UFDC Home  |  Search all Groups  |  Digital Library of the Caribbean  |  dLOC  

Planters' Punch

MISSING IMAGE

Material Information

Title:
Planters' Punch
Physical Description:
Serial
Language:
English
Creator:
Herbert G. deLisser
Publisher:
Planters' Punch
Place of Publication:
Kingston: Jamaica
Publication Date:

Subjects

Subjects / Keywords:
Periodicals   ( lcsh )
Genre:
serial   ( sobekcm )
Spatial Coverage:
Jamaica

Record Information

Source Institution:
National Library of Jamaica ( SOBEK page | external link )
Holding Location:
National Library of Jamaica ( SOBEK page | external link )
Rights Management:
All rights reserved by the source institution.
Resource Identifier:
nlj - P57
System ID:
AA00004645:00027


This item is only available as the following downloads:


Full Text




_


II ,_
VOL. II. NO. 6. 1931-32 PRICE: ONE SHILLING

PRINCIPAL CONTENTS.
THE CUP AND THE LIP, By Herbert G. de Lisser,--A HOW JAMAICA IMPRESSED ME=,--By Miss Shirley Derby-
Jamaica Novel, telling the old, old story as it is re- shire.-Eflfect on a visitor of a first look at Jamaica.
enaced n ou ow locl cnditonsMONTEGO BAY AT BREAKFAST, LUNCH AND WORK.
THE PRINCE AS DALNCER,--rThe Story of ~an informal A Northeide City's Progress.-Illustrated.
night at Constant Spr ng Hotel.--lilustrated
WARS INV JAMAICA--An entertaining blend of H-istory and I HOIW PARAMOUNT D'OES IT. Behind the Scenes of a
Humour.--lik:4trated great Moving Picture Organization.--Illustrated
THE TALE OF~ T~HE PICTURES.--The Past and the
Present, and the wvork of famous Producers.-- THE HAUNVTING OF THE FLAMINGO,--By David Sin-
illustrated clair.--An old superstition of the Sea

-- I


I


.A NI Al CAnroR


c\. ~
i se We' j~y


Lnl ;litd


Two ma S\ilrnining~ 1)....5 Innes I'ool0 1.1() 11. x ('" I ot-
PaulII 1 .1!l1. x ln it.-Dliv.ing, Phitflll nIS--Sprli* .* neis-ia-hC
na1 lr-lln- TreIll''l--\nze-Wat II. .rses Unt-- Hubb er-I:! III Ilat --

Music ~ ~ T niniDanin- haly y Uineout Royal Hungarian Oypsy"~ Orchestra

Co(IIIl RlefrelShin*: IDrinksii-Li*L~t Luncheon--Afternoon Tea
Tlra Dou~LSantS ;1ual. Drlis Arranged
171.andalrlle, ;Ind- (:nllfortaly~n)I FmnI~iShedI AleI-I..ne- (erlooking Sixth Best Harbour in World

(:inhI Exclusi\-l- ly 1 I se of 30-mber-I1
~h13)UI .Anl theiril Ave'"lillinied (n; i lI 1.'


BOUR N E MO U TH


CLUCJB













STEAMSHIP AGENTS FOR: 1Ve Are:
ROYAL NETHERLANDS EXPORTERS OF ALL ISLAND PRODUCE ,
STEAMSHIP. CO.
d ;r:COFFEE EXPERTS & FACTORY OWNERS
JAMES NOURSE &( CO.. LTD.
-;-~IMPORTERS OF MERCHANDISE
FOODSTUFFS ETC.


WHARF-OWNERS.











"'Frorn the Far Corners of the Earth .....
WVe B~ring Our Merchandise to You."

Together W~ith Our Londoln Affiliation 1E. A. de Depass &t Co, Ltd,, we
have W~orld-wide connections which enable us to quote you extremely
competitive prices, on both Merchandise and Island Produce.
IT PAYS TO GIVE US YOUR BUSINESS. BOTH HERE AND ABROAD.

LASCELLES onI ~MERCADO & Co., LTD.


PLANTER S' PUNCH


1931-32














MIXED BY
HERBERT G. DE LISSER. C.M.G.


For the Ylear 1931-1932


Vol. II. N'o. 6.




The P-



THE Prince of Wales
came to Jamaica as
the Earl of Chester. His
brother, Prince George,
travelled with him as Lieu-
tenant Windsor. But the
people of Jamaica would
have nothing to do with in~-
cognitos; when Their Rtoyal
Highnesses landed at t-he
waterfront of K~ing~ston it
was as Royal personages
that they were greeted, and
hardly anywhere, save at
one function, could they S
relax and become simple
gentlemen according ;to the
desire of their hearts.

ON the night of the 3rd
February, 193~1, there
was a great reception at
King's House for the meet-
ing of the Princes with
members of the local so-
ciety. Dinner to a limited l
number of persons had been
served inl the Governor's
dining roomo, and sometime
past nine o'clock the .re-
ception began. Without a
decoration of any kind the
Princes stood at the e~ast
end of the K'ingr's house
ballroomz and before them
passed a long stream of
couples, with. officers in
waiting announcing the
nlames. With each person
Their Royal Highnesses
shook hands, smiling brightt-
ly and cheerfully. It WaS H.R.H. THE PR
PATRICK DAVID,
an ordeal; receptions of or Rneurew, Lord
this sort are always ordeals. Pc., K.T., K.P., (
Colondl Welsh Gu.
The story goes that some Air Force, Mbaster
persons had borrowed dress
coats in order to have the honour of clasping
tl~ie hands of the Prince of Wales: such indul-
gencec in honrrowfing may well be excused otn
suchl a parlltil.-larl occasion. Some ladies were
saidl to. hatl\e benc~ much perteurbed over the
qunestionl I-f phites.lS Should gloves be worn?
Should glows n,.lt be worn'? There was one
lady who, Ilurling her march in, the queue to-
wa~rds Their Royal Highnesses, took off and
pult onI her glovesci no fewer than three times,
and~ thenu foound herself inl front of the Royal
visit-rls with halt of a glove hanging loose on
hler right hanud. But at last it was all over
andi the Princ~es retired to the north verandah
of K~ing'ii HI-use, where they talked for some
little timec with various people. Then twelve
o'cloc-k drew\ nlear, and it was rumoured that
Their Royal H~ighnesses would go down to
Bournemouth ]Bath for an. hour or two of re-


Camera Portrait by/ H


.,] i


~IINCEi OF- WALIES, EDW1ARD ALBERT CHRISTIAN G
,Earl of Chester, Duke of Cormvall. Duke of Rothesay, Earl
of the Isles, and Great Steward oi Scotland, High Steward
G.C.S.I., G.C.M\.G., G.C.I.E,., G.C.V.O., G.C.B.E., Personal A.D.C
lards, Colonel-in-Chief M~iddlesex Regimnent, Captain R.N., G
of the Merchant Navy and Fishing Fleets, born June 23, 1894

laxation after their strenuous labours of the
night.

T HERE was a dance a~t Bournemnouth Bath,
1Hundr~eds of persons drifted thither in the
hope of the Prince of Wales and of Prince:
George making an appearance there. The royal
cars had twice driven up to the principal en-
trance of King's House, waited for so~me
minutes, and then driven away again. Ai crowd
had assembled in the hall of the building ex-
pecting to see Their Royal Highnesses emecrge
and depart. After the cars had disappeared
for the last time, however, the rumour was
that the Princes had left already, by another
way, and after midnight King's House was free
of the crowd. Only the next day did hundreds
and thousands of persons learn that at about
midnight Their Royal Highnesses had driven up


PUNC~H


P LANT~7E R S'


~rince


Dance7-


lughl Cecil (Gopylrighct).

to the Constant Spring
Hotel, then not yet formal-
Sly opened, and had found
There twenty or thirty per-
sons, some of whom had
been specially invited to
meet the Royal brothers.
.' No one had thoughtl
of Constant Spring Hotel
when speculating upon the
chance of mobbing the
Princes. It was Command-
er J'. Ki. L. Ross, who had
previously known the
(.Prince of Wales in Canada,
who on this reception night
had invited His Roy~al HEigfh-
ness to spend in private
relaxation a little time at
the CII 1 to mf Spring Hotel.
The orchestra was playing,
amongst the, younger ladies
presentt were Mliss Peggy
O'Neil, and Miss Gardiner,
daughters of Canadians
then in the island, Miss
Baztte~rsby, daughter of an
American, Miss deLittle,
the daughter of an Aush-
~tralian. Also Mrs. KEno
Cocking, Miss Iris deLiasser
and 3lim~ Hope Cahusac, all
Jamnaicans. During tboe
first few minutes lifter thle
princes' arrival, there was
that feeling of restraint,
that gene, which the pres-
ence of Royalty so frequenlt-
lyV inspires. But the night
was soft and beautiful, the
:EOBoE ANDREW Orchestra was playing a
lof Carrick, Baron
of Windsor, K;.G., lively tune, the Royal bro-
.to H.MU. the Kiing, others were, for the first
roup Captain Boyal
time while in Jamazica, free
from formality and tedious
duties. So a night's pleasant dancing, inform-
al, debonair, delightful, began; and continued
until over the eastern hills the rayrs of the sun
began to paint in pink and opal the skies andl
clouds of dawn.

AND `the Prince of Wales was once again
the Fairy Prince.
H-e danced with Miss O'Neil, Miss Gardinl-
er and Miss Battereby. So did Prince George,
who danced also with Miss Iris deLisser (nowp
Mrs. J. Ki. L. Ross), Miss deLittle? and Mrs,
Cocking.
But the Prince of Wales had already seen
and decided upon his dancing partner for the
most of the time. Miss Hope Cahusac, but re-
centlyv a debutante, quiet, shy like a violet,
that modestly peeps out from its shelter of`
dark green leaves, had been. observed by His


as






PLANTER S' PUNCH


1931-32


Royal Highness. 'Standing by the fountain in
the patio of the hotel, or framed in one of the
arches of the long colonnade, the little la~dy
may have wondered, hoped, wished---one does
not know. But presently--suddenly it must
have seemed--a pleasant voice was speaking,
and smiling eyes and lips were asking for a
dance. If this had been the wild, impossible
dream of hundreds of Jamaica girls when it
was known that the Prince was coming here,
in this instance a't least the dream had come
true. He danced with her again, and again;
again and yet again; in the intervals of the
dancing he sat with her and talked; he showed
his preference for this shy, retiring petite dane-
ing partner of his who was too natural to be
self-conscious. That was truly an honour and
a compliment 'to a charming little lady of
Jamaica*

TrHE island buzzed with the
story of this night's danc-
ing. Envy of the favourite andi
admired partner of the Pr~ince
sprang into quick existence:
that was inevitable. H~undredls
of persons metaphorically
gnashed their teeth and tore
their hair, and donned sack-
cloth, and strewed ashes on
their heads, and sat down upon
the ground, with all the railing
and impatience of the Patriarch
Job when he found himself sore
afflicted. How was it that they
had not thought of Constant
Spring ? Surely they might
have known that it was to Con-
stant Spring that the Royal
brothers would go? Whose
fault was it that it had not
been whispered to them to ap-
pear at midnight at the Con-
stant Spring Hotel? Surely
Their Royal H~ighnesses would
have wished to meet this and
that and 'the other person?
"Someone had blundered." if
and if and if--but the past was
past, the dances had been dane-
ed, the few brief hours of
brightness and pleasure were
over, and at nine on the fore-
noon of the day after the dance
the Princes were busy review.
ing ex-soldiers of the Jamaica
Contingent, opening d re-avv
clock towers, performing fune-
tions of the sort which make
such a burden of life and form
a part of the penalty paid for
being a Royal Prince.

H~AT afternoon the Prince
was at polo, some of his gentlemen-in-wait-
ing playing against some members of the grL-
rison. He had been up all night and nearly all
day, having had perhaps not more than two
hours' sleep in the last twenty-four hours. But
at the polo match the traditional charm of His
Royal Highness shone out as it had done at no
other function except the dance of the night be-
fore?. He smiled gailyv and happily. At 'Ihe
match he greeted with cheery friendliness his
dancing partner of but a fe~w hours previously
and irradiated good humour. HEe was as a muan
transformed.
For the truth is that the Pirince of Wub s 1
does not go through life always pleasant and
smiling, or even polite, as the popular belief
has represented him. He is angry when pctst-
ered with too much crowding ( when he wishes


to enjoy an hour to himself he resents intr~u-
sion and he shows his resentment. Major Ver-
ney, who has written an admirable character
study of His Royal Highness, mentions as an
errPoneous conception of the Prince the popular
story that he is alfa~ys a model of politeness
"and that in public at least he would not say
boo to a goose." As a matter of fact he can
express displeasure in public quickly enough
when he feels displeased. Once in South Africa
he w-as beings received, especially, by some
thousands of school children. The Prince of
Wa~les likes children and this recitpt-ion touch-
ed him. After they had sung "Giod Bless The
Prince of Wales": a w~omnan-undoubtedly a
society lady or she would not have been as
near to H. R. H. as she wfas--rushed up to him
and thrust her autograph book before him.


to dance with her-O Death and D~estrulction,
O hurricanes and earthquakes! Bu-t Ma~jor
Verney says that the Prince, after a few "duty
dances" with "'important" ladies, had ~turnedl
with relief to "a partner who was slender,
graceful and skilful." And "imnmediately there
wer~e signs of a feminine d~isquietude in the
ballroom of the Presidential P-alace; and whisp-
ering grloups were formed." One of the Prince's
Eqluerries enquir~ed into the reason. He dis-
covered that a deputation of three leading
members of the local society had beenl appoint-
ed to convey to His Royal Highlneqs's staff'llhe
serious, w~orld-distur~bing fact that the lady
with wihomn the Prince was dancing, aInd hand
danced sev-eral times, was an assistant in a
dingl s~tore. Well-timed~ it was3 felt that this
might ;,rl~le. the price of drugs, or the taking
of drugs, or the failure of drugs
lea~ryand Elliott. to p~roduc'e their usual effect,
wals not clearly expressed; but
the social c~ataclysml caused by
the PCrince's dancing with a
rvoung lady who wTo~rked for her
living in a drugi store, instieadl
of dancing with ancienlt ladies
of the bony or the polrtly type,
whose husbands owned drug
stores and cheated the custom-
er~ thlereof, was:1 terrific.
The Prince's chief of staff,
Sir Lionel Halsley, agr'eed
acquaint His Royal Higl
w~ith the existingi catastro
situation. The Prince sml
chleerfully when Sir Lioneol nr
toned, the drug store, and
marked that "'it musti bie al
good drug store."' But nhe
Sir Lionel H~alsley told hir
wha~t thle other folks thought
ab~out his dancing with a gjl
fr~om a dlrug store, H.R.EL' I
came very much annoyed at thi
impertinence and snobbery
31ljo~r Verney assures us tha
he had actually decided t*
change his partner for the nex
dance. But hle did not. IL(
~5~ -would not do so nowf. He dant
ed once again with the girl froni
tIhe drug store, so doubtless, a:
~j~j~ito make it quite plain that he
knew who she was and what
~i;;-'l~ she wa s ad did not care? a
-.. anamanian coin or curse
.about it, since she was a little
lady and all exquisite dancer.
Still, he was in Panama forml-
all,', and so, says Sir Lione~l,
''he soothed the lacerated feel-
ings of society by dancing the
remainder of the evening ne-
cording to the calendar of local precedence '
In Peru and in the Argentine the prine
indulged in his favourite social pastime <
dancing; meeting in those countries, or
especially in the Argentine, many a beautiful
senorita. But one may well believe that those
few hours spent ait Constan't Spring Hotel that
night (after so wearisome a programme of
speeches and of handshakes, and with the pros-
pect of other equally dreary functions to fol
low shortly after) will linger in His Royal
Highness' mind as the bright spot of his ex-
periences in Jamaica. When he thinks in tht
future of Jamaica the picture that will p~erhape)
spring vividly up in his recollection is the il
ruminated danceroom of the Constant Sprin;
Hotel, and the little lady whom he selected a!
his partner for one brief tropic night.


Photo bu/ OC


aIIss noPE CAHUSAO


"Won't you please sign your name in this for
me, Sir she gushed. Major Verney who was
sitandingi immediately behind the Prince, tells
us that he stared at her for a few seconds, and
then he spoke. "Nro,"' he answered, definitelS,
"I will NOT sign your book,"' and he keft her
standing there and stepped down among the
children.

y/HEN he was in Panama for the first time
VVand danced often with a Panamlanian
girl who had caught his fancy as a dancer, some
people of the Upper Ten of Panamanian, Aimer
ican and English society-wne suspect it was
chiefly members of the American and English
bociety in the little Republic--were horrified.
This girl was not in "society," and for a Prince,
a young man who would some day be a King,






1913 PLANTERS' PUNCH 3


tye ba pi tu esh ehat was select d
ter type of picture (a great silent
film like "White Shadows" for in-
stance) was ignored. For example,
Mr. Elmer Rice wrote a whole book
on one imaginary silent pic-
ture-play in which imaginary
play he packed every plot, de-
vice and incident occurring
in the average silent picture.
With that sort of plot all mov-
ing picture lovers are only
too well acquainted, especial-
ly as some of the talkies have
not yet got away from it. But
even when Mr. Rice wrote the
silent pictures' were being
much improved.
Let us go back awhile.
In the moving picture world
depicted by Mr. Elmer Rice,
and called "Puerilia," which
is a synonym for "puerile,"
we have Pansy Malone, "a
lovely unspoilt child of na-
ture." Pansy, it is announced,
is nineteen years of age and
when she is first seen by Mr.
Rice is "bare-foot and dress-
ed in well-fitting rags." She
leant daintily upon the
11andle of a rake, which, upon
reflection, struck one as a
little odd, for it was scarcely
the season for hay-making.
Her person contradicted the
suggestion.that she had led a
life of arduous toil and of ext-
posure to the elements. She
stood in the fields of Puerilia
hatless, yet her skin was
snowy and unblemished. Her
hair was wonderfully done up,
her finger nails were beauti-
fully shaped and polisheQ;
and when she wa.s first seen~
it was, of course, twilight.
Twilight and the dawning
were the periods of day most
admired and patronised by
the earlier makers of moving
Pictures; every now and then
"Came the dawn," and also
"Came the gloaming;" and
Mr. Elmer Rice says that on
his first visit to Puerilia, iml-
mediately after he had be-
come acquainted with Pansy,
he noticed a herd of cows
making their way slowly, in
single file, in the twilight,
along the very ridge of a line
of distant hills; and later on
he was to learn that camneis,
mules, horses, and other an',-
mals invariably selected the
ridge of hills for their per-
ambulations at twilight, their
progress being explained by
such words on the screen as
"the lovely hour of twilight,
when the sun sinks behind
the western hills and man and
beast return homewards after
a day's toil."
UT to return to Pansy of
Sthe conventional silent
sentimental picture. She in-
vites the two strangers who
have just arrived to her hum-
ble cottage, and as she places
her hands upon the latch of
the the door her face expands
tion- until it blots out the cottage
itself. This is a "close up"


W HEN a polongredh"O--oooooo~ TOnP
taedaterceyoun a moortg pictures Talking
hernine bafi just kissed the hero
who1~ lia- elf\ ..r ral the riot part of his
life t~ 1!. nl-understandti ng her

nilmates1: 1 Ito l n--si lina he from
lbi s.Iirnltle **( rlh desperate
\\'ilain Wh ar aniendous


the ca-llt v-v-thte k*.1-- being



rill.-, u-. thatr the Ilainnable
snys-a-r has; at that1 moment
heen~l f.iledl lay the handsome
E..:.11.ellnal.nvh~.. I I's.hably a
inillllonairr- Iin (l-aI.CIe, and
tbur n:2.htr. .linstia.e 0.1 virtue
a~rne lll alo rl 11.. I ra. iple t long


I C.in Iver cl.rle wIllni ,I~ where
thle nit....ame Licurlle lias be-
csome a 1aiile o~r Iodinary IF P
hineUt .n hn-thti
Janil.* h? li 11h-pint of the .
all.Ilen.. nit s..ollll i- ,li little
.n ilei~u ..io r ban in .
T nipoll "is l ntri s.
I Iore r. I-l..i l.1 inl the thea-

..the St...wn ..'( his Ois- i

1Ulr their! i-, llun is the

.114 plent.*,- ..t n..tl-c every-

11.. ss~lene berinel Ilpleted on
Ilrh i-iber m.Iven :.Ind indica-
livel of rthe I..1I re-Ips~nse of

Iclnr irud I.. thieir motions.

