University Press of Florida

Introduction to Open Educational Resources

Buy This Book ( Related URL )
MISSING IMAGE

Material Information

Title:
Introduction to Open Educational Resources
Physical Description:
Book
Language:
en-US
Creator:
Baker, Judy, Connexions, Rice University

Subjects

Subjects / Keywords:
OER, open courseware, open textbooks, open educational resources, free textbooks, OGT+ isbn: 9781616100438
Copyrights, Intellectual Property, Open Education
Educational Technology / Integrating technology into the classroom

Notes

Abstract:
A free PDF text introducing open educational resources as alternatives to textbooks for college teachers. Contents: 1) Introduction. 2) Open Courseware. 3) OER Fair Use, Copyright, and TEACH Act. 4) Identifying Sources. 5) Discipline Specific Sources. 6) Public Domain Textbook Sources. 7) Use of Primary Sources. 8) OER Development. 9) Delivery, Storage, and Organization.
General Note:
Expositive
General Note:
Community College, Higher Education
General Note:
http://www.ogtp-cart.com/product.aspx?ISBN=9781616100438
General Note:
Adobe PDF Reader
General Note:
Textbook
General Note:
http://florida.theorangegrove.org/og/file/d40ed145-b944-01ad-fe4f-2c1bdcd608cf/1/OpenResources.pdf

Record Information

Source Institution:
University of Florida
Rights Management:
Copyright 2008 Judy Baker. This selection and arrangement of content is licensed under the Creative Commons Attribution License: http://creativecommons.org/licenses/by/2.0/
Resource Identifier:
isbn - 9781616100438
System ID:
AA00011640:00001


This item is only available as the following downloads:


Full Text

PAGE 1

IntroductiontoOpenEducational Resources By: JudyBaker

PAGE 3

IntroductiontoOpenEducational Resources By: JudyBaker Online: < http://cnx.org/content/col10413/1.3/ > CONNEXIONS RiceUniversity,Houston,Texas

PAGE 4

2008JudyBaker ThisselectionandarrangementofcontentislicensedundertheCreativeCommonsAttributionLicense: http://creativecommons.org/licenses/by/2.0/

PAGE 5

TableofContents 1OERIntroduction .................................................................................1 2OEROpenCourseware ...........................................................................7 3OERFairUse,Copyright,andTEACHAct ..................................................11 4OERIdentifyingSources ........................................................................15 5OERDiscipline-SpecicSources ................................................................19 6OERPublicDomainTextbookSources ........................................................27 7OERUseofPrimarySources ...................................................................31 8OERDevelopment ...............................................................................35 9OERDelivery,Storage,andOrganization .....................................................41 Index ................................................................................................45 Attributions .........................................................................................46

PAGE 6

iv

PAGE 7

Chapter1 OERIntroduction 1 1.1Lesson:Introduction 1.1.1LessonComponents FastFact Skills/Objectives SuccessIndicators Introduction Activity Reviewquestions Resources 1.1.2FastFact AccordingtoWikipedia 2 ,OERisatermthatwasrstadoptedatUNESCO's2002ForumontheImpact ofOpenCoursewareforHigherEducationinDevelopingCountriesfundedbytheHewlettFoundation.The denitionOERis: digitizedmaterialsoeredfreelyandopenlyforeducators,studentsandself-learnerstouseandre-use forteaching,learningandresearch 1.1.3Skills/Objectives Learnerswillbeableto: 1.DeneanddescribeOER. 2.ListtheadvantagesanddisadvantagesofOERuse. 1.1.4SuccessIndicators 1.LearnermembershipsinOERcommunitywebsites. 2.Learner-generatedpostingtoopenforumaboutOERissues. 1 Thiscontentisavailableonlineat. 2 http://en.wikipedia.org/wiki/Open_educational_resources 1

PAGE 8

2 CHAPTER1.OERINTRODUCTION 1.2Introduction Denition OpenEducationalResourcesOERarelearningmaterialsfreelyavailableinthepublicdomain.A denitionofOER 3 fromtheTheWilliamandFloraHewlettFoundationis: "OERareteaching,learningandresearchresourcesthatresideinthepublicdomainorhavebeenreleased underanintellectualpropertylicensethatpermitstheirfreeuseorre-purposingbyothers.Openeducational resourcesincludefullcourses,coursematerials,modules,textbooks,streamingvideos,tests,software,and anyothertools,materialsortechniquesusedtosupportaccesstoknowledge." ThetermOERhasbeenusedtorefertolearningmaterialssuchas: Learningobjects 4 quizzes,crosswordpuzzles,ashcards,animations,etc. Audiolectures 5 Audiovideolectures Images 6 Soundsandmusic Entirecoursecontentandopencourseware 7 Collectionsofjournalarticles 8 andinstitutionalrepositories Textbooks 9 Background HewlettFoundation 10 hastakenapioneeringroleinthedevelopmentanduseofOERwithitssupport ofmanyinitiatives:"TheOpenEducationalResourcesmovementbeganin2001whentheHewlettandthe AndrewW.MellonfoundationsjointlyfundedMITOpenCourseWareOCW,therstinstitutioncommitted tomakingallofitscoursematerialsfreelyavailable.Sincethen,morethan60additionalinstitutionshave launchedOpenCourseWareWebsites."JustsomeofthemanyOERinitativessupportedbytheHewlett Foundationinclude: MITOpenCourseware 11 Foothill-DeAnzaCommunityCollegeDistrict,SharingOfFreeIntellectualAssetsSoa 12 JohnsHopkinsBloombergSchoolofPublicHealthOpenCourseWare 13 TuftsUniversityOpenCourseWare 14 UtahStateUniversityOpenCourseWare 15 eduCommons 16 CarnegieMellonUniversity,OpenLearningInitiative 17 MontereyInstituteforTechnology,OnlineAdvancedPlacementcourses 18 Connexions 19 InternetArchive,Education 20 3 http://www.hewlett.org/Programs/Education/OER 4 http://taste.merlot.org/repository.html 5 http://webcast.berkeley.edu/courses.php 6 http://commons.wikimedia.org/wiki/Category:Public_domain 7 http://opencontent.org/ocwnder/ 8 http://www.doaj.org/ 9 http://www.gutenberg.org/ 10 http://www.hewlett.org/Programs/Education/OER/Publications/oeroverview.htm 11 http://ocw.mit.edu/ 12 http://soa.fhda.edu/ 13 http://ocw.jhsph.edu/ 14 http://ocw.tufts.edu/ 15 http://ocw.usu.edu/ 16 http://cosl.usu.edu/projects/educommons 17 http://www.cmu.edu/oli/ 18 http://www.archive.org/details/ap_courses 19 http://cnx.org/ 20 http://www.archive.org/details/education

PAGE 9

3 TheOpenEducationalResourcesmovementispartofaglobaleorttomakeknowledgeavailabletoall.The UNESCO'sVirtualUniversityForum 21 providesanoverviewaboutdenitions,initiatives,andcommunitybuilding.ManyrepositoriesofopenlearningmaterialsarelistedattheOpenEducationalResourcesOER Index 22 SomebenetsofOERinclude: Fosterspedagogicalinnovationandrelevancethatavoidsteachingfromthetextbook Broadensuseofalternativestotextbookswhilemaintaininginstructionalquality Lowerscostsofcoursematerialsforstudents SomedisadvantagesofOERinclude: QualityofavailableOERmaterialsinconsistent MaterialsmaynotmeetSection508ADAaccessibilityorSCORMrequirementsandmustbemodify tobringintocompliance NocommonstandardforreviewofOERaccuracyandquality Needtocheckaccuracyofcontent Customizationnecessarytomatchdepartmentaland/orcollegecurriculumrequirements Technicalrequirementstoaccessvary Technologicaldeterminismcreatedbythedeliverytool CaseStudy InhisMay2006article"ByetheBookMyyearofteachingenvironmentalsciencewithoutatextbook" 23 EricPallantdescribeshowheandco-professorTerryBenselexperimentedwithteachingtheirIntroduction toEnvironmentalSciencecourseatAlleghenyCollegewithnotextbook.Insteadtheyusedavarietyofopen educationalresources.Basedonself-report,41of46studentsintheirrst-semesterclassreadthesameor morethantheywouldhaveinatextbook.Theexperimentprovedsuccessfulenoughthattheentireacademic departmenthasembracedtheconceptofOER.Facultyhavedistributedtheworkofcollectingandbanking websitesforcommonuse. Sustainability Recently,severalwebsiteshavebecomeavailablethatprovidetoolstosupporttheidentication,development,use,re-use,collaboration,anddeliveryofopenlearningcontentincludingsearchingandorganization ofcontent.Somewebsites,suchas:OERCommons 24 ,OpenLearn 25 ,OpenContent 26 ,WikiEducator 27 Connexions 28 ,OWLInstitute 29 ,andOERderves 30 ,aredevotedtonurturingonlinelearningcommunities, wikis,andblogsonvariousaspectsofOER.Also,anewjournalhasgoneonlinewithafocusonOER: Eduforge:TheInternationalJournalofOpenEducationResources 31 1.2.1SupportforOERUseonCampus InordertopromoteuseofOERacrosscampus,thechallengesmustbeidentiedandaddressed.Resultsof atwo-yearstudyarepresentedinthearticle"WhyStudyUsers:AnEnvironmentalScanofUseandUsers ofDigitalResourcesintheHumanitiesandSocialSciencesUndergraduateEducation 32 ."Basedonthis 21 http://www.unesco.org/iiep/virtualuniversity/forumsche.php?queryforumspages_id=13 22 http://cwr.unitar.edu.my/le.php/1/Index.htm 23 http://www.grist.org/comments/soapbox/2006/05/02/pallant/index.html?source=mtv 24 http://www.oercommons.org/ 25 http://www.open.ac.uk/openlearn/home.php 26 http://opencontent.org/blog/ 27 http://www.wikieducator.org/Main_Page 28 http://cnx.org/ 29 http://owli.org/home/ 30 http://www.oerderves.org/ 31 http://journal.eduforge.org/index.php/eduforge 32 http://www.rstmonday.org/issues/issue12_1/harley/index.html

PAGE 10

4 CHAPTER1.OERINTRODUCTION study,barrierstouseofdigitalresourcesincludingthelackofdirectrelevancetotheirpreferredpedagogical approaches,andinsucienttimeandclassroomresources.Challenges Resourcesforfacultysupport Qualityassuranceoflearningmaterials Limitedavailabilityoffullyvettedandcomprehensivelearningmaterialsinsomedisciplines Articulationandtransferissues Printingandcomputerlabdemandsoncampusbystudents Identicationofcollaborativetoolsfordevelopment,use,anddeliveryofOERlearningmaterials Fosteringuseofthetoolsbyfaculty Compliancewithfederalandstateaccessibilityrequirements ResourcesNeededtoSupportFacultyUseandDevelopmentofOER Training Technicalassistance Software Hardware Releasetime 1.3Activity Experience 1.GetconnectedandbecomeapartoftheOERmovementcommunity: GotoOERCommons 33 .Join 34 andsignuptoreceivee-news. GotoOpenLearn 35 .Browsetopics 36 ,register 37 tobecomeapartoftheOERcommunity,signup forthenewsletter,andtellonefriendaboutOpenLearn 38 GotoRiceUniversity'sConnexions 39 toreadthefeedback 40 fromusersandthenregister. 2.ReadatleastoneofthefollowingabouttheOERmovement: ModelsforSustainableOpenEducationalResources 41 byStephenDownes 42 ,January30,2006 TheCurrentStateofOpenEducationalResources 43 byDavidWiley,February3,2006 OpenEducationalResources:TowardaNewEducationalParadigm 44 byPetrides&Jimes,October 2006 Reect 1.OnceyouhavejoinedOERCommons 45 ,makeyourownpostingtotheOERMattersDiscussions 46 area.ClickonOERMattersTeachingandLearningForumtoanswerthefollowingquestion: 33 http://www.oercommons.org/ 34 http://www.oercommons.org/createMember 35 http://openlearn.open.ac.uk/index.php 36 http://openlearn.open.ac.uk/index.php 37 https://openlearn.open.ac.uk/login/signup.php 38 http://www.open.ac.uk/openlearn/tell-your-friends.php 39 http://cnx.org/ 40 http://cnx.org/feedback 41 http://www.downes.ca/cgi-bin/page.cgi?post=33401 42 http://www.downes.ca/cgi-bin/page.cgi?author=1 43 http://opencontent.org/blog/archives/247 44 http://www.ijournal.us/issue_14/ij_14_04_articleframe_Petrides_Jimes.html 45 http://www.oercommons.org/join_form 46 http://www.oercommons.org/matters/oer-matters-discussions

