University Press of Florida
Introduction to Open Educational Resources
Buy This Book ( Related Link )
Full Citation
Permanent Link:
 Material Information
Title: Introduction to Open Educational Resources
Physical Description: Book
Language: en-US
Creator: Baker, Judy, Connexions, Rice University
Subjects / Keywords: OER, open courseware, open textbooks, open educational resources, free textbooks, OGT+ isbn: 9781616100438
Copyrights, Intellectual Property, Open Education
Educational Technology / Integrating technology into the classroom
Abstract: A free PDF text introducing open educational resources as alternatives to textbooks for college teachers. Contents: 1) Introduction. 2) Open Courseware. 3) OER Fair Use, Copyright, and TEACH Act. 4) Identifying Sources. 5) Discipline Specific Sources. 6) Public Domain Textbook Sources. 7) Use of Primary Sources. 8) OER Development. 9) Delivery, Storage, and Organization.
General Note: Expositive
General Note: Community College, Higher Education
General Note:
General Note: Adobe PDF Reader
General Note: Textbook
General Note:
 Record Information
Source Institution: University of Florida
Rights Management: Copyright 2008 Judy Baker. This selection and arrangement of content is licensed under the Creative Commons Attribution License:
Resource Identifier: isbn - 9781616100438
System ID: AA00011640:00001


This item is only available as the following downloads:

( PDF )

Full Text


IntroductiontoOpenEducational Resources By: JudyBaker


IntroductiontoOpenEducational Resources By: JudyBaker Online: < > CONNEXIONS RiceUniversity,Houston,Texas


2008JudyBaker ThisselectionandarrangementofcontentislicensedundertheCreativeCommonsAttributionLicense:


TableofContents 1OERIntroduction .................................................................................1 2OEROpenCourseware ...........................................................................7 3OERFairUse,Copyright,andTEACHAct ..................................................11 4OERIdentifyingSources ........................................................................15 5OERDiscipline-SpecicSources ................................................................19 6OERPublicDomainTextbookSources ........................................................27 7OERUseofPrimarySources ...................................................................31 8OERDevelopment ...............................................................................35 9OERDelivery,Storage,andOrganization .....................................................41 Index ................................................................................................45 Attributions .........................................................................................46




Chapter1 OERIntroduction 1 1.1Lesson:Introduction 1.1.1LessonComponents FastFact Skills/Objectives SuccessIndicators Introduction Activity Reviewquestions Resources 1.1.2FastFact AccordingtoWikipedia 2 ,OERisatermthatwasrstadoptedatUNESCO's2002ForumontheImpact ofOpenCoursewareforHigherEducationinDevelopingCountriesfundedbytheHewlettFoundation.The denitionOERis: digitizedmaterialsoeredfreelyandopenlyforeducators,studentsandself-learnerstouseandre-use forteaching,learningandresearch 1.1.3Skills/Objectives Learnerswillbeableto: 1.DeneanddescribeOER. 2.ListtheadvantagesanddisadvantagesofOERuse. 1.1.4SuccessIndicators 1.LearnermembershipsinOERcommunitywebsites. 2.Learner-generatedpostingtoopenforumaboutOERissues. 1 Thiscontentisavailableonlineat. 2 1


2 CHAPTER1.OERINTRODUCTION 1.2Introduction Denition OpenEducationalResourcesOERarelearningmaterialsfreelyavailableinthepublicdomain.A denitionofOER 3 fromtheTheWilliamandFloraHewlettFoundationis: "OERareteaching,learningandresearchresourcesthatresideinthepublicdomainorhavebeenreleased underanintellectualpropertylicensethatpermitstheirfreeuseorre-purposingbyothers.Openeducational resourcesincludefullcourses,coursematerials,modules,textbooks,streamingvideos,tests,software,and anyothertools,materialsortechniquesusedtosupportaccesstoknowledge." ThetermOERhasbeenusedtorefertolearningmaterialssuchas: Learningobjects 4 quizzes,crosswordpuzzles,ashcards,animations,etc. Audiolectures 5 Audiovideolectures Images 6 Soundsandmusic Entirecoursecontentandopencourseware 7 Collectionsofjournalarticles 8 andinstitutionalrepositories Textbooks 9 Background HewlettFoundation 10 hastakenapioneeringroleinthedevelopmentanduseofOERwithitssupport ofmanyinitiatives:"TheOpenEducationalResourcesmovementbeganin2001whentheHewlettandthe AndrewW.MellonfoundationsjointlyfundedMITOpenCourseWareOCW,therstinstitutioncommitted tomakingallofitscoursematerialsfreelyavailable.Sincethen,morethan60additionalinstitutionshave launchedOpenCourseWareWebsites."JustsomeofthemanyOERinitativessupportedbytheHewlett Foundationinclude: MITOpenCourseware 11 Foothill-DeAnzaCommunityCollegeDistrict,SharingOfFreeIntellectualAssetsSoa 12 JohnsHopkinsBloombergSchoolofPublicHealthOpenCourseWare 13 TuftsUniversityOpenCourseWare 14 UtahStateUniversityOpenCourseWare 15 eduCommons 16 CarnegieMellonUniversity,OpenLearningInitiative 17 MontereyInstituteforTechnology,OnlineAdvancedPlacementcourses 18 Connexions 19 InternetArchive,Education 20 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20


3 TheOpenEducationalResourcesmovementispartofaglobaleorttomakeknowledgeavailabletoall.The UNESCO'sVirtualUniversityForum 21 providesanoverviewaboutdenitions,initiatives,andcommunitybuilding.ManyrepositoriesofopenlearningmaterialsarelistedattheOpenEducationalResourcesOER Index 22 SomebenetsofOERinclude: Fosterspedagogicalinnovationandrelevancethatavoidsteachingfromthetextbook Broadensuseofalternativestotextbookswhilemaintaininginstructionalquality Lowerscostsofcoursematerialsforstudents SomedisadvantagesofOERinclude: QualityofavailableOERmaterialsinconsistent MaterialsmaynotmeetSection508ADAaccessibilityorSCORMrequirementsandmustbemodify tobringintocompliance NocommonstandardforreviewofOERaccuracyandquality Needtocheckaccuracyofcontent Customizationnecessarytomatchdepartmentaland/orcollegecurriculumrequirements Technicalrequirementstoaccessvary Technologicaldeterminismcreatedbythedeliverytool CaseStudy InhisMay2006article"ByetheBookMyyearofteachingenvironmentalsciencewithoutatextbook" 23 EricPallantdescribeshowheandco-professorTerryBenselexperimentedwithteachingtheirIntroduction toEnvironmentalSciencecourseatAlleghenyCollegewithnotextbook.Insteadtheyusedavarietyofopen educationalresources.Basedonself-report,41of46studentsintheirrst-semesterclassreadthesameor morethantheywouldhaveinatextbook.Theexperimentprovedsuccessfulenoughthattheentireacademic departmenthasembracedtheconceptofOER.Facultyhavedistributedtheworkofcollectingandbanking websitesforcommonuse. Sustainability Recently,severalwebsiteshavebecomeavailablethatprovidetoolstosupporttheidentication,development,use,re-use,collaboration,anddeliveryofopenlearningcontentincludingsearchingandorganization ofcontent.Somewebsites,suchas:OERCommons 24 ,OpenLearn 25 ,OpenContent 26 ,WikiEducator 27 Connexions 28 ,OWLInstitute 29 ,andOERderves 30 ,aredevotedtonurturingonlinelearningcommunities, wikis,andblogsonvariousaspectsofOER.Also,anewjournalhasgoneonlinewithafocusonOER: Eduforge:TheInternationalJournalofOpenEducationResources 31 1.2.1SupportforOERUseonCampus InordertopromoteuseofOERacrosscampus,thechallengesmustbeidentiedandaddressed.Resultsof atwo-yearstudyarepresentedinthearticle"WhyStudyUsers:AnEnvironmentalScanofUseandUsers ofDigitalResourcesintheHumanitiesandSocialSciencesUndergraduateEducation 32 ."Basedonthis 21 22 23 24 25 26 27 28 29 30 31 32