B IT 1.... ...me-, MrI G:eorge
lbe-r knw :(American ;
11lli. 9nd hie la\- It down
.hat in ril'e 1erl~ the- moving

and al m..- ~t dli sa peal e~d, and



7i mani :lll.rlir idII. thiat the
~lilet pll:till(e mi5 .pproach-
mei -u~nmethinc ilk. a crisis
when tIIi rta;lk~oc...lugl in.


lease If life 11 i\:l Ielieved
b! inall\ whe. k~~rl-r.1 ;tudied
thc rtal te Ilr Iib 1.ubb that
burrt', f... \he -~~in bg an of
oaundl niIl l in, ei ntll at a


,,dlllaps e.II ,and .-man l have
.per~ished But Ir t...a these
gentle a e r...; That
there was a ...I ..t .:isis in

be yPonld question.11 But the
s ilent pil rare w.~:.ull d not have

ieen nc. ITr.-runnel--t- inst then
.erfectedl tu !re...ul sound
.nd dialiiguet F*ii there
T'OUld hnle IN-a-in !I..rbing tO One of the leaders of
put in thenl 11.10.e Ild it is sre'ecn, and whose hal
nonjsenbe to thirdl; ~..f rhe mil.
lilos ljf url~au Ilue~lrlen giving up the picture theatres
altogetheI. andt equl."i. absurd to think of them as
being: satisfiedi wll i- 1.its to the "legitimate" theatre,
at v~ery~ lone intnrFl-'l and at considerable expense,
TFheir appetite ((.1l anlinantentl as well as their pockets
wouldiha\'r prote-tted.
h is true. How~~~erer that the lovers of simple
,love C~enlei .rnd he*roic rescues and desperate
encoulntrsr. Ibi- rll~rulous ejaculators of "Oooo---",
the enthuusiast.: applauders of hair-breadth escapes,
were becorniuP we-ary of seeing the same thing
,over and over ag.-lln. the same thing rendered nau-
seating by repeliti..n and cloying from an'excess of
eyrupy sweetness E\en the panegyrists of the pie-
tures betgan to ilhowr signs of boredom. As to the


ADnOLPH ZUKOR,
f the moving picture industry, who early realized the necessity for quality on
nd and spirit are largely responsible for the progress of the Paramount organize


satiric critics, they had commenced to write articles
and books which were having their effect upon the
minds of the multitude. Some of the most amusing
and telling oe these criticisms appeared, as it hap-
pened, just when the silent pictures were a~bou't to
disappear. They were evidently written under the
impression that no early change impended in the
moving picture world. Then, almost as swiftly as we
pass from one scene to another on the screen, the
talkies were put across the narrow proscenium of
the picture theatre and the critics were obliged to
allowv the pictures another lease of life.

THE hits at the pictures were amusing, even if
unfair in that it was the conventionalised


for the purpose of showing tears. "It is the most
beautiful house in the world," she murmurs with
simple feeling; "it is home." Whereupon her face
shrinks to normal dimensions, the party enters the
house, and the adventures begin.
Naturally, Pansy's mother is a widow. It was al-
ways thought advisable that most mothers of simple
young girls battling with life should be widows. The
fathers made it a rule to die at convenient periods,
when the children had not yet grown up, and when
the home was probably mortgaged to a man whot
was a cheat and a scoundrel trusted only too iml-
plicitly by fathers who never seemed to have any
sense whatever. Inevitably, too, the widows' only
sons were away, and their mothers never heard from


The


Pictures


rChe


CTale


o


Insy to the Present the Silent and the

Film Zukor, Lasky, and their woork






PLANTERS'


PUNCH


1931-32


them. These mothers now and then wept over photo-
graphn of the absent ones; but we all knew that the
son was somewhere in the wide, wide world and
would return in time to mother; meanwhile the man
w~ho has a mortgage on the property wants Pansy
badly, b~ut Pansy dislikes and mistrusts him, perhaps
because he twists his mouth to one side in sinister
fashion, or because she loves the brave young man
who has just entered her life, either by leaping wild-
ly from an aeroplane or by dashing steeply down the
sides of a precipice on a restive horse which always
betrays great spirit when it sees this girl.
And now with Pansy and the periodically weep-
ing Mrs. Malone, and with the sinister evil mort-
gagee, and the devoted lover and his faithful friend,
the stage is set. The only son is still away. The
mortgagee makes a sudden appearance just when
Pansy and Mamma and the strangers are go
ing to a simple supper. And then a full
moon rises, and along the very ridge of the
distant hills a herd of deer marches slowly
in single file--it will be the turn of the
donkeys next time.

ADVENTURES follow fast. The villain-
Aous mortgagee intends to get both Pansy
and the land on which the cottage stands;
but especially the land. For oil is beneath
the surface of that soil, and Pansy is a rich
oil owner although she knows it not. But
the villain knows it; hence his determina-
tion to employ either Chinese or Italian
thugs of the underworld to capture Pansy and
so compel her to marry him. And, of course,
Pansy is captured. This compels her lover
to pursue her captors; he selects a train for
the purpose, which train proceeds to its des- I
tination by rapidly rounding an incredible
number of corners and curves, all trains in
silent picture-land being in the habit of tra-
velling exclusively round curves and never in
a straight line for even a single mile if they
canl help it And, of course, in the world
of the silent pictures, nobody ever boarded a
train while it was standing in a station. At
any rate no brave lover did that. He always
waited until it was gathering speed and
sweeping round its first curve, then he would
dash up to it with a mighty spurt, leap on
to the step or clamber up the side in some
miraculous manner, and swing himself into
a car through a window, although sometimes
he would prefer the roof. And after a train
accident or two, and several fights with Chi-
nese of the underworld or Americans of the
uptier world, within view or not of a string
of elephants slowly proceeding along the
ridge of distant hills which form the skyline
of the valley through which the train is rapid-
ly curving, the lover finally succeeds in rescu-
ing Pansy, either just as she is about to
marry the villain in order to prevent her
mother from being turned out of the cottage,
or when she is putting her signature to some
deed that will alienate the precious oil-bear-
ing land. Then the young lovers embrace;
and after that the lost son and brother makes
an unexpected appearance, thus causing his J"
mother to weep more than ever; and the two
young lovers march to the altar amidst the strains
of the W~edding March; and this takes place in the
sweet hour of twilight when, in a country like Ja-
maica, the mosquitoes emerge to make a wedding
party miserable, or when, in America, the motor
buses are seen silhoutted against the distant hori-
zon, they having chosen the ridge of some lofty hill
as the shortest and most convenient route to their
garage.
It couldn't last. There had to be some changes.
These changes were being thought out, and ap-
plied, even though so many of the moving picture
directors were men who, with a good knowledge of
the technique of picture making, had a very limited
sense of the architecture of a play or of true dra-
matic: appeal. Most of the earlier directors seem to
have thought that almost any sort of plot--and the
more p~uerile the better--would do. The bigger men
of the moving picture world, however, realized in due
time that this idea was a mistake. It was this real-
ization of a truer sense of the need of the artistic
development of the moving pictures that has helped
to make the success of men like Adolph Zukor and
Jesse Lasky, two men who are now among the mag-
nlates of the moving picture world. Such men may
not always have liked the kind of criticism that
came from the Elmer Rices and the Carl van Vech-
tens, but at any rate they had the good sense to
see that there was something in it, and to profit ac-
cordingly.


Y EARS ago the writer of this sktetch mentioned
in the Jamaica Gleaner that the Lasky pictures
were almost always of a good quality, possessed a
better and more interesting plot than the average run
of pictures shown in this country, and so could usu-
ally be depended upon for entertainment.
Lasky had been a show man, had attempted mak-
ing money by giving musical performances, had play-
ed in vaudeville, and had even devised musical acts


for other persons to perform. This training and ex-
perience were of the utmost value to him and were
to prove of great value to Zukor also, for Lasky's
experience in the show world really meant the edu-
cation of his dramatic technique and sense.
The root of the matter was indubitably in him.
Consequently when Jesse Lasky struck up a partner-
ship with Adolph Zukor (after already having been
associated with such men as Goldwyn and Cecil de
M~ille), Zukor brought to the partnership a great busi-
ness experience and aptitude, and Las'ky his under-
standing of what would please the public and yet be
of good quality and worth.
From the very earliest times Lasky had realized
that the story to be told on the screen--the plot
and its developments--were of the greatest impor-
tance. Fiine acting, the personality of actors and


strongly, and work and wait for, we usually achieve.
Young Zukor had his mind fixed on that wonderful
new country in the West, the land of opportunity.
In the days of his youth America had no re-
strictions on foreign immigration, and a foreign boy
might still begin with but a few dollars in his pocket
and rise to be one of the money princes of New
York or of some other expanding American city.
Adolph Zukor landed as an immigrant in New York,
with about forty dollars, and stood gazing one even-
ing of an autumn day at the strange metropolis with
its glowing electric lights, its swift incessant move-
ment, its clamorous expressions of energy. He felt
no doubt in his heart that he had come to make a
name and a place for himself in this new world.
But he was to go farther and do more than he could
possibly imagine then, however high his boyish am
bitions.

UKOR had in the beginning to learn the
English language. He had also to find
a job, for even in the penultimate decade of
the nineteenth century forty dollars would
not last for ever in New York. Mr. W~ill
Irwin pictures him to us as walking the
streets of Manhattan "a gaping young rus-
tic in a, strangely cut suit of old-country
clothes." In his perambulations he must have
felt thrilled and depressed by turns, thrilled
bythe novel sights and experiences, de-
pressed by the indifference of the multitudes
about him, by his ignorance of the country's
language, by that curious feeling of isolation
which afflicts a stranger in a world that is
not his own.
The first job that he obtained he did not
like. Then he became an errand boy in a
restaurant at four dollars a week. He did
the chores, he filled a menial occupation, he
was learning a language and he was learn-
ing something about New York. He went in-
to other lines, he took to studying the Eng-
lish tongue with great assiduity, choosing
great models. It is said that Milton and
Bunyan appealed to him, as of course they
would if he were acquainted with Old Testa-
ment literature. He read the newspapers.
He went in for salesmanship. At nineteen
years of age he left New York for Chicago
and there embarked in the fur business. After
some years of this, being then a partner in the
firm of Kohn and Company, furriers, Zukor
returned to New York to push the business
there; in the meantime Edisonl had invented
a process for making shadows thrown upon
a screen move as men and things moved in
ordinary daily life, for these shadows were
the shadows of men and things. Edison him-
self said that it was but a toy that he hadl
invented; there was no commercial future in
.IIit. Thus has thought many an inventor in
regard to the miracle he has brought to birth.
And often he is not even remembered as the
manl who made the miracle.

AAR. ZUKOR'S biographer informs us that
V in the earlier stages of the moving pic-
Stures, about thirty-five or thirty-six years ago,
and for some little time after, Adolph Zukor
hardly gave a thought to the possibilities of
the pictures as a means to fortune. The view
that there might be a fortune. in them was pro-
pounded to him and to his partner, Maurice Kohn,
by one Max Goldstein; there were millions in thle
picture show, Max Goldstein said, and so convincing
was his enthusiasm that Zukar and Kohn lent hurn
three thousand dollars to buy a partnership in a
company that was being formed to exploit the pic-
tures, while they themselves invested in the com
Dany. So, very far down in the down-town district
of New York, and in the east side of that district
Zukor embarked upon the moving picture business.
But at first he failed; he was up against other
people who were fighting against him. He failed,
yet he did not leave his new line, did not finally
abandon the show business, at any rate in his mind!.
For Zukor knew that urban populations love amuse-
rnent; that if some amusement could be organised
and so developed as to retain its popularity, the
man or men behind such a movement could not fail
to arrive at riches. During the coming years this
view was to be demonstrated as correct.

J N reading Mlr. Will Irwin's life of Zukor or -
Scognises how again and again the millionaire of
today was on the verge of bankruptcy; indeed many
persons would have said at th- timie that he had
completely failed even if he hadli not proclaimed
bankruptcy. But he never really failed, for he sit
had youth and energy and hope and faith, and great
ability; and with these assets no man can faill He
was always learning; always studying the details
of any business into which he ventured; always edul
eating himself in his enterprises: the dramatic art
appealed to him and he studied theatrical production,
As Mr. Will Irwin has so well put it, "He was study-
ing the spoken theatre, with its background of three
centuries, drawing on the accumulated experiences
of its managers in pleasing and alluring the public.
And he was bored at the careless yet ossified meth-


LCK OAKIE, THE MUAN WHO MIAKES HIILLIONE L~AU;H

actresses, counted immensely-he was well aware of
that. But he was aware also that a puerile story,
and especially a series of puerile stories, could not
easily be put across by even the brightest stars of the
moving picture firmament after a while: the best
photography or the most lavish advertising would not
make a poor play worth seeing. The Pansy Malone
kind of film may have been acceptable enough when
any so~rt of action on a white screen still aroused
curiosity, admiration and wonder; but when that
initial phase was passed a different and a higher
appeal was clearly indicated.
Las~ky was not only one of the few men who uln-
derstood this, but he had the good fortune to know
how to satisfy the unexpressed and largely inarticu-
late desires of picture lovers. Zukor grasped this
fact; Zukor had also been thinking on Lasky's lines;
it was Zukor who approached Lasky, after seeing some
of his work, and made the proposition of partner-
ship which ultimately resulted in the Paramoulnt
Publix Corporation coming to birth. Zukor saw the
possibilities of better films; he appreciated Lasky's
ability to make such films. The combination of these
two, with other brains and personalities joining in,
has been Droductive of one of the greatest picture
making and distributing~ organisations--perhaps the
greatest--in the world.

SHIS Adolph Zukor has had a very romantic and
adventurous career; what emerges from a study
of that career is a clear-cut impression of tenacity
of purpose, firm faith in one's self, great organisinlg
and financial ability. Zukor was born in Hungary,
of Jewish parentage. As a boy the little Hungarian
may have dreamt dreams: of future greatness; must
indeed have had visions of a rise in the world, other-
wise he would have remained among the common
ruck of European humanity. For one's dreams and
ambitions are to a considerable extent a measure of
one's capacity to achieve; what we wish for most






PLANTERS'


PUNCH


od- ith ein..ine[...1.11I'i- iiiducers." He saw that
;impl-\tntlr.emn was1 ne~..t -ar and he sensed the di-
re.~:!lniln 1II whichl ther inrov~l\ement must go. And
here ani n~.l.w I I.II.rne t.. :l I..int upon which'I have
insi-tcd t`..r vetr! miin:- !'-.II-
In ;Ipirte et wa'! r ma. Ilr said by some of those
wh..~ litterl I~pini-=n- ~..n ni1ting pictures and de
clan, -la that thei motllil.ll.n 1-,1. do something entirely
diffel,ren r~..ni \rilcrt i, d..ne. .nI "the legitimate stage,"
1<..ntainill tha~t whllt ile th.- pitlres can produce effects
nestr p..s--Ibie ..nI the --tag. because that is bounded
b.1 thle limits; ~...1 fearl walI-. atnd obliged to produce
ice illusl~~is.n armidti~ -..ItI restrictions, the pic
turei mull-t nevetle.Te-4~j~ it..id. like the stage, a mir-
rar p 1.. naure inl *..!lth words, they must pre-
bEntl 1:i:.\s tjil are ll'**rtrayal of human life--human


scenario--the Pansy Malone stuff and motif--was
strikingly apparent,
Zukor and Lasky perceived this at a very early
date, and this truth must now become general and
be acted upon far more than has hitherto been at-
tempted. For if it be true that the moving picture
began to affect the legitimate stage seriously some
time ago, it is also true that the legitimate stage,
and the stage-play, are influencing the moving pic-
ture to the latter's great benefit and that of the
pleasure-loving multitudes. In a word, the moving
picture, in spite of all the aids and adjuncts. of mec
ture stars, outdoor scenery and wonderful pht.,--
graphy, can never hold its position permanenitl\
without the aid of playwrights and of adapted ste.~~
plays, and this is more indisputable with di3-


porters of the moving picture screen realize this
too, hence their insistence that dialogue is partly
doomed, that sound with but a few spoken words
will be retained, but that the almost silent picture
will be the picture of the future. In their innocence
or their vain hopes they imagine that audiences will
be content to go back to something like Pansy Malone


r

,i


9 '5t
Q
/E,


Constellation


of the Paramount

Picture Stars


and the bad manl and the good lover, and the train
sweeping incessantly round curves, and the lost son
reappearing, and the infernal old mother weeping:
all the time and boring us to distraction, and with
general embracings and happiness at the end of a
tedious number of reels. If it should again come to
that, then of a surety is the moving picture doomed.
But there is not the slightest likelihood of its ever
coming to that once more.
What the moving picture people will be comi-
pelled to do in the future, are being compelled to
do even now, is to eliminate more of the custom-
ary rubbish, and concentrate upon good stuff. This
may mean fewer plays, but the encouragement to
potential dramatists will be so great, because of the
increased demand for plays presenting possibilities
of popularity, that the supply of good and presentable
dramas wvill certainly increase. In that, to a large
extent, lies the hope of the talking picture.

FOR some time past the stories of popular books
have been utilised for screen purposes, and some-
times the result has been excellent, sometimes ex-
tremelyy poor. This, one fancies, has been due to
the sort of scenario manufactured from the booki,
the way in which the plot has been utilised and
the selection of the dialogue done. In future it
will be men who are themselves playwrights, or
who have displayed great ability and taste in the
writing of scenarios, who will utilise the available
book-stuff for screen plays; and such scenarios, and
stage-play adaptations, and plays especially composed
for the screen by talented playwrights, will provide
the material upon which the moving picture director
and his staffs and photographers will work.
And if the stage play will also become more and
more the picture play, thus developing the tendency
it displayed many years ago (a tendency which Zukor
and Lasky perceived), the actors and actresses of
the legitimate stage will also be more in the pic-
tures than they have been hitherto. For that is
one of the changes rendered inevitable by the con-
nection of sound with shadow movements in these
recent years.
The voice counted for nothing when the pictures
were silent. The voice will count for more as the
audiences grow more sophisticated and critical.


logues possible on the screen than it was in the
days of the silent picture.