PAGE 11

5 "Openingupnewavenuesforteachersandlearnerstoselectandaugmentlearningresourcesthatmeet one'suniqueteachingandlearningneedsisthebasicmissionbehindOER.ButhowdoOERimpactteaching andlearningandwhataretheissuesthatweneedtotakeintoconsideration?"" Apply NowthatyouhaveageneralideaofwhatOERisallabout,youshouldbereadytomakeacoupleof decisions: 1.DoyouwanttolearnmoreaboutOER? Decidewhichlessonsyouwanttocompleteinthistutorial. Decidetheorderinwhichyouwanttocompletethelessonsthatmakesthemostsenseforyourlearning needs. 2.Doyouwanttogetthemostoutofthislearningexperience? Inviteacolleaguetojoinyouinthistutorial. CompletealltheexerciseslistedintheActivitycomponentofeachLesson. 1.3.1ReviewQuestions 1.WhatareOpenEducationalResources? 2.WhataretheadvantagesanddisadvantagestousingOERforteaching? 1.3.2Resources ModelsforSustainableOpenEducationalResources 47 TheCurrentStateofOpenEducationalResources 48 AReviewoftheOpenEducationalResourcesOERMovement 49 OpenEducationalResources:TowardaNewEducationalParadigm 50 OpenEducationalResources:OpportunitiesandChallenges 51 OpenEducationalResourcesServetheWorld 52 GivingKnowledgeforFree:TheEmergenceofOpenEducationalResources 53 TheFutureofFreeInformation 54 47 http://www.downes.ca/cgi-bin/page.cgi?post=33401 48 http://opencontent.org/blog/archives/247#more-247 49 http://oerderves.org/ 50 http://www.ijournal.us/issue_14/ij_14_04_articleframe_Petrides_Jimes.html 51 http://www.oecd.org/dataoecd/5/47/37351085.pdf 52 http://www.educause.edu/apps/eq/eqm05/eqm0533.asp 53 http://www.oecd.org/dataoecd/35/7/38654317.pdf 54 http://www.dufoundation.org/downloads/Article_2006_01.pdf

PAGE 12

6 CHAPTER1.OERINTRODUCTION

PAGE 13

Chapter2 OEROpenCourseware 1 2.1OEROpenCourseware 2.1.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 2.1.2FastFact MIT 2 rstannounceditsOpenCoursewareprogramin2001.TheOCWprovidesopenaccesstocourse materialsforupto1,550MITcourses,representing34departmentsandallveMITschools.Thegoalisto includematerialsfromallMITcoursesby2008. 2.1.3Skills/Objectives Learnerswillbeableto: 1.Identifysourcesofopencoursewareforuseintheirownteachingdisciplines. 2.Locateatlessoninanopencoursetomodifyforuseintheirownteaching. 2.1.4SuccessIndicators 1.PostedlessonplanthatrepurposeslearningcontentfromOCWforlearner'sownteaching. 2.2Introduction TheOpenCourseWaremovementbeganattheMassachusettsInstituteofTechnologyMITin2002andhas nowspreadtosome120otheruniversitiesworldwide.AccordingtoUCIrvine 3 :"OpenCourseWareOCW 1 Thiscontentisavailableonlineat. 2 http://ocw.mit.edu/ 3 http://ocw.uci.edu/ 7

PAGE 14

8 CHAPTER2.OEROPENCOURSEWARE isafreeandopendigitalpublicationofhighqualityuniversity-leveleducationalmaterials,oftenincluding syllabi,lecturenotes,assignmentsandexams.Openeducationalresourcesarebasedonthenotionthat knowledgeandeducationarecommongoodsthatmustbesupportedbyadenedcommunity." WhileOCWinitiativestypicallydonotprovideadegree,credit,certication,oraccesstoinstructors, thematerialsaremadeavailable,forfree,underopenlicensesforuseandadaptionbyeducatorsandlearners anywhere. Denition AccordingtotheOpenCoursewareConsortium 4 : "AnOpenCourseWaresiteisafreeandopendigitalpublicationofhighqualityeducationalmaterials, organizedascourses...isavailableforuseandadaptationunderanopenlicense...doesnottypicallyprovide certicationoraccesstoinstructors." TheOpenCourseWareFinderFinder 5 currentlyshowssearchresultsfrom: MITOCW 6 UtahStateUniversityOCW 7 JohnsHopkinsSchoolofPublicHealthOCW 8 TuftsUniversityOCW 9 FoothillDe-AnzaSOFIA 10 CarnegieMellonOpenLearningInitiative 11 Otheruniversitieswithopencoursewareinclude: UniversityofCalifornia,Irvine 12 UniversityofNotreDame 13 UniversityofWashingtonComputerScience&Engineering 14 StanfordoniTune 15 PennState 16 Wikiversity 17 isaonlinegroupofeducatorsengagedinacollaborativelearningeortusingwikisoftware, whichmakescollaborationeasy.Taketheguidedtour 18 todiscovermore. HippoCampus 19 ,aprojectoftheMontereyInstituteforTechnologyandEducationMITE,provides high-quality,multimediacontentongeneraleducationsubjectstohighschoolandcollegestudentsfreeof charge. 2.3Activity Experience 1.UsetheOpenCourseWareFinderFinder 20 tosearchforOpenCoursewareinyourteachingdiscipline. 4 http://www.ocwconsortium.org/support/index.html 5 http://opencontent.org/ocwnder/ 6 http://ocw.mit.edu/ 7 http://ocw.usu.edu/ 8 http://ocw.jhsph.edu/ 9 http://ocw.tufts.edu/ 10 http://soa.fhda.edu/ 11 http://www.cmu.edu/oli/ 12 http://ocw.uci.edu/ 13 http://ocw.nd.edu/ 14 http://www.cs.washington.edu/education/course-webs.htm 15 http://itunes.stanford.edu/ 16 https://www.e-education.psu.edu/oer 17 http://en.wikiversity.org/wiki/Wikiversity:Introduction 18 http://en.wikiversity.org/wiki/Wikiversity:Guided_tour/Main_Page 19 http://www.hippocampus.org/ 20 http://opencontent.org/ocwnder/

PAGE 15

9 2.ListentoalecturepodcastatStanfordoniTunes 21 orBerkeley. Reect 1.ParticipateintheWikiversityMottocontest 22 bypostingyourchoiceandwhyonthewikioratthe 23 WikiversityColloquium 24 Apply 1.DevelopalessonplanthatrepurposeslearningcontentfromOCWforyourownteaching. 2.ConsideraddingyourowncoursetoWikiuniversity 25 .Usethetutorial 26 provided. 2.3.1ReviewQuestions 1.Whataresomeofthesourcesofopencourseware? 2.Whichsourcesofopencoursewareprovidelearningmaterialsthatcanbemodiedforuseinthe learner'sownteaching? 2.3.2Resources HowtheOpenSourceMovementHasChangedEducation:10SuccessStories 27 ThePromiseofOpenEducationalResources 28 21 http://itunes.stanford.edu/ 22 http://en.wikiversity.org/wiki/Wikiversity:Motto_contest 23 http://en.wikiversity.org/wiki/Wikiversity:Colloquium#Motto_and_slogan_contests:_selecting_amongst_tied_nalists 24 http://en.wikiversity.org/wiki/Wikiversity:Colloquium#Motto_and_slogan_contests:_selecting_amongst_tied_nalists 25 http://en.wikiversity.org/wiki/Wikiversity:Adding_content 26 http://en.wikiversity.org/wiki/Wikiversity:Introduction 27 http://oedb.org/library/features/how-the-open-source-movement-has-changed-education-10-success-stories 28 http://www.hewlett.org/NR/rdonlyres/4DEF17E2-4578-4453-BA9C-

PAGE 16

10 CHAPTER2.OEROPENCOURSEWARE

PAGE 17

Chapter3 OERFairUse,Copyright,andTEACH Act 1 3.1Lesson:FairUseandCopyright 3.1.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 3.1.2FastFact Thecopyrightnotice isnolongerrequiredforworkspublishedafterMarch1989.Absenceofnoticedoes notnecessarilymeantheworkiswithinthepublicdomain. 3.1.3Skills/Objectives Learnerswillbeableto: 1.Denecopyright,fairuse,theTEACHAct,andintellectualproperty. SuccessIndicators DeterminetheappropriatenessoftheirownuselearningmaterialsforOERintermsoffairuse.Creative Commonslicenseselectedforlearner'sOER. 3.2Introduction Abasicunderstandingofcopyright,fairuse,theTEACHAct,andintellectualpropertyisnecessarybefore usinganddevelopingOERinordertominimizetheriskofviolatingthelaw.Youareencouragedtovisit oneormoreofthemanyonlinetutorialsexistwhichaddressthesetopics. Copyright 1 Thiscontentisavailableonlineat. 11