4 CHAPTER1.OERINTRODUCTION study,barrierstouseofdigitalresourcesincludingthelackofdirectrelevancetotheirpreferredpedagogical approaches,andinsucienttimeandclassroomresources.Challenges Resourcesforfacultysupport Qualityassuranceoflearningmaterials Limitedavailabilityoffullyvettedandcomprehensivelearningmaterialsinsomedisciplines Articulationandtransferissues Printingandcomputerlabdemandsoncampusbystudents Identicationofcollaborativetoolsfordevelopment,use,anddeliveryofOERlearningmaterials Fosteringuseofthetoolsbyfaculty Compliancewithfederalandstateaccessibilityrequirements ResourcesNeededtoSupportFacultyUseandDevelopmentofOER Training Technicalassistance Software Hardware Releasetime 1.3Activity Experience 1.GetconnectedandbecomeapartoftheOERmovementcommunity: GotoOERCommons 33 .Join 34 andsignuptoreceivee-news. GotoOpenLearn 35 .Browsetopics 36 ,register 37 tobecomeapartoftheOERcommunity,signup forthenewsletter,andtellonefriendaboutOpenLearn 38 GotoRiceUniversity'sConnexions 39 toreadthefeedback 40 fromusersandthenregister. 2.ReadatleastoneofthefollowingabouttheOERmovement: ModelsforSustainableOpenEducationalResources 41 byStephenDownes 42 ,January30,2006 TheCurrentStateofOpenEducationalResources 43 byDavidWiley,February3,2006 OpenEducationalResources:TowardaNewEducationalParadigm 44 byPetrides&Jimes,October 2006 Reect 1.OnceyouhavejoinedOERCommons 45 ,makeyourownpostingtotheOERMattersDiscussions 46 area.ClickonOERMattersTeachingandLearningForumtoanswerthefollowingquestion: 33 34 35 36 37 38 39 40 41 42 43 44 45 46


5 "Openingupnewavenuesforteachersandlearnerstoselectandaugmentlearningresourcesthatmeet one'suniqueteachingandlearningneedsisthebasicmissionbehindOER.ButhowdoOERimpactteaching andlearningandwhataretheissuesthatweneedtotakeintoconsideration?"" Apply NowthatyouhaveageneralideaofwhatOERisallabout,youshouldbereadytomakeacoupleof decisions: 1.DoyouwanttolearnmoreaboutOER? Decidewhichlessonsyouwanttocompleteinthistutorial. Decidetheorderinwhichyouwanttocompletethelessonsthatmakesthemostsenseforyourlearning needs. 2.Doyouwanttogetthemostoutofthislearningexperience? Inviteacolleaguetojoinyouinthistutorial. CompletealltheexerciseslistedintheActivitycomponentofeachLesson. 1.3.1ReviewQuestions 1.WhatareOpenEducationalResources? 2.WhataretheadvantagesanddisadvantagestousingOERforteaching? 1.3.2Resources ModelsforSustainableOpenEducationalResources 47 TheCurrentStateofOpenEducationalResources 48 AReviewoftheOpenEducationalResourcesOERMovement 49 OpenEducationalResources:TowardaNewEducationalParadigm 50 OpenEducationalResources:OpportunitiesandChallenges 51 OpenEducationalResourcesServetheWorld 52 GivingKnowledgeforFree:TheEmergenceofOpenEducationalResources 53 TheFutureofFreeInformation 54 47 48 49 50 51 52 53 54




Chapter2 OEROpenCourseware 1 2.1OEROpenCourseware 2.1.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 2.1.2FastFact MIT 2 rstannounceditsOpenCoursewareprogramin2001.TheOCWprovidesopenaccesstocourse materialsforupto1,550MITcourses,representing34departmentsandallveMITschools.Thegoalisto includematerialsfromallMITcoursesby2008. 2.1.3Skills/Objectives Learnerswillbeableto: 1.Identifysourcesofopencoursewareforuseintheirownteachingdisciplines. 2.Locateatlessoninanopencoursetomodifyforuseintheirownteaching. 2.1.4SuccessIndicators 1.PostedlessonplanthatrepurposeslearningcontentfromOCWforlearner'sownteaching. 2.2Introduction TheOpenCourseWaremovementbeganattheMassachusettsInstituteofTechnologyMITin2002andhas nowspreadtosome120otheruniversitiesworldwide.AccordingtoUCIrvine 3 :"OpenCourseWareOCW 1 Thiscontentisavailableonlineat. 2 3 7


8 CHAPTER2.OEROPENCOURSEWARE isafreeandopendigitalpublicationofhighqualityuniversity-leveleducationalmaterials,oftenincluding syllabi,lecturenotes,assignmentsandexams.Openeducationalresourcesarebasedonthenotionthat knowledgeandeducationarecommongoodsthatmustbesupportedbyadenedcommunity." WhileOCWinitiativestypicallydonotprovideadegree,credit,certication,oraccesstoinstructors, thematerialsaremadeavailable,forfree,underopenlicensesforuseandadaptionbyeducatorsandlearners anywhere. Denition AccordingtotheOpenCoursewareConsortium 4 : "AnOpenCourseWaresiteisafreeandopendigitalpublicationofhighqualityeducationalmaterials, organizedascourses...isavailableforuseandadaptationunderanopenlicense...doesnottypicallyprovide certicationoraccesstoinstructors." TheOpenCourseWareFinderFinder 5 currentlyshowssearchresultsfrom: MITOCW 6 UtahStateUniversityOCW 7 JohnsHopkinsSchoolofPublicHealthOCW 8 TuftsUniversityOCW 9 FoothillDe-AnzaSOFIA 10 CarnegieMellonOpenLearningInitiative 11 Otheruniversitieswithopencoursewareinclude: UniversityofCalifornia,Irvine 12 UniversityofNotreDame 13 UniversityofWashingtonComputerScience&Engineering 14 StanfordoniTune 15 PennState 16 Wikiversity 17 isaonlinegroupofeducatorsengagedinacollaborativelearningeortusingwikisoftware, whichmakescollaborationeasy.Taketheguidedtour 18 todiscovermore. HippoCampus 19 ,aprojectoftheMontereyInstituteforTechnologyandEducationMITE,provides high-quality,multimediacontentongeneraleducationsubjectstohighschoolandcollegestudentsfreeof charge. 2.3Activity Experience 1.UsetheOpenCourseWareFinderFinder 20 tosearchforOpenCoursewareinyourteachingdiscipline. 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20


9 2.ListentoalecturepodcastatStanfordoniTunes 21 orBerkeley. Reect 1.ParticipateintheWikiversityMottocontest 22 bypostingyourchoiceandwhyonthewikioratthe 23 WikiversityColloquium 24 Apply 1.DevelopalessonplanthatrepurposeslearningcontentfromOCWforyourownteaching. 2.ConsideraddingyourowncoursetoWikiuniversity 25 .Usethetutorial 26 provided. 2.3.1ReviewQuestions 1.Whataresomeofthesourcesofopencourseware? 2.Whichsourcesofopencoursewareprovidelearningmaterialsthatcanbemodiedforuseinthe learner'sownteaching? 2.3.2Resources HowtheOpenSourceMovementHasChangedEducation:10SuccessStories 27 ThePromiseofOpenEducationalResources 28 21 22 23 24 25 26 27 28




Chapter3 OERFairUse,Copyright,andTEACH Act 1 3.1Lesson:FairUseandCopyright 3.1.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 3.1.2FastFact Thecopyrightnotice isnolongerrequiredforworkspublishedafterMarch1989.Absenceofnoticedoes notnecessarilymeantheworkiswithinthepublicdomain. 3.1.3Skills/Objectives Learnerswillbeableto: 1.Denecopyright,fairuse,theTEACHAct,andintellectualproperty. SuccessIndicators DeterminetheappropriatenessoftheirownuselearningmaterialsforOERintermsoffairuse.Creative Commonslicenseselectedforlearner'sOER. 3.2Introduction Abasicunderstandingofcopyright,fairuse,theTEACHAct,andintellectualpropertyisnecessarybefore usinganddevelopingOERinordertominimizetheriskofviolatingthelaw.Youareencouragedtovisit oneormoreofthemanyonlinetutorialsexistwhichaddressthesetopics. Copyright 1 Thiscontentisavailableonlineat. 11