ONE understands to some extent thle viewpoint
of those who predict the comparatively early col.
lapse of the talking pictures, when one grasps thle
fact that good plays must be presented on the screen
if the talking picture is to survive. There is no
possibility of a return to the silent picture. There
is no possibility of any continued production of silver
screen dramas with sound but no dialogue, or but
very little dialogue. Screen conversations may be
minimised. That will greatly depend upon the play,
upon the intensity of its dramatic action, upon its
interesting or amusing situations. But with the nt.
most minimisation of the spoken word there will
still have to be a fair proportion of it, and that
is proved conclusively by such a picture as Charlie
Chaplin's "City Lights". Charlie Chaplin was
able to make a success of "City Lights" because of
the fame he had won, because of his personality.
because of legend created about him--because he was
Charlie Chaplin. He could bring all the resources
of an extraordinary facial expression into play in
that production, could accumulate in pantomimic ac
tion all the popular appeals of comedy and pathos,
with himself always in the centre of the stage;
could therefore achieve a great success and prove
what might be done by pantomime alone. But a
Charlie Chaplin's success might be likened to the
one swallow that does not make a summer. For
how many silent pictures would be endured today?
How many Charlie Chaplins are there? And how
would a large number of even Chaplin pictures be
received today? What would even Maurice Chevalier
be without his quaint accent and his songs? How
much does Chevalier not owe to his voice!

AN outstanding theatrical critic like George Jean
Nathan sees the debacle of the whole moving
picture world because he knows that, amongst other
things, the difficulty of procuring good plays for
screen production is terrific: playwrights are bori,
not made, and they are not born every day. And
the exigencies of the moving picture market demnand
an infinitely greater number of plays than do the
exigencies of the legitimate stage. Some of the sup-


emotijnl, hluma:n a.:11entrll the~ comic and the tragic
sides ofI human exi-leni..e

N Oll the :tt~e .1'1:' It true authentic drama,
as Je--se Lack.\ I~tel~rlseI from the first, has de-
velojped !hrsl..ughj theI .emlulu-- a, technique and form
ofl conistruc~tison whih rI relle-l~ving picture play sint-
ply cann..r aflR'TIr.1 antlrct to ignore. Zukror
realised thl~ir factr all-.. whearl he was studying thea-
trial I**uct..n Tha re itli-ation has been of the

The mov\inig pi.rure in !ts first phases, andl up
to a en~uple of l~l :1'-rs ac. ...ubt~ not have spoken dia'
logue: the :I.unrbile.:..iIIan. -ound-synchronising in-
strument hadJ .\er r.. HeF psc.!llcted. But the plot of
a good stagei !lus. anti -II- II words of it as could
form interesting ...r 11rnameI1 ;aptions on the screen,
were always far. -Ierl.ll.r t.. the scenarios the aver-
age picture dirca tor carI bi- liack were so prone :o
grind out, onle masn f-ll-r.II..m n the lines of another
until repetitil-n rl.reate Inausea. Many scenario
i.:writers felt thatr they) had~ Ia uly to lift a plot out of
.; 3: b ook, put in somne n..r,is here and there, and the
E' ",-'rto was goo~d entluen M~any of them still take
jthat view. The). are erl-...n- of no talent for play-
writing, they haver neerberl a knowledge of nor an
instinct for the teihn!igile oft the drama, and, of
course, anything like tlhe (Ipl..uction of a play corn-
p.Idlee and fit for pr~estautn- nn a stage is utterly be-
Syond them. Yet these wr~je the people who were
writfug the scenarios for the silent drama! For the
most part selecting The ablelr producers of the mov-
Ing picture world, however, r\ent to the playwrights
for their plays when they could get them. These plays
might have to be alteredl to suit the exi-
geneles of picture produclts.:.n: bitt the basis was the
laywright's w~ork, andl whenlever that was used,
whether it was a play by! Zangwill or Somerset
1%augham, or some old classical writer, the differ-
ence between it and thle mush of the ordinary






1931-32


PLANTERS'


PUNCH


-go, Montreal and fifty other places, and five
years hence as well as today, it follows from
this sort of mass mechanical production that
the cost of going to the pictures must always
be considerably less than the cost of patronis-
ing the legitimate theatre. A stage play is
not produced in half a dczen theatres at once;
for one thing it becomes associated with a
particular set of actors, and often with but
one actor, and the public wishes to see those
actors in that play. Members of the public
will therefore wait for days, weeks, and even
months to gratify their desires; they will
book seats a long time in advance, they will
stand in queues so long as they are certain
to enjoy the pleasure upon which they have
set their minds. But the largest legitimate
theatre is comparatively small, the average
theatres are decidedly of very moderate di-
mensions, and the price of admission to most
theatres is, considering the financial resources
of the average person, decidedly high. One
may purchase a good seat in any of these
theatres at anything from eight shillings to
Fourteen shillings, in London or New York,
but one may obtain an excellent seat in even
better surroundings at a moving picture show
for sixty-five cents, eighty-five cents, or a dol-
lar and a half when some play w~ith a favour-
ite actor and a tremendous appeal is put
upon the screen. Surely the economics of
the situation alone must play a tremendous
part in ensuring the continued life of the
talking picture, just as aesthetics will ensure
the continued popularity of the stage and of
Sthe legitimate theatre, since the living. voice
will be sweeter, more pleasant to the ear,
than -the voice reproduced by mechanical
means, and the living face dearer and more
appealing than the shadow on the screen.
UKOR and Lasky, the two chiefs of the
Paramount Publix Corporation, the or-
ganization with which our Jamaica picture
theatres are now so closely connected, indu-
bitably realise all this, and have long realized
%1,it. So now also do many of the men wvho
direct the vast affairs of what has become
one of the leading industries of' the United
States, an industry that is also ambitious to
become an art. From. screen to stage andi
TS from stage to screen now go the actresses
and actors who are the stars of the Para-
mount Publix Company. Name after name appears
upon the screen and also upon the billboards of
the theatres. The play of the stage becomes the
play of the screen, with some variation and adapta-
tion-good or bad according to the sense and taste
of the director:--many men and women see the same
play in a different milieu. But the greater multitude,
those to whom a dollar is an important consideration,
see it only on the Bcreen.. Isn't it of advantage that,
so long as the play is not spoilt, they should see it
on the screen rather than not at all? Aren't their
lives brighter and happier because of such a means
of popular enjoyment?
Those who condemn the moving pictures as
scmething below the level of art (although thly
can quite easily be raised to a high level of art),
and who sneer at the millions who flock to see such
pictures, forget what the pictures mean in the lives
of those millions; and how drab otherwise those lives
might be, even with the legitimate theatres full to
capacity but charging prices to pay. The highbrow
or the high-hat, who is; very often but a prig or a
snob, thinks in terms of the few, and actually praises
plays that are sometimes putrid. For though it is
true that two out of three moving pictures may be
very poor stuff, that has been true also of a number
of stage plays. If the screen can be silly and tedious,
so can be the legitimate stage also. The latter has
made remarkable progress since the 1890's. We may
count about the screen developing likewise. Its
p-orssibilities of accomplishment are vast.


HERE was much talk about enunciation, -
pronunciation and voice training when
first singing and conversation accompanied
the flitting shadows on the screen. A good
many of the picture actors and actresses
found themselves faced with loss of occupa.
tion; several of them possessed fine photo-
graphic faces, excellent figures--and what
Elinor Glyn has classified as "It." But the
rumour was that these "Its" had the voices
of macaws, of something to that effect, as a
lawyer might put it. Some of them hurried .
over to England to learn how to speak, others
sped to voice trainers in the United States,
perhaps to discover that lifting the larynx -
would not be as effective as lifting the face. ,
Schools of elocution began to be established; .
actors and actresses at Hollywood, ant -
especially the latter, busied themselves with
lessons in voice modulation and in the utter-
ing of simple English sounds.
But in the meantime the talking pictures
had to have mimes, thle conversations of the
screen had to hre carried on, and, so, no mat-
ter what the voices sounded like, they had I
to be reproduced. A dozen companies were
making talking pictures. Some were produe-
ing over fifty a, year. How could these sus- r
pend operations until the proud beauty, and
the heroic warrior, and especially the son
of the millionaire educated at Yale or Havard'
had learnt to express themselves in tolerably
decent tones? The consequence we know. W~e
have heard some terrific accents emanating
from the figures on the silver screen since
talking pictures were invented. Some produce~
ers have apparently, in a sort of desperation'
decided that any sort of voice must do: "we ,~
cannot wait." But the best of the producers -
know that a comparison between the voices
on the screen and the voices on the stage
will always be made, and that in screen enun-
ciation and tone there must be improvement,
especially as, at best, the reproducing instru-
ment, gives to the finest voices` a markedly
mechanical effect. The vulgar voice will al-
ways have its place on the screen--there is
plenty of scope for it--but audiences, grow-
ing ever more critical, will revolt against
much of what now passes for speaking on
the silver screen. And as the stage does re- RIe
present good vocal effects, as well as a good
manner and appearance on the whole, as the legiti-
mate stage does provide still the best histrionic
training obtainable, it is from the stage that the
screen will draw a larger number of its stars in the
future than it does even in the present.

BUT one hears it said that the stage is dying,
That a few years hence there will be little of
the legitimate stage left, this being the exaggera-
tion of those who see the situation from a view
point diamletrically opposite to that of Mr. George
Jean Nathan. Is that really the prospect? We hear
in England that the theatre does not pay, but when
one remembers the crowds that throng to see a suc-
cessful play in England; remembers also the long
run of such plays, and how often it is difficult to
obtain a theatre in London, one is suspicious of these
pessimistic forecasts. As to the United States, M~r.
George Jean Nathan has pointed out, and proved,
that at the present time thle American theatre is in a
very healthy economic condition. "Consider," he
wrote in July, 1931, "this last season. Larger sums
of money were made on plays and shows than in
several seasons' past," and we must remember that
1931 has been the peakr year of the depression in
the United States. "~More and more," Mr. Nathan
writes, "the American theatre is lifting itself out
of the emotional childhood in which it had becen
placidly rocking itself for years, and is entering
upon an adult course." It is indeed this develop-
ment and triumph of the theatre that has caused


CHARD ABLENV, A FLYING STAR OF STARTLING EXPLOIT

Mr. Nathan to believe that the talking picture is
doomed within the next five years. But the
primary successes of the talking picture have led the
adherent-s of the pictures to say whetherr they believe
it or not) that it is the legitimate theatre that is
doomed. That is nonsense: the theatre is not doomed.
Men and women will always wish to hear the liv-
ing voice, and not to rest content only with the
mechanised voice; they will always wish to see the
living actresses, the actors in the flesh and in their
habit as they live upon the stage: the shadow alone
will not be satisfying. The truth simply is that
both the theatre and the talking pictures will con-
tinue to appeal to the play-loving crowd, for eazh
has a place of its own to fill in the emotional life
of civilization. And since both of them deal with
human life and emotions, both must use living
agents for the representation of life. And the thea-
tre, because it is vivid and living, with a great tech-
nique and great traditions, will always compel the
moving picture to utilise the best and finest of its
impersonators of human character, since these will
be the best to be found anywhere.

J T has already been mentioned that the motion l
pictures have a much wider medium of repre-
sentation and expression than the stage. Here is
one of its great advantages. And because the film:
of the same picture can be multiplied, so that. a
picture that is being exhibited in New York may
be simultaneously seen in Kingston, London, Chica-


OLIVE BROOKI
A Paramount Picture


KAY FRANICIS
A Paramount Picture


MARY BRIAN
A Paramount Picture


OHIARLES RUGGLES
A Paramount Picture






PLANTER S' PUNCH





Jamaica,


-,1.83 1-3 2


ON iFat~rl.ie- thatr if in December, 1831, some
Ir'inger hadl asked; anly prominent Jamaican
whe~rre flc I.;reat Wr wedT~~ then raging--assuming
that :Ilny ceneralcr Euro~pean war was theni in pr!-
g res< be \ro~uI ld a sanllyl have been informed that
the --sene; 1o ;t wasl cEl Jamnes, that Trelawny was
als.. 11rll~raternti and1 11hat the rest of Jamaica was
in a hIliplly dlrturbed Indlition. If the stranger,


end of the year, and there was a stir and a threaten-
ing movement in the neighboring parish of,Trelaw-
ny. And in St. Elizabeth, Portland, St. Ann, St.
Thomas: and elsewhere strikes of slaves began, and,
with that, a movement of troops, of militia troops es-
pecially, and the publication of military despatches,
proclamations, and all that sort of thing. And,
especially, the emergence of generals.


Mi.18-tONW IN AMBUSH IN THE PABISH[ OF TRELAWNY IN ONE OF THE llAROON WABS. THEY ABE AWAITING TH[E APPROACH
OF GOVERNMENT TROOPS


THE~ numerous local Major-Generals girded on
their swords, mounted their horses, and called
out their men. These men were white and coloured,
with practically no training or discipline, but thley
were opposed only to rebel slaves who had still
less. And the militia as well as the regular soldiery
were fairly well armed, while the slaves had but
few guns between them, and but little ammunition.
Still, they were the eliemy. The slaves, of course,
did nlot regard themselves as the enemy. They took
it that they and they only were the King's men (and
womer.) since they were fighting to maintain the
inviolability of His Majesty's orders. They really
believed that that freedom which was soon to be
theirs had been determined upon already and was
being illegally withheld from them; but that belief
of theirs did not make the masters any the more
pacific or lenient. The masters objected to any aboli-
tion, and they would have fought the K~ing himself
had the~y possessed power enough. Now they would
fight the rebellious slaves. That was necessary too,
for already some of the estate works in St. James-
but not the factories or the Great Houses--were go-
Ing up in flames. It does not seem that the rebels
wanted to destroy all the valuable property. Probab-
ly they had a notion that such property would after-
wards fall to them, or they may have felt that they
would still have to work on the estates for wages
and so should not destroy the means of their own
livelihood. Whatever their reason, they did not
destroy as much as they might have done.
ALL the island was astir and anxious and afraid.
Thle Christmas had come and it was hardly over
before there were thousands proclaiming war on
earth and ill-will to men. The Major-Generals
hastened to put their services at the Governor's dis-
posal; the real soldier, Sir Wmilloughby Cotton, has-
tened td St. James. Everybody now began to talk


almost hear some militia Major-General practising
to himself the command, "Up, guards, and at them!"
Meantime the newspapers were not idle. That week-
ly journal, The St. Jago Gazette, wrote on January
7, 1832, that "we have every hope, from what has
already been done, that when Sir Wil'oughby Cotton
takes the field, a few days will restore peace to the
country." Sir Willoughby was taking the field! To
that practised soldier it must have seemed more like
taking to the gullies and the hills.
It was a great war. It was the biggest thing in
the country since the last war with the IMaroons. We
read of one encounter between the opposing armies
in St. James, that after a fierce attack on the partt
of the rebels one militia-man was killed: that was
the only casualty suffered by the Government's
forces on that occasion. Wre wonder how it happened.
The onemy, however, were driven back in confusion,
so it was a glorious victory. The war, indeed, did
not endure for long. The enemy were everywhere
defeated. The enemy returned to work. Only the
estates in St. James suffered much damage. Never-
theless one fears that the gentlemen of Jamaica
everywhere suffered at tremendous fright.
THERE were any number of proclamations of
1caorse. Every Major-General issued one, and
some Generals had more than one to their credit. The
language was decisive even if the grammar was
shaky; of all these spirited utterances one perhaps
likes best that composed by Major-General Robert-
son. That hero was in command of St. Elizabeth,
where nothing had happened as yet. But he feared
that the example of St. James might be infectious,
and he was taking no chances. -Here was a fine op-
portunity for words, but words with a very practical
meaning. "If any fires take place on the properties,'
he proclaimed, "I command that every negro house
be burnt down, and all their hogs and poultry


rrahrr pu1ZzC led, h thenl enquired who were the ene-
my' anll theil r leade Ir- he would promptly have been
informed that !Ihe ellnlmy were desperate hordes of
rebelliolus ilav.ei amlliln that(eir instigators and secret
c ommalnderi bail qljguraduat in the Military Academy
of the loial Bapust~ C'lliersh, were Englishmen and
L ministers win.. hadt dt*~:.ledl their lives to fomenting
rebllin a..n th =lve-If the stranger had asked
still 'lulrhel rl~ wh..are the defenders of the King's
Deace :n the corl..~n\. her woulld have been overwhelmed
with namesJ. lI i. w..ubi havet been told that the Com-
manaer llin-Cie wo:- ..ne Sir Willoughby Cotton, a
regular. Army! O~ttih-r. best! that there were also a host
of other Generldl. verteran< who had never been on
a feleW of battle; b~ef..rl Thiey were militia command-
ers. He aw..ul.1 bas.e Irleart some of their names;
Gener11 Cox, May11r(;enelal Marshal, Major-General
MeIlonI-. Aajl:Ir-ient-tal Rtobertson, and so forth.
Jamarira nas prainfu*i in~ pgeerals. Every parish had
Its militia, and It w..mild rem that every militia had
its general. Tr. -:Iy no~-thing of innumerable colonels
and casptain, all ilnnoc~ent of the elements of the
militar! art.
In Decrember,. 14.11. quite suddenly, a report went
about among the --laws~ thlat the King of England
had decreed that they! Ihould all be free. It was
further stated Ilhat thet slave-owners were preventing
t: he King's ordei t rom becooming effective. Te
slave were,,, laval. e-~pecially in any matter affecting
themselveS. The?. angued that since the King had
set them free-anld they believed implicitly in the
power of Mlonarc~h!-it w'as but right and proper
that they should see tos it that the King's decree
shoukl be respected The King was being defied
It therefore behaved his faithful Negro subjects-
they had begun to think of themselves as the K~ing's
*nbjects--to show that none could defy him with
impanit~y. Besides, w~hr. wanted to remain a slave?
Bo there was a slave rising in St. James towards the


And


The


Wa~rs


In


&


el 8 8nt

in military terms, and of course those gentlemen
who felt themselves safe for the moment began to
walk aIbout with a military swagger. The enemy
must be defeated. The troops must advance in
columns The artillery must be massed. How did
Napoleon defeat the Austrians at Wagram? How
did Wellington break the French at Waterloo? The
same tactics must be employed in St. James. We can


AD Frtl And Humour





PLANTER S' PUNCH


1931-32


killed, if any horned cattle belonging to them, they
are to be killed for the use of the troops; also their
provision grounds destroyed." The Major-General
made it very clear that the horned cattle would be
eaten by his troops; but what was to become of
the slain hogs and poultry? Presumably, these would
disappear. The troops were but human. A pig or a
towl might easily be concealed. A little dishonesty
is creditable in a militia-man. Let us not enquire too
closely into the fate of the rebels' pigs and poultry.
There was no rebellion in St. Elizabeth, but one
fancies that many pigs and poultry died suddenly and
were never seen again. One can imagine the Govern-
ment's forces maintaining order in the parishes by
the simple expedient of proclamations and petty lar-
ceny. 'Why not? All's fair in love and war, and
militia-men had good appetites. It is also very con-
soling to read of how many persons were shot for
fighting for their freedom. The death list was quite
a satisfactory one, but the casualties did not mainly
occur in the field. They were the result of summary
executions. The rebels were either executed when
captured, or were tried before a properly prejudiced
tribunal and shortly despatched out of this world.
They were given the freedom of heaven. They were
too dangerous for Jamaica.
UTr who had put it into the minds of the slaves
that the King had willed and commanded that
slavery should cease in Jamaica at the end of 1831?
The planters knew, the newspapers knew, everybody
interested in the maintenance of slavery knew. It
was the English missionaries, and especially thle
Baptist missionaries, a most dangerous and blood-
thirsty body of persons, men with no regard for
morality, morality being the maintaining of
the right of some men to hold numbers of their
fellow-creatures perpetually in bondage. The Corn-
wLall C'ourier, which did not have a single slave
among its subscribers, nor a single missionary among
its contributors, expressed the hope "That the coll-
blooded wretches, who have instigated our semi
barbarous peasantry to rebellion and incendiarism, '
would not escape detection; that indeed, it contendetll'
should be quite impossible, since everybody knew
who they were and what they had done. The Cour~ier
further hoped that "the examples which will be made
of theml, will, we trust, ensure to those of us whose
only stake is in Jamaica, future protection for our
lives and property." The Cou~rier did not say what
the examples should be: but one suspects it had
in mind a series of floggings to be followed by
a painful hanging. Three missionaries were actually
arrested and marched off to gaol; the Rev. Williarn
Knibb was chief among them. The gentlemen on
the northside were quite persuaded that an insur-
rection, which did not spread beyond the confines
of a single parish, and which was quickly suD-
pressed, must have been planned and put into exe-
cution by educated Englishmen whose connection
with the Baptist Church was a sufficient proof of
high military gifts, diabolical treachery, and a cray-
ing for bloodshed. But they didn't hang the mis-
sionaries. The time for that sort of thing was gone.
And though the newspapers of the period implor-
ed that only men with a license should be per-
mitted to preach anywhere in the island--whicil
would have meant, and was intended to mean, that
the religious instruction of the slaves should cease
forthwith--such strong decisive measures were not
taken. They let the arrested missionaries go free
after a while: these had a very powerful backing in
England. And they stopped executing rebels, for the
very excellent reason that, while slavery still exist-
ed, a live slave was of value, while a dead slave-
he might have a soul, though that was extremely
doubtful-was of no value to anyone on earth or any-
where else.
And so ended the last slave rebellion in Jamaica.
During its continuance Sir Willoughby Cotton "took
the field" and Major-General Robertson took the pigs-



B l~~tle Mpp yf aRPTDttS.