PAGE 18

12 CHAPTER3.OERFAIRUSE,COPYRIGHT,ANDTEACHACT CopyrightandDistanceEducation 2 Primer 3 ,UniversityofMaryland Digital 4 focusesspecicallyonissuesrelatingtocopyrightindigitalworksandtheproblemsencounteredbyeducationalinstitutionsintheiruseofdigitalmaterialsforteaching,researchandservice TheCaseofDr.No 5 isavideoclipthataddressesthechallengesfacedbyfacultywhendistributing copyrightedmaterialfromvarioussources. TheCopyrightCrashCourse 6 fromtheUniversityofTexasatAustin CopyrightTermandthePublicDomainintheUnitedStates 7 CopyrightManagementCenteratIUPUI 8 VATechCopyrightInfo 9 CopyrightTutorial 10 FairUse Thefairusedoctrine,ascodiedinU.S.C.107,setsforthfourgeneralfactorstobeconsideredwhen evaluatingwhetheraproposeduseofacopyrightedworkisafairuseandthus,doesnotrequirepermission fromthecopyrightholder. Thefourfactorsare: 1.Whatisthepurposeoftheproposeduse? 2.Whatisthenatureofthecopyrightworktobeused? 3.Howmuchofthecopyrightedworkwillbeused? 4.Whatistheeectonthemarketorpotentialmarketforthecopyrightedwork? FairUse 11 CommonScenariosofFairUseIssues:PostingMaterialsonCourseManagementSystems 12 LibraryofCongressQuestionsandAnswers:CopyrightandFairUse 13 Copyright&FairUseatStanford 14 RulesofThumbforDisplayingandPerformingOthers'WorksinDistanceLearning 15 ATeacher'sGuidetoFairUseandCopyright 16 CopyrightandFairUseintheClassroom,ontheInternet,andtheWorldWideWeb 17 StanfordCopyrightLawandFairUse 18 TEACHAct TheTEACHActisupdatescopyrightlawfordigitalonlineeducationasacompromiseeorttoaddress thecopyrightrestrictiondisparitiesbetweendigitalclassroomandthetraditionalclassroomintermsof performancesanddisplays.TEACHToolkit 19 provideschecklistsandabestpracticesaswellasbasic information.UndertheTeachAct,facultycanusecopyrightedmaterialintheironlinecourseswithout seekingtheauthor'spermissionunderthefollowingcircumstances: 2 http://www.copyright.iupui.edu/dist_learning.htm 3 http://www-apps.umuc.edu/primer/ 4 http://www-apps.umuc.edu/dcprimer/enter.php 5 http://marconi.umuc.edu/ramgen/cip/educause_dr_no/case_of_no.rm 6 http://www.lib.utsystem.edu/copyright 7 http://www.copyright.cornell.edu/training/Hirtle_Public_Domain.htm 8 http://www.copyright.iupui.edu/ 9 http://scholar.lib.vt.edu/copyright/ 10 http://www.lib.ncsu.edu/scc/tutorial/copyuse/index.html 11 http://www.copyright.iupui.edu/fairuse.htm 12 http://www.copyright.iupui.edu/fuscenarios.htm 13 http://memory.loc.gov/learn/start/cpyrt/ 14 http://fairuse.stanford.edu/ 15 http://www.utsystem.edu/ogc/intellectualproperty/copypol2.htm#distance 16 http://home.earthlink.net/ cnew/research.htm 17 http://www.umuc.edu/library/copy.html 18 http://www-sul.stanford.edu/cpyright.html 19 http://www.lib.ncsu.edu/scc/legislative/teachkit/

PAGE 19

13 Thecollegemustbeaccreditedandnonprot. Thecollegemusthaveaninternalpolicyonuseofcopyrightedmaterialandoncopyrightlaw. Thecollegemustprovideprintedoronlineresourcesforfacultymembersthatdescribetheirrightsand responsibilitiesundercopyrightlaw. Thematerialmustnothavebeenoriginallyintendedforeducationaluse. Thematerialmusthavebeenlawfullyacquired Thematerialmustbeanintegralpartoftheclasssession. Reasonableprecautionsmustbemadetorestrictaccesstothecopyrightedcontenttostudentsenrolled inthecourse. Otherreasonablecontrolsmustbeusedtopreventstudentsfromdisseminatingthematerialafter viewingit. Ifadigitalversionofthematerialisreadilyavailableforuseattheinstitution,thentheinstructor cannotconvertananalogversiontodigitalformforuseinanonlinecourse. Thecollegemustinformstudentsthatthematerialmaybeprotectedbycopyrightlaw. IntellectualProperty Watchthevideointroduction 20 toCreativeCommonsCC 21 .CCisanonprotorganizationthatprovidesauthorswithfreetoolstomanagetheirintellectualproperty.ACClicenseallowsotherstoreproduce alicensedworkwhentheygivecredittothelicenseholder.TheCCwebsitehasatoolthatgenerates licenses 22 inHTMLformatbasedonchosencriteria.Educauseprovidesgoodsummaryof7ThingsSeries YouShouldKnowAboutCreativeCommons 23 3.3Activity Experience 1.WatchDr.NoReturns! 24 isavideoclipinwhichaninstructorwouldliketousetheTEACHActto providemusicfromvarioussourcestoa"HistoryofMusic"coursethroughapasswordprotectedweb site. 2.UseChecklistfortheTEACHAct 25 todeterminewhetherornotyourplanneduseoflearningmaterials aresuitableasOERisincompliancewiththeTEACHAct. 3.UseoneoftheEduSourceCanadaPublicDomainWizard 26 todetermineifthelearningmaterialsyou plantouseareinthepublicdomain. 4.UseChecklistforFairUse 27 todeterminewhetherornotyourplanneduseoflearningmaterialsare suitableasOERintermsoffairuse. Reect 1.OnceyouhavejoinedOERCommons 28 ,makeyourownpostingtotheOERMattersDiscussions 29 area.ClickonOERMattersIntellectualPropertyForumtoanswerthefollowingquestion: 20 http://search.creativecommons.org/ 21 http://creativecommons.org/ 22 http://creativecommons.org/ 23 http://www.educause.edu/ir/library/pdf/ELI7023.pdf 24 http://marconi.umuc.edu/ramgen/cip/educause_dr_no/no_returns.rm 25 http://www.copyright.iupui.edu/teachlist.htm 26 http://www.edusource.ca/craw/PD_Wizard.html 27 http://www.copyright.iupui.edu/checklist.htm 28 http://www.oercommons.org/join_form 29 http://www.oercommons.org/matters/oer-matters-discussions

PAGE 20

14 CHAPTER3.OERFAIRUSE,COPYRIGHT,ANDTEACHACT "AtthecoreofOERuseandre-usearelegalissuessurroundingthesharing,use,andre-useofOERasa waytosustainandgrowtheOERmovement.Howdoestheshiftfromproprietarytoparticipatoryimpact OER?" Apply 1.ChooseanOERLicense 30 forlearningmaterialsyoumightdevelopandshare. 2.Readabouthowintellectualpropertyandfairuse 31 impactdecisionstopublishscholarlyworksat Connexions 32 .Decideifyouwanttocontribute 33 toConnexions. 3.3.1ReviewQuestions 1.Whatisfairuse? 2.WhatistheTEACHAct? 3.HowdofairuseandtheTEACHActapplytotheuseofOERinyourteaching? 3.3.2Resources TheCopyrightCrashCoursefromtheUniversityofTexasatAustin 34 NewCopyrightLawforDistanceEducation:TheMeaningandImportanceoftheTEACHAct 35 Balancingcopyrightconcerns:TheTEACHActof2001 36 30 http://wikieducator.org/Open_Educational_Content/olcos/CHOOSE_a_license 31 http://cnx.org/help/ipfaq 32 http://cnx.org/ 33 http://cnx.org/content/m14346/latest/ 34 http://www.lib.utsystem.edu/copyright 35 http://www.copyright.iupui.edu/teach_summary.htm 36 http://www.educause.edu/ir/library/pdf/ERM01610.pdf

PAGE 21

Chapter4 OERIdentifyingSources 1 4.1OERToolstoIdentifyandSelect 4.1.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 4.1.2FastFact OpenEducationalResourcesOERaredigitizedmaterialsoeredfreelyandopenlyforeducators,students andself-learnerstouseandre-useforteaching,learningandresearch.TermrstadoptedatUNESCO's 2002ForumontheImpactofOpenCoursewareforHigherEducationinDevelopingCountriesfundedby theHewlettFoundation.-fromWikipedia 2 4.1.3Skills/Objectives Learnerswillbeableto: 1.Identifyresourcesforuseofprimarysourcesaslearningmaterialsintheirownteachingdisciplines. 2.Locateatleastoneprimarysourceforuseinteaching. 3.Developalessonplanusingprimarysources. 4.1.4SuccessIndicators 1.OERaddedtolearner'sownonlinecollectionorportfolio. 2.OERreviewpostedbythelearner. 3.PostedlessonplanthatusesatleastoneprimarysourceasanOERfortheirownteaching. 1 Thiscontentisavailableonlineat. 2 http://en.wikipedia.org/wiki/Open_educational_resources 15

PAGE 22

16 CHAPTER4.OERIDENTIFYINGSOURCES 4.2Introduction SeveralresourcesareavailableontheInternetthatprovideteacherswithtoolstoidentifyandselectOER foruseininstruction.Someoftheseare:OERCommons 3 ,MERLOT 4 ,Connexions 5 ,FREE:Federal ResourcesforEducationalExcellence 6 ,COLKnowledgeFinder 7 ,andCreativeCommons 8 4.2.1OERCommons OERCommonsisoneofseveralInternetresourceswhereyoucanidentifyandselectOER.Withafree membership,youcanaddtags,ratings,reviews,comments,andfavoritestoyourownportfolio.Youcan posttodiscussion,blog,andwikiareas,andseehowothersareusingOER. OERCommonsiscreatedandproducedbyISKME,theInstitutefortheStudyofKnowledgeManagement inEducation.ItisgenerouslysupportedbytheWilliamandFloraHewlettFoundationandrepresentsdozens ofcollaborationswithOERpartnersandcommunitiesacrosstheglobe. 4.2.2MERLOT MERLOTisapioneerinthedevelopmentofsearchableandshareableonlinelearningmaterialsforhigher education.Thesiteprovidescollection 9 ofpeerreviewed 10 learningmaterialscreatedbyregisteredmembers. MERLOTprovidescriteriaforpeer-reviewoflearningmaterialssubmitted. TakeaTourofthenewMerlot 11 .SearchesinMERLOTcanbesortedbydate,reviewsratings,title, author,andmaterialtype.AtutorialabouthowtosearchforlearningmaterialsusingMERLOTisavailable fromtheSUNYTeaching,Learning,andTechnologyProgram. Connexions Connexions 12 hasarepositoryofOERthataresearchablebysubject,language,popularity,title,keyword, andauthor.Therepositorycontains3925reusablemoduleswoveninto211collections.Thecontentin Connexionscomesintwoformats:modules,whicharelikesmall"knowledgechunks,"andcourses,which arecollectionsofmodules.TheConnexionsCreativeCommonsopenlicense 13 allowsforfreeuseandreuse ofallitscontent. FREE FREE:FederalResourcesforEducationalExcellence 14 provideslinkstohundredsofeducationresources fromorsupportedbytheU.S.government. OERRepositories WikiEducatorprovidesseveraltoolsforidenticationanduseofOERincludingtheExemplaryCollection ofOpeneLearningContentRepositories 15 .LolaExchange 16 provideslearningobjectsandlearningactivities availableforsearchingbytopic,title,discipline,orauthor.DisciplineslistedareMathematics,Scienceand Technology,SocialSciences,Business,Arts,Education,andHumanities.Allmaterialsarereviewedaccordingtostandardcriteriabyvolunteers.Curriki 17 isaglobaleducationandlearningcommunitydedicated 3 http://www.oercommons.org/ 4 http://www.merlot.org/ 5 http://www.oercommons.org/matters/oer-matters-discussions 6 http://www.free.ed.gov/ 7 http://cnx.org/content/m14475/latest/www.colnder.org/ocw 8 http://search.creativecommons.org/ 9 http://taste.merlot.org/merlotcollection.html 10 http://taste.merlot.org/peerreviewprocess.html 11 http://taste.merlot.org/tour/index.htm 12 http://cnx.org/ 13 http://creativecommons.org/licenses/by/2.0/ 14 http://www.free.ed.gov/ 15 http://www.wikieducator.org/Exemplary_Collection_of_Open_eLearning_Content_Repositories 16 http://www.lolaexchange.org/ 17 http://www.curriki.org/xwiki/bin/view/Main/WebHome