12 CHAPTER3.OERFAIRUSE,COPYRIGHT,ANDTEACHACT CopyrightandDistanceEducation 2 Primer 3 ,UniversityofMaryland Digital 4 focusesspecicallyonissuesrelatingtocopyrightindigitalworksandtheproblemsencounteredbyeducationalinstitutionsintheiruseofdigitalmaterialsforteaching,researchandservice TheCaseofDr.No 5 isavideoclipthataddressesthechallengesfacedbyfacultywhendistributing copyrightedmaterialfromvarioussources. TheCopyrightCrashCourse 6 fromtheUniversityofTexasatAustin CopyrightTermandthePublicDomainintheUnitedStates 7 CopyrightManagementCenteratIUPUI 8 VATechCopyrightInfo 9 CopyrightTutorial 10 FairUse Thefairusedoctrine,ascodiedinU.S.C.107,setsforthfourgeneralfactorstobeconsideredwhen evaluatingwhetheraproposeduseofacopyrightedworkisafairuseandthus,doesnotrequirepermission fromthecopyrightholder. Thefourfactorsare: 1.Whatisthepurposeoftheproposeduse? 2.Whatisthenatureofthecopyrightworktobeused? 3.Howmuchofthecopyrightedworkwillbeused? 4.Whatistheeectonthemarketorpotentialmarketforthecopyrightedwork? FairUse 11 CommonScenariosofFairUseIssues:PostingMaterialsonCourseManagementSystems 12 LibraryofCongressQuestionsandAnswers:CopyrightandFairUse 13 Copyright&FairUseatStanford 14 RulesofThumbforDisplayingandPerformingOthers'WorksinDistanceLearning 15 ATeacher'sGuidetoFairUseandCopyright 16 CopyrightandFairUseintheClassroom,ontheInternet,andtheWorldWideWeb 17 StanfordCopyrightLawandFairUse 18 TEACHAct TheTEACHActisupdatescopyrightlawfordigitalonlineeducationasacompromiseeorttoaddress thecopyrightrestrictiondisparitiesbetweendigitalclassroomandthetraditionalclassroomintermsof performancesanddisplays.TEACHToolkit 19 provideschecklistsandabestpracticesaswellasbasic information.UndertheTeachAct,facultycanusecopyrightedmaterialintheironlinecourseswithout seekingtheauthor'spermissionunderthefollowingcircumstances: 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 cnew/research.htm 17 18 19


13 Thecollegemustbeaccreditedandnonprot. Thecollegemusthaveaninternalpolicyonuseofcopyrightedmaterialandoncopyrightlaw. Thecollegemustprovideprintedoronlineresourcesforfacultymembersthatdescribetheirrightsand responsibilitiesundercopyrightlaw. Thematerialmustnothavebeenoriginallyintendedforeducationaluse. Thematerialmusthavebeenlawfullyacquired Thematerialmustbeanintegralpartoftheclasssession. Reasonableprecautionsmustbemadetorestrictaccesstothecopyrightedcontenttostudentsenrolled inthecourse. Otherreasonablecontrolsmustbeusedtopreventstudentsfromdisseminatingthematerialafter viewingit. Ifadigitalversionofthematerialisreadilyavailableforuseattheinstitution,thentheinstructor cannotconvertananalogversiontodigitalformforuseinanonlinecourse. Thecollegemustinformstudentsthatthematerialmaybeprotectedbycopyrightlaw. IntellectualProperty Watchthevideointroduction 20 toCreativeCommonsCC 21 .CCisanonprotorganizationthatprovidesauthorswithfreetoolstomanagetheirintellectualproperty.ACClicenseallowsotherstoreproduce alicensedworkwhentheygivecredittothelicenseholder.TheCCwebsitehasatoolthatgenerates licenses 22 inHTMLformatbasedonchosencriteria.Educauseprovidesgoodsummaryof7ThingsSeries YouShouldKnowAboutCreativeCommons 23 3.3Activity Experience 1.WatchDr.NoReturns! 24 isavideoclipinwhichaninstructorwouldliketousetheTEACHActto providemusicfromvarioussourcestoa"HistoryofMusic"coursethroughapasswordprotectedweb site. 2.UseChecklistfortheTEACHAct 25 todeterminewhetherornotyourplanneduseoflearningmaterials aresuitableasOERisincompliancewiththeTEACHAct. 3.UseoneoftheEduSourceCanadaPublicDomainWizard 26 todetermineifthelearningmaterialsyou plantouseareinthepublicdomain. 4.UseChecklistforFairUse 27 todeterminewhetherornotyourplanneduseoflearningmaterialsare suitableasOERintermsoffairuse. Reect 1.OnceyouhavejoinedOERCommons 28 ,makeyourownpostingtotheOERMattersDiscussions 29 area.ClickonOERMattersIntellectualPropertyForumtoanswerthefollowingquestion: 20 21 22 23 24 25 26 27 28 29


14 CHAPTER3.OERFAIRUSE,COPYRIGHT,ANDTEACHACT "AtthecoreofOERuseandre-usearelegalissuessurroundingthesharing,use,andre-useofOERasa waytosustainandgrowtheOERmovement.Howdoestheshiftfromproprietarytoparticipatoryimpact OER?" Apply 1.ChooseanOERLicense 30 forlearningmaterialsyoumightdevelopandshare. 2.Readabouthowintellectualpropertyandfairuse 31 impactdecisionstopublishscholarlyworksat Connexions 32 .Decideifyouwanttocontribute 33 toConnexions. 3.3.1ReviewQuestions 1.Whatisfairuse? 2.WhatistheTEACHAct? 3.HowdofairuseandtheTEACHActapplytotheuseofOERinyourteaching? 3.3.2Resources TheCopyrightCrashCoursefromtheUniversityofTexasatAustin 34 NewCopyrightLawforDistanceEducation:TheMeaningandImportanceoftheTEACHAct 35 Balancingcopyrightconcerns:TheTEACHActof2001 36 30 31 32 33 34 35 36


Chapter4 OERIdentifyingSources 1 4.1OERToolstoIdentifyandSelect 4.1.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 4.1.2FastFact OpenEducationalResourcesOERaredigitizedmaterialsoeredfreelyandopenlyforeducators,students andself-learnerstouseandre-useforteaching,learningandresearch.TermrstadoptedatUNESCO's 2002ForumontheImpactofOpenCoursewareforHigherEducationinDevelopingCountriesfundedby theHewlettFoundation.-fromWikipedia 2 4.1.3Skills/Objectives Learnerswillbeableto: 1.Identifyresourcesforuseofprimarysourcesaslearningmaterialsintheirownteachingdisciplines. 2.Locateatleastoneprimarysourceforuseinteaching. 3.Developalessonplanusingprimarysources. 4.1.4SuccessIndicators 1.OERaddedtolearner'sownonlinecollectionorportfolio. 2.OERreviewpostedbythelearner. 3.PostedlessonplanthatusesatleastoneprimarysourceasanOERfortheirownteaching. 1 Thiscontentisavailableonlineat. 2 15


16 CHAPTER4.OERIDENTIFYINGSOURCES 4.2Introduction SeveralresourcesareavailableontheInternetthatprovideteacherswithtoolstoidentifyandselectOER foruseininstruction.Someoftheseare:OERCommons 3 ,MERLOT 4 ,Connexions 5 ,FREE:Federal ResourcesforEducationalExcellence 6 ,COLKnowledgeFinder 7 ,andCreativeCommons 8 4.2.1OERCommons OERCommonsisoneofseveralInternetresourceswhereyoucanidentifyandselectOER.Withafree membership,youcanaddtags,ratings,reviews,comments,andfavoritestoyourownportfolio.Youcan posttodiscussion,blog,andwikiareas,andseehowothersareusingOER. OERCommonsiscreatedandproducedbyISKME,theInstitutefortheStudyofKnowledgeManagement inEducation.ItisgenerouslysupportedbytheWilliamandFloraHewlettFoundationandrepresentsdozens ofcollaborationswithOERpartnersandcommunitiesacrosstheglobe. 4.2.2MERLOT MERLOTisapioneerinthedevelopmentofsearchableandshareableonlinelearningmaterialsforhigher education.Thesiteprovidescollection 9 ofpeerreviewed 10 learningmaterialscreatedbyregisteredmembers. MERLOTprovidescriteriaforpeer-reviewoflearningmaterialssubmitted. TakeaTourofthenewMerlot 11 .SearchesinMERLOTcanbesortedbydate,reviewsratings,title, author,andmaterialtype.AtutorialabouthowtosearchforlearningmaterialsusingMERLOTisavailable fromtheSUNYTeaching,Learning,andTechnologyProgram. Connexions Connexions 12 hasarepositoryofOERthataresearchablebysubject,language,popularity,title,keyword, andauthor.Therepositorycontains3925reusablemoduleswoveninto211collections.Thecontentin Connexionscomesintwoformats:modules,whicharelikesmall"knowledgechunks,"andcourses,which arecollectionsofmodules.TheConnexionsCreativeCommonsopenlicense 13 allowsforfreeuseandreuse ofallitscontent. FREE FREE:FederalResourcesforEducationalExcellence 14 provideslinkstohundredsofeducationresources fromorsupportedbytheU.S.government. OERRepositories WikiEducatorprovidesseveraltoolsforidenticationanduseofOERincludingtheExemplaryCollection ofOpeneLearningContentRepositories 15 .LolaExchange 16 provideslearningobjectsandlearningactivities availableforsearchingbytopic,title,discipline,orauthor.DisciplineslistedareMathematics,Scienceand Technology,SocialSciences,Business,Arts,Education,andHumanities.Allmaterialsarereviewedaccordingtostandardcriteriabyvolunteers.Curriki 17 isaglobaleducationandlearningcommunitydedicated 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17


