROPE BacktoEurope:A.D.701to800Section22.4 Asthiscenturyopened,andparticularlyinA.D.814,theyearofthedeathofCharlemagne,EuropeandAsiawere recoveringfromthepreviouswavesofbarbarianinvasionsandaseriesofpowerfulempiresextendedinunbroken sequencefromtheAtlantictothePacic.ThenorthernonesofEurope,however,-FrankishandBulgarian-were reallyconquestsofwarbandsandhadverylittlestability.Ref.8[14] ThecopperminesofCypruscontinuedtobeexploited.Overaperiodofsome3,000yearsabout200,000tonsofthat metalhasbeenproducedonCyprus.Thesmeltingrequirescharcoalintheamountthatwouldbetheequivalentof 150,000squarekilometers,000squaremilesofforest.SinceallCyprustotalsonly9,300squarekilometers,the forestsoftheislandmusthavebeendestroyedatleast16times.Ref.281[113]TheTurkstookCretefromthe ByzantinecontrolledVenetiansandin825builtabasewithasurroundingmoat,whereMoslempiratesdominated untilthemiddleofthenextcentury.MaltawastakenbytheMoslemsin869.Ref.38[59],222[296] ThegreaterpartofGreecewasapartofByzantiumand,assuch,sharedinitstemporaryrenaissance.Bulgariatook overpartofnorthernGreeceasapartoftheirexpansionearlyinthecentury.Demonstratingthegeologicalinstability oftheregion,anearthquakeof856killed45,000Corinthians.Ref.222[296] TheAvarswereconqueredbyCharlemagnein805andastheremnantswerepushedoutofHungaryintotheupper Balkans,theywereabsorbedbytheBulgarsandSlavs.In811thestillpaganBulgars,underPrinceDrum,defeated anddestroyedtheByzantinearmiesofEmperorNicephorusandthentheytookoveralargepartofthepeninsula,even includingsomeofGreece.TheirterritorythenstretchedfromtheDanubetotheTheissandfromtheCarpathiansto theDniester.OriginallyaTurkishpeople,theBulgarsbecame,byrepeatedadmixture,almostentirelySlavonicinrace andlanguage.TheBulgarKhanate,underCzarsMalamirandBoris,continuedtoexpandrapidlyandtheirempire evenincludedagreatpartofHungaryuntilabout893,whentheMagyarsovercamethelightholdoftheBulgariansin thatregion.Ref.137[188],8[14] BulgariaandSerbiawerewonfortheeasternChristianChurchin870and879,respectively,throughtheeffortsof CyrilandMethodius,MacedonianBrothers,whohelpedKhanBoristoevolveaSlavonicorCyrillicalphabet,thus allowingthedevelopmentofanationalwrittenlanguageandculture.FacedwithSlavonicsoundswhichdidnotexist inGreek,theystretchedtheGreekalphabetasfarasitwouldgo,thendraftedoneortwoHebrewcharactersand inventedothers.TheEasternChurchRussian,Ukrainian,SerbianandBulgarianstillusesthisCyrillicalphabet. Ref.168[229],222[296]FartherforWesternChristianityin879,aftertheyhadmadethemselvesindependent oftheGermanEmpirein869.Ref.137[188] WenotedinthelastchapterthatCharlemagnehadseizedtheLombardKingdomin774andthisremainedunderhis controluntilhisdeathin814.Italy,asawholewasunderdividedrule.BytheTreatyofVerdunof843,theFrankish heir,Lothar,gotalongcentralstripofEuropealongwithnorthernItalyanddowntothefrontieroftheDuchyof 4 Thiscontentisavailableonlineat.

PAGE 366

354 CHAPTER23.A.D.801TO900 BeneventoinsouthernItalyandheretainedthetitleofemperor.Aweakpapacy,leaguedwithFrance,ruledacentral area;theVenetianshadtheirownkingdom;andvariousdukesruledscatteredprovinces.PartofSicilywasconquered bytheAghlabidsfromTunisiain827andby840theyheldmostofthatislandandtheheelofItaly.Theywerenally expelledbytheByzantinesattheendofthecentury.DuringtheperiodoftheMoslemraids,evenRomehadbeen attacked.Ref.8[14],137[188] WhileeasternandsouthernItaly,inspiteoftheMoslemraids,remainedforthemostpartByzantineinculture,therest ofthepeninsuladevelopedanewcivilization,anewlanguage,religionandartfromitsRomanheritage.TheItalian languagebecamethemostmelodiousoftongues;ItalianChristianitywasaromanticandcolorfulpaganism,-afrank mythologyoflegendandmiracle.Romeitselfdeclinedandsciencesuccumbedtosuperstitionandonlymedicinekept itsheadupthroughthemonasteries.LatinChristendomadoptedtheIraniantypeofheavyarmoredcavalryandwith thisbegantostemthebarbariantideandpavethewayforcounter-expansioninthenexttwocenturies.Abrightspot onthepeninsulawasSalerno,whereauniversitywithamedicalschoolwasfounded,whichsoonbecamefamous throughoutEurope.Ref.49[73],125[173] CENTRALEUROPE TheempireofKarltheGreatCharlemagnewasatheocraticchurch-statewithhisfunctioningasapriest-kingandas anemperor.IncludedinhisreligiousmissionshadbeentheconquestandconversionoftheSaxons.Heregardedthe popeassimplyhischaplain.Ref.181[247]Atthesametime,hisempirewasactuallyanarticialconstruction anddidnotsurvivehim.Nevertheless,inasense,hesavedcivilizationbecausethroughhimtheAtlanticworldreestablishedcontactwiththeancient,Mediterraneanculture.Hedidthisbyarrangingforthecollectingandcopyingof books.Withtheexceptionof3or4survivingoriginalantiquemanuscripts,ourwholeknowledgeofancientliterature hascomeonlythroughthecopyingthatbeganunderCharlemagne.ThesecopyistsalsodevelopedtheCarolingian scriptwhichhassurviveduntiltoday.Theirbookswereworksofartandoverallsplendidmasterpieces.Ref.33 [55]Theemperordiedin814,veyearsaftertherealmhadbeensweptbyfamine.Ref.213[288]The CarolingianDynastyimmediatelydeclinedastheempirewasdividedbyhisonesurvivingsonamongthreegrandsons -Pepin,LouisandKarl,allofwhomdiedwithin8years.Theirsuccessorswereweakleadersandmanylocalwars brokeoutbetweenrulers,noblesandchurchwithresultingrecurrentpartitionsoftheempire.FinallybytheTreatyof Verduntheoriginalempirewasofciallydividedintothreeparts,withLothairkeepingthetitleofemperorand acentralarea,extendingfromtheNetherlandsalmosttoNaples.CharlestheBaldgotthewesternareaandLudwig theeasternareaandinthiswayFranceandGermanybecamedissociated.Ref.57[82]Itwasnotoriginallya differenceofraceortemperamentbutadifferenceoflanguageandtradition.Thewesternbranchwasassimilatedby thecountry-sideLatin,whichbecameFrench,whiletheGermanicgrouphadretainedtheiroriginalGermanictongue. TheFranksinnorthGermanyevendifferedalsofromtheSwabiansandsouthGermans.Ludwigactuallywastherst kingofGermany,butthearticialdivisionsoftheempirewerestillpoorlyarrangedbecausetheypaidnoheedto thesegrowingregionaldifferences.ThemonstrousterritoryofLotharingiaFrench-"Lorraine"wastobedisputed betweenFranceandGermanywellupintothe20thcentury.TheItalianpartwasalsoacontinuedproblemarea,with subsequentGerm