IN these days one thinks of the Maroons as having
Been a race of doughty warriors, not unlike the
ancient Scotch Highlanders, secure in their mountain
fastnesses, defiant of the lowland enemy, periodically
making raids upon the estates in the valleys below,
perpetually a cause of terror to the Government and
to the! English inhabitants of Jamaica.
T, some extent they were all this: unqu~es-
tionably they had to be watched down to the end of
the eighteenth century, when those of them that rose
in rebellion for the last time, in Trelawny and St.
James, were defeated and deported, first to Halifax,
in Canada, and then to West Africa-
But who were the Maroons? The nucleus of that
body of people was formed in the first instance by
Negroes who had been slaves to the Spanish mas-
ters of Jamaica. When the Spaniards had perforce
to learc the island and flee to Cuba they gave free-
dom to their slaves; and as the Spaniards hoped to
return to Jamaica, these liberated slaves remained as
the representatives of the Spanish owners of the
island with the intention of harassing the English.
In a word, these Spanish Negroes were to continue


the war against the invaders, and their immediate
reward was their liberty.
To give the Maroons their due, they gladly ful-
filled their obligations. Between them and their
Spanish masters there had been a good deal of real
friendship. Up into the mountains, therefore, which
they knew very well, went the black men who regard-
ed th.3 English exactly as did the Spaniards. The
English were the enemy. And war must be made
upon an enemy.
ATURALLY, the English sent expeditions against
these Spanish Maroons but could not sub.
due or exterminate them. The Maroons on their part
slaughtered every white man or woman that ven-
tured to settle at any distance from the coast; it is
said that they butchered every white person who
came within striking distance of them, without dis-
tinction of age or sex. Now and then they made
treatie:, with the Government, which treaties they
broke as soon as it was convenient. A Jamaican his-
torian states that, within half a century after the
capture of the colony by the English forces, upwards
of forty-four Acts were passed by the House of As-
sembly against the Maroons, and nearly a quarter of
a million sterling expended on efforts for their sup-
pression. They constituted a real and a terrible
danger*
There was also another danger. Slaves front
the English plantations, imported from Africa, would
often run away and join the Maroons. Thus the
ranks of the latter grew in numbers. Then in 1730 the
war-horn was sounded and the Maroons (who by one
means and another had managed to procure guns,
ammunition and cutlasses) broke into a big war and
swept down upon the English settlements. This w~as
the first; great Maroon War.
Ihe war dragged on for several years; the Eng-
lish planters and their subordinates must have felt
that they were conducting a vast campaign against, a
terrible enemy. The Maroons probably rejoiced in the
belief that they were setting all England at defiance,
though: they knew nothing about England. But, of
course, by this the Spaniards were nearly forg'otten
and no, one expected their return. This was a Maroon
war, though the Maroons could hardly have hope~l
to drive the English out of the country. What they
probably did hope for was some sort of formal re-
cognition as an independent group of people, and th~at
end was eventually achieved. A treaty of peace b~e-
tweenl English and Maroons was at last decided upon
in 1738. Land was granted to them in different parts
of the country, notably in St. Mary and Trelawny,
and bothl Governme~nt and Maroons were glad o~f hese
arrangements, for both were sick and tired of the
struggle.
SUT there was to be no nonsense about the treaty
11between the Maroons and the English in 1738.
The thing was to be done in good form and style,
in proper language, with a flourish and a bow. Trhe
Marocrs leader was one Captain Cudjoe, whose name
is still remembered and mentioned in Jamaica. The
head ofi the Island was Governor Trelawny. His
agent in dealing with the Maroons was D~r. Russell;
and in this wise the Articles of Pacification began: -
"in the name of God, Amen. Whereas Captain
Cudice, Captain Accompong, Captaig Johnny, CnP-
tain Cuffee, Captain Quaco, and several other Ne-
groes, their dependents and adherents, have been
in a state of war and hostility, for several years
past, against our Sovereign Lord and King, and the
inhabitants of this island; and whereas peace
and friendship among thankind, and the preventing
of offusion of blood, is agreeable to God, consonant
to reason, and desired by God and man" (and so
on and so forth) it was enacted that "all those with
Captain Cudjoe should be in a perfect state of
freedom and should live in amity and friendship
and peace with the Government, and the Goveri-
ment with them," that they should undertake to
put down rebellions in the island, that th~ey
should work with the Government forces for that
purpose, and that if the country should be invaded
by anly foreign enemy, they (or their successors)
should assist in repelling the enemy with their
utmost force, etc.
As to any slaves that might run away to the
Maroons in the future, they were to be handed back
immediately to the chief magistrate of the nearest
parish, and runaway slaves should be hunted dow-n
and cdtfdvered up by the Marooms--therelwas sa wo d

fled to the Maroons up to two years previous to the
signing of the treaty, they could remain as Maroons
if they wished; but if they desired to return to their
master's and owners they were promised full pardon
and amnesty for what was passed, though one is
afraid that such pardon and amnesty would have
subsequently taken the form of a terrific thrashing'
laid on in private. One doubts if any of these run-
away slaves of two years' freedom availed themselves
of the proffered clemency of their former owners'
There is a Jamaica proverb which says: "Man fool
one time, no fool; man fool two time, damn fool."
The writer is not sure that he has got the words ab-
solutely right. But he has rendered the sense of the
proverb admirably.


g/HAT one likes about the wording of the agree-
VV ment between Captain Cudjoe and the Govern-
ment is its devout reference to the desirability of
peace and friendship among mankind, and its grave
statement that the preventing of the effusion of blood
is agreeable to God, consonant to reason and desired
by every good man. One likes to read the humble
and holy observations of early eighteenth century
slave-owners on the mind of God, and on the desires
of good men. Of course it is indisputable that they
frequently interpreted the mind of God as having no
objection whatever to one's flogging a slave to death,
chopping off an arm or a limb, an ear or a nose,
by way of punishment, or to working a slave till he
perished--for often it was cheaper to import new
slaves than to preserve as workers those who were
growing weak. There is, too, in the Museum of the
Institute of Jamaica an old iron gibbet containing
the kcnes of a female, and Edward Long has sug-
gested tc us that it was considered agreeable to God.
consonant to reason, and desired by every good
man, that a lady thus confined should be permittedl
to perish slowly of starvation, if indeed her execu-
tioners did not also light a slow fire beneath the gib-
bet so that she should not suffer from the cold of a
tropical climate. Granted that persons thus treated
were probably regarded as desperate criminals, that
leaders of an insurrection, obeah-men or women
who had poisoned many persons on an estate, and
others of that kind, would be starved or burned to
death. Still, there were more humane forms of exe-
cutionl available, and the point is that those who didl
the starving and the burning seemed to have believed
that they were doing something for the protection
of religion, something pleasing to the mind of the
Almighty, and decidedly a thing which all good men
would desire. They regarded themselves as the best
of men and they were certain they knew the mind
of God.

HOW did these Maroons appear to others, and wbat
J was their method of fighting? They are des-
cribedl as bold in appearance, swift and independent
in movement, athletic in their habits. Conscious of
their freedom in a country where the majority of
the men of their race were in servitude, they moved
about with a bearing which at a glance distinguished
them from slaves'.
WiTer-e they courageous? Bryan Edwards almost
denies it. Others deny it also; most probably-
when tlbe Maroons were at peace, and established on
the land after the treaty of 1738, which they ch-
servedl until 1795, they were spoken of (in private)
rather contemptuously by the owners of estates and
other representatives of the dominant classes of the
country. When a few Maroons were around, it is
probanki that they were courteously treated. It was
a casea of "before Dawg, it is Mr. Dawg, but behind
Dwag it is only Dwag," and sometimes commonn
dawg at that. Bryan Edwards thinks that the
Maroom~s were terribly cruel, even to their wives and
children. and it is related by Edwrards that a Maroonl
had actually been seen to size one of his children by
a leg, whirl him around two or three times, then
dash his brains out against a rock. This was said
to have been done in a fit of temper, but it may have
been done in a~fit of insanity. Besides, the Maroons
could hardly have niade' the dashing out of their
children's brains a sort of regular pastime, otherwise
there would soon have ceased to be any Maroons.
There must have been some cruel wretches amongst
them, but that they were as a tribe guilty of an ab-
normal indulgence in cruelty amongst themselves dur-
ing times of peace there is no evidence. On the other
hand it is unquestionable that they were ruthless and
bloody fighters.

1T is even said that on at least one occasion the
Maroons roasted and devoured the heart and en-
trails of a fugitive shot dead. Bryan Edwards says
so; he also affirmed that the Maroons had no nice
sense of smell, that he himself had seen them eat
some rotten beef which had been originally salted in
Ireland--it really does not seem to matter where the
beef was salted--that this beef was preferred because
it was putrid, and that he had seen Maroons drink
n ruhm rehoffromdthe stsll in preference to some

Hle did not think much of their fighting. He
asserted that they used to lurk in the woods, and
ambush or rush at an unsuspecting enemy. Andi
once, when the Maroons were helping the English to

1 0), no aaMaro was toC om ou d whes h bata
tle between the soldiers and the rebels was proceed-
ing. Edwards affirms that the commander of the
English troops for some time suspected that the iMa-
roons themselves were his assailants; it was dis-
covered, however, that, "immediately on the attack,
the whlole body of them had thrown themselves flat
on the ground, and continued in that position until
the rebels retreated, without firing or receiving a
shot." Was this cowardice? Or was it only a plan
to let ths English bear the brunt of the battle?
URING this same year of 1760 the Maroons were
L/accused of having brought in the ears of a num-
her of rebels whom they said they had engaged and
defeated. It was afterwards discovered that they had







19 1-2


PLANTER S'


PUNCH


cut thtc:e (.ars5 off th.. Isodies of insurgent slaves al-
read! sllain it battldlF I! the regular troops. This par-
tiular[B 3.1 d..e-r II.[ however, on reflection, indi-
cate ic.l~l.ards. -...~ mu.I! as a sound business instinct.
Of re.3m-.': rher .1;Ial....- Lied,,but when did they ever
se~t the-mwhis~r upil r.ssemplars of the truth? There
wall ;1 Iwa rdl ..flr.~I t0. .reach pair of ears, these ears
to be prl....ft that th.- !laels had been killed. If the
troolps. watri rl hir~ I~augage followers (who, of course.
were -I.o\'t I. balrl ilt-n 1o silly as to leave each dead
rebe~l In II~-a-u~~~n ..t his ears, they could hardly
example inin ;! ther ani-l[lise of the Maroons. Besides,
II.. lei~ ca enemi .:"Inip-- on the ground, to be dealt
with i.s illle ur'~'pica l light, was a highly unsari-
tary :Ills.I tnon !inninal~l thing to do: for even in those
dlays It wo- I:ta.;I \\ls t decomposing bodies spread
disea-.- 4.. a InkI. I~ril...id question, the Maroons who
assists-si usle Itha~\eronw!- ll~ in 1760 to put down a Coro-
matur :.,- I-lr~cia.! .oilrr guilty of a deception, the
part1:. .f clie ..tjir! I par was guilty of stupidity and
neelip--nl.;l.' and th.-rlte must be regarded as con-
tributine 1,. ri ll;`\ II...us' exhibition of a

menu mi:ll,. LLIs.- \*.12e faults on both ;i~~
side
RulII Iif th ?I.!..sus were as cow-
ardjis RI .an! 5.1 yards suggested,
thlraIsInt l;rhena- Io ..a the ground when
thrrre iso- rents. n*=t -hlooting a gun at :;'
anl rlnanl 1 exam.I1r 1!..n Ibehind a tree, and
sor heavy1~ ~..u dI; \ 11..1.- rather contempt-
ib~le It...<-man ..I ;\*lj..iSs why there was
(.- n1In..IIs I..w ata.a.l"!! throughout Ja-
mml... Leon rlc? .1 .o:L!n arose in rebellion
in 17'r. True,! LI1..1-,,,: was the last Mar-
.il~n I\;lar ..1 rlula- us .. .and indeed it seem-
rd trust. 11n ris,- \1;s ..I the Government J
aud ..t Ille .Ilnmlilnall r ...te in Jamaica at
that 1.en...i 1r ;i a- the~ Great War of all
time Thei E I I ...I i-:l..al res was Governor,
ant i~ w Il.'...=.ei !(i,_ ..tmolst determination
r.. **-sa Ilt er he canant General Walpole
waa ini ...nrmanl; 1l~ ..t I! troops. Mosquito

wrrF -p,-.i~l JIib..u=-[I or ver to pursue the
Manrs....n.. 'The i-lanall qluaked in appre-
benst..nl. I-lawsr \re.. attacked by the
rebTelllun I..n!lr:lil- in s, no one knew
when sonsll. -e~ natu.I le-rdant field might
r~es.:.I~ tIt -.- Iinton~ r. 6 yelling warriors -
intnt lin 1bh-- l..d.For that was .,
what hapena~lrli .Iaini .Ind again.

THE halar....u- us co l110 nt to cover their
bel~sll- a iltls Il ver es and light
branl~ch- ~...r Iplaur- Thlus disguised, it
wasnoRZ ...--~;lish- 11nit ;....t came very near
to distingen-II rhaml [t..In shrubs and low
tr~ee. and v b.-nl .11. .lme near enough
to malke the tiil-s..very. You probably had
no t he timel t1... a-:l:- it. They fought
w-ith lung clln;, muzlle-oi.ading, of course'
and he~\!y coutlas-es TIhey usually wore
a ehbort paj ir ..( pnl. snd nothing else,
thr~ughl -..ni .1t risen, affected a rough
sack cirn -.banl r~neaning They carried
tbear annuanitl..nl inl ., horn slung to
their rid-e andI1 **\-1 therll left shoulder by
a learthern th..w:- 1116: were adepts at
seekring thle pr... e..II..Isl and concealment
of erely in-e. eter.. depression in the
ground Ior r..ckl availlabitF. This habit of
theirs it na-< whii.I emi .lsed some obsery-
ers toi believe~ to.,[r IIly were cowards.
But one seems~ r.:l hate beard of the Boers COLON'EL
of South ailfri..x Jbone something of the DISCUSSI:
sort, while rhlthuc r-~ 1I1- opposite side who
did not sdopyt simals31t usetics hardly ever
lired long en~lcLu, 1,-,*. ivail their reckless bravery.
After Itheir I: leit deft in 1796 the Maroons never
rose 1.guin1 the~ lebel- ivere deported, the others
wouldl not rj~ik a -a~iilar fate. On the occasion of
the lthrranr Bay iIllrt-ana, in 1865 they came downl at
the call of thie I;~iclvernrent, burned every peasant
bouse w~ithin reil~ i. we~re said to have taken a good
man (.1 the hdad~nda..me peasant girls up to the St.
Mary and Po~rtllllan 11roon towns--but perhaps the
girls ha~d no I**Ner II..-n-an received the thanks of
the Go\'ernment anti thl House of Assembly. As for
their owmn la[ rebelliion in 1795, it is interesting to
learn that the Hou-e~t oi Assembly felt and stated that
but for the blitl.dlyullds imported to hunt thlem
down, "the rebels .:~uldl not have been induced to
surrender from their almost inaccessible fastnesses."
Doga, then, might reall\ have been said in 1795-96 to
have won the \ ar ll's are not informed that they
demanded an!-th ng inl the form of a war indemnity.