PAGE 23

17 toprovidingqualitylearningmaterialsworldwide.Learningmaterialscanbesearchedbythefollowingtopics:Arts,EducationalTechnology,ForeignLanguages,Health,LanguageArts,Mathematics,Science,Social Studies,andVocationalEducation.Are-launchofthesiteisplannedsoontoaddthefollowingnewfeatures: Accessinformation,tools,andresourcesfromthenewmemberhomepage 18 Viewandcommentonothermembers'learningresources 19 Editandcollaborateonlearningmaterials,andbuildcollectionsandresourceswithCurrikulum Builder 20 DevelopcontentintheCurrikulumBuilderwithtemplates 21 Manageyourowncontributionsandcollections,aswellasyouruserproleandblog,usingyour personalizedspaceinMyCurriki 22 COLKnowledgeFinder COLKnowledgeFinder 23 isaservicethatsearchesreliablesourcesofinformationinopenanddistance learningandprovidesorganizationtools.Emphasisisoninternationaldevelopmentgoalslikepovertyalleviation,healthandeducationforall.TheCOLKnowledgeFinderserviceisprovidedbyTheCommonwealth ofLearningCOLwhichisanintergovernmentalorganisationcreatedbyCommonwealthHeadsofGovernmenttoencouragethedevelopmentandsharingofopenlearninganddistanceeducationknowledge, resourcesandtechnologies.Tousethesearchtool,clickon"Search".Thenfollowtheguidelinesonthe screen.MoredetailsareavailablefromtheOrientation 24 .Trainingvideos 25 foreectivesearchinganduse oftheCOLKnowledgeFindertoolsareavailable. CreativeCommons CreativeCommons 26 providesawaytondshareablephotos,music,text,books,andothereducational materialutilizingCreativeCommonsenabledsearchservicesatGoogle,Yahoo!,Flickr,blip.tv,Owlmusic, andSpinXpress.AContentCurators 27 wikiareaisavailablethatprovidesalistofcuratorsofCreative Commons-licensedcontent.Usersareinvitedtocontributetoandeditthislistthemselves. Edu2.0 Takeatour 28 ofEdu2.0 29 todiscoverallbrowsablesharedcoursecontentorganizedbytopic.Resources includequizzes,webquests,presentations,projects,experiments,courses,classes,curricula,audio,video, powerpoint,excelandotherkindsofattachments. 4.3Activity Experience 1.Reviewthecriteria 30 availablefromMERLOT'sPeerReviewprocess. 2.GotoOERCommons 31 ,MERLOT 32 ,Connexions 33 ,andFREE 34 tosearchforcontentinyour teachingdiscipline. 18 http://www.curriki.org/xwiki/bin/view/mail/Memberhome 19 http://www.curriki.org/xwiki/bin/view/Main/Learningresources 20 http://www.curriki.org/xwiki/bin/view/Main/CurrikulumBuilder 21 http://www.curriki.org/xwiki/bin/view/Main/Templates 22 http://www.curriki.org/xwiki/bin/view/Main/MyCurriki 23 http://www.colnder.org/ocw 24 http://www1.colnder.org/colintro/index.jsp 25 http://www.colnder.org/training/index.jsp 26 http://search.creativecommons.org/ 27 http://wiki.creativecommons.org/Content_Curators 28 http://www.edu20.org/company/tour 29 http://www.edu20.org/ 30 http://taste.merlot.org/evaluationcriteria.html 31 http://www.oercommons.org/ 32 http://www.merlot.org/merlot/index.htm 33 http://cnx.org/ 34 http://www.free.ed.gov/

PAGE 24

18 CHAPTER4.OERIDENTIFYINGSOURCES 3.ViewtheCNBCvideointerview 35 withScottMcNealyaboutCurriki. 4.VisittheOWLInstitutePortal 36 tosearchforresources,peopleandcommunities;browsecoursesand homepagesorcreateyourown. Reect 1.ParticipateinthelatestOERCommonsSurvey 37 andchecktheresults. 2.VisittheOERMattersDiscussions 38 toreadandpostcommentsabouttheHowandWhyofOER: "Shareyourthoughts,experiencesandexpertiseontheOERmovement,itschallengesandpotentialimpact. WhydoesOERmatter,howdoesitwork,andwhatarethepossibilitiesforthefutureofuseandre-useof openeducationcontent?" Apply 1.ReviewlearningmaterialsatOERCommons 39 .TypekeywordsintheSearch 40 boxintheupper rightcornerofthescreentoidentifyatleastoneOERtoreview. ClickonSavethisSearch. SortbyRating.ClickonthetitleoftheOERyouwanttoreview,thenclickonViewItem. ClickonRateItemtogiveityourrating. ClickonReviewItemtosubmityourreview. 2.SubmityourreviewofsomelearningmaterialsatMERLOT 41 .Youwillneedtobecomeamember 42 beforeyoucansubmityourreview. 3.Ifyouknowofagoodsourceofopeneducationalresources,submittheInternetaddressforinclusion ontheCOLKnowledgeFindersubmit-a-sitepage 43 4.3.1ReviewQuestions 1.WhataresomeoftherepositorieswhereOERcanbelocatedandreviewed? 2.WhattoolsandfeaturesareavailabletoidentifyandselectOER? 4.3.2Resources ExemplaryCollectionofOpeneLearningContentRepositories 44 SearchingforPublicDomainMaterialsontheWeb 45 OpenEducationalPracticesandResources.OLCOSRoadmap2012 46 35 http://www.cnbc.com/id/16184176 36 http://owli.org/moodle/ 37 http://www.oercommons.org/matters/surveys-results 38 http://www.oercommons.org/matters/oer-matters-discussions 39 http://www.oercommons.org/ 40 http://www.oercommons.org/ 41 http://www.merlot.org/ 42 http://www.merlot.org/merlot/join.htm 43 http://www.colnder.org/support/request_general.jsp 44 http://www.wikieducator.org/Exemplary_Collection_of_Open_eLearning_Content_Repositories 45 http://library.colstate.edu/tutorials/webnd/webnd6.shtml 46 http://www.olcos.org/english/roadmap/roadmap.html

PAGE 25

Chapter5 OERDiscipline-SpecicSources 1 5.1OERDiscipline-SpecicSources 5.1.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 5.1.2FastFact Learningobjects 2 are: Web-based,self-contained,smallchunksoflearning smallenoughtobeembeddedinalearningactivity,lesson,unitorcourse exible,portable,andadaptable,andcanbeusedinmultiplelearningenvironmentsandacrossdisciplines 5.1.3Skills/Objectives Learnerswillbeableto: 1.IdentifyresourcesforlocatingOERintheirownteachingdisciplines. 2.Developalessonplanusingadiscipline-specicOER. 5.1.4SuccessIndicators 1.LessonplandevelopedwhichusesOER. 1 Thiscontentisavailableonlineat. 2 http://www.wisc-online.com/about.asp#dened 19

PAGE 26

20 CHAPTER5.OERDISCIPLINE-SPECIFICSOURCES 5.2Introduction InadditiontosimplysearchingforPublicDomainMaterialsontheWeb 3 ,anumberofOERandlearning object 4 repositoriesofontheinternetprovideameanstosearchforlearningmaterialsbytopicandacademic subjectmatter.TheCenterforInternationalEducationatUW-Milwaukeeprovidesathoroughlistoflearning objectrepositories 5 Otherrepositoriesinclude: Wisc-OnlineWisconsinOnlineResourceCenter 6 GatewaytoEducationalMaterials 7 Co-operativeLearningObjectExchangeCLOE 8 WikipediaListofGraphicsinthePublicDomain 9 WikimediaPublicDomainImages 10 CreativeCommons 11 LibriVox 12 ibiblio 13 OAIstercatalogofdigitalresources 14 PhotosatFlickrLicensedunderCreativeCommons 15 SubjectSpecicImagesforEducationalUsefromUniversityofMichigan 16 GCSEBitesize 17 Otherdiscipline-specicsourcesofOERinclude: Archeology Archeology 18 ArtHistory ArtHistoryimagesfromUniversityofMichigan 19 ComputerScience XML:ManagingDataExchange 20 ProgrammingfromtheGroundUp 21 Learning2.0 22 Economics 3 http://library.colstate.edu/tutorials/webnd/webnd6.shtml 4 http://en.wikipedia.org/wiki/Learning_Object 5 http://www.uwm.edu/Dept/CIE/AOP/LO_collections.html 6 http://www.wisc-online.com/ 7 http://www.thegateway.org/ 8 http://cloe.on.ca/ 9 http://en.wikipedia.org/wiki/Wikipedia:Public_domain_image_resources#General_collections 10 http://commons.wikimedia.org/wiki/Category:Public_domain 11 http://creativecommons.org/ 12 http://librivox.org/ 13 http://www.ibiblio.org/ 14 http://www.oaister.org/ 15 http://ccickr.bluemountains.net 16 http://images.umdl.umich.edu/cgi/i/image/image-idx?page=groups;g=art-ic 17 http://www.bbc.co.uk/schools/gcsebitesize/ 18 http://opencontext.org/ 19 http://arthist.cla.umn.edu/aict/html/tech.html 20 http://en.wikibooks.org/wiki/XML:_Managing_Data_Exchange 21 http://savannah.nongnu.org/projects/pgubook/ 22 http://blog.missiontolearn.com/2008/02/learning-20-ebook-free/

PAGE 27

21 EconPort 23 Marketing 24 CorporateFinance 25 PrinciplesofEnterpreneurship 26 U.S.EconomyinBrief 27 OutlineoftheU.S.Economy 28 PoliticalEconomy 29 NewRulesfortheNewEconomy 30 IntroductiontoEconomicAnalysis 31 French FrenchLearningObjectRepositoryforEducation 32 Health JohnsHopkinsCenterforPublicHealthPreparedness 33 CDCPublicHealthImageLibrary 34 MedlinePlusInteractive 35 TheChemistryofHealth 36 HIVMedicine2007 37 FreeMedicalInformation 38 History LibraryofCongress,AmericanMemory 39 DigitalHistory:AmericanHistory 40 HarvardUniversityLibraryOpenCollectionsProgram 41 HistoryMatters 42 InternetModernHistorySourcebook 43 UniversityofCalifornia,AmericanWestCollection 44 WorldHistorySources 45 AmericanPoliticalHistoryimages 46 23 http://econport.org/ 24 http://ollie.dcccd.edu/mrkt2370/book/mrktbook.htm 25 http://welch.econ.brown.edu/book/ 26 http://usinfo.state.gov/products/pubs/entrepreneurship/ 27 http://usinfo.state.gov/products/pubs/economy-in-brief/ 28 http://usinfo.state.gov/products/pubs/oecon/ 29 http://en.wikibooks.org/wiki/Political_Economy/General 30 http://www.kk.org/newrules/contents.php 31 http://introecon.com/ 32 http://ore.uvic.ca/welcome.php 33 http://www.jhsph.edu/preparedness/index.html 34 http://phil.cdc.gov/phil/home.asp 35 http://www.nlm.nih.gov/medlineplus/tutorials/ 36 http://publications.nigms.nih.gov/chemhealth/ 37 http://www.hivmedicine.com/ 38 http://www.freemedicalinformation.com/fmi/2ndedit.htm 39 http://lcweb2.loc.gov/amhome.html 40 http://www.digitalhistory.uh.edu/ 41 http://ocp.hul.harvard.edu/ 42 http://www.historymatters.gmu.edu/ 43 http://www.fordham.edu/halsall/mod/modsbook.html 44 http://www.cdlib.org/inside/projects/amwest/ 45 http://chnm.gmu.edu/whm/whmnding.php 46 http://teachpol.tcnj.edu/amer_pol_hist/