17 toprovidingqualitylearningmaterialsworldwide.Learningmaterialscanbesearchedbythefollowingtopics:Arts,EducationalTechnology,ForeignLanguages,Health,LanguageArts,Mathematics,Science,Social Studies,andVocationalEducation.Are-launchofthesiteisplannedsoontoaddthefollowingnewfeatures: Accessinformation,tools,andresourcesfromthenewmemberhomepage 18 Viewandcommentonothermembers'learningresources 19 Editandcollaborateonlearningmaterials,andbuildcollectionsandresourceswithCurrikulum Builder 20 DevelopcontentintheCurrikulumBuilderwithtemplates 21 Manageyourowncontributionsandcollections,aswellasyouruserproleandblog,usingyour personalizedspaceinMyCurriki 22 COLKnowledgeFinder COLKnowledgeFinder 23 isaservicethatsearchesreliablesourcesofinformationinopenanddistance learningandprovidesorganizationtools.Emphasisisoninternationaldevelopmentgoalslikepovertyalleviation,healthandeducationforall.TheCOLKnowledgeFinderserviceisprovidedbyTheCommonwealth ofLearningCOLwhichisanintergovernmentalorganisationcreatedbyCommonwealthHeadsofGovernmenttoencouragethedevelopmentandsharingofopenlearninganddistanceeducationknowledge, resourcesandtechnologies.Tousethesearchtool,clickon"Search".Thenfollowtheguidelinesonthe screen.MoredetailsareavailablefromtheOrientation 24 .Trainingvideos 25 foreectivesearchinganduse oftheCOLKnowledgeFindertoolsareavailable. CreativeCommons CreativeCommons 26 providesawaytondshareablephotos,music,text,books,andothereducational materialutilizingCreativeCommonsenabledsearchservicesatGoogle,Yahoo!,Flickr,,Owlmusic, andSpinXpress.AContentCurators 27 wikiareaisavailablethatprovidesalistofcuratorsofCreative Commons-licensedcontent.Usersareinvitedtocontributetoandeditthislistthemselves. Edu2.0 Takeatour 28 ofEdu2.0 29 todiscoverallbrowsablesharedcoursecontentorganizedbytopic.Resources includequizzes,webquests,presentations,projects,experiments,courses,classes,curricula,audio,video, powerpoint,excelandotherkindsofattachments. 4.3Activity Experience 1.Reviewthecriteria 30 availablefromMERLOT'sPeerReviewprocess. 2.GotoOERCommons 31 ,MERLOT 32 ,Connexions 33 ,andFREE 34 tosearchforcontentinyour teachingdiscipline. 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34


18 CHAPTER4.OERIDENTIFYINGSOURCES 3.ViewtheCNBCvideointerview 35 withScottMcNealyaboutCurriki. 4.VisittheOWLInstitutePortal 36 tosearchforresources,peopleandcommunities;browsecoursesand homepagesorcreateyourown. Reect 1.ParticipateinthelatestOERCommonsSurvey 37 andchecktheresults. 2.VisittheOERMattersDiscussions 38 toreadandpostcommentsabouttheHowandWhyofOER: "Shareyourthoughts,experiencesandexpertiseontheOERmovement,itschallengesandpotentialimpact. WhydoesOERmatter,howdoesitwork,andwhatarethepossibilitiesforthefutureofuseandre-useof openeducationcontent?" Apply 1.ReviewlearningmaterialsatOERCommons 39 .TypekeywordsintheSearch 40 boxintheupper rightcornerofthescreentoidentifyatleastoneOERtoreview. ClickonSavethisSearch. SortbyRating.ClickonthetitleoftheOERyouwanttoreview,thenclickonViewItem. ClickonRateItemtogiveityourrating. ClickonReviewItemtosubmityourreview. 2.SubmityourreviewofsomelearningmaterialsatMERLOT 41 .Youwillneedtobecomeamember 42 beforeyoucansubmityourreview. 3.Ifyouknowofagoodsourceofopeneducationalresources,submittheInternetaddressforinclusion ontheCOLKnowledgeFindersubmit-a-sitepage 43 4.3.1ReviewQuestions 1.WhataresomeoftherepositorieswhereOERcanbelocatedandreviewed? 2.WhattoolsandfeaturesareavailabletoidentifyandselectOER? 4.3.2Resources ExemplaryCollectionofOpeneLearningContentRepositories 44 SearchingforPublicDomainMaterialsontheWeb 45 OpenEducationalPracticesandResources.OLCOSRoadmap2012 46 35 36 37 38 39 40 41 42 43 44 45 46


Chapter5 OERDiscipline-SpecicSources 1 5.1OERDiscipline-SpecicSources 5.1.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 5.1.2FastFact Learningobjects 2 are: Web-based,self-contained,smallchunksoflearning smallenoughtobeembeddedinalearningactivity,lesson,unitorcourse exible,portable,andadaptable,andcanbeusedinmultiplelearningenvironmentsandacrossdisciplines 5.1.3Skills/Objectives Learnerswillbeableto: 1.IdentifyresourcesforlocatingOERintheirownteachingdisciplines. 2.Developalessonplanusingadiscipline-specicOER. 5.1.4SuccessIndicators 1.LessonplandevelopedwhichusesOER. 1 Thiscontentisavailableonlineat. 2 19


20 CHAPTER5.OERDISCIPLINE-SPECIFICSOURCES 5.2Introduction InadditiontosimplysearchingforPublicDomainMaterialsontheWeb 3 ,anumberofOERandlearning object 4 repositoriesofontheinternetprovideameanstosearchforlearningmaterialsbytopicandacademic subjectmatter.TheCenterforInternationalEducationatUW-Milwaukeeprovidesathoroughlistoflearning objectrepositories 5 Otherrepositoriesinclude: Wisc-OnlineWisconsinOnlineResourceCenter 6 GatewaytoEducationalMaterials 7 Co-operativeLearningObjectExchangeCLOE 8 WikipediaListofGraphicsinthePublicDomain 9 WikimediaPublicDomainImages 10 CreativeCommons 11 LibriVox 12 ibiblio 13 OAIstercatalogofdigitalresources 14 PhotosatFlickrLicensedunderCreativeCommons 15 SubjectSpecicImagesforEducationalUsefromUniversityofMichigan 16 GCSEBitesize 17 Otherdiscipline-specicsourcesofOERinclude: Archeology Archeology 18 ArtHistory ArtHistoryimagesfromUniversityofMichigan 19 ComputerScience XML:ManagingDataExchange 20 ProgrammingfromtheGroundUp 21 Learning2.0 22 Economics 3 4 5 6 7 8 9 10 11 12 13 14 15 16;g=art-ic 17 18 19 20 21 22


21 EconPort 23 Marketing 24 CorporateFinance 25 PrinciplesofEnterpreneurship 26 U.S.EconomyinBrief 27 OutlineoftheU.S.Economy 28 PoliticalEconomy 29 NewRulesfortheNewEconomy 30 IntroductiontoEconomicAnalysis 31 French FrenchLearningObjectRepositoryforEducation 32 Health JohnsHopkinsCenterforPublicHealthPreparedness 33 CDCPublicHealthImageLibrary 34 MedlinePlusInteractive 35 TheChemistryofHealth 36 HIVMedicine2007 37 FreeMedicalInformation 38 History LibraryofCongress,AmericanMemory 39 DigitalHistory:AmericanHistory 40 HarvardUniversityLibraryOpenCollectionsProgram 41 HistoryMatters 42 InternetModernHistorySourcebook 43 UniversityofCalifornia,AmericanWestCollection 44 WorldHistorySources 45 AmericanPoliticalHistoryimages 46 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46