Externts satitut Bih EastnianistagS

TEHEE'S nothling like courage. Nothing like the
bravery which enables men to face fearful odds.
But it may tend to make? a man conceited, so that is
probably why whenl. in October 1824, it was reported
among the planters o~f Trelawny that a handful of
runawvay slaves were situated somewhere in the
mountains of that parish, it was decided that they
shoulu be attacked with adequate numbers. There


may have been many persons who felt that half a
dozen of them would be sufficient to reduce these
defaulting slaves to abject submission. But they did
not express their feeling in action. That might have
seemed vain-glorious. And if discretion is the better
part of valour, it may also have been considered by
the ,rentlemen of Trelawny that modesty was quite
nine-tenths of it.
There wvas already, in the year 1824, plenty of
talk about a coming emancipation of the slaves. Thle
latter had heard this talk and rejoiced in it; the
owners of slaves and their employees were convinced
that what emancipation meant was ruin, the delive~-
ing of the country over to the savages, and the ulti-
mate suffering of the..savages themselves. They ar-
gued that the slaves were perfectly happy and con-
tented, were well looked after, not worked too hard,
and had not a care in the world. Slaves were nlot
obliged to worry about what they should eat, for thiey
were permitted to cultivate plots of their master's
land for food, and w~hat part of the produce they did


seemed almost inhuman that people who were given;
everything that they really needed should wish to
fly fromr it all. Most, however, could not escape; and
the occasional runaway slave had to be very careful;
there was no city of refuge to which he could go. If
maany slaves escaped at any one time, they knew that
they would be promptly hunted down and brougvht
back, or shot. Their masters and the Maroons saw
to that.
Nevertheless, now and then a slave would flee.
Sometimes, tired of his freedom and loneliness, and
finding it hard to obtain sustenance, he would return
to his; owner after a while, be properly flogged, per-
haps otherwise punished also, and then put to work
again. There were even slaves who ran away peri-
odicallyr; they went on holiday. It was difficult to
know what to do with these when slavery was near-
ing its end, for, some fifty years prior to the end
of the slavery system, it became illegal to cut off
a manl's. arm or leg for persistent and unauthorised
~departures. It must have been felt by some of the
owners that the abolition of this form of
punishment was pure sentimentality axid
showed that everybody was getting too
soft. In a word, the country was going
Sto the devil. The time might come when
Slogging itself would be prohibited. Then,
Indeed, the country's degeneration would
be complete. It was a sad future to
which many gentlemen looked forward.
SIn October, 1824, then, while planters
discussed the prevalent reports of a
.-probable emancipation with indignation
-and horror, and with assertions about
.its being morally wrong from the view-
point of the interests of the slaves them-
..selves, a rumour went about Trelawny
t11at, miles away in the interior of the
parish, in a little valley surrounded by
high hills and inaccessible save through
-narrow defiles which could easily be de-
--"fended, a number of runaway slaves had
made a settlement where they lived in
freedom, cultivating the land, drawing
from. it a good living, and leaving the
towns and estates of the parish severely
alone. This republican society consisted
of persons who had stolen their freedom:
unquestionably they were rogues, rebels,
1 vagabonds, and a bad example. Shooting
parties were sent out against them; three
of the runaways were shot and their
heads brought to the town of Falmouth,
where they were exposed as a warning
to all slaves wickedly dissatisfied with
the blessings of a servile life. The rest
of the group escaped, retired still farther
into. the mountain fastnesses of Tre-
lawny, and for some time nothing more
was heard about them. It was hoped
That they were dead.


Then again began the rumours, the
reports. Perhaps one or two of the run-
aways had been seen. They were now
cultivating more? land, they were growing
a quantity of vegetables, and in order to
supplement their food resources they
would exchange some of their ground pro-
visions for salt and herrings with one or
two slaves who came secretly to them to
effect this barter. They did not encour-
age others to join them; they knew that
if others did so there would be a search
and a discovery, and the slaves who
knew of their existence were aware of


JAMAICA,


GARDINER, REPRESENTINiG THE: GOVERNOR OF
NG TEPlVS OF PEACE WITH CAPTAIN CUDJOE, THE
OF THE MIAROONS IN 1738

not usec themselves they could dispose of for their
own profit. It is true that sometimes there came
droughts and then people died of hunger; but dea.th
was the1 common portion of all humanity and why
should a. slave expect to live forever? The slave.
then, had not as a rule to fear starvation; he wa~s
made to work to prevent himself from starving. As
for his clothing, why need he think about that when
he wore so little? In those days no one argued about
"the simple life," and "back to nature," but the slave
popurlaton lived the simple life and was very close
to nature. A single osnaburg garment for the wo-
men, a pair of trousers and a sack of the same
material for the men, and, behold, both sexes were
clothed. The fashions did not change. There wpre
no nightgowns. You slept in your day clothes or
you slept without them. In the warm weather the
latter procedure was frequently adopted.
As for housing, there were the huts which the
slaves themselves were put to build, or long rows of
small rooms, called barracks. These kept out the
rain, and also the: fresh air. What more could
men desire? That, anyhow, is what the masters
asked, atnd the bondsmen did not answer. They were
supposed to be happy and contented. It was not wise
for anly of them to express discontent or indicate
unhappiness.

BUT some of these people would now and then
L1run away. This' was distressing to the planters,
who could not understand such ingratitude. It


LEAD)ER this also. But perhaps one of the latter
talked, or maybe a book-keeper discover-
ed something; what actually happened
does not matter. A report spread, it grew, it became
a conviction. And the word went forth among the
overseers and book-keepers, the chief employees of
the estates, that justice and right must be maintain-
ed, which noble sentiment was expressed in the de-
ermination to hunt the runaways down.

THERE were now some twenty-one persons living,
1in the runaways' town, which its founders had
named "We Don't Send, You Don't Come." These
were nine men, eight women anld foui' children. To
deal with them an expedition of white men, accoml-
panied by confidential negro slaves and baggage car-
riers, wras fitted out. One account asserts that there
were "twenty-four armed whites and confidential
slaves," and ten baggage carriers, and the other ac
counts give more or less the same numbers. At the-
very least the bandits, as the runaways were now
described (though they had never attacked and rob-
bed anybody), were outnumbered: in the attacking
party, too, there were no women. And twenty-four
of the punitive party were well armed.

Wh1-ether, before setting out to chastise ban-;
ditry rond to maintain good principles of conduct, the
expedition indulged in prayer we are not told. More:
probably it imbibed rum punch. But it marched
valia~ntly forth, strong in the sense of numbers andi
of a righteous cause, aind after some time it came-
to a narrow pass in the moufitiins, which, it hadl
(Continued on Page C2)




__ ~


PL .-I NTERI S'


PC' 5 C H


193S1-32


11..1-1 e latt' :e1IIrjal.. l himlr that he w s stllrl re-

1,I1 11:n'i risu w.,-; unimlyr i ri.niI1.1 Irl Iic .1... :.hile


~11.1 u 1 .* l~ .IrIII ill ar e n=. exactl y~ triej j same


linit.;1I Yr t :*lll liall., 1Ind( h.- vi~ier gallanly rof-i


1.red.11 bl-';I :srnt t.. Illc Iu. n e Inr.,1 the
11.11..rl At 11111 that1 nt.me t rn.. e that ever he-11
leta tha ar i:...ni ho~ll hi )II.IIvier! Il- :re- For


p.r I su IIr= n \ .**.eld ll ll ne- an.H li ttv il

** It-,,wa-in-r th II'!I 'I 11r if ill~i etI'



7,.el 01.1 1.. 11,l isi tha Phil



I I 1.101I .In.-r o I i t li. iin -. b e'1!..








.*i~ i leil lin F~lrJt- ll 1 a- l IRai~.I r** LI'



,le I~~r, 1 11 1: 111 Pel Ill.I -Il*=u 11si

1~1 11~ rl ~I~ Illl,,- ili II. \'.I. Illl...rs-

Illl(I nCII;11 1 \.-a i l--Hll. Ii il l l~l

ha~ ..lll -..u ....11.1 Ill I' II
1, 1.llI' .I~. .....1.1 I l..r i...--11.1 b a r


t i n .. 1 ifthu r Ii 10 .11 ii Il t**I.sIt*I.I rantill


p 0* jf l n **I he **I

X~ !1 11-' \i.i II'lj \i.lll h. n**-* I TLI bl th a
1I.1lI ~ ~ I .1"111 1 1 111 .11 1|** 11 ht-j~II) Ilrl.~i

10 \ *Ir- .1 ierr .il A nll


I:I''. P I II)I i (I .1 I ~ ~l Ilt0l- all.In I llyr.L







,r OC\ *( 11 I .r a 14 In i II I e- i l 1 1 '




Irni her rnit*! I'uhls!'. 111 lun aal, i

\~cl rlu nl\' f!l i.- I"r. l (.? .. L .. ,.
.1II1 :'. ll Illlr Cj~ i, !,,,; Ir..4, ,, ltTz,,,j' nir I,.,0
Ull~c~"Hr s 1, I-nn :.-I=.H.*e Ih r l~: FI',-t 1. 1 .:.1

Ilke Ilr L e .11t~- !v-=ii I..-rl i..m..I rn .i -..I n .lll.ijl Int


ani o rll~l1 n!t v..s. i,. !r I;.. ,,..\ l'j 11 .1 ri,... as .. t .

no i, nall; liP mIll~ij nurly an n.rbt nv B t


i1l 111.1.f .111.t.r ..t 1 IIIrs- at h a l .1.1--1.E.1 m ., ll l. "(tl. '.-
I11.:.rrell-.1 n .- a l \ Is n ,11 h .d r n a
is .a!s- l:Ic~ lik d rs 1 '.1..Ii. .[ s rn th.1*I ItII~/ I Ill llll .


* i* ** ?ir **** 2****


N (O.OL .1TTIHE ON filE CO'CsTANTi THI'Nl (.cI.F LI\

Ir-ink:l? I".0.1 ..f ....;r: ul-. her Iran-JI..m .I !lel tra- *ni .






IITI I -IV w ( E Iaulj~ (Iherjl ...n11! ]\ft11 pr l ol s 1 ~ I I



\\~11.1 :<11 ..1 '1 -be Isa II rak-n inel neI II II ai e us Er n

Imrt;.I. -* uri nR "II' Ilil. l i f..r 1. but la. I 111e .!llrs.lliC ...

. ln. l.(t Bu -h.-l Ilrllllt -1.!IC Iiil e-H llr t e
\\.man-II..ra.I nlllur .1, I.\.IIIje r Inlif th..I b\1 -lo Isrl


-10..11.1 In iiz 1,,.w 1. ..I I er --II I I 1 .cl I, hil n th. .
Ill l rll; I dFI I)Ind!I in l"I.h I Oninenuntll n .rici ii .II..C


Eir\ 1r~n.Le Irt .II Il the I.-upl -in-ni.
Lotua l. I'- Diha \l T eerr re fl- rn .rlnr

Ilj. Il..\rnEd .ll. n L~ sir ~ 111'~ ;111\ rf rr ns n nl., .bI1x .




Theli l ri It ise i ..t r. II; .l parr\ -tr..~lled Inj ril.,~ -li .


TheCTpa Th Li


By HERBERT G;. Dr LISSER,







\X/ ~ *HEE F: "!! ili.-l -r ll ht











W"EN~i~ .Itircrl Pi.mbrr..n ...1 LII!I.hl h 1pl
Bush- 11.!!1. 11> 1-11 thit.l 11. [.sr. 11'11 a'

11..- n 1 c\L ns.. I rir~ c ... I. 1 1 1.. II had1!n" et


I...111 Kne-.n the nichI b*(*a !!1l lir "'111 .r. at "



E~I\l-ll, l II ..n-a -Ipr ing.! H.r- eII a l I
Inn c.1 .urb 1111 [st ..II I.-r-.u !1 r.



\.i~ll.[ II ex ra ak toIILI;! I H II II I.i E -l i r. .

ISir."I th.Ir1I !ard L(1.'' .1 i er le 1 FI

Kltd ~. r-.. .I Palrk.l rn I ldI.I' Ii .' I
- )! \ ( 1s..f .,i 111 1. {**1 10= II 11 4 -.1 1 1







[Il el r ..t I. fili.11. r~~ll~ 1101 :11 iI- :




.1.-0.1\ 1.11 rIlt cill:e L'. ile !\.4. Italip



[II"'. i st III till I'aI, ~ii In111.1 11.. ij In 1 111t11 1.


"\,r. AI -0. Irrl tt l ~I..- r'e ui~rn 13lr!. .I l

"\\h lrc ..l.-in al.0).il pt! ?. JllllllTJ 1 ll~l III I

11). \ IrIi ~ nl' [** IIa l ial *** il .ir*I .


(. *II Letrlia11l l ? -.1i T U t lillll r-.rl c





j{.-~cln!' y,.. r-1 11 if sl. .\lie ler Ihnit 3 er l-i







b Bthar'e and lu arl 111311, .= lal.1 l Hn F. T l







PUNCH


PLANTERS'


"I agree," assented Mr. Pemberton. "If you mix
with everybody, you will lose your own position. I
have told Arthur so many a time. But this Miss
Ludford looks a nice girl, and if she is an artist,
that makes a whole lot of difference."
Then fortune was again most kind to Mr. Pem-
berton. Mr. Beaversham came along to see how his
wife was getting on. ]He himself danced but rarely,
and at public dances he made it a rule to dance first
with his wife. H~e was certain that this procedure
was duly observed and commented upon, and made
his dancing a sort of high ritual as well as a great
and glorious example. He now came to suggest to
his wife that this ritual should be proceeded with,
And, inwardly, Mr. Pemberton thanked God.
Mrs. Beaversham rose and went away with her
husband. Mr. Pemberton also got up with alacrity
and made his way out to the lawn. He strolled down
the Palm Avenue of the hotel, now illuminated byv
many-coloured lamps. The lawn was partly in light,
partly in shadow, and groups were dotted about it,
sipping drinks, laughing and talking, while from the
ballroom came the sound of a merry air to which a
mass of couples moved swiftly. Mr. Pember-
ton continued his walk until he came to
where the long fronds of the coconut palms
were stirring in the breeze. He ascended
the short esplanade that overlooked the sea-
bath; beyond were the shimmering waters
of the harbour of Kingston; overhead was
a half-moon that made radiant the tropic
scene.
He was in a mood to be romantic. He
had had a happy day, had dined well, had
inbibed just sufficient champagne to give
him that feeling of exhilaration in which
one could appreciate the beauties of nature,
provided that one had an excellent cigar to
smoke and could look forward to meeting
presently an uncommonly attractive girl. It
was true he was sixty, but he felt quite
youthful just now. Twenty years ago he
would have thought of himself as being an
old and almost decrepit man at sixty, but it
was wonderful how, as he had drawn nearer
to that age, he had discovered that it didL
not mean old age at all. He had altered his
scale of values in so far as age was con-
T cerned. At eighty he would be old, but that
was twenty years away. H-e was now, strict-
ly speaking, only middle-aged. He had en-
joyed his life hitherto; he intended to enjoy
it to the end; he was a bachelor; he would
remain a bachelor. But life might be rend-
Sered more interesting: to a bachelor by ac-
quaintanceship and friendship with lovely
ladies, and he had known a few of these, in
the very best society, and it had been plea:-
sant to entertain and to be entertained by
them, and they had always: been nice to
him. although they must have seen long ago
t-hat he was not a marrying man. As a rule,
he had not sought his friends amongst any
except the best Deople, though he had no-
ticed that some of those who were not th~e
best to-day became so to-morrow, and that
it might be hazardous to prophesy in society
who would never be amongst the best. Ile,
however, had usually waited to be quite
sure; but now he felt that he could safely
follow the advice he himself had given to
K.G., Mrs. Beaversham: he could relax. He want-
LINCIE ed to meet Miss Ludford; quite suddenly
O JA- she had interested him. Clearly, she was
not yet in the higher ranks of society, but
she claimed to be an artist, and Mr. Pemn-
berton had heard that artists elsewhere sometimes
rose very high indeed socially. If elsewherer, why
not here? And, indeed, what did it matter anyhow?
For the first time in his life he was conscious of a
contempt for hard-and-fast social divisions' and dis-
tinctions, and he felt proud of that feeling. He was
rising to new heights of mental and moral superior-
ity. Meantime he must find his nephew at the close
of this dance. Now was the time to get introduced
to Miss Ludford.
The music ceased, the crowd was pouring once
more from out of the ballroom. Mr. Pemberton left
the esplanade and slowly took his way up the illu-
minated Palm Avenue, down which flowed a stream
of chattering people, eager for the cool night wind
and the glamour of the tropical night. He reached
the entrance to.the hotel's lobby; standing there he
sawr his nephew and two other' young men with him.
He moved towards them, wondering what had be-
come of the girl.
~Well, Arthur," was his greeting, "how are you?
I didn't know I should meet you here to-night." He
nodded to the other men as he spoke. He knew them
both slightly, but did not remember their names.
"Only made up my mind at the last moment to
come," said Arthur. "I ranl up to Kingston to-day
and was of half a mind to go back to Portland to-
night. But I thought I'd stay over. Won anything-
at the races?"
"A few shillings. As you know, I never bet
heavily."
Any observer would have noticed that Mr. Pem-
berton's nephew resembled him generally; yet there


of the next dance, and the dancers began hurrying
in from the lawn and the lobby. They flocked into
the long verandah on their way to the ballroom, and
Mr. Pemberton's eyes eagerly scanned the faces for
the one that had attracted him. He might easily
miss her, he knew, for there were other entrances
to the verandah besides the western door. He kept
glancing in more than one direction, therefore, and
it was when he turned his head westward again that
he saw her, and an exclamation of surprise almost
burst from his lips.
For now she was with a new partner, and this
was no other than his nephew Arthur. The young
man was nodding to him gaily as he passed, and the
girl was also looking in his direction. Arthur called
out a cheery greeting to Mrs. Beaversham, who re-
turned it with a bow just a trifle cold. Then the
couple disappeared into the ballroom, and Mr. Pem-
berton, wvho had half thought of asking Mrs. Beaver-
sham if she would dance with him again, decided
that it would be nicer if they sat out this dance.
This way he would the quicker get rid of he~r.
"It's so hot in that room that I don't feel I ouglt


to a mnlI..n ,...uncer! U..m..n~l before addressing her.
He was aware~ tha:r the Irl-puted possession of much
wealth a-..lelr~ ..nI un.. -... sal rights and privileges

**(if e..ill-e 1 ..~1I.1 n..lr". answered Mrs. Beaver-
sham sub rh n lilll\ I Illte nI:. wish to meet the lady
at an. timec. allu iithat i- wh!i I don't know her."
*\tat' aalr=r er .ir-ked Mr. Pemberton con-
fidentiall He knew\ lh.,rt trlre was much to be said
against n el~l .-a-c..I....I.. butl that no one ever seeml-
ed to, surferl fr..ml nI Ill .nuatlled scandal. And the
sUggestissul .i ..I'.1I -an l ish..:- Save a spice to conver-
satilon it helliedl to' ns olic Ilil worth living.
'I kn..w~~ ..f II.4hillls ;1..unit her. Only we move
In quitei Iiffeirint Iihe-, -. Alltred: that is all." The
voice indllentl rII l th:.lr En.[ :l- more than enough. Mr.
Pembejrl.:.nl t*rl!~ol~l. Ill.' 'landct'Ood her point of view.