PAGE 28

22 CHAPTER5.OERDISCIPLINE-SPECIFICSOURCES EASEHistory 47 HypertextHistory:OurOnlineAmericanHistoryTextbook 48 USHistory.org 49 Hippocampus-clickonU.S.history,thenclickonTextbookstab 50 OralHistories 51 America'sStoryJumpBackinTime 52 AmericanMemoryTimeline 53 FreedomAU.S.Historywebisodes 54 OutlineofU.S.History 55 AboutAmerica:WomenofInuence 56 Literature ElectronicTextPublicLibraryOnlineTexts 57 Children'sLiterature 58 U.S.LiteratureinBrief 59 Math DrexelUniversity,MathForum 60 EisenhowerNationalClearinghouse 61 AMSERtheAppliedMathandScienceEducationRepository 62 CauseWeb 63 Math 64 LinearAlgebra 65 AFirstCourseinLinearAlgebra 66 IntroductiontoProbability 67 ElementsofAbstractandLinearAlgebra 68 LinearMethodsofAppliedMathematics 69 MultivariateCalculus 70 MathematicsundertheMicroscope 71 Philosophy 47 http://www.easehistory.org/index2.html 48 http://www.digitalhistory.uh.edu/database/hyper_titles.cfm 49 http://www.ushistory.org/ 50 http://www.hippocampus.org/ 51 http://www.tellingstories.org/ 52 http://www.americaslibrary.gov/cgi-bin/page.cgi/jb 53 http://memory.loc.gov/ammem/ndlpedu/features/timeline/index.html 54 http://www.pbs.org/wnet/historyofus/menu.html 55 http://usinfo.state.gov/products/pubs/histryotln/index.htm 56 http://usinfo.state.gov/products/pubs/womeninn/ 57 http://www.ipl.org/div/subject/browse/hum60.60.00/ 58 http://bygosh.com/ 59 http://usinfo.state.gov/products/pubs/literature-in-brief/ 60 http://mathforum.org/ 61 http://web.archive.org/web/20041013043116/www.enc.org/?ls=bc 62 http://amser.org/ 63 http://www.causeweb.org/resources 64 http://www.nongnu.org/fhsst/fhsstmaths.pdf 65 http://textbookrevolution.org/math/a-rst-course-in-linear-algebra 66 http://linear.ups.edu/ 67 http://www.dartmouth.edu/ chance/teaching_aids/books_articles/probability_book/book.html 68 http://www.math.miami.edu/ ec/book/ 69 http://www.mathphysics.com/pde/ 70 http://www.math.gatech.edu/ cain/notes/calculus.html 71 http://www.maths.manchester.ac.uk/ avb/micromathematics/downloads

PAGE 29

23 StanfordUniversity,EncyclopediaofPhilosophy 72 FormalLogic 73 Physics OpenTextProjectPhysics 74 Physics 75 PhysicsLightandMatter 76 Physics 77 PoliticalScience DemocracyinBrief 78 HowtheU.S.isGoverned 79 OutlineoftheU.S.LegalSystem 80 IntroductiontoHumanRights 81 OutlineofAmericanGeography 82 Psychology ePsych 83 Science Illumina 84 AccessExcellence 85 CarnegieMellonUniversity,ChemistryCollective 86 UniversityofWashington,HighSchoolHumanGenomeProgram 87 NationalHumanGenomeResearchInstitute 88 NationalScienceDigitalLibrary 89 UniversityofColorado,PhysicsEducationTechnology 90 NationalScienceTeachersAssociation,ScienceTeachers'GrabBag 91 AMSERtheAppliedMathandScienceEducationRepository 92 Teacher'sDomain 93 Bacteriology 94 72 http://plato.stanford.edu/ 73 http://en.wikibooks.org/wiki/Formal_Logic 74 http://www3.baylor.edu/Physics/open_text/ 75 http://physics/ 76 http://www.lightandmatter.com/area1.html 77 http://www.nongnu.org/fhsst/fhsstphy.pdf 78 http://usinfo.state.gov/products/pubs/democracy-in-brief/ 79 http://usinfo.state.gov/products/pubs/abtamerica/index.htm 80 http://usinfo.state.gov/products/pubs/legalotln/ 81 http://usinfo.state.gov/products/pubs/hrintro/hrintro.htm 82 http://usinfo.state.gov/products/pubs/geography/ 83 http://epsych.msstate.edu/index.html 84 http://www.ilumina-dlib.org/index.asp 85 http://www.accessexcellence.org/AE/ 86 http://www.chemcollective.org/ 87 http://hshgp.genome.washington.edu/ 88 http://www.chemcollective.org/ 89 http://www.nsdl.org/ 90 http://www.colorado.edu/physics/phet/ 91 http://www.nsta.org/resourcesgrabbag 92 http://amser.org/ 93 http://www.teachersdomain.org/index.html 94 http://www.textbookofbacteriology.net/

PAGE 30

24 CHAPTER5.OERDISCIPLINE-SPECIFICSOURCES PhysicalGeography 95 ThePhysicalEnvironmentIntroductiontoPhysicalGeography 96 IntrotoPhysicalOceanography 97 Biochemistry 98 Biology 99 TheStructuresofLifebiology 100 Chemistry 101 HumanPhysiology 102 TheNewGenetics 103 EnvironmentalScience 104 IntroductiontoPhysicalOceanography 105 InsidetheCell-Biology 106 CuriosityCreatesCuresTheValueandImpactofBasicResearch 107 MedicinesbyDesignpharmacology 108 Sociology IntroductiontoSociology 109 Spanish Spanish 110 5.3Activity Experience 1.Findlearningmaterialsinyourteachingdisciplineateachofthefollowingrepositories.Notewhether ornotarevieworratingofthelearningmaterialsisavailable. MERLOT 111 Wisc-OnlineWisconsinOnlineResourceCenter 112 GatewaytoEducationalMaterials 113 Co-operativeLearningObjectExchangeCLOE 114 95 http://www.physicalgeography.net/fundamentals/contents.html 96 http://www.uwsp.edu/geo/faculty/ritter/geog101/textbook/title_page.html 97 http://oceanworld.tamu.edu/home/course_book.htm 98 http://www.web.virginia.edu/Heidi/home.htm 99 http://www.estrellamountain.edu/faculty/farabee/biobk/biobooktoc.html 100 http://publications.nigms.nih.gov/structlife/ 101 http://www.nongnu.org/fhsst/fhsstchem.pdf 102 http://en.wikibooks.org/wiki/Human_Physiology 103 http://publications.nigms.nih.gov/thenewgenetics/index.html 104 http://oceanworld.tamu.edu/resources/oceanography-book/contents1.htm 105 http://oceanworld.tamu.edu/home/course_book.htm 106 http://publications.nigms.nih.gov/insidethecell/ 107 http://publications.nigms.nih.gov/curiosity/ 108 http://publications.nigms.nih.gov/medbydesign/ 109 http://en.wikibooks.org/wiki/Introduction_to_Sociology 110 http://studyspanish.com/index.htm 111 http://www.merlot.org/merlot/communities.htm 112 http://www.wisc-online.org/ 113 http://www.thegateway.org/ 114 http://cloe.on.ca/

PAGE 31

25 WikipediaListofGraphicsinthePublicDomain 115 WikimediaPublicDomainImages 116 FREE:FederalResourcesforEducationalExcellence 117 CreativeCommons 118 Reect Completeoneofthefollowingreectionactivities: 1.JoinMERLOT 119 ,identify 120 learningmaterialsinyourteachingdiscipline,thenaddanassignment toalearningobjectorreviewalearningobject. 2.JoinOERCommons 121 ,thenmakeyourownpostingtotheOERMattersDiscussions 122 area.Click onOERMattersLocalizationForumtoanswerthefollowingquestion: "ParticipateindiscussionsabouthowopeneducationcontentislocalizedandhowthecreationofOER facilitatesorimpedesmakingcontentbecontext-specic.Howiscontentlocalizedattheindividual,school, cultural,andnationallevel,andwhatarethebenets?" Apply 1.IdentifythemostusefulsourcesofOERforuseinyourteachingdiscipline. 2.Developalessonplanusingthesediscipline-specicsources.PostyourlessonplantoMERLOT 123 5.3.1ReviewQuestions 1.Whatisalearningobject? 2.WhatarethemostusefulsourcesofOERinyourteachingdiscipline? 3.WhatcriteriacanbeusedtoassesstheusefulnessoftheseOERs? 5.3.2Resources TheInstructionalUseofLearningObjects:OnlineVersion 124 AKEEPToolkitCaseStudy:PromotingUseofMERLOTLearningObjects 125126 bySharing Authors'andUsers'PedagogicalKnowledgeandExperience 127 Allaboutlearningobjects 128 LearningObjects-EduCause 129 115 http://en.wikipedia.org/wiki/Wikipedia:Public_domain_image_resources#General_collections 116 http://commons.wikimedia.org/wiki/Category:Public_domain 117 http://www.free.ed.gov/ 118 http://creativecommons.org/ 119 http://www.merlot.org/merlot/join.htm 120 http://www.merlot.org/merlot/communities.htm 121 http://www.oercommons.org/join_form 122 http://www.oercommons.org/matters/oer-matters-discussions 123 http://www.merlot.org/merlot/index.htm 124 http://reusability.org/read/ 125 http://jolt.merlot.org/vol1_no1_iiyoshi.htm 126 http://jolt.merlot.org/vol1_no1_iiyoshi.htm 127 http://jolt.merlot.org/vol1_no1_iiyoshi.htm 128 http://www.eduworks.com/LOTT/tutorial/ 129 http://www.educause.edu/645?PARENT_ID=606

PAGE 32

26 CHAPTER5.OERDISCIPLINE-SPECIFICSOURCES

PAGE 33

Chapter6 OERPublicDomainTextbookSources 1 6.1OERSourcesofPublicDomainTextbooks 6.1.1LessonComponents FastFact Skills/Objectives SuccessIndicators Introduction Activity Reviewquestions Resources 6.1.2FastFact 6.1.3ProjectGutenberghas20,000freebooksinitsOnlineBookCatalogand istheoldestproduceroffreeebooksontheInternet. 6.1.4Skills/Objectives Learnerswillbeableto: Locatesourcesofpublicdomaintextbooks. Establishcriteriaforselectionofpublicdomaintextbooks. 6.1.5SuccessIndicators Lessonplandevelopedthatincorporatesuseofapublicdomaintextbook. 6.2Introduction Facultyoftenndthetaskofselectingreadingmaterialsortextbooksforacoursedaunting.Instructorscan easetheselectionprocessbyestablishingandfollowingcriteriasuchasquantity,quality,accuracy,currancy, 1 Thiscontentisavailableonlineat. 27