22 CHAPTER5.OERDISCIPLINE-SPECIFICSOURCES EASEHistory 47 HypertextHistory:OurOnlineAmericanHistoryTextbook 48 49 Hippocampus-clickonU.S.history,thenclickonTextbookstab 50 OralHistories 51 America'sStoryJumpBackinTime 52 AmericanMemoryTimeline 53 FreedomAU.S.Historywebisodes 54 OutlineofU.S.History 55 AboutAmerica:WomenofInuence 56 Literature ElectronicTextPublicLibraryOnlineTexts 57 Children'sLiterature 58 U.S.LiteratureinBrief 59 Math DrexelUniversity,MathForum 60 EisenhowerNationalClearinghouse 61 AMSERtheAppliedMathandScienceEducationRepository 62 CauseWeb 63 Math 64 LinearAlgebra 65 AFirstCourseinLinearAlgebra 66 IntroductiontoProbability 67 ElementsofAbstractandLinearAlgebra 68 LinearMethodsofAppliedMathematics 69 MultivariateCalculus 70 MathematicsundertheMicroscope 71 Philosophy 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 chance/teaching_aids/books_articles/probability_book/book.html 68 ec/book/ 69 70 cain/notes/calculus.html 71 avb/micromathematics/downloads


23 StanfordUniversity,EncyclopediaofPhilosophy 72 FormalLogic 73 Physics OpenTextProjectPhysics 74 Physics 75 PhysicsLightandMatter 76 Physics 77 PoliticalScience DemocracyinBrief 78 HowtheU.S.isGoverned 79 OutlineoftheU.S.LegalSystem 80 IntroductiontoHumanRights 81 OutlineofAmericanGeography 82 Psychology ePsych 83 Science Illumina 84 AccessExcellence 85 CarnegieMellonUniversity,ChemistryCollective 86 UniversityofWashington,HighSchoolHumanGenomeProgram 87 NationalHumanGenomeResearchInstitute 88 NationalScienceDigitalLibrary 89 UniversityofColorado,PhysicsEducationTechnology 90 NationalScienceTeachersAssociation,ScienceTeachers'GrabBag 91 AMSERtheAppliedMathandScienceEducationRepository 92 Teacher'sDomain 93 Bacteriology 94 72 73 74 75 http://physics/ 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94


24 CHAPTER5.OERDISCIPLINE-SPECIFICSOURCES PhysicalGeography 95 ThePhysicalEnvironmentIntroductiontoPhysicalGeography 96 IntrotoPhysicalOceanography 97 Biochemistry 98 Biology 99 TheStructuresofLifebiology 100 Chemistry 101 HumanPhysiology 102 TheNewGenetics 103 EnvironmentalScience 104 IntroductiontoPhysicalOceanography 105 InsidetheCell-Biology 106 CuriosityCreatesCuresTheValueandImpactofBasicResearch 107 MedicinesbyDesignpharmacology 108 Sociology IntroductiontoSociology 109 Spanish Spanish 110 5.3Activity Experience 1.Findlearningmaterialsinyourteachingdisciplineateachofthefollowingrepositories.Notewhether ornotarevieworratingofthelearningmaterialsisavailable. MERLOT 111 Wisc-OnlineWisconsinOnlineResourceCenter 112 GatewaytoEducationalMaterials 113 Co-operativeLearningObjectExchangeCLOE 114 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114


25 WikipediaListofGraphicsinthePublicDomain 115 WikimediaPublicDomainImages 116 FREE:FederalResourcesforEducationalExcellence 117 CreativeCommons 118 Reect Completeoneofthefollowingreectionactivities: 1.JoinMERLOT 119 ,identify 120 learningmaterialsinyourteachingdiscipline,thenaddanassignment toalearningobjectorreviewalearningobject. 2.JoinOERCommons 121 ,thenmakeyourownpostingtotheOERMattersDiscussions 122 area.Click onOERMattersLocalizationForumtoanswerthefollowingquestion: "ParticipateindiscussionsabouthowopeneducationcontentislocalizedandhowthecreationofOER facilitatesorimpedesmakingcontentbecontext-specic.Howiscontentlocalizedattheindividual,school, cultural,andnationallevel,andwhatarethebenets?" Apply 1.IdentifythemostusefulsourcesofOERforuseinyourteachingdiscipline. 2.Developalessonplanusingthesediscipline-specicsources.PostyourlessonplantoMERLOT 123 5.3.1ReviewQuestions 1.Whatisalearningobject? 2.WhatarethemostusefulsourcesofOERinyourteachingdiscipline? 3.WhatcriteriacanbeusedtoassesstheusefulnessoftheseOERs? 5.3.2Resources TheInstructionalUseofLearningObjects:OnlineVersion 124 AKEEPToolkitCaseStudy:PromotingUseofMERLOTLearningObjects 125126 bySharing Authors'andUsers'PedagogicalKnowledgeandExperience 127 Allaboutlearningobjects 128 LearningObjects-EduCause 129 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129




Chapter6 OERPublicDomainTextbookSources 1 6.1OERSourcesofPublicDomainTextbooks 6.1.1LessonComponents FastFact Skills/Objectives SuccessIndicators Introduction Activity Reviewquestions Resources 6.1.2FastFact 6.1.3ProjectGutenberghas20,000freebooksinitsOnlineBookCatalogand istheoldestproduceroffreeebooksontheInternet. 6.1.4Skills/Objectives Learnerswillbeableto: Locatesourcesofpublicdomaintextbooks. Establishcriteriaforselectionofpublicdomaintextbooks. 6.1.5SuccessIndicators Lessonplandevelopedthatincorporatesuseofapublicdomaintextbook. 6.2Introduction Facultyoftenndthetaskofselectingreadingmaterialsortextbooksforacoursedaunting.Instructorscan easetheselectionprocessbyestablishingandfollowingcriteriasuchasquantity,quality,accuracy,currancy, 1 Thiscontentisavailableonlineat. 27


28 CHAPTER6.OERPUBLICDOMAINTEXTBOOKSOURCES readinglevel,relevance,andreliability.Whetherduetopassionforthecoursetopicorsimplyhastydecisionmaking,someinstructorsmakethemistakeofselectingandassigninganoverwhelmingamountofreading fortheirstudents.Tryestimatinghowmanyminutesstudentswillneedtocompleteeachreadingassignment andadjustyourselectionoflearningmaterialsaccordingly.Anotherconcernisthatinformationprovidedto students,especiallyinprintedtextbooks,canquicklybecomeoutdated. Criteria/GuidelinesforSelectionofMaterials Qualityofcontent,literarymeritandformat Timeliness Favorablereviews Permanence/lastingvalue Authority:author Scope Physicalquality Format:print,CD-ROM,online,etc. readinglevel TwomajoreortstopromotethedevelopmentandsharingofpublicdomaintextbooksareConnexions 2 andWikibooks 3 .FreeTextbookSearch 4 allowsuserstosearchforfreetextbooksin113sitesinEnglish, German,French,DutchorSwedish. Connexions 5 isaprojectatRiceUniversitysupportedbytheHewlettFoundationtopromotecollaborative development,freesharing,andrapidpublishingofscholarlycontentontheWeb.Contentisorganizedin smallmodulesthatareeasilyconnectedintolargercourses.Allcontentisfreetouseandreuseunderthe CreativeCommons"attribution"license. Wikibooks 6 isaWikimediaprojectstartedin2003withthemissiontocreateafreecollectionofopencontenttextbooksthatanyonecanedit. CollectionsofbooksthatarefreelyavailableincludeProjectGutenberg 7 ,ReadPrint 8 ,Bartleby 9 OnlineBooks 10 ,ElectronicTextService 11 ,andtheOpenBookProject 12 ProjectGutenberghas20,000freebooksinitsOnlineBookCatalogandistheoldestproduceroffree ebooksontheInternet.ThemissionofProjectGutenberg 13 istoencouragethecreationanddistribution ofeBooks.Inaneorttopromoteinterculturalunderstanding,theWorldDigitalLibrary 14 planstomake availablesignicantprimarymaterialsfromculturesaroundtheworld,includingmanuscripts,maps,rare books,musicalscores,recordings,lms,prints,photographs,architecturaldrawings,andothersignicant culturalmaterials. TheAssayer 15 displaysalistoftextbooksthatarefreelyavailableinmanydisciplines.Foranexample, seetheseintroductoryphysicstextbooks 16 andLiberte 17 ,arst-yearcollegelFrenchtextbook.TheInternet PublicLibrary 18 providesacomprehensivelistofbooksthatareavailableontheinternet.Avideotour 19 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19