Iaml r~...Ii h. an... ....r I.. Jamaica to open some
sort o~f Ib~.*p" Mr!- lH.\. le.-!!am added, as though
that explainrll e\er.111.ne
Mrls Reutl~.l.-l.* II ui. l.unllajther had been a gro-
cer in a small 1.8.1~. ...In-.-.inently she always spoke
with ,...merllna. hkl~ ..ms.!-nalI~ of commerce.
That wa-- ..nr i. rible liast
M~r Pennuars..nII lia.1 rI Inlinlit to himself
that. th..unlLi h~ reIr he w;.I- ..nie of the most
liberal-moridedi men.~ ,iite rhre was some.
tiling wnl~l~; l**olr rh,- -... I.Il ita~tus of any.
one w-h.. 1.8.1 1.* E-l i ;! sIzed A store was,
Obv iluz l\. 51Ui.f Ir re I .\ .r..i.- was compara-
lively or I. ....r '-- .. jlrae. Lace where a
concideral..ie a-.1.c..I.1I'rI lf -..ds was stock-

scale ~ .1 @*II ii.l -**natthLue!I small. The
owner at a ~-1.*1>l n!ilcrI 1. .ninrlitted to have
a rigbyr t,. -...:al Ice....nos.l. .II he proprietor
of sh.p *0=n. ...il .10.1I ladies rarely
kept a 1h...[. nle-lr- Ilhi lus.)i tome down in
the walll el E\len a i IIr i'-re~ ladies, they
seemed by~ tll-lr ros.rti~i ..I ..t eaning a livell-
hocd ts. Itale ~1 -I~n sult I~ 1 ri-l social rights.
He wa still asItIIIII' Iii 1 l e Ilretty stranger
who b~d i 30- Ila--e'l i-1 I.- was now con-
scious nf irr-lin: 1---- II'.--ne to meet her
than behad t~lt ..nI lli .1 fe~ minutes before.
He would n..r. lII s..Ints.--*..I rn~ himself, like
to be seen dau.l Ill- 1. 1 Imi.Is.. hotel with a
female nh..pe-1-*-1 .\!~1 4. maintained
M lrJ RFa ten ts.lll miai .11 conversation-
al moord She~ n1 II dull-. in that mood
when there aso !bils..I.1 to 1.0 discussed, a
pedigree rralesi. ? -rat. -- ..,-!It1-d. She was a
criic onth a.i. -sI.-hie ;vas convinced
that she no-n~i LIt 1.. her...,-, and especially
to herself. thalt (lie 1IruthI ,rbout everyone
should be kn**nri. I1, rt.- Ilnterests of truth
itself she r..1.1 it-idel~l ii atreerred to any-
one else. Hclr usnlll rli~lli was always
something m..n- lhan rlu. ILa uh, for she ad-
minted no~ galaliltin:u In surstances; she
would mentiuml **nd-' ilsIr- ?rith simple sev-
erity., but wor~lld n..-r r usable- 1.I. say anything
about olnr's \i!rtune- ,! rhe .rnie tim~e. Thus
her wOrd-Pirtune- **10~ all In primary col-
ours; the-re was; ur. -lianisei anywhere. See-
Ing nolw that II .17~1Y Penl~eri. was somewhat
.curious al).=Iit IIIls *;:il. Ill ia.t lising the in-
conveniencer II her! ..t ! assoc~iatinE w!thl 1F.*-r-olu 11rol in that circle, H.R.H
she felt that he( I....acti !o. I. \*.lrned in time. G.C.V.l
. He might meet! the~ !linn iw..anan later and ACCO~
:d:might altually want !.. Inirl...Ince her to the
Beaversham 3.1.h tIn lll- 11.li4 happened be-
fore. It hadl u~..t alwal: be an possible to prevent
calamlitis Still. ..n.- -Il..ul.1 Ir~y to; that was a duty
not to be ignated l
"Very) bIlle- I- really I:n..11nn about her," she col-
tinued. ""She c.talte ..uII rl1- .1ear, but what part of
England she rsame tr...m. ;.:he. her parents are, what
she did in Eng!land. it h..~ --be was, and who she is,
nobody here know:- S h.- imis-r, anybody, you see, or
we should ha\e hce-arll i..nlrething definite about her."
"That's so~." :Illmilred 111 Pemberton; "she would
have brought lerttr. ..r .-.-l would have ....
well, she would bute Fput r.. knlow people like you in
.8055* way or uthcr."
"Quite so. W~e wouldl hav\e taken her up, for I
llbt admit that shle I..a:.ki~ Iluite presentable. But
the hadn't been here- unt tlnme before she opened this
shop of hers. Thul's t'nic-ntlly what she came out
fo."
"What does helt sell.'" ;Isked Mr. Pemberton,
though his interest was Ilapullly waning now. Mrs.
Beaversham had almn..-- kledlcl it.
"Curios and thingsz 1,f that soft; art objects, she
,Calls them. I believeP site 2.1s she is an artist, but
tha~t is probably conlyrn~ tal
"Objects ofP artl"' exclarimed~ Mr. Pemberton; "but
that is not the samle Lllthin a- 4hop-keeping, Arabella;
SIt is altogether a diffr'irnt tlIn~g." He felt elated at
halfiing that this Firl un-, ..ne to whom the mys-
terious appellation of~ arrist light be applied. That
orrd could cover a multitudie of things offered for
gale.* Here was. as it were, a new angle from which
ase might be approached
Just then the orchestra struck up the opening bars


. IRINCE GEORGQE EDWARD AL;EXANDER EDMIUND,
O., IIEUTENANT R.N., BORN IDECEMUBER 20, 1902. THIE PR
MIPANIED HIS BROTHER, THE PRINCE OF TVALIES, T(
MAICA IN FEBRUARY 1931

to ask you to dance this one with me, Arabella", he
said,; besidess, you are so interesting a conversa-
tionalist that it is always a pleasure to have a
long talk with you. Did you see wYho Arthur was
with?"
"Yes, and I can't say I quite approved."
"But if the girl is an artist and sells objects of
art, you know .. ."
"I don't see what difference that makes. She has
other things in her shop, and who would buy artistic
objects in Jamaica from somebody we don't know?
When wve want these things, we go to England to get
them, or we get a catalogue and select what suits
us, and send for them. It is true Arthur is young,
but why not mix with people of your own class? It
never does to have two or three sets of friends."
"I am more democratic than you," laughed Mr.
Pemberton, who just then felt that he was almost a
socialist, so expansive had his creed of equality sud-
denly become. He wished that Beaversham would
put in an appearance. It was unreasonable for Beaz-
versham to leave him alone with his wife for so long
a time.
"Well, whatever you do, don't ever introduce me
to that girl if you should get to know her, Alfred.
Or any of us."
"~All right, my dear; I will respect your wishes.
But, really, you are much too strict; you should re-
lax a little."
"I have an unmarried daughter. You are a
bachelor and have only your nephew. A man can
know people that it is ~best that a woman should not.
And if you once begin to mix with everybody-"


79F31-:32





PLANTERS'


PUNCH


were marked differences. Mr. Pemberton was of
,middle height, dapper, clean-shaven, with hair .grey-
ing at the temples, nose slightly aquiline, and
keen grey eyes. H-e had a strong chin and firm n
mouth; he carried himself as one very conscious of
his importance in the scheme of things local.
You felt that he was careful never to forget himself.
Arthur, on the other hand, was tall, somewhat loose-
ly-built, with blue eyes, brown hair, and straight
nose. He had an intelligent forehead, a pleasant ex-
pression; his face gave you an impression of good^
nature. At bottom, you would have concluded,
his uncle wvas a determined man, Arthur more
agreeable, more loveable, while strength anc
~determination were not yet among the qualities high'
ly developed in him.
The two were very fond of one another; in so
far as differences of age permitted, they were warn>
friends. Arthur always said that his uncle had beel
exceptionally good to him, and he was grateful. Mr.
Pemberton cared more for Arthur than he thought
it was consistent with dignity to express. He saw
no faults worth speaking of in the young man.
Meanwhile Arthur was earnest at his work as his
uncle's planting attorney, and knew that some day
he would inherit his uncle's wealth. Provided, that
is, that he did not in the interval displease the older
man seriously. For he ktnew that Mr. Pemberton
had it in him to be hard and unforgiving-
"Who," casually enquired Mr. Pemberton. "was
the pretty girl I saw you taking into the ballroom
a little while ago?"
"She? Oh, she is Miss Ludford; a real good
sort. I should like you to meet her, Uncle Alfred, if
you don't mind."
"Certainly I don't mind, my dear boy; only too
pleased to meet any of your friends; where is she?"
"Gone to powder her face, I believe. It seems
that no woman can dance or dine or even take a drinl
without wanting to powder her face, and that cere-
Inony sometimes takes anl unconscionable length of
time. But here she comes."
He turned towards the advancing girl. (His
two friends had drifted away). "Gladys," he said,
'this is my uncle, Mr. Pemberton, whom I have toll
you about." The girl held out her hand at once wit'1
a bright smile and a "how do you do?"
"So you are the young lady who danced into le
to-night," said Mr. Pemnberton. "Now I am sure you
didn't know I had marked your face."
"No, indeed; I rather hoped you hadn't. I was
ashamed of myself, though it was my partner's
fault." She had really forgotten who it was she had
run into, but she didn't mention that. It would not
have sounded as nice as what she actually said.
"I am glad it happened," returned Mr. Pember-
ton gallantly, "for it caused me to observe you par-
ticularly." He bowed as he spoke. The gesture anti
words conveyed the fact that his attention had been
arrested,
He saw her very clearly now; her bright eyes,
her delicate straight nose, her wonderful colouring.
He remarked also, though subconsciously, that her
lips, though alluring, suggested firmness, and that
the chin beneath them was round and strong. An
intriguing as well as an attractive counten.
ance. She was of middle height and slim, though
with no touch of angularity. And she dressed with
exquisite taste. "Miss Ludford is an artist," Arthur
mentioned.
"A smatterer," she corrected.
"Miodest," added 1Mr. Pemberton, "and now," hie
went on, "what about finding a seat on the lawn and
having something to drink? You must be thirsty
after your dances."
"I should love to," she answered, and Arthlur
laughed through sheer exuberance of spirits and said
he was always thirsty.
They found a seat on the lawn, ordet'ed and
sipped drinks, and Mr. Pemberton felt himself even
happier than he had been when entering the Grand l
Stand at Knutsford Park in the Governor's company.
This was extraordinary, for he had not thought ex-
altation could go higher than it had during the
afternoon of that day. H-e wanted to ask Miss Lud-
ford to dance with him, but shrank from taking. her
away from a partner so much nearer her own age-
But she might have a spare dance later on. He en-
quired, she gladly consented to let him have tle
sixth dance; it was a waltz (the young men were
not fond of waltzing, neither was she herself, but she
said nothing about that). Mr. Pemberton had in
tended to go back to Constant Spring Hotel before
midnight, being a man of regular habits; but he de-
cided to break all rules on this occasion. The sixth
dance would come on about midnight.
Arthur took Gladys Ludford away, and Mr.
Pr-niher-raln went in search of the party he had dined
ivith. Only Mr. Hepworth he found disengaged, for
Mr. Hepworth- did not dance. They sat together
until Mr. Pemberton's engagement came round, and
he hurried off to claim his partner. As but few per-
sons bothered with the waltz, those few who did
w~ere naturally all the more noticeable and noticed,
and some persons remarked to one another that
Gladys Ludford had got to know Mr. Pemberton, who
was at the very top rung of the social ladder, and
that this was something of .a social triumph for her,
even~ though hre wasf a man and not a woman. Mrs.


wvorldl fair just now; and as, standing for a moment on
the sidewalk, she glanced northward, she enjoyed th~e
view of the Central Park, but a little distance away:
the Park through which a wide driveway ran, on
either side of which were long parterres of scarlet
and yellow cannas, and umbrageous trees, and green
lawns, and in the middle of it all a fountain which
threw a steady jet of silver water upwards.
It had rained recently, and now the Park was
a~t its fairest. She saw the palms, and the plants
that blossomed into trailing bunches of golden flow-
er~s whiose name she did not know; she saw the bril-
1 ant flush of red hibiscus and the sparkling sky.
The thoroughfare had not yet begun to fill with mo-
t~or ears, but presently that would commence;
meantime the trams and motor 'buses were bearing
the employed workers--white, black and brown--to
their various destinations, and carts full of water-
rcoconuts were drifting downwards, their drivers
calling out their vegetable drink in words unrecog-
nisable to anyone who had not lived for some time
in Jamaica. Hundreds of pedestrians were already
passing to and fro, dark-complexioned mainly, de-
cently clothed, absorbed in their own affairs. The
sunlight of the southern tropics glowed softly: later
on it would fall like a fiery sword upon this street.
The newsboys passed along shouting forth the names
of the papers they sold, and Gladys called one of them
and bought a paper from him; she wanted to see if
she had been mentioned among those who had at-
tended the ball at the Myrtle Bank Hotel last night.
Before going inside, she gave a quick, critical glance
at the show-window wherein was displayed a selec-
tion of the goods she sold. She was satisfied with
this.
.She passed into the shop. She had rented one
side of the lower floor of a rather narrow two-
storeyed building opposite to the Parish Church.
She had divided this into two compartments; the
first which looked upon the street, being the longer,
In this a lengthy show-case of plate-glass formed a
counter and separated the customers from the at-
tendants; in this show-case were portraits of cele-
brated people, English maiinly, coloured reproductions
of great paintings, vases that were imitations of
ancient Greek and Renaissance Italian work, and
things of that sort. But in the shop there were some
rorigmnal paintings, too, in oils and water-colours of
respectable workmanship by artists in England who
had made no name as yet, and might never become
anything more than moderately knowvn; and there
mer'e some etchings, and the more expensive sort of
Derfumery. There were curios, both native and
imported, and shawls which claimed to have been
made in China and Japan and Spain--great squares
of silk with striking designs of birds and flowers
and conventional arabesques. But the name of the
establishment was The Art Studio, and its principal
business, as advertised, was to sell things of an ar-
tistic description. And it had been put about that
Miss Ludford wras an artist. Art was, so to speak,
brought within the reach of the pockets of the
Jamaica people. And an artist had appeared among
them.
In the inner and smaller r~oom, which she now
entered, a few drawings and paintings were hung
against the wall. The apartment wvas small, but,
nlicely fixed out with three comfortable wicker
chairs, a wicker table on which there was usually
a bowl of flowers, and a Crex carpet of really neat
design. A few of the things on the wall were
Gladys's own work: some sketches in pen and ink,
a mediocre study of still life, and a copy of a picture
in the National Gallery. London, depicting women
weeping over a dead body. These things pro-
claimed Gladys to be no artist. They wrere ordinary,
poor, and the result of painful effort; yet they were
exhibited, and the fact of their exhibition indicated
that the girl had plenty of practical brains. For she
had calculated that hardly anyone in this tropical
country would know much more about art than she
did, and that the opinion of the few who had real
knowledge would not matter.~ They were not likely
to go about condemning her; they would probably
take no notice of her work, and that would be all.
The things that she offered for sale were not hier
own; they were good enough; they came within the
means of those who wished to have pictures and ob-
jects of art in ~their houses. If there should be any
criticism of her taste, that could always be attri-
buted to the saddening lack of appreciation which
the artist has to struggle against, as a rule, during
the greater part of his life. Gladys usually kept on
the wNicker table, with the flowers, some sketching
paper with marks upon it, and this she changed at
intervals. It suggested that, when time allowed, she
engaged in original work. It justified, in a manner
of speaking", the alipellation of Art Studio which dtig-
nified her shop.
She had taken off her hat and was busy setting
out one or two of her everlastingly unfinished sketch-
es when there came a rap at the door that divided
the two compartments. She said, "Come in," antd
Arthur Norris made his appearance.
"I told you I'd come around this morning, Glad,"
he exclaimed, "but I hardly expected to find you down
so soon. Great night, wasn't it?"
(continued on Page 227)


MISS 'ELINOR BRANDON


MISS Elinor Brandon, a talented daughter of Ja-
maica, is at present a student of art in Eng-
land, having shown a special aptitude for drawing
and modelling at a very early age. She was only
fourteen when she received honours in six divisions
of the Royal Drawing Society of England. After
that she pursued her studies in drawing for some
time in Paris.
A Cew years ago Miss Braandon entered the Slade
School of Art (University College, London) and
stayed there for one term only. She returned, how.
ever, to the Slade School in January of 1929, worked
there until the end of the year, then went to the
south of France where she continued drawing and
modelling, went back to the Slade School, came to
Jamaica for some time last year, and then returned to
England to resume her studies.
Miss Brandon is now devoting her time to sculp.
ture. She has completed several interesting figures,
one or two of which have been shown privately to
friends in Jamaica. That she has gifts as a sculp-
tor is admitted by her masters, and those who have
seen her work have been struck by it. All Jamaicans
will naturally wish that the promise in sculpture
now given by Miss Brandon will be fully redeemed
in the future. She loves the work to which she is
devoting herself. She should bring credit to Jamaica


Beaversham observed the dancing pair, and recalled
the interest Mr. Pemberton had displayed in Gladys
Ludford earlier that night. She did not like this
development. Not because there was anything seri.
ous in it, but because it might aid Gladys socially;
and Mrs. Beaversham considered that one's duty to
society was not to aid others, but to keep them dowl.


CHAPTER TWO.

Nthe November morning, the principal thorough-
fare of Kiingston, known as King Street, which had
earlier been swept and flushed, looked clean and
cool. Its buildings were of moderate height and suffi-
ciently individualised in appearance to rescue the
scene from a depressing monotony. The shops--or
stores, as they are invariably called in the West In.
dies--were open or opening. Gladys Ludford, in spite
of having been up till twNo o'clock that morning, arriv-
ed at eight promptly; awaiting her were her a;-
sistants, Kingston girls, who attended to all the or-
dinary customers and did most of the actual work of
the little establishment.
Gladys was feeling buoyant, even happy, this
morning, in spite of the fatigue and late hours of
the night before. She had made more than one go~d
impression, even if mainly upon men. The women
had held aloof, the women of the class to which Mr.
Pemberton and Arthur Norris, his nephew, i.ltm~i-~rme.t
but. after all, she knew quite a number of nice girls
and their mothers already, and never was at a loss
for a female companion with whom to sit or to go
out when she wanted one. The dance, then, had been
a success from her point of view; she found the


1931-32


A~~~~~ JIACc TS







PLANTER S' PUNCH


1931-32


yampi and cho-cho, while we have no fish in England
whose name can be compared with that of snook.
It is so pleasant, too, the way in which you can
take all your meals out of doors--everywhere I stay-
ed, there seemed to be a vista of sea and land which
was as poetic as the meal spread before me. At
Port Antonio, the kling-klings, their black feathers
shining in the sun, used to call sweetly to one an-
other and then jump on to the verandah,
demanding crumbs with all the impudent as-
surance of success. The garden sloped down
to the sea and occasionally boats passed out
of the harbour with a loud hoot of farewell,
and it was all very peaceful and pleasant. At
Montego Bay there was the sea, and again at Kings-
ton, and when you took your meals out of doors you
didn't have to glance continually at the sky for the
first appearance of rain douds. You knew you would
see either a brilliant sun or equally brilliant stars. I
only know of one London family bold enough to
take its meals out of doors during the summer.
Through several years of familiarity, it has now
ceased to be an object of surreptitious curiosity for
the neighbours, but the cats still sit in serried rows
along the walls and stare with all their might.
The open-air life in Jamaica is something so
different from anything that w~e are accustomed to
in England. The bathing is admittedly amongst the
finest in the world, although it takes the visitor a
little time to rid himself of the fears engendered by
the awesome stories he has been told of sharks and
barracootas. Even in London we try to sunbathe
now, because the doctors say it is so good for us,
but it is apt to be a sooty business, not to be com-
pared with sun-bathing in Jamaica. No wonder the
object of life is to get as brown as possible, when the
acquirement of a mahogany complexion is such a
pleasant undertaking. And it is a lesson in c~oncen-
tration to watch fervid sun-bathers turning them-
selves round methodically, at stated intervals, to
ensure an all-over brownness of even colouring. Why
people don't get sunstroke in Jamaica is one of the
mysteries of nature that cannot be logically explain-
ed. But the fact that they don't lends point to the
rather startling theory propounded by my chamber-
maid, who was a treasure never to be forgotten. She
elucidated the idea that England was hotter than
Jamaica. With some reason, I think, I said that I
hardly thought this could be so. "Why, yes," wyas tihe
reply, "in England people die of the heat, in Jamaica
you never hear of such a, thing." Before such irre-
futable evidence, argument melted within me.