PAGE 34

28 CHAPTER6.OERPUBLICDOMAINTEXTBOOKSOURCES readinglevel,relevance,andreliability.Whetherduetopassionforthecoursetopicorsimplyhastydecisionmaking,someinstructorsmakethemistakeofselectingandassigninganoverwhelmingamountofreading fortheirstudents.Tryestimatinghowmanyminutesstudentswillneedtocompleteeachreadingassignment andadjustyourselectionoflearningmaterialsaccordingly.Anotherconcernisthatinformationprovidedto students,especiallyinprintedtextbooks,canquicklybecomeoutdated. Criteria/GuidelinesforSelectionofMaterials Qualityofcontent,literarymeritandformat Timeliness Favorablereviews Permanence/lastingvalue Authority:author Scope Physicalquality Format:print,CD-ROM,online,etc. readinglevel TwomajoreortstopromotethedevelopmentandsharingofpublicdomaintextbooksareConnexions 2 andWikibooks 3 .FreeTextbookSearch 4 allowsuserstosearchforfreetextbooksin113sitesinEnglish, German,French,DutchorSwedish. Connexions 5 isaprojectatRiceUniversitysupportedbytheHewlettFoundationtopromotecollaborative development,freesharing,andrapidpublishingofscholarlycontentontheWeb.Contentisorganizedin smallmodulesthatareeasilyconnectedintolargercourses.Allcontentisfreetouseandreuseunderthe CreativeCommons"attribution"license. Wikibooks 6 isaWikimediaprojectstartedin2003withthemissiontocreateafreecollectionofopencontenttextbooksthatanyonecanedit. CollectionsofbooksthatarefreelyavailableincludeProjectGutenberg 7 ,ReadPrint 8 ,Bartleby 9 OnlineBooks 10 ,ElectronicTextService 11 ,andtheOpenBookProject 12 ProjectGutenberghas20,000freebooksinitsOnlineBookCatalogandistheoldestproduceroffree ebooksontheInternet.ThemissionofProjectGutenberg 13 istoencouragethecreationanddistribution ofeBooks.Inaneorttopromoteinterculturalunderstanding,theWorldDigitalLibrary 14 planstomake availablesignicantprimarymaterialsfromculturesaroundtheworld,includingmanuscripts,maps,rare books,musicalscores,recordings,lms,prints,photographs,architecturaldrawings,andothersignicant culturalmaterials. TheAssayer 15 displaysalistoftextbooksthatarefreelyavailableinmanydisciplines.Foranexample, seetheseintroductoryphysicstextbooks 16 andLiberte 17 ,arst-yearcollegelFrenchtextbook.TheInternet PublicLibrary 18 providesacomprehensivelistofbooksthatareavailableontheinternet.Avideotour 19 2 http://cnx.org/ 3 http://en.wikibooks.org/wiki/Main_Page 4 http://www.freetextbooks.eu/ 5 http://cnx.org/ 6 http://en.wikibooks.org/wiki/Main_Page 7 http://www.gutenberg.org/ 8 http://www.readprint.com/ 9 http://www.bartleby.com/ 10 http://onlinebooks.library.upenn.edu/ 11 http://etext.lib.virginia.edu/ebooks/ 12 http://www.ibiblio.org/obp/ 13 http://www.gutenberg.org/ 14 http://www.worlddigitallibrary.org/project/english/index.html 15 http://www.theassayer.org/ 16 http://www.lightandmatter.com/area1.html 17 http://www.lightandmatter.com/french/ 18 http://www.ipl.org/ 19 http://www.ipl.org/div/about/tours/IPLTourIntroVideo.mov

PAGE 35

29 ofthesiteisavailable.ExamplesoffreeavailableeBooksfromBartleby 20 : TheHarvardClassicsShelfofFiction 21 TheOxfordShakespeare 22 AnatomyoftheHumanBody 23 TheWorldFactbook,2003 24 OnlineSapiens 25 TwosourcesofaudiobooksinthepublicdomainareLibriVox 26 andLoudlit 27 .LibriVox 28 providesfree audiobooksfromthepublicdomainwithseveraloptionsforlistening.Loudlit 29 providesatextofgreat literarymasterpiecesaswellashighqualityaudiotohelpreadersimprovetheirspelling,punctuationand paragraphstructure.Loudlitliteratureincludeschildren'sstories,poetry,shortstories,andnovels. Othersourcesoftextbooklearningmaterialsaredigitalcollectionsofinstitutionalrepositories 30 atuniversitiesandself-archiving 31 byauthorsontheinternet.Someoftheseinclude: ScholarshipoftheCaliforniaDigitalLibrary 32 MITtextbooks 33 HofstraUniversityHofprints-HofstraUniversityE-PrintArchive 34 CornellRace,Ethnicity,andReligionProject 35 6.3Activity Experience 1.IdentifysomelearningmaterialsatProjectGutenberg 36 2.GotoWikibooks 37 toidentifytextbooksinyourteachingdiscipline. 3.ConsiderusingWikibooksforaclassproject 38 ;readtheguidelines. 4.Takeatour 39 ofConnexionstondoutifithasresourcesofusetoyouinyourteaching. Reect 1.Createanaccount 40 atProjectGutenbergthenpostyourownreviewofatextbook. Apply 20 http://www.bartleby.com/ 21 http://www.bartleby.com/ebook/ 22 http://www.bartleby.com/70/ 23 http://www.bartleby.com/107/ 24 http://www.bartleby.com/151/ 25 http://onlinesapiens.com/books.html 26 http://librivox.org/ 27 http://www.loudlit.org 28 http://librivox.org/ 29 http://www.loudlit.org 30 http://en.wikipedia.org/wiki/Institutional_repository 31 http://www.eprints.org/openaccess/self-faq/ 32 http://repositories.cdlib.org/escholarship/ 33 http://ocw.mit.edu/ans7870/resources/index.htm 34 http://hofprints.hofstra.edu/ 35 http://racereligion.library.cornell.edu/race/ebooks.php 36 http://www.gutenberg.org/ 37 http://en.wikibooks.org/wiki/Main_Page 38 http://en.wikibooks.org/wiki/Wikibooks:Guidelines_for_class_projects 39 http://cnx.org/aboutus/tour/1.html 40 http://www.gutenberg.org/wiki/Special:Userlogin

PAGE 36

30 CHAPTER6.OERPUBLICDOMAINTEXTBOOKSOURCES 1.DistributedProofreaders 41 .HelpcreateaneBook. 2.Contribute 42 toWikibooksbyeditingpages,creatingnewpages,publicizingWikibooks,andmany otherways,suchasdonating. 6.3.1ReviewQuestions 1.Whataretheadvantagesanddisadvantagestousingpublicdomaintextbooksforteaching? 2.Whatarethemostusefulsourcesofpublicdomaintextbooksinyourdisciplineandwhy? 6.3.2Resources ProjectGutenberg 43 The7ThingsYouShouldKnowAboutE-Books 44 41 http://www.pgdp.net/c/ 42 http://en.wikibooks.org/wiki/Wikibooks:Contributing_FAQ 43 http://www.gutenberg.org/wiki/Main_Page 44 http://www.educause.edu/content.asp?page_id=666&ID=ELI7020&bhcp=1

PAGE 37

Chapter7 OERUseofPrimarySources 1 7.1OERUseofPrimarySources LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources FastFact TheLibraryofCongressisthenation'soldestfederalculturalinstitutionandservesastheresearcharm ofCongress.Itisalsothelargestlibraryintheworld,withnearly130millionitemsonapproximately530 milesofbookshelves.Thecollectionsinclude:booksandotherprintedmaterials,soundandmotionpicture recordings,photographs,maps,andmanuscripts.Reference:OceoftheLibrarian 2 7.1.1Skills/Objectives Learnerswillbeableto: 1.Identifyresourcesforuseofprimarysourcesaslearningmaterialsintheirownteachingdisciplines. 2.Locateatleastoneprimarysourceforuseintheirownteaching. 3.Developalessonplanusingprimarysources. 7.1.2SuccessIndicators 1.LearnerwillpostalessonplanthatusesatleastoneprimarysourceasanOERfortheirownteaching. 7.2Introduction AccordingtotheNationalArchives 3 ,theuseofprimarydocumentsaslearningmaterialspromotes 1 Thiscontentisavailableonlineat. 2 http://www.loc.gov/about/ 3 http://www.archives.gov/education/ 31

PAGE 38

32 CHAPTER7.OERUSEOFPRIMARYSOURCES 1.Studentawarenessthatallwrittenhistoryissubjectiveinthesensethatitreectsanauthor'sinterpretationofpastevents,and 2.Importantanalyticalskills. Primarysourcesinclude: personalrecordsbirthcerticates,deathcerticates,passports,driver'slicenses federalcensusgures newspapers localgovernmentles letters,personaldiariesandmemoirs drawingsandphotographs oralhistories artifacts courttranscripts CompletetheIntroductoryLesson 4 aboutprimarysourcesavailablefromtheAmericanMemoryprojectat theLibraryofCongress. TheSmithsonianSourceTeachingwithPrimarySources 5 isanotherusefulresourceforteachingAmerican History.Itincludesvideos,lessonplans,andsearchablecollectionofprimarydocuments. AmericanRhetoric 6 makesaudioclipsofvariousspeechesavailablefromaSpeechBankviatheinternet. WebsitecontentatAmericanRhetoric 7 isfreeforeducationalusesundertheFairUseexceptionwith attribution. 7.3Activity Experience Completeatleasttwoofthefollowingactivities: 1.ReviewoneofthelessonplanspostedattheNationalArchive'sTeachingWithDocuments:Lesson Plans 8 andlookattheAnalysisWorksheets. 2.Createanaccount 9 attheSmithsonianSourceTeachingwithPrimarySourcessothatyoucanreview lessonsandaddthemtoyourowncollection.ClickonHistoricalPerspectives 10 tondatopicof interesttoyouandndDBQtoaddtoyourcollection. 3.Createanaccount 11 andlogintothePrimarySourcesothatyoucansetupaPortfolioforstoring primarydocumentsthatyouhaveidentiedandselectedforuse.Contribute 12 aLibraryofCongress resourcelinkforyoursubjectarea.SearchtheLearningExperiencesCollection 13 ,selectaLearning Experienceofinterest,andreviewit. 4.CreateanintroductoryactivityforyourownstudentsfollowingtheinstructionspostedatPrimary SourceLearning 14 Reect PostyourresponsestothefollowingquestionsinyourcourseDiscussionarea: 4 http://memory.loc.gov/learn/lessons/psources/source.html 5 http://www.smithsoniansource.org/ 6 http://www.americanrhetoric.com/ 7 http://www.americanrhetoric.com/ 8 http://www.archives.gov/education/lessons/index.html 9 http://www.smithsoniansource.org/account/newaccount.aspx 10 http://www.smithsoniansource.org/his/viewdetails.aspx 11 http://www.primarysourcelearning.org/db/submission/ 12 http://www.surveymonkey.com/s.asp?u=17335722530 13 http://www.primarysourcelearning.org/db/search/le.php 14 http://www.primarysourcelearning.org/db/imagesdraw/index.shtml

PAGE 39

33 Howwouldthelearningexperiencebedierentforastudentcompletingalessonthatusesprimary sourcesversusthesamelessonthatusesatextbook? Whatchallengesmightyouencounterasateacherusingprimarysourcesinsteadoftextbooks? Apply 1.Identifyasetofprimarysourcesforuseinyourteaching. 2.Developalessonplanusingtheseprimarysources.PostyourlessonplantoMERLOT 15 orOER Commons 16 7.3.1ReviewQuestions 1.Whataretheadvantagesanddisadvantagestousingprimarysourcesforteaching? 2.Whatarethemostusefulresourcesforteachingwithprimarysourcesinyourdisciplineandwhy? 7.3.2Resources PrimarySourceLearningHandbook 17 UseofPrimarySourcesinLibraryofCongress 18 NationalArchivesLessonPlans 19 LibraryofCongress 20 PrimarySourceLearning 21 Usingdigitizedprimarysourcematerialsintheclassroom 22 15 http://www.merlot.org/merlot/index.htm 16 http://www.oercommons.org/ 17 http://www.primarysourcelearning.org/handbook/ 18 http://memory.loc.gov/learn/start/prim_sources.html 19 http://www.archives.gov/education/lessons/ 20 http://memory.loc.gov/learn/lessons/primary.html 21 http://www.primarysourcelearning.org/ 22 http://www.rstmonday.org/issues/issue10_6/bloom/index.html