29 ofthesiteisavailable.ExamplesoffreeavailableeBooksfromBartleby 20 : TheHarvardClassicsShelfofFiction 21 TheOxfordShakespeare 22 AnatomyoftheHumanBody 23 TheWorldFactbook,2003 24 OnlineSapiens 25 TwosourcesofaudiobooksinthepublicdomainareLibriVox 26 andLoudlit 27 .LibriVox 28 providesfree audiobooksfromthepublicdomainwithseveraloptionsforlistening.Loudlit 29 providesatextofgreat literarymasterpiecesaswellashighqualityaudiotohelpreadersimprovetheirspelling,punctuationand paragraphstructure.Loudlitliteratureincludeschildren'sstories,poetry,shortstories,andnovels. Othersourcesoftextbooklearningmaterialsaredigitalcollectionsofinstitutionalrepositories 30 atuniversitiesandself-archiving 31 byauthorsontheinternet.Someoftheseinclude: ScholarshipoftheCaliforniaDigitalLibrary 32 MITtextbooks 33 HofstraUniversityHofprints-HofstraUniversityE-PrintArchive 34 CornellRace,Ethnicity,andReligionProject 35 6.3Activity Experience 1.IdentifysomelearningmaterialsatProjectGutenberg 36 2.GotoWikibooks 37 toidentifytextbooksinyourteachingdiscipline. 3.ConsiderusingWikibooksforaclassproject 38 ;readtheguidelines. 4.Takeatour 39 ofConnexionstondoutifithasresourcesofusetoyouinyourteaching. Reect 1.Createanaccount 40 atProjectGutenbergthenpostyourownreviewofatextbook. Apply 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40


30 CHAPTER6.OERPUBLICDOMAINTEXTBOOKSOURCES 1.DistributedProofreaders 41 .HelpcreateaneBook. 2.Contribute 42 toWikibooksbyeditingpages,creatingnewpages,publicizingWikibooks,andmany otherways,suchasdonating. 6.3.1ReviewQuestions 1.Whataretheadvantagesanddisadvantagestousingpublicdomaintextbooksforteaching? 2.Whatarethemostusefulsourcesofpublicdomaintextbooksinyourdisciplineandwhy? 6.3.2Resources ProjectGutenberg 43 The7ThingsYouShouldKnowAboutE-Books 44 41 42 43 44


Chapter7 OERUseofPrimarySources 1 7.1OERUseofPrimarySources LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources FastFact TheLibraryofCongressisthenation'soldestfederalculturalinstitutionandservesastheresearcharm ofCongress.Itisalsothelargestlibraryintheworld,withnearly130millionitemsonapproximately530 milesofbookshelves.Thecollectionsinclude:booksandotherprintedmaterials,soundandmotionpicture recordings,photographs,maps,andmanuscripts.Reference:OceoftheLibrarian 2 7.1.1Skills/Objectives Learnerswillbeableto: 1.Identifyresourcesforuseofprimarysourcesaslearningmaterialsintheirownteachingdisciplines. 2.Locateatleastoneprimarysourceforuseintheirownteaching. 3.Developalessonplanusingprimarysources. 7.1.2SuccessIndicators 1.LearnerwillpostalessonplanthatusesatleastoneprimarysourceasanOERfortheirownteaching. 7.2Introduction AccordingtotheNationalArchives 3 ,theuseofprimarydocumentsaslearningmaterialspromotes 1 Thiscontentisavailableonlineat. 2 3 31


32 CHAPTER7.OERUSEOFPRIMARYSOURCES 1.Studentawarenessthatallwrittenhistoryissubjectiveinthesensethatitreectsanauthor'sinterpretationofpastevents,and 2.Importantanalyticalskills. Primarysourcesinclude: personalrecordsbirthcerticates,deathcerticates,passports,driver'slicenses federalcensusgures newspapers localgovernmentles letters,personaldiariesandmemoirs drawingsandphotographs oralhistories artifacts courttranscripts CompletetheIntroductoryLesson 4 aboutprimarysourcesavailablefromtheAmericanMemoryprojectat theLibraryofCongress. TheSmithsonianSourceTeachingwithPrimarySources 5 isanotherusefulresourceforteachingAmerican History.Itincludesvideos,lessonplans,andsearchablecollectionofprimarydocuments. AmericanRhetoric 6 makesaudioclipsofvariousspeechesavailablefromaSpeechBankviatheinternet. WebsitecontentatAmericanRhetoric 7 isfreeforeducationalusesundertheFairUseexceptionwith attribution. 7.3Activity Experience Completeatleasttwoofthefollowingactivities: 1.ReviewoneofthelessonplanspostedattheNationalArchive'sTeachingWithDocuments:Lesson Plans 8 andlookattheAnalysisWorksheets. 2.Createanaccount 9 attheSmithsonianSourceTeachingwithPrimarySourcessothatyoucanreview lessonsandaddthemtoyourowncollection.ClickonHistoricalPerspectives 10 tondatopicof interesttoyouandndDBQtoaddtoyourcollection. 3.Createanaccount 11 andlogintothePrimarySourcesothatyoucansetupaPortfolioforstoring primarydocumentsthatyouhaveidentiedandselectedforuse.Contribute 12 aLibraryofCongress resourcelinkforyoursubjectarea.SearchtheLearningExperiencesCollection 13 ,selectaLearning Experienceofinterest,andreviewit. 4.CreateanintroductoryactivityforyourownstudentsfollowingtheinstructionspostedatPrimary SourceLearning 14 Reect PostyourresponsestothefollowingquestionsinyourcourseDiscussionarea: 4 5 6 7 8 9 10 11 12 13 14


33 Howwouldthelearningexperiencebedierentforastudentcompletingalessonthatusesprimary sourcesversusthesamelessonthatusesatextbook? Whatchallengesmightyouencounterasateacherusingprimarysourcesinsteadoftextbooks? Apply 1.Identifyasetofprimarysourcesforuseinyourteaching. 2.Developalessonplanusingtheseprimarysources.PostyourlessonplantoMERLOT 15 orOER Commons 16 7.3.1ReviewQuestions 1.Whataretheadvantagesanddisadvantagestousingprimarysourcesforteaching? 2.Whatarethemostusefulresourcesforteachingwithprimarysourcesinyourdisciplineandwhy? 7.3.2Resources PrimarySourceLearningHandbook 17 UseofPrimarySourcesinLibraryofCongress 18 NationalArchivesLessonPlans 19 LibraryofCongress 20 PrimarySourceLearning 21 Usingdigitizedprimarysourcematerialsintheclassroom 22 15 16 17 18 19 20 21 22




Chapter8 OERDevelopment 1 8.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 8.2FastFact "Universaldesign 2 isthedesignofproductsandenvironmentstobeusablebyallpeople,tothegreatest extentpossible,withouttheneedforadaptationorspecializeddesign.Theintentofuniversaldesignisto simplifylifeforeveryonebymakingproducts,communications,andthebuiltenvironmentmoreusablebyas manypeopleaspossibleatlittleornoextracost.Universaldesignbenetspeopleofallagesandabilities." -CenterforUniversalDesign 3 8.3Skills/Objectives Learnerswillbeableto: 1.UsetoolsandresourcestodevelopOER. 2.IdentifytherequirementsforOERinordertocomplywithADASection508requirements. 8.4SuccessIndicators 1.OERdevelopedbythelearneraddedtolearner'sownonlinecollectionorportfolio. 1 Thiscontentisavailableonlineat. 2 3 35