SOthe Jamaican days went by, each one adding its
impression to the store already garnered. Out of
all the memories, some emerge more clearly than
Others and it is not always the big things that re-
manin so definite-I may forget the exact contours of
some tropical valley but I will never forget the ex-
prlession of the chicken who was trying to cross a
swollen river on the way to Moore Town. Even the
car found it difficult to pass through. How much
more terrifying, then, for the chicken, who counted
onl the help of stepping stones and found, when too
late, that they had been submerged. There it stood
in mid-stream, its neck stretched forward tense and
strained as it gazed longingly at the opposite bank
and then, with a despairing squawk, flapped its
wings in a last hopeless effort and flew crazily to
safety. There was, too, the washerwoman, a terma-
gant if ever there was one. I should hate to have
entrusted my clothes to her on one of her bad morn-
ings, they wNould, I am sure, have been pounded to
shreds. We had presumed to take a photograph of
her, against the background of some picturesque falls,
at the foot of which she was doing her washing. But
the photograph never came out, as it happened; it
resulted in a smurred streak whic-h represented, in
reality, the washerwoman hurling herself towards us.
a vengeful fury screaming maledictions. It was just
as well we couldn't understand what she was saying,
otherwise we might have blushed for weeks. But our
hasty departure did not placate her. Next day, pass-
ing the same waterfall, there she was again and not
only did she recognize us, but she called out, with
enormous vigour, just a few of the remarks which,
in the heat of yesterday's encounter, she had not
Pound time to say.
But she was the only cross person I met in the
whole of Jamaica, a country where everyone is so
friendly that the visitor is almost overwhelmed with
kindness. Small wonder, therefore, that the West
Indies are becoming so popular. Since I have been
back in England, I have heard again and again of
people who have either been out to those delectable
islands or are planning to go next year. The West
Indian cruise is becoming even more popular than
the Mediterranean one, and people who have been to
the West Indies, and particularly to Jamaica, can
feel no surprise at this development. Jamaica will
always represent to them an island where the natural
beauties of its scenery are only rivalled by the natur-
al kindliness of its people.


Bay to M~ontego Bay, is an experience which no
visitor should be allowed to miss. The whole of
Jamaican history seems to unroll itself before you,
prefaced by the long straight road, a glory of logwood
blossom, which leads to Spanish Town. There is
something very sad about Spanish Town, with its
old, shabby, jalousied houses grouped about the broken
magnificence of King's House. King's House, ruined
by fire but still fronted by the elegant dignity of
classic pillars, seems symbolical of the contrast be-
tween Spanish Town as it used to be and Spanish
Town as it now is. It is inevitable that the centres
of progress should change. Montego Bay looks for-
ward to a prosperous future, but in admiring its
modernity one can still spare a sigh of regret for
the forgotten, lonely dignity of Georgian Falmouth,
When one gazes across Runaway Bay, and in the
mind's eye sees that desperate little? boat with its
crew of beaten Spaniards setting out on their perilous
journey to Cuba, it is still possible to look with sad-
ness upon the remnants of the fine old houses which
are falling into irreparable decay.
NE learns many things in Jamaica. H~ow to
Seat an orange properly, for one thing. It is,
after all, an important question which has for years
worried the compilers of etiquette books. Why we
have never, in England, thought of peeling the fruit
and spearing it with a fork, I don't know. It is,
after all, very much on the principle of a toffee apple-
and plenty of them are eaten in England, in all
conscience. I am anxiously waiting an opportunity
to prove whether English cattle are as intelligent as
Jamaican ones. On more than one occasion, when
our c~ar suddenly became submerged in a herd of
cattle and I had really given everything up for lost,
at path was miraculously cleared for us by the strong-
er minded members of the party leaning: boldly from
the window and shouting firmly, "Side!" Why do
Jamaican cattle obey this order so promptly and so
docilely? Not once did they show any signs of
defiance, even on the occasion when the presence of
a red hat in the car might have been regarded as
justifiable provocation. No, they simply moved quiet
ly to one side and allowed us to depart in peace. If
shouting "side" will have any effect on English cattle,
motoring thro'lgh Devonshire lanes will lose much of
its terrors.
The endless pageantry of the roads is one of the
unforgettable features of Jamaica. In England, cer-
tainly, the roads are never empty but the sameness of
a continual stream of motor traffic tends to be mo~n-
otonous. The traffic in Jamaica is of an In-
finite variety and even the motor traffic is more ex-
citing than it is in England. There is always a de-
lightful uncertainty as to which side of the road an.
other car will take at a curve and the almost in.
evitable presence of precipices lends a spice of excite-
ment to even the shortest drives. Those long pro-
cessions of native men and women, walking to mar-
kret in the morning and back home again in the
evening, remain in my memory as one of the most
characteristic: features of an island which is full of
character. Their tirelessness cannot help but be im.
pressive. They swing along for miles, full of vigour,
carrying heavy burdens on their heads, and when one
passes you can only marvel at the perfect balance
which allows them to swing round so unconcernedly
to stare at you. And then the hundreds of patient
donkeys, donkeys drawing carts, donkeys laden with
paniers, and the equally numerous mules who, I am
told, all rejoice in the name of Alice and never find
it muddling to share so universal a cognomen.
Also there are the pigs: more squealing pigs it
has never been my lot to see. You never meet such
small ones in England, it was a great temptation to
adopt one as a pet and tie him up with a necklet of
pink ribbon. But the smallest pigs grow into large
porkers in the fullness of time and such a pet, there-
fore, would be bound to lead to disillusionment. But
the little black pigs scampering along the Jamaican
highways, to say nothing of the goats and kids who
monopolise the banks, remain as one of the pleasant
diversions of a country where mongoose run across
like rabbits do in England.
\ HEN I embark on any of these subjects, in res.
ponse to my friends' requests to "tell them
about Jamaica", I find myself being led on
and on; it is difficult to marshal into order such a
kaleidoscopic richness of impressions. One subject
opens up another and it is impossible to come to an
end of them. The poetry of Jamaican food, for in-
stance; our traditional Sunday dish of roast beef and
Yorkshire pudding is well matched by your
traditional dish of cod-fish in ackee, we have no
fruit so succulent as the purple and white lus-
ciousness of the star apple, nor anly delicacy that
can outrival the savoury flavour of black crab. The
centre-piece of fruit, cooled with cracked ice, which
graces the Jamaican breakfast table, is poorly sub-
stituted by toast and marmalade, our potatoes sound
dull when compared with those exotic equivalents,


.111* ~IllRI1lli I)IRBYTSHIRE
a he rinald 1Ih. quest.9io. **lt hat~ is Jamaica Like" a


I-ERE- I- -..metrhln- \-. compelling about a
Ile-a-ust rll.,r willl PI"no* a whole boat-load of
peolplr rn~.-a- .It an IIn. !...Illlly early hour to see a
sulnrlse. i 11.ll.111 I;!!..o b.. It came about that we
ac.cprori HIl rs 10. lisat -- -ts....ld get our first glimpse
of ama~a rrue.La.n um Few of us had been
c.url 1,, II!I ill--r lialcl- In-r..r- but gradually, as the
days Ihppeal 1.- .andl (1=.-- I- et -increasing warmth of
the -un 1 I-.10.16.r~ /1 III :-* *,Iet the cold fogginess
whub narl .1 1.n! .1.n \alearerllon from England, we
bee s, [11 a....tth- *a... ariv l. "Of course '
we said LU. -.l- b1 ~11-..rbr '\. Inust get up very early
,-II Frls.Iai. rinr-, -;.I thatl all.Pise over Jamaica is a

F!l-1.al.' l.!.-usly. '-.ause It..i we drank hurried cups
olf ted In ..nl1 slan1- R ...elan crushed through the last
bili of P1 pa k!-:11~ \aim 1 went all deck with all possible
speedl TIIr- -lai -isa. rlll say, the sea colourless,
the rnou~lnr.lln.- ..( the mosl~!ltlad stood out dark and
us..mblre Ne....I...w1 .I1n;.ub res and the only sound
that ofl te blrrl,- \liaise -I:..11ag away from the side
of th ly11 TI1 -ed..birmll without any warning'
thle ski.v I-';..irm thelr-l \.IIrb pink. The pinkness
warmer)d I.. r..w; a...I III.-n L. :.eld; it spread, covering
thect; ..rls11-.I.it 1.. down on the horizon
where thr ..ne 1~1 i: r.I !In !!. appeared the enflamed
dis =.' r< -n.TIIv. -..I took on bewilderingly
beautifull tuthl II rljlul.g.I.. :I.ud blue, the mists that
Swrreathel an...~~ir sh.~ m..n.,r son tops flushed in the
refitlectio r.1 thl- -ki;. 11,. me!an trees stirred in the
tresh tra..IninL an 0.111 II.- lirrie curved beaches shone
brilliant unre l'r ab-=-. .I deep breath. We had
seen the Iun !I-8'\l ..1-r .J..nl.a and knew that, once
again, tralddI(I n lia1.1 n1..r lulal.led us false.
11'hni jx.!llll.rnnt usIjc! ri at, to note the different
feature- vchiish .I,tarv.) I- triat we really had come
t.:. a tropical~ i-Inne1 lt 1r th West Indies. All our*
jumbledl imple=-.v~l~n- ..f 110- banish main, of pirates
and Ahl ips 111 tie-a-ol. ..1[ .rIllng battles by land and
sen, of' Lral:.- .mai~ l:llil al nd Nelson and Morgan
and a hu~ndllrs-. ..iber unitities, all these seemed
fothcusse. as It were~. li=. 1lee jight of our first palm
tree. Andc this parlltllll.-la Ipalm tree stands well in
viewof rriing ullet- It is all by itself, some-
where pazt the Pnlirl-ad... -. nd growing there by the
edge of thl e se It -r-ein., r... offer an official and au-
thenti weleramle in~ \i-ir..r- from colder and less
colurul hre tree than we saw I-u~r tir-r na~tives, bobbing about in
the sea in their trail Ir...iinl boats, providing a bril-
liant spolt I'I ~1~I.f culaur w th dier gay clothes. Then'
for the filst timeF in funrrl~eenl 13ys our engines stopped'
the doctor ~ncam orl Il...urd 116 moved once more, sail-
ing over the unlkenl r'Enin::1ts of old Port Royal.
How m~any of 114 kiinndelrlj it. in that quiet morning
air, we rulehl not1 hear rtle bells pealing from the
steeple of that faous~~l -Ilbm.-r-gede church? Yet there
was, after all. nlo ltim r-. listen to ghostly chimes,
we were mov\inlg slunici(I aIr. to the wharf and in a
few moments had a~~~irs.mph.i the first of our am.
bitions. 11'e had set to..t~ inl J tmaica.

SINCE I haver beenl 1.a.7.k In E~ngland, so many people
have said rl. me. *Tr-ll mel. what is Jamaica like?"
and each time the Irue-lloln Ilsas seemed more difficult
o h newer am r ?ilrl a.1II n e c .y describe the
hot?" I have been a rl-;-l. and as soon as I have said
yes, I have remembered~i Ili.- cool breezes that blow
down from the moujntain: up! Constant Spring way
"Of course it is a \r.\! r respieal country, isn't it?'
I: have also been asked~ and my instinctive ac-
quiescence has been il:thee~l lay a memory of Mon-
engue. Could an?'thinS: Ilr m..re English looking than
that rolling coulntry. r\lll its spreading meadows
and shady clumps r..f Lt~res'' Even the grey stone
walls of England are~ tliter. nnd the soft white mists
that come up in the evenine. blotting out the panora.
ma of the hills. Only in Eng~land we don't have the
firellies darting brilliamrl! through the darkness, nor
do lizards perch themse~le~s upon begonia leaves and
listen, with a knowing Ino~k. to all our conversations.
That drive to Mo~neague and on past Runaway


How Jamaica Impressed M/e

By MIss SHIRLEY DERBYSHIRE

















Editor Behind the Scenes of one (

Is Greatfest Movbing Picftue Se


that in NIew York, during the summer, the days are
sometimes stiflingly hot, while the height of the
buildings retard a free ingress and circulation of
the air. In London, on the other hand, very few
really hot days are known; a whole summer may
pass without anything like warmth as they know
it in America. So it is actually a comfort to sit
in a small office in London, with the rain drizzling


PLANTER S' PUNCH


1931-32





It


in a very short spaee of time, and
now occupies a highly important posi-
tion in the Paramount organisation.
He is a brisk, sharp, very energetic
man, is apparently up to his eyes in
business and keen on pushing the in-


IMES Square was clamorous with T e
Noises, with the tooting of in- Th
numerable taxi-horns, the impact of at Wo
thousand feet upon the concrete side-OTd
walks, the murmur of a myriad voices.
It was a summer's day in New York,
the blue skies showing beyond the summits of sky-
scrapers, with Broadway at its liveliest. The shops
and offices were beginning already to disgorge their
armies of workers wvho would soon be thronging the
restaurants and eating-houses thereabouts for their
diurnal luncheon. The building of the New York
Times rose slender and graceful, like a sort of
arrowhead of stone projected into the Square, then
immobilised forever. To my
right as I faced this building
towered the huge bulk of the
Paramount Picture Corpora-
tion's great structure, the big-
gest in this centre of magnifi- E 1f]~~~-i
cent edifices, a mammoth
amongst stone monsters.~ But
a mammoth among. monsters e
built on a, particular archi-
tectural plan, and with nothing
of the ugliness of mere size
without design, of mere bulk
divorced from the dreams and
the fashioning of artists.
When Mr. Audley Morais
asked me to call on the Para-
mount Picture people in New
York, and mentioned to me
their offices in Broadway, I ex-
pected to find this company
occupying a floor or two in a
Broadway skyscraper. It had
not dawned upon me that they :
owned this great building, had
erected it for themselves, and
that within its walls were not
only the Company's business
offices but also the famous
Paramount Picture Theatre of
New York, one of the theatres
spoken of, written about, and
patronised by millions from all [iill
over the United States. "' i
On this bright summer
afternoon, then, I entered a
hall communicating with the
elevators and the stairway
leading upwards to the business ~ i!
departments of the Paramount 1 l
Picture Company. I gave the 1
name of Mr. Nathan to the ele- 'I
vator boy who sped me swiftly C
to some floor high up above,
(I think it was the eleventh
floor) and there I found a mes-
senger in a corridor, discus-
sing with two fellow attendt-
ants behind a counter in an
alcove some topic of the day: UC ;
it may have been theology, but
did not exactly sound so. He
carried my card into Mr. J. B.
Nathan, I in the meantime sit-
ting in a padded couch-seat in
the anteroom. watching people,
mainly young women with a
busy look on their faces, pass s
to and fro. Rather more space ...
here than you would find in an
English corridor, certainly
more movement; but then the THE PARAMOUNT
Americans are given to mov-
ing about much more than the
English, though I do not think that they accomplish
more. Soon the messenger came back to me: "Mr.
Nathan will be glad to see you." I murmured somne-
thing about .I myself being prepared to be glad to
see Mr. Nathan; for, if there was to be any joy in
this meeting, I was not disposed to allow it to be
monopolised by any native of New York.

MR." J B. Nathan is, I understand, the Chief As-
8sisant to ]Mr. Joseph Seidelman, who is head
of the foreign department of the Paramount Publix
Corporation. He sat behind a large desk, on which
a few papers were arranged in orderly fashion, in
a large room with comfortable chairs and well car-
peted, the ensemble giving one an instant impree-
sion of spaciousness and comfort. They tell you in
Neily York that space is so precious and the area
of Manhattan Island so limited, that buildings
must soar into the skies and rentals soar even high-
er. Yet the Americans provide comfortable offices,
in their newer structures at any rate, far more than
is done in our own London for instance. .It might
seem, as though there was less room for.this sort
of thing in London, but I think the real reason is


terests of his business. We talked for a little while
about Jamaica, and I fancy that he could also have
talked about Japan had I known anything regarding
the moving picture business in that country. H-e
has done some travelling in his time, for the Para-
mount people make it their policy to become per-
sonally acquainted with the territories where are
situated theatres which they supply with pictures or
which they own. Presently Mr.
Seidelman wished me a good
~ _f~';;;;s~;:.r 1 dhy, and I resumed my conver-
2-:- station with Mr. Nathan.
He expressed a wish to
.; show me over the building,
-' :.and especially over the theatre.
And would I visit the other
Paramount theatres in New
York and Brooklyn? He would
send to my hotel a pass for
that purpose; he would also be
pleased to know when I could
go to see the Paramount Studio
in Long Island, there to wit-
ness the making of a talking
Picture. He would send, some-
one to take me to this studio,
they would be delighted if I
and my party (which consist-
ed of one lady only) would
lunch at the studio: I might
also meet any star who was
working at the time. Every-
thing would be arranged in a
day or so. In the meantime we
might visit the theatre below,
using the steps instead of ele-
vators, so that as wve descended
we might be able to take in
some of the features of the
Paramount home in New York.
I agreed and we began the ex-
*! ploration.

PRESENTLY we pushed
I through a silent swinging
I~~~.. LL'...-,;~ZI door and stood at the farther
I~ i~i L17JI end of an arched corridor
i!~ s cintillating with light, paint-
,ed in gleaming colours, and
adorned on either side with pic-
rf ~d~ c~atures. The parquet floor wvas
.!~kl smooth to the feet; this was a
r~~- ~ifjl gallery such as one finds in
II some palaces constructed in
Sthe France of the Monarchy.
II "Peacock Alley," Mr. Nathan
.C murmured; "the patrons of our
rhows come here to promnenade
sometimes. You can imagine
their pleasure. Many of them
live in rather drab surround-
'FdC ings, and to be able to enjoy
4 something like this appeals to
.,- them. They appreciate it."
In the corridors and halls
of the Opera House of Paris
one sees again and again thou-
sands of persons of ordinary
position promenading with an
appearance of pride, a look of
BROADWAY, NEW personal possession. The beauty
and the grandeur of palatial
surroundings are theirs for
the price of an opera ticket: they are not excluded,
and so are not maddened with anger and envy. In
the great picture theatres or picture palaces of
New York a great and successful attempt is now
made to delight and satisfy the sensuous in-
stincts of ordinary humanity: one pays to enter a
show place to enjoy an entertainment which might
last for a couple of hours; in addition one may
move amidst the light and colour of gorgeous gal-
leries or repose in Jounges provided with luxurious
couches and chairs. Thus the little typist may be a
princess for an hour. F~or an hour, if she will, she
may enjoy the luxury of palaces.
Someone opened a door in this Peacock Alley;
there distinctly came, from the theatre below, a crash
of orchestral music. The door closed again, and
once more it was silence. We went still lower, to a
lounge where, in the winter, I understand, cups of
hot coffee are served gratis to those who wish for
such refreshment. We descended yet farther, to the
ground floor of the Paramount Building, to that part
of it which forms the vestibule of the Paramount
Theatre of New York. And this too was a place
of beauty.


PICTURE COMPANYY'S THEATRE AND OFFICES IN
YORK

outside, the skies gray and gloomy, a bite of winter
almost always in the atmosphere, and perhaps a
small fire burning in the room. Still I, as a tropical
person, appreciated immensely the larger offices of
New York. In this' particular one I felt particularly
at home.
We talked about the pictures, the appreciation
of them in Jamaica, their hold upon the American
public: I liked this quiet, well-dressed man with the
cultured voice: it was a pleasure to meet him. He
told me he would very much like me to meet Mr.
Seidelman, who was the chief in charge of the Cor-
poration's department which handled the whole of
the distribution of pictures to different parts of the
world. He took up the telephone receiver: "Mr.
Nathan calling," he said.
So Mr. Nathan "called," and presently Mr. Seidel-
man, who seemed to inhabit a still higher region
in this New York skyscraper, responded to the call
by appearing on the scene. And then I discovered
that I had met him in Jamaie'a before.