PAGE 40

34 CHAPTER7.OERUSEOFPRIMARYSOURCES

PAGE 41

Chapter8 OERDevelopment 1 8.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 8.2FastFact "Universaldesign 2 isthedesignofproductsandenvironmentstobeusablebyallpeople,tothegreatest extentpossible,withouttheneedforadaptationorspecializeddesign.Theintentofuniversaldesignisto simplifylifeforeveryonebymakingproducts,communications,andthebuiltenvironmentmoreusablebyas manypeopleaspossibleatlittleornoextracost.Universaldesignbenetspeopleofallagesandabilities." -CenterforUniversalDesign 3 8.3Skills/Objectives Learnerswillbeableto: 1.UsetoolsandresourcestodevelopOER. 2.IdentifytherequirementsforOERinordertocomplywithADASection508requirements. 8.4SuccessIndicators 1.OERdevelopedbythelearneraddedtolearner'sownonlinecollectionorportfolio. 1 Thiscontentisavailableonlineat. 2 http://en.wikipedia.org/wiki/Universal_design 3 http://www.design.ncsu.edu:8120/cud/about_ud/about_ud.htm 35

PAGE 42

36 CHAPTER8.OERDEVELOPMENT 8.5Background AsnotedbyToddRichmond 4 ataDIYMediaseminarattheAnnenbergCenterin2006,thecommonsbasedpeerproduction 5 ordo-it-yourselfsharedmediaproductionaspectofOERmaywellbeacatalystfor innovationonceOERgoesviral 6 .SeveralresourcesareavailableontheInternetthatprovideteacherswith toolstoshareandcollaborateonthedevelopmentofOERforuseininstruction.Someoftheseare:Rice Connexions,OpenLearningContentObservatoryServicesOLCOS,WikiEducator,andWikiBooks. Accessibility CertainaccessibiiltyrequirementsmustbeaddressedwhendevelopingOERforelectronicdisseminationto students.Bylaw,ADASection508 7 ,learningmaterials,includinginterfaces,images,sounds,multimedia elements,andallotherformsofinformation,mustbemadeavailableforusedbyanyone,regardlessof disability.DetailedinformationaboutaccessibilityguidelinesareavailableatWebAccessibilityInitiative WAI 8 andtheAmericanswithDisabilitiesActADA 9 .A-Prompt 10 isanaccessibilityevaluationand repairtoolfromtheUniversityofTorontoincooperationwiththeTraceCenterandCAST.Ademonstration versionisavailablefordownload.A-Promptlistswhatitconsiderstobeerrorsandoersachancetocorrect eachone.UtahStateUniversity,WebAccessibilityinMindWebaim 11 oersvarious"HowTo"information andsupportoncreatingaccessiblewebsites.WebauthorscanndaSectionchecklist,sampleHTMLmarkup andvariousarticlesandcoursesonaccessiblewebdesign.TheAccessibleWebPublishingWizard 12 simplies thetaskofconvertingPowerPointpresentations,Worddocuments,andinthefutureExcelspreadsheetsto accessibleHTMLthroughaneasy-to-useuserinterfaceandautomationofmanyofthedetailsofconversion. 8.5.1RiceConnexions TakeatourofConnexions 13 .ConnexionswasstartedatRiceUniversityin1999topromoteinnovative waystowrite,edit,publish,andusetextbooksandotherlearningmaterials.Connexionparticipantsare encouragedto: Createeducationalmaterialsandcontributethemtotherepository 14 Riporcopythematerialandcustomizeit Mixthematerialtogetherintonewbooksandcourses Burnorcreatenishedproductssuchase-learningwebcourses,CDroms,andevenprintedbooks Open-accesssoftwaretoolsandfree-usematerialsareavailableviatheCreativeCommonsAttributionlicense 15 tofacilitatecollaborationandsharing.AtConnexions,instructorscaneasilycollaborate 16 onOER developmentinavarietyofrolesincludingcoauthors,maintainers,workgroupmembers,suggesters,andusers ofderivedcopies.InstructorscanupdatetheirOERcoursematerialandmakeitavailablefordistribution quickly. OWLInstitute InadditiontoprovidinguserswithconnectionstoOERresourcesandcommunities,theOWLInstitute Portal 17 toprovidestheopportunityforuserstodevelopandsharetheirownOERresources.Contactthe OwlInstitutetoreceive"creator"or"teacher"accesstocoursesandpages. 4 http://weblogs.annenberg.edu/diy/2006/10/todd_richmond_on_open_educatio.html 5 http://en.wikipedia.org/wiki/Commons-based_peer_production 6 http://www.nostatic.com/hewlett/ 7 http://www.section508.gov/ 8 http://www.w3.org/WAI/Resources 9 http://www.usdoj.gov/crt/ada/adahom1.htm 10 http://aprompt.snow.utoronto.ca/ 11 http://www.webaim.org/ 12 http://cita.rehab.uiuc.edu/software/oce/ 13 http://cnx.org/aboutus/tour/ 14 http://cnx.org/sitelicense 15 http://cnx.org/creativecommons.org/licenses/by/2.0/ 16 http://cnx.org/help/reference/collaboration 17 http://owli.org/moodle/

PAGE 43

37 DigitalUniverse TheDigitalUniverse 18 seeksstewardsandvoluntaryconsultantstoassist 19 intheireorts"toorganizethe sumtotalofhumanknowledgeandmakeitavailabletoeveryone." LeMill TourLeMill 20 tondavarietyofopenlearningmaterials.JointheLearningMillcommunitytocontribute andshareyourownlearningmaterials.FAQs 21 describehowtousethesite. MoreTools OLCOS,theUK'sOpenLearningContentObservatoryServices 22 projectcontainsa30minutetutorial abouthowtoproduceOER 23 .Thistutorialprovidesinformationandpracticaltasksincreatingandmodifyingopencontentinopenprocessaswellasformatsthatcanbepublishedasopeneducationalresources andtools,thatsupportthisprocess.Wikieducator 24 promotescollaborativeauthoringanduseofOERby providingtoolsusingwikitechnologiessuchaseXe 25 .TheWikideducatorContentDevelopmentProject 26 isanopportunityforeducatorstocontributeandsharetheirOER.WikibooksWikibooks 27 isaWikimedia 28 projectthatstartedin2003withthegoaltocreateafreecollectionofopen-contenttextbooksthatanyone canedit.Sinceitsinception,volunteershavewrittenover25,000modulesinamultitudeoftextbooks.If you'reaninstructorplanningonusingWikibooksforaclassproject,readguidelinesforclassprojects 29 Takeatour 30 oftheInstructionalArchitect 31 ,aserviceoftheNationalScienceDigitalLibrary,tondout howyoucanuseittonddiscipline-specicOER,organizeandmodifythoseresourcesintoactivitiesfor yourstudents,andmakethosenewactivitiesavailabletoavarietyofaudiences.ccMixter 32 isacommunity musicsiteprovideopportunitiestocollaboratewithotherstore-purposeandmixexistinglearningmaterials licensedunderCreativeCommons.Send2Wiki 33 isanewtoolthatletsuserseasilysendacopyofawebpage toawikiforremixing.Wikia 34 areprovidesfreewikihostingdesignedexpresslyforpromotingreuseofopen contentwiththeMediaWikisoftware.AllcontentonWikiaisperpetuallylicensedundertheGNUFree DocumentationLicense. 8.6Activity Experience CreativeCommons UseCreativeCommons 35 tosearchforlearningmaterialsthatyouarefreetouse,remix,repurpose,etc. Wikieducator WatchashortvideoabouthowtocreateanaccountatWikieducator 36 .Registerforyouraccount. OERCommons 1.JoinOERCommons.GototheOERCommons 37 website,thenclickonJoinNow. 18 http://www.dufoundation.org 19 http://www.dufoundation.org/participation.php 20 http://lemill.net/content/lemill-tour 21 http://lemill.net/content/lemill-faq 22 http://www.olcos.org/english/home/ 23 http://wikieducator.org/Open_Educational_Content/olcos/PRODUCE_&_REMIX 24 http://www.wikieducator.org/ 25 http://exelearning.org/ 26 http://www.wikieducator.org/How_to_contribute_and_use_content 27 http://en.wikibooks.org/wiki/Main_Page 28 http://en.wikipedia.org/wiki/Wikimedia 29 http://en.wikibooks.org/wiki/Wikibooks:Guidelines_for_class_projects 30 http://ia.usu.edu/takethetour.html 31 http://ia.usu.edu/index.php 32 http://ccmixter.org/ 33 http://www.send2wiki.com/ 34 http://www.wikia.com/ 35 http://search.creativecommons.org/ 36 http://www.wikieducator.org/Wikieducator_tutorial/Creating_an_Account/Show_me_how 37 http://www.oercommons.org/

PAGE 44

38 CHAPTER8.OERDEVELOPMENT 2.ClickonStartMyOERPortfolio. 3.VisitSharedPortfolios 38 postedtotheOERCommonswebsitetoseetoseehowotherssearch,use, andinteractwithOER. Reect PosttoyourcourseDiscussionareainresponsetothefollowingquestions: 1.WhatisthebestwaytopromotedevelopmentofOERamongeducators? 2.WhoshouldberesponsibleforensuringthatOERaredevelopedwithADASection508accessibilty requirementsinmind? Apply MERLOT 1.ViewtheGalleryofSampleMERLOTFromtheAuthorSnapshots 39 2.GototheMERLOTwebsite. 3.ViewafewPersonalCollectionspostedbyothers. 4.BecomeamemberofMERLOT 40 5.CreateyourownMERLOTPersonalCollection 41 Wikibooks 1.CreateanaccountatWikibooks 42 2.GotoWikibooksSandbox 43 tocreateawiki. Connexions Createamodule 44 toshareatConnexions 45 Afterregistering,reviewtheNewAuthorGuide 46 YoucanimportaWorddocumentorusetheConnexionsEdit-in-Placetooltocreateyourmodule. 8.6.1ReviewQuestions 1.Whataresomeoftheresourcesyoucanusetoremix,repurposeOER,anddevelopyourownOER? 2.WhatisnecessarytoensurecompliancewithADASection508accessibilitylawswhendevelopingOER forelectronicdisseminationtostudent? 8.6.2Resources CollaborativeDevelopmentofOpenContent 47 WikiEducator:Memoirs,Myths,MisrepresentationsandtheMagic 48 OERDevelopmentandPublishingInitiatives 49 38 http://www.oercommons.org/matters/share 39 http://www.cfkeep.org/html/gallery.php?id=96530011199908 40 http://taste.merlot.org/evaluationcriteria.html 41 http://taste.merlot.org/personalcollections.html 42 http://en.wikibooks.org/wiki/Special:Userlogin 43 http://en.wikibooks.org/wiki/Wikibooks:Sandbox 44 http://cnx.org/help/ModuleInMinutes 45 http://cnx.org/ 46 http://cnx.org/help/authorguide 47 http://rstmonday.dk/issues/issue8_2/keats 48 http://blog.worldcampus.psu.edu/index.php/2007/04/04/wikieducator/ 49 http://oerwiki.iiep-unesco.org/index.php?title=OER_development_and_publishing_initiatives

PAGE 45

39 OpenEducationalResourcesAnonymityvs.Specicity 50 AdvancingSustainabilityofOpenEducationalResources 51 50 http://www.eurodl.org/materials/contrib/2006/Bernd_Remmele.htm 51 http://proceedings.informingscience.org/InSITE2007/IISITv4p535-544Kooh275.pdf