36 CHAPTER8.OERDEVELOPMENT 8.5Background AsnotedbyToddRichmond 4 ataDIYMediaseminarattheAnnenbergCenterin2006,thecommonsbasedpeerproduction 5 ordo-it-yourselfsharedmediaproductionaspectofOERmaywellbeacatalystfor innovationonceOERgoesviral 6 .SeveralresourcesareavailableontheInternetthatprovideteacherswith toolstoshareandcollaborateonthedevelopmentofOERforuseininstruction.Someoftheseare:Rice Connexions,OpenLearningContentObservatoryServicesOLCOS,WikiEducator,andWikiBooks. Accessibility CertainaccessibiiltyrequirementsmustbeaddressedwhendevelopingOERforelectronicdisseminationto students.Bylaw,ADASection508 7 ,learningmaterials,includinginterfaces,images,sounds,multimedia elements,andallotherformsofinformation,mustbemadeavailableforusedbyanyone,regardlessof disability.DetailedinformationaboutaccessibilityguidelinesareavailableatWebAccessibilityInitiative WAI 8 andtheAmericanswithDisabilitiesActADA 9 .A-Prompt 10 isanaccessibilityevaluationand repairtoolfromtheUniversityofTorontoincooperationwiththeTraceCenterandCAST.Ademonstration versionisavailablefordownload.A-Promptlistswhatitconsiderstobeerrorsandoersachancetocorrect eachone.UtahStateUniversity,WebAccessibilityinMindWebaim 11 oersvarious"HowTo"information andsupportoncreatingaccessiblewebsites.WebauthorscanndaSectionchecklist,sampleHTMLmarkup andvariousarticlesandcoursesonaccessiblewebdesign.TheAccessibleWebPublishingWizard 12 simplies thetaskofconvertingPowerPointpresentations,Worddocuments,andinthefutureExcelspreadsheetsto accessibleHTMLthroughaneasy-to-useuserinterfaceandautomationofmanyofthedetailsofconversion. 8.5.1RiceConnexions TakeatourofConnexions 13 .ConnexionswasstartedatRiceUniversityin1999topromoteinnovative waystowrite,edit,publish,andusetextbooksandotherlearningmaterials.Connexionparticipantsare encouragedto: Createeducationalmaterialsandcontributethemtotherepository 14 Riporcopythematerialandcustomizeit Mixthematerialtogetherintonewbooksandcourses Burnorcreatenishedproductssuchase-learningwebcourses,CDroms,andevenprintedbooks Open-accesssoftwaretoolsandfree-usematerialsareavailableviatheCreativeCommonsAttributionlicense 15 tofacilitatecollaborationandsharing.AtConnexions,instructorscaneasilycollaborate 16 onOER developmentinavarietyofrolesincludingcoauthors,maintainers,workgroupmembers,suggesters,andusers ofderivedcopies.InstructorscanupdatetheirOERcoursematerialandmakeitavailablefordistribution quickly. OWLInstitute InadditiontoprovidinguserswithconnectionstoOERresourcesandcommunities,theOWLInstitute Portal 17 toprovidestheopportunityforuserstodevelopandsharetheirownOERresources.Contactthe OwlInstitutetoreceive"creator"or"teacher"accesstocoursesandpages. 4 5 6 7 8 9 10 11 12 13 14 15 16 17


37 DigitalUniverse TheDigitalUniverse 18 seeksstewardsandvoluntaryconsultantstoassist 19 intheireorts"toorganizethe sumtotalofhumanknowledgeandmakeitavailabletoeveryone." LeMill TourLeMill 20 tondavarietyofopenlearningmaterials.JointheLearningMillcommunitytocontribute andshareyourownlearningmaterials.FAQs 21 describehowtousethesite. MoreTools OLCOS,theUK'sOpenLearningContentObservatoryServices 22 projectcontainsa30minutetutorial abouthowtoproduceOER 23 .Thistutorialprovidesinformationandpracticaltasksincreatingandmodifyingopencontentinopenprocessaswellasformatsthatcanbepublishedasopeneducationalresources andtools,thatsupportthisprocess.Wikieducator 24 promotescollaborativeauthoringanduseofOERby providingtoolsusingwikitechnologiessuchaseXe 25 .TheWikideducatorContentDevelopmentProject 26 isanopportunityforeducatorstocontributeandsharetheirOER.WikibooksWikibooks 27 isaWikimedia 28 projectthatstartedin2003withthegoaltocreateafreecollectionofopen-contenttextbooksthatanyone canedit.Sinceitsinception,volunteershavewrittenover25,000modulesinamultitudeoftextbooks.If you'reaninstructorplanningonusingWikibooksforaclassproject,readguidelinesforclassprojects 29 Takeatour 30 oftheInstructionalArchitect 31 ,aserviceoftheNationalScienceDigitalLibrary,tondout howyoucanuseittonddiscipline-specicOER,organizeandmodifythoseresourcesintoactivitiesfor yourstudents,andmakethosenewactivitiesavailabletoavarietyofaudiences.ccMixter 32 isacommunity musicsiteprovideopportunitiestocollaboratewithotherstore-purposeandmixexistinglearningmaterials licensedunderCreativeCommons.Send2Wiki 33 isanewtoolthatletsuserseasilysendacopyofawebpage toawikiforremixing.Wikia 34 areprovidesfreewikihostingdesignedexpresslyforpromotingreuseofopen contentwiththeMediaWikisoftware.AllcontentonWikiaisperpetuallylicensedundertheGNUFree DocumentationLicense. 8.6Activity Experience CreativeCommons UseCreativeCommons 35 tosearchforlearningmaterialsthatyouarefreetouse,remix,repurpose,etc. Wikieducator WatchashortvideoabouthowtocreateanaccountatWikieducator 36 .Registerforyouraccount. OERCommons 1.JoinOERCommons.GototheOERCommons 37 website,thenclickonJoinNow. 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37


38 CHAPTER8.OERDEVELOPMENT 2.ClickonStartMyOERPortfolio. 3.VisitSharedPortfolios 38 postedtotheOERCommonswebsitetoseetoseehowotherssearch,use, andinteractwithOER. Reect PosttoyourcourseDiscussionareainresponsetothefollowingquestions: 1.WhatisthebestwaytopromotedevelopmentofOERamongeducators? 2.WhoshouldberesponsibleforensuringthatOERaredevelopedwithADASection508accessibilty requirementsinmind? Apply MERLOT 1.ViewtheGalleryofSampleMERLOTFromtheAuthorSnapshots 39 2.GototheMERLOTwebsite. 3.ViewafewPersonalCollectionspostedbyothers. 4.BecomeamemberofMERLOT 40 5.CreateyourownMERLOTPersonalCollection 41 Wikibooks 1.CreateanaccountatWikibooks 42 2.GotoWikibooksSandbox 43 tocreateawiki. Connexions Createamodule 44 toshareatConnexions 45 Afterregistering,reviewtheNewAuthorGuide 46 YoucanimportaWorddocumentorusetheConnexionsEdit-in-Placetooltocreateyourmodule. 8.6.1ReviewQuestions 1.Whataresomeoftheresourcesyoucanusetoremix,repurposeOER,anddevelopyourownOER? 2.WhatisnecessarytoensurecompliancewithADASection508accessibilitylawswhendevelopingOER forelectronicdisseminationtostudent? 8.6.2Resources CollaborativeDevelopmentofOpenContent 47 WikiEducator:Memoirs,Myths,MisrepresentationsandtheMagic 48 OERDevelopmentandPublishingInitiatives 49 38 39 40 41 42 43 44 45 46 47 48 49


39 OpenEducationalResourcesAnonymityvs.Specicity 50 AdvancingSustainabilityofOpenEducationalResources 51 50 51




Chapter9 OERDelivery,Storage,and Organization 1 OERDelivery,StorageandOrganization 9.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 9.2FastFact "AsofJanuary2006,therewereover3,200modulesandover150coursesinConnexions.Volunteersaretranslatingmodulesandcoursesintoawidevarietyofdierentlanguages,includingSpanish,Japanese,Italian, Chinese,Portuguese,andThai."-OECD 2 9.3Skills/Objectives Learnerswillbeableto: 1.CourseparticipantswillusevarioustoolsaswellaspeercollaborationtobuildaPublicDomain MaterialsPortfolioofdiscipline-specicpublicdomainmaterialssuitableforuseintheirownteaching. 2.Determinecost-eectiveprintingoptionsforstudents. 9.4SuccessIndicators 1.OERaddedtolearner'sownonlinecollectionorportfolio. 2.OERreviewpostedbythelearner. 1 Thiscontentisavailableonlineat. 2 41


42 CHAPTER9.OERDELIVERY,STORAGE,ANDORGANIZATION 9.5Introduction SeveralresourcesareavailableontheInternetthatprovideteacherswithtoolstoorganize,deliver,andshare OERforuseininstruction.Someoftheseare:MERLOT,Connexions,andWikiEducator.Instructorscan deliverdeliverOERtostudentsineitherdigitalorprintformats.OLCOS,theUK'sOpenLearningContent ObservatoryServices 3 projectcontainsa30minutetutorialabouthowtopublishandshareOER 4 9.5.1OERCommons OERCommons 5 allowsmemberstoshareportfolios.Yourpersonalizedportfolioallowsyouquickaccess toyourprevioususeoftheOERCommons.AsyouengagewithOERcontentbysubmittingratingsand reviews,yourportfolioiscreatedautomatically.Ifdesired,youcanshareyourportfoliowithothersand allowotherstobuildonwhatyouknow.Also,youcanviewothers'portfoliostoseehowpeoplearending, using,andinteractingwithOER. 9.5.2MERLOT ReadaboutMERLOT'sPersonalCollections 6 .Buildanddisplayyourportfolio,asitevolvesforthe durationofyourstudents'courseparticipation,usingtheFromtheAuthorSnapshots. WikiEducator WikiEducatorprovidesanContentDevelopmentProject 7 asanopportunityforinsturctorstocontribute andsharetheirOER. Connexions FundedbytheWilliamandFloraHewlettFoundation,Connexionsispartofabroadereorttousethe internetforinnovativedeliveryofeducationalmaterials.AtConnexions,instructorscansetupacollection oflearningmaterials.Acourse/collectioncontainsseveralConnexionsmodulesthatyougrouptogetherin aspecicorder.ThesemoduleswillappearaschaptersinasingledocumenttoConnexionsvisitorswho viewyourcourse/collection. RiceUniversity'sConnexions 8 provideson-demandprintingwithQOOPInc.thatwillallowstudents andinstructorstoorderhigh-quality,hardboundtextbooksfromConnexionsviatheinternetforaordable prices. IntheConnexionsCommunityCollegeInitiative,thetop10communitycollegecourses,includingEnglish composition,collegealgebra,introductiontopsychology,generalchemistry,arebeingdeveloped.These courseswillbeavailableforfreeinConnexionsandinalow-costprintedform.Underthismodel,readers canaccessallbooksonlineforfree,andtheywillpayonlyiftheywantaprintedbook,whichthey'llorder onlineandforhomedelivery.Connexionsalsoplanstodevelopacatalogofthe10most-popularcommunity collegetextbooks,whichalsowillbefreeforonlineviewingandcostlessthan$30whenpurchasedas hardboundbooks.Connexionsplanstooermorethan100titlesforonlinepurchasebyyear'send. DeliveryofCourseMaterials OERdeveloperscandistributetheirlearningmaterialsviatheinternetusingthetoolsandresources providedforfreetoeducatorsatWordCircle 9 ,NiceNet 10 ,Digication 11 ,orEpsilen 12 3 4 5 6 7 8 9 10 11 12


43 PublishingLearningMaterials QOOP 13 'sprint-on-demand 14 servicewillallowConnexionsuserstoordercustomizedcourseguidesand avarietyoffullydevelopedConnexionstextbooks.Standardpaperbackswilltakejust3-5daystoproduce andship,andtraditionalhardbackswilltakeaboutaweektoproduce.QOOPshipsdirectlytocustomers. Lululetsyoupublishandsellandprintondemandbooks,e-books,onlinemusic,images,customcalendars safariTakeatourofLulu 15 tondouthowtopublishusingtheirservices.Lulumakes20%oftotalcostofthe textbookyoupublishusingtheirservices.SafariU 16 allowsfacultytocreate,publishandsharecustomized comuterscienceandinformationtechnologycoursematerials.SafariUwasdevelopedbyO'ReillyMedia inconjunctionwithsubstantialfeedbackfromeducatorsandtrainers.SafariUallowsmemberstoselect chaptersorsectionsfromO'Reillybooksandarticlestoincludeincustomprintbooksandonlinelearning resourcesthatstudentscanaccessdirectly.Otherprint-on-demandservicesincludeIllumina 17 andexlibris 18 Activity Experience OERCommons 1.Ifyouhaven'talreadydoneso,joinOERCommons.GototheOERCommons 19 website,thenclick onJoinNow. 2.ClickonStartMyOERPortfolio. 3.VisitSharedPortfolios 20 postedtotheOERCommonswebsitetoseetoseehowotherssearch,use, andinteractwithOER. MERLOT 1.ViewtheGalleryofSampleMERLOTFromtheAuthorSnapshots 21 thenndouthowtocreateyour ownAuthorSnapshot 22 usingtheKEEPToolkit 23 2.GototheMERLOTwebsite. ViewafewPersonalCollectionspostedbyothers. CreateyourownMERLOTPersonalCollection 24 Connexions 1.CreateaCourse/Collection 25 attheConnexionswebsite. Reect PostyourresponsetothefollowingtoyourcourseDiscussionarea: 1.WhatisthebestwayforyoutodisseminateOERtoyourstudents? 2.DoyouwanttoshareyourOERforpublicuseandrepurposing?Whyorwhynot? Apply 1.Createamodule 26 toshareatConnexions. 2.DeterminethecosttoyourstudentstopurchaseOERforyourcourseusingLulu 27 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27


44 CHAPTER9.OERDELIVERY,STORAGE,ANDORGANIZATION 9.5.3ReviewQuestions 1.Whataresomeoftheprint-on-demandservicesfordisseminatingOER? 2.WhattoolsandfeaturesareavailabletodeliverOER? 9.5.4Resources CaseStudy:PromotingUseofMERLOTLearningObjectsbySharingAuthors'andUsers'Pedagogical Knowledge 28 OpenEducationalPracticesandResources.OLCOSRoadmap2012 29 WhatMakesanOpenEducationProgramSustainable:TheCaseofConnexions 30 28 29 30


INDEX 45 IndexofKeywordsandTerms Keywords arelistedbythesectionwiththatkeywordpagenumbersareinparentheses.Keywords donotnecessarilyappearinthetextofthepage.Theyaremerelyassociatedwiththatsection. Ex. apples,1.1 Terms arereferencedbythepagetheyappearon. Ex. apples,1 D discipline,5 F fairuse,3 O oer,1,2,4,5,7, 9 opencourseware,2 openeducationalresources,1,4, 5,7,8,9 P primarysources,7 R repositories,9 S sources,4 T textbookalternatives,6


46 ATTRIBUTIONS Attributions Collection: IntroductiontoOpenEducationalResources Editedby:JudyBaker URL: License: Module:"OERIntroduction" By:JudyBaker URL: Pages:1-5 Copyright:JudyBaker License: Module:"OEROpenCourseware" By:JudyBaker URL: Pages:7-9 Copyright:JudyBaker License: Module:"OERFairUse,Copyright,andTEACHAct" By:JudyBaker URL: Pages:11-14 Copyright:JudyBaker License: Module:"OERIdentifyingSources" By:JudyBaker URL: Pages:15-18 Copyright:JudyBaker License: Module:"OERDiscipline-SpecicSources" By:JudyBaker URL: Pages:19-25 Copyright:JudyBaker License: Module:"OERPublicDomainTextbookSources" By:JudyBaker URL: Pages:27-30 Copyright:JudyBaker License:


ATTRIBUTIONS 47 Module:"OERUseofPrimarySources" By:JudyBaker URL: Pages:31-33 Copyright:JudyBaker License: Module:"OERDevelopment" By:JudyBaker URL: Pages:35-39 Copyright:JudyBaker License: Module:"OERDelivery,Storage,andOrganization" By:JudyBaker URL: Pages:41-44 Copyright:JudyBaker License:


IntroductiontoOpenEducationalResources Aself-pacedtutorialaboutopeneducationalresourcesasalternativestotextbooksforcollegeteachers. VisitorsareinvitedtoactivelyparticipatebypostingActivityReectionentriestothecourseDiscussion area.Thistutorialhas9Lessonsorganizedinto3Units:Background,OERSources,andOERUse. AboutConnexions Since1999,Connexionshasbeenpioneeringaglobalsystemwhereanyonecancreatecoursematerialsand makethemfullyaccessibleandeasilyreusablefreeofcharge.WeareaWeb-basedauthoring,teachingand learningenvironmentopentoanyoneinterestedineducation,includingstudents,teachers,professorsand lifelonglearners.Weconnectideasandfacilitateeducationalcommunities. Connexions'smodular,interactivecoursesareinuseworldwidebyuniversities,communitycolleges,K-12 schools,distancelearners,andlifelonglearners.Connexionsmaterialsareinmanylanguages,including English,Spanish,Chinese,Japanese,Italian,Vietnamese,French,Portuguese,andThai.Connexionsispart ofanexcitingnewinformationdistributionsystemthatallowsfor PrintonDemandBooks .Connexions haspartneredwithinnovativeon-demandpublisherQOOPtoacceleratethedeliveryofprintedcourse materialsandtextbooksintoclassroomsworldwideatlowerpricesthantraditionalacademicpublishers.