PAGE 46

40 CHAPTER8.OERDEVELOPMENT

PAGE 47

Chapter9 OERDelivery,Storage,and Organization 1 OERDelivery,StorageandOrganization 9.1LessonComponents FastFact Skill/Objective SuccessIndicators Introduction Activity Reviewquestions Resources 9.2FastFact "AsofJanuary2006,therewereover3,200modulesandover150coursesinConnexions.Volunteersaretranslatingmodulesandcoursesintoawidevarietyofdierentlanguages,includingSpanish,Japanese,Italian, Chinese,Portuguese,andThai."-OECD 2 9.3Skills/Objectives Learnerswillbeableto: 1.CourseparticipantswillusevarioustoolsaswellaspeercollaborationtobuildaPublicDomain MaterialsPortfolioofdiscipline-specicpublicdomainmaterialssuitableforuseintheirownteaching. 2.Determinecost-eectiveprintingoptionsforstudents. 9.4SuccessIndicators 1.OERaddedtolearner'sownonlinecollectionorportfolio. 2.OERreviewpostedbythelearner. 1 Thiscontentisavailableonlineat. 2 http://www.oecd.org/dataoecd/3/6/36781781.pdf 41

PAGE 48

42 CHAPTER9.OERDELIVERY,STORAGE,ANDORGANIZATION 9.5Introduction SeveralresourcesareavailableontheInternetthatprovideteacherswithtoolstoorganize,deliver,andshare OERforuseininstruction.Someoftheseare:MERLOT,Connexions,andWikiEducator.Instructorscan deliverdeliverOERtostudentsineitherdigitalorprintformats.OLCOS,theUK'sOpenLearningContent ObservatoryServices 3 projectcontainsa30minutetutorialabouthowtopublishandshareOER 4 9.5.1OERCommons OERCommons 5 allowsmemberstoshareportfolios.Yourpersonalizedportfolioallowsyouquickaccess toyourprevioususeoftheOERCommons.AsyouengagewithOERcontentbysubmittingratingsand reviews,yourportfolioiscreatedautomatically.Ifdesired,youcanshareyourportfoliowithothersand allowotherstobuildonwhatyouknow.Also,youcanviewothers'portfoliostoseehowpeoplearending, using,andinteractingwithOER. 9.5.2MERLOT ReadaboutMERLOT'sPersonalCollections 6 .Buildanddisplayyourportfolio,asitevolvesforthe durationofyourstudents'courseparticipation,usingtheFromtheAuthorSnapshots. WikiEducator WikiEducatorprovidesanContentDevelopmentProject 7 asanopportunityforinsturctorstocontribute andsharetheirOER. Connexions FundedbytheWilliamandFloraHewlettFoundation,Connexionsispartofabroadereorttousethe internetforinnovativedeliveryofeducationalmaterials.AtConnexions,instructorscansetupacollection oflearningmaterials.Acourse/collectioncontainsseveralConnexionsmodulesthatyougrouptogetherin aspecicorder.ThesemoduleswillappearaschaptersinasingledocumenttoConnexionsvisitorswho viewyourcourse/collection. RiceUniversity'sConnexions 8 provideson-demandprintingwithQOOPInc.thatwillallowstudents andinstructorstoorderhigh-quality,hardboundtextbooksfromConnexionsviatheinternetforaordable prices. IntheConnexionsCommunityCollegeInitiative,thetop10communitycollegecourses,includingEnglish composition,collegealgebra,introductiontopsychology,generalchemistry,arebeingdeveloped.These courseswillbeavailableforfreeinConnexionsandinalow-costprintedform.Underthismodel,readers canaccessallbooksonlineforfree,andtheywillpayonlyiftheywantaprintedbook,whichthey'llorder onlineandforhomedelivery.Connexionsalsoplanstodevelopacatalogofthe10most-popularcommunity collegetextbooks,whichalsowillbefreeforonlineviewingandcostlessthan$30whenpurchasedas hardboundbooks.Connexionsplanstooermorethan100titlesforonlinepurchasebyyear'send. DeliveryofCourseMaterials OERdeveloperscandistributetheirlearningmaterialsviatheinternetusingthetoolsandresources providedforfreetoeducatorsatWordCircle 9 ,NiceNet 10 ,Digication 11 ,orEpsilen 12 3 http://www.olcos.org/english/home/ 4 http://wikieducator.org/Open_Educational_Content/olcos/SHARE 5 http://www.oercommons.org/ 6 http://taste.merlot.org/personalcollections.html 7 http://www.wikieducator.org/How_to_contribute_and_use_content 8 http://cnx.org/ 9 http://www.wordcircle.org/ 10 http://www.nicenet.org/ 11 http://www.digication.com/ 12 http://www.epsilen.com/

PAGE 49

43 PublishingLearningMaterials QOOP 13 'sprint-on-demand 14 servicewillallowConnexionsuserstoordercustomizedcourseguidesand avarietyoffullydevelopedConnexionstextbooks.Standardpaperbackswilltakejust3-5daystoproduce andship,andtraditionalhardbackswilltakeaboutaweektoproduce.QOOPshipsdirectlytocustomers. Lululetsyoupublishandsellandprintondemandbooks,e-books,onlinemusic,images,customcalendars safariTakeatourofLulu 15 tondouthowtopublishusingtheirservices.Lulumakes20%oftotalcostofthe textbookyoupublishusingtheirservices.SafariU 16 allowsfacultytocreate,publishandsharecustomized comuterscienceandinformationtechnologycoursematerials.SafariUwasdevelopedbyO'ReillyMedia inconjunctionwithsubstantialfeedbackfromeducatorsandtrainers.SafariUallowsmemberstoselect chaptersorsectionsfromO'Reillybooksandarticlestoincludeincustomprintbooksandonlinelearning resourcesthatstudentscanaccessdirectly.Otherprint-on-demandservicesincludeIllumina 17 andexlibris 18 Activity Experience OERCommons 1.Ifyouhaven'talreadydoneso,joinOERCommons.GototheOERCommons 19 website,thenclick onJoinNow. 2.ClickonStartMyOERPortfolio. 3.VisitSharedPortfolios 20 postedtotheOERCommonswebsitetoseetoseehowotherssearch,use, andinteractwithOER. MERLOT 1.ViewtheGalleryofSampleMERLOTFromtheAuthorSnapshots 21 thenndouthowtocreateyour ownAuthorSnapshot 22 usingtheKEEPToolkit 23 2.GototheMERLOTwebsite. ViewafewPersonalCollectionspostedbyothers. CreateyourownMERLOTPersonalCollection 24 Connexions 1.CreateaCourse/Collection 25 attheConnexionswebsite. Reect PostyourresponsetothefollowingtoyourcourseDiscussionarea: 1.WhatisthebestwayforyoutodisseminateOERtoyourstudents? 2.DoyouwanttoshareyourOERforpublicuseandrepurposing?Whyorwhynot? Apply 1.Createamodule 26 toshareatConnexions. 2.DeterminethecosttoyourstudentstopurchaseOERforyourcourseusingLulu 27 13 http://www.qoop.com/ 14 http://en.wikipedia.org/wiki/Print_on_demand 15 http://www.lulu.com/demos/get_started 16 https://www.safariu.com/index.do 17 http://www.illumina.com/ 18 http://www2.xlibris.com/ 19 http://www.oercommons.org/ 20 http://www.oercommons.org/matters/share 21 http://www.cfkeep.org/html/gallery.php?id=96530011199908 22 http://taste.merlot.org/snapshots.html 23 http://www.cfkeep.org/static/index.html 24 http://taste.merlot.org/personalcollections.html 25 http://cnx.org/help/CreateCollection 26 http://cnx.org/help/ModuleInMinutes 27 http://www.lulu.com/

PAGE 50

44 CHAPTER9.OERDELIVERY,STORAGE,ANDORGANIZATION 9.5.3ReviewQuestions 1.Whataresomeoftheprint-on-demandservicesfordisseminatingOER? 2.WhattoolsandfeaturesareavailabletodeliverOER? 9.5.4Resources CaseStudy:PromotingUseofMERLOTLearningObjectsbySharingAuthors'andUsers'Pedagogical Knowledge 28 OpenEducationalPracticesandResources.OLCOSRoadmap2012 29 WhatMakesanOpenEducationProgramSustainable:TheCaseofConnexions 30 28 http://jolt.merlot.org/vol1_no1_iiyoshi.htm 29 http://www.olcos.org/english/roadmap/roadmap.html 30 http://www.oecd.org/dataoecd/3/6/36781781.pdf

PAGE 51

INDEX 45 IndexofKeywordsandTerms Keywords arelistedbythesectionwiththatkeywordpagenumbersareinparentheses.Keywords donotnecessarilyappearinthetextofthepage.Theyaremerelyassociatedwiththatsection. Ex. apples,1.1 Terms arereferencedbythepagetheyappearon. Ex. apples,1 D discipline,5 F fairuse,3 O oer,1,2,4,5,7, 9 opencourseware,2 openeducationalresources,1,4, 5,7,8,9 P primarysources,7 R repositories,9 S sources,4 T textbookalternatives,6

PAGE 52

46 ATTRIBUTIONS Attributions Collection: IntroductiontoOpenEducationalResources Editedby:JudyBaker URL:http://cnx.org/content/col10413/1.3/ License:http://creativecommons.org/licenses/by/2.0/ Module:"OERIntroduction" By:JudyBaker URL:http://cnx.org/content/m14466/1.10/ Pages:1-5 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/ Module:"OEROpenCourseware" By:JudyBaker URL:http://cnx.org/content/m14467/1.3/ Pages:7-9 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/ Module:"OERFairUse,Copyright,andTEACHAct" By:JudyBaker URL:http://cnx.org/content/m14465/1.3/ Pages:11-14 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/ Module:"OERIdentifyingSources" By:JudyBaker URL:http://cnx.org/content/m14475/1.10/ Pages:15-18 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/ Module:"OERDiscipline-SpecicSources" By:JudyBaker URL:http://cnx.org/content/m14473/1.17/ Pages:19-25 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/ Module:"OERPublicDomainTextbookSources" By:JudyBaker URL:http://cnx.org/content/m14471/1.10/ Pages:27-30 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/

PAGE 53

ATTRIBUTIONS 47 Module:"OERUseofPrimarySources" By:JudyBaker URL:http://cnx.org/content/m14474/1.4/ Pages:31-33 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/ Module:"OERDevelopment" By:JudyBaker URL:http://cnx.org/content/m14469/1.15/ Pages:35-39 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/ Module:"OERDelivery,Storage,andOrganization" By:JudyBaker URL:http://cnx.org/content/m14472/1.3/ Pages:41-44 Copyright:JudyBaker License:http://creativecommons.org/licenses/by/2.0/

PAGE 54

IntroductiontoOpenEducationalResources Aself-pacedtutorialaboutopeneducationalresourcesasalternativestotextbooksforcollegeteachers. VisitorsareinvitedtoactivelyparticipatebypostingActivityReectionentriestothecourseDiscussion area.Thistutorialhas9Lessonsorganizedinto3Units:Background,OERSources,andOERUse. AboutConnexions Since1999,Connexionshasbeenpioneeringaglobalsystemwhereanyonecancreatecoursematerialsand makethemfullyaccessibleandeasilyreusablefreeofcharge.WeareaWeb-basedauthoring,teachingand learningenvironmentopentoanyoneinterestedineducation,includingstudents,teachers,professorsand lifelonglearners.Weconnectideasandfacilitateeducationalcommunities. Connexions'smodular,interactivecoursesareinuseworldwidebyuniversities,communitycolleges,K-12 schools,distancelearners,andlifelonglearners.Connexionsmaterialsareinmanylanguages,including English,Spanish,Chinese,Japanese,Italian,Vietnamese,French,Portuguese,andThai.Connexionsispart ofanexcitingnewinformationdistributionsystemthatallowsfor PrintonDemandBooks .Connexions haspartneredwithinnovativeon-demandpublisherQOOPtoacceleratethedeliveryofprintedcourse materialsandtextbooksintoclassroomsworldwideatlowerpricesthantraditionalacademicpublishers.