R. SEIDELMAN had begun at the bottom in the
moving picture business, learnt much about it


H~o w


Paramount


CGoes


of the

pricess




































































































































,tar

in s1.Fint~ ~r!~r t :in il rb:rll Inen ^ lc I1. --





grear J 1 br. : h~ll; wh1 IIisl r n. I !m i **. Ihe- [.1 1air



of Europe,

spend ur R s .. u p. = t 1 si rr~ s l
aPPeal to~ those isly.. IIll.* in surlT miisell ings j:,.:kiru- In

lelborated



when they step ilathan anI erranl'~l..a bIUl like:r IIl-


House of' Pans~ anid fid thems-live III -urr..r .II,.j-
intgs that o~nl-e wre !lih~ e ldirbt .st a1 iinalidrir ar~i-.
tacracy.
"Tell me snmething abs..ait ra;Ilcls her.--" I s~l
to Mr. N~athan, as we~ paced, rthe mi.aii rl.....r

... '..2 2","',"an '',' ,' Ie 02.',' I.'.: ci'...,', ..',

until eleven atl nlJIIht
'1I mIust havie I<*>.l an~ illlrnmen .: sum lof nsors1.1
to build." I said
Ilt did,"' he Irpli-il withl a --ile. sind r..Ini rn"
Sthe amount .

would you prefer to return. "
I told my genial civerojne rbat I n~..uld prolbabl\
Teturn to the theatre ain tile f~,lh~l..ngr day. .nd w..u1l1I
algovrisit the other Para~mllunt theat1ri S inl New~ Y.~rk..
A~nd some other picture pal31 e, not Paraml.un.;un, ap
with the object ofI seeing fo~r myself thle atractic.I. ~l
hic~h these plates cxerl:lsed ..o thle Newi Y..rk ppil-
.1Ation. ,
Iln the meantime.'" I amiltin~led ar .r~-J
that you supply to Janlnawa ~...th.rT pictullr(- inr--vis-
those you make yoursel< "
"Of course,'" said Mlr Nathan;: *Par~nilnt .Iant ma--
between sixty and sev~enl! le~tute=: r m.lr. anll II
maayou change thp play .l ....tenl that nllr ..w11
0adnot be half enojuph. uth..r p rr
we need and distltbute Ibrnm tl- ther IIIn.I.t.~ 4 ill
irhich were connecterd. but in ...ir..nn\ I ~lthrre ..i
New York, Brooklyn and Lo-ng lulandl wer ..f~ .ur: >
hoour own films excrlisivli "
A a matter of fact the Jamal..a thearre-- a1re .up-
Itdthrough Paramou~nt Pubrlix nalh pistre-,: mad j~
Fox n er io.,Th eFir 1 .11.na~lli. IAlerr~- ~..G..i: .si


.











































































.


--193:1-:32


P L AN T ER S' PU/N CH


15


were accompanied by the orchestra; for in the
great theatres of the big American cities one does not
hear mechanical music. This was mass production
of amusement with a vengeance, but the pictures
were only a part of the amusement. I frankly con-
fess, however, that it was the pictures that I appre-
ciated most, and I believed that it was the pictures
the audience cared most for. I do not think that
vaudeville and the rendering of popular music would
draw by themselves half the crowd which the pic-
tures attract, while the pictures, if of good quality
and appeal, could certainly do without these acces-
sories.

STis diffcult to institute a reasonable comparison
between a New York picture theatre and, say, the
Palace Pic'ture Theatre of Kingston. Here, with our
brilliant perpetual sunshine and our open-air theatre
we could hardly have day-time performances, though
we do have matinees at the Cross Roads Movies.
Here we build light structures, with, mainly the
sky for roof, and our music is the mechanical repro-
duction of an orchestral performance in New York
or Hollywood. Nevertheless we too, in our open-air
moving picture theatres, can give a glamorous im-
pression of gorgeousness. Nature helps us. Indeed,
nature does the trick for us. The breezes that fan
our cheeks are breezes from the northern hills, the
little lamps of gold above our heads are the stars
of heaven. A wave of happiness seems to sweep
through our picture theatre; it is an emanation of
the people's joyous spirits, an expression of their
bubbling hilarity, the welling up in each one
of a feeling of contentment. The emotions of each
of them affect the whole, the music, though of a
mechanised description, is usually excellent even it
sometimes a little too loud, the audibility of the
voices on the screen is usually good. We are not in
a backwater in so far as the pictures are concerned.
So that when I found myself, on my first visit
to the Paramount Theatre of Manhattan, thinking of
the Palace Theatre in Jamaica, I was peculiarly con-
tented, although I knew that not in dreams could
we have here a structure of stone and marble and
plush and gilt, with scores of living dancers to per-
form in it and with a huge orchestra to render the
necessary music. 3Even apart from the financial out-
lay, the conditions here would make such a structure
with its accessories unnecessary. And I maintain
that tthe pople sherte wou d hvat- ot the vaudeville

par of the daily pao iammeme It sthel pcures they

drama which is an illustration or a criticism of life,
that they instinctively crave for. All through the ages
men and women have hankered after plays, comic
or tragic, portraying some aspect of human life. WNe
get these now by means of mechanical reproduction,


Tiffany; and Mr. Morals has told me
that every ten days an English picture
comes to him, for which the Jamaica
directors made special arrangements.
The Paramount Publix Corpora-
tion is connected with no fewer than
~t:two thousand theatres all over the
world, yet it does not hold a single
share in the Jamaica theatres. The
Jamaica Palace Amusement Company
is not only a Jamaica institution, but
every share is held in Jamnaica by
residents of this country. The arrange-
'r ments made with the Paramount peo-
ple, by which .has been secured a large
number of the best pictures produced
Sin the United States, have been in.
strumental in keeping us in touch
with the latest developments in move
ing-picture production,


visited the great Paramount Thea-
tre. The thermometer stood at some-
i~i-thing like 88 degrees in the shade and
when the taxi in which I rode stop-
ped in a traffic block for two minutes,
4C I felt as though I were in an airless
cubicle, with my head throbbing as if
a vein were likely to burst. The heat
had descended upon New York, a heat
wave beginning somewhere in the mid-

e* dle west had swept eastward, and I
who had travelled north to escape our
tropical summer was experiencing
f' something much worse. But when I
got to the Paramount Theatre and had
passed through the big swinging doors
into the gorgeous vestibule, and
through the inner doors into the audi-
torium, I suddenly found myself in a
genial spring temperature, with a de
licious coolness bathing my body, and
the darkened interior restful to my
eyes after the garishness and glare of
the heated streets outside.
I Hp In New York, as in London, the
moving picture theatres are artificial-
ly warmed in the winter and cooled
Is o~nemfo Insi et efone f tdhetmoyou can escap

!I hr"ned ,oa lhr the speds eno i tehe sumsm r
t pl ..ro-play or a vaudeville performance.
flile interior of these great New York picture
rlhostles--the Paramount, Roxy, and the rest--sur -
I~a:-a- easily in architecture and decoration the in-
r-rll.r of the "legitimate" theatre. A critic who be-
il.i- in very delicate shades and
rn--- may say that these picture
!***1.r. Fs revel too much in colour, ap-
[*-.r1 too strongly to the cruder emoc-
rt..aslal appreciation of the crowd. But,
!r,! all, that might also be said of
!lhr decorative effects of some of the
lear.-st of French palaces, with their
I nt ed roofs and mural embellish-1
n!l Ir., their marble columns and high-
1.1 nc.11lshed parquet floors. I ai my-
til ;1 lover of quiet effects, yet I conl-
trc- to having no aversion to the de-
**Drive scheme of the Paramount
Thatr!e, and I know that it brings a
rr- Ins; of joy and exhilaration to the
Intll.~.*ns who make no pretence to a
linehnl aesthetic education, but who
in I IIIassionately to enjoy themselves.

WHAT sikesdtihesr angethalso is
L'.I.milne presented at these theatres.
The, Ilief picture exhibited, the feature
Illlrsle of several reels, is but one
Itr~n of that programme; there is
In..a~lly a two-reel comic piece as well,
as~I. 1. f course, there is the picture
no -i of the world, or pictorial news i
I~lill-rin. Yet these are but about two-
1bIIIh( of the programme. In the
8 sy.? Theatre, for instance, I saw the
ni1.l spectacular parts of "Aida"
.' I!k'c*ed on the stage by living actors
Sivd1I~~ in the customary operatic gar- Ii:
nt-.1I of diverse colours and singing ~'
Ibe jl accompaniment of an orchestra.
;;ii I must have contained between ;-. -s
iiiand forty instruments. In the ,
Pol i Inilount Theatre on this day of
ir liI. II I write there was quite as large
.,ri .1-chestra; there were humorous
*Illal~~ues by well known artistes, and
..a~iviledancing, and amusing
liet..es. You got, that is to say,
.ntailriting like what you get in the
SI~ilary Music Hall. There was also
.I [s-1formance on the great organ by
:In ..egXanist with a considerable re-
I ll:rtion, and when' the moving pic-
rnr'i came tohbaed shown, ttlhe smro e An exotic s


11.1H I.E l l: D II. I H li II. .1 4. H L 1 1 [ 110 1 1411.11. .it







PLANTER S' PUNCH I


on such a vast scale that all the world may see them,
and though many of the plays are poor there is a
steady improvement discernible-

Nthe forencon following my visit to the Paramount
offices, a young fellow called at the Roosevelt for
me and my party; he was taking us to the studio at
Long Island where Paramount makes some of its
talking pictures. This was nearly an hour's ride
away, traffic blocks included. This studio, which I
have seen described as "The Paramount Famous
Lasky Corporation's Studio at Astoria, Long Island,"
is a big building covering a large area, but apparent-
ly not more than three stories high. Admission to
it is not easily achieved; strangers unaccompanied
by one of the Paramount officials, I am informed,
never get beyond the porter at the door, and when
you have passed through that first door there is still
some other functionary to demand your credentials.
For here time is p precious; noise at the wrong
moment may mean serious loss; too many outsiders
on the spot would create an unwelcome diversion. So
a, special official of the company, already informed
of our impending arrival, appears in the entrance
hall and takes us under his wing.
He leads us through a narrow way into the
studio-
"And when you hear a bell clang," he says,
"please stand still and be veryi silent, for that means
that they are "shooting" a scene upstairs, and any
noise we make below may be heard above."
At that very moment agong clanged rapidly, and
we all stood frozen like soldiers at attention. No one
even whispered a word. Not exactly understanding
what it was all about, I endeavoured to abstain from
breathing but found that far too inconvenient. Pre-
sently the gong clanged out again and our guide
relaxed into activity and said that we could go along
now and see things until another "shot" was being
mov n I ay elien t tom eo whohd no' hunder-
America does not mean a drink, as it does in
Jamaica, where we shoot pretty often and with quite
satisfactory effect. When at a moving picture studio
they are taking parts of a picture they are said to
be "shooting" it. But had I not known this before-
hand, and had been suddenly told in the studio that
they were going to "shoot," I should have shot like
lightning out of the internal place, since I am pos-
sessed of the immovable idea that shooting is a dan-
gerous process and likely to be unpleasant to middle-
aged literary people.


I T is out of the question that I should successfully
convey to my readers what a moving picture stu-
dio is like. To me it looked more like a junk shop
than anything else. I had to walk carefully to avoid
stumbling over cans of liquid paint, walking too
heavily upon slippery sheets of quarter-inch iron
colliding with vast movable electric lamps of what
seemed to be a million candle power, and bruising
my nose on bedsteads or bureaux which were shortly
to form part of a suite for a magnificent bedroom in
which some beautiful Princess of Filmodia would re.
ceive the news of the defeat of her valiant troops
led so gloriously by Field Marshal Runaway. I never
saw such a peculiar medley of objects in my life.
Only the pen of a Balzac could describe it.
"You see that corner there," asked our guide,
"with those couches and chairs, and the pictures
against the wall?"
The corner indicated formed a large right-angle,
the floor of which had been covered by a carpet now
rolled to one side. Some of the mural decorations
had already been removed, some of the furniture had
been thrust aside. The place, such as it was, looked
drab and dirty. But-
"We took a scene there, a drawing room scene,
not long ago," said our guide. "I think it was a
scene in a palace, which will look quite wonderful
when the film has passed through all its processes.,,
"And the exterior of the palace I asked, "earl
you make that here too?,,"
"Oh, easily, if necessary. Or if there is to be a
large garden in front of it and movement in the gar-
den, we may build it at the studio in Hollywood, in
the open air, or we may take an actual building
somewhere in the country.
"How do you reproduce the interior and the
exterior of a place like the O~pera House in Paris?"
I enquired. "I have seen many pictures of the Opera
House on the screen, with people moving up and
down the great stairways, and walking along the
splendid corridors, and it seemed to me that you
had the Paris Opera House reproduced to perfection.
On the other hand, it must cost a lot of money to
collect large crowds in the Opera House itself, as
well as to send your actors there."
"We can and do reproduce any historical build-
ing that we need in our studios," was the answer I
received.
"What we do," continued my instructor, "is to
take a number of "stills" of the building both out-
side and inside. These photographs are faithful
and perfect representations of the buildings and from
thmo e anc t onstrine, onurmy scale we like, any


go to prison to escape gangsters who are after him;
he has done everything possible to invite arrest, but
the police have ignored him so far. No~w he is going
to beg at a stand in Fifth Avenue, knowing that that
is strictly forbidden and in the hope that he will
go to prison at last. He is disguised as a blind man
to put the gangsters off the scent, and is being led
by that little dog which you see him holding by a
leash."
"So that is Fifth Avenue!" I exclaimed. "I
should be very pleased indeed to come here, if you
will let me, when you are giving a representation of
Heaven. That would be amusing!"
But now the gong clanged out once more, a whis-
tle sounded loud and shrill, several voices sharply
shouted "Silence!" A deathlike silence fell upon the
scene, and then the voice of the director ale t--\ he
emphatic order--"Speed!"

ABOVE the little strip of studio pavenl* ulr lus*I1
been erected tremendously powverfuil els-.-tr~i-
lamps, all pouring their intense rays uponl 1II- let\I-
ment, and the glare of other lamps wtl, dil~.r,..a
towards the artificial outer wall from djlthiant ;I!!
ges Thips was t iee atofiirnsd li nt wh th h -- M:|.1\:~

rays of the sun in making Jictures. Thell 1.0.. .II-.
Mr. Charles Ruggles with his attendant andl hi- Irlitl
blind-man's dog. Mr. Ruggles presently -Ir'evrll *I ..
to the pavement, which was lifted about 1t ini..e-
above the floor of the studio, and preparll ni rll~tlr
to be led by his dog. But the little bea-r .0,1 Il..r
want to lead anybody, and especially noT .\11 it:g:
gles. Instead of going forward it turnell .Ir II,!hr
angles towards the edge of the pavem!!r ThenI'I
someone on the opposite side beckoned to it -;!,-ate;
and it obeyed the signal. The celebrated Inanlll..rl..-
actor, now blind for picture purposes, shorth.1~ hs-
few steps along, his stool was placed for him 1... br,~
assistant, and he seated himself to beg :. h
scene had not heen satisfactorily taken. T-ri...u
gave the word that it must be done all i.: -1 I.. .
Therefore again the same process of walkin.~ .I.0.1 ..r
~being led commenced, as soon as the ...E1 is ..t
clanged, the people had cried "silence," .rll.1 rhe.-
director had shouted "speed!"
This time, after a step or two, the dog rr 1 IIl.l. 1:
wards, and for one brief second the blindl naI.1I st:l-
leading the dog and not the dog the blind lintra Tlill
halted the proceedings, and again the tedr...~- I. tinc
commenced. Meantime, the wooden thill .I lul\
back was boring into my spine, thus (Irs.llranC In
my body the utmost discomfort, while the~ cl:..rric
lamp structure in front was obscuring to.~:! al
view the face of a very well made-up yo~un I1.ras-
who stood somewhere in the middle dust,m..., In~
the left. Thus what with the pain in mg- b~.l:ki alrd
the partial obliteration of my vision, I was is. rlllts.rse
to wish that Mr. Ruggles would die anil Ellast 11..
dog were dead, and that I had, restrained rni. ~.. Ir.... .
ty to witness the making of a talking pietli!r~ li.n,
ever, after about half a dozen trials, the Ihin. ni.-l
done to satisfaction, and then I gatherral r!int I!
was to be done once more for further so rs c.I. rIn ,l
ars mhoed away with hel ret at the rI.,~~ !.al
ing picture made would be destructive I.:. r he ein-
joyment of a play in the case of the mainnry-r? ..!
Dicture-lovers. There is such a thing a~ kis..u a~rc
too much about some things. "Where ign~~.ll.r a ..
bliEss, 'tis folly to be wise," said the poet (;la.'.. and~
he knew what he was talking about. Th~e liln-i..
of the screen is what the pic'ture-goers want, no.r ,|,4
reality of the studio with its wearisome re-l-t~ir*i !.
rt artificial 1reperod cieotnos, ansperaspi itngF :lnts~i..

mn oeotdboring into yours iek whlh tant~lr a ..
ject in the room that you wish to look uponl.

THE lunch-room of this Long Island Srn.3,,, v;.a
Crowded. The lunch is provided by thle I:..rp.:.r-
ation, the food is plain, well cooked, and rd.-nrlt'l(
A good lunch there would not cost you :i..soe rlann
seventy-five cents, but there is nothing luxur~i..uz
about it. The star at hundreds of dollaij s aat
lunches along with the ordinary super at a fewn d.:.1l
lars a week, and there is also a lunch coun~tel r Il-r
you may get your sandwiches or a helping ..f rnuse
thing at a still cheaper rate. In this room ovrih...J~~lr
laughs and chats at ease, is animated and reclaxed,~~
within an hour the feeding is over and backe is. .<..rt
goes everyone. And though you may smo.;e in ,!il
lunch-room, not a cigarette must be puffect inl au.;
other part of the studio's interior, unless cat e...Ilrk
during the acting of a scene if smoking Is .1 ica
ture of it. They vigilantly guard against ril- !n
these studios. They know what a fire wealll. Ilcn-n
to them.
After lunch I went back to the city. I !ia~l!.i1 Ma
an interesting experience. I had seen the makrra1. ..( a
moving pictures before, but the making of .i tallki~e.
it seems to me, involves a far greater degree *( i nlllrea a
scene-taking, while voice reproduction has~lll~ III.- rra
difficulties to the work. For the techniquer ..( ;le' q
talkies is different somewhat from the tech*il~l~~..l' -.h
the silent pictures. The introduction of th. I : 1 o
word has made aodifference which will m .e n: rc llrb I


"D UT your scenes of a ship labouring in a heavy
LJsea," said I. "I know, of course, that you cannot
possibly photograph the exterior of a great liner with
the waves dashing over her decks ill an actual storm;
for you and your precious camera would also be
in imminent danger of sinking. But I do not see
how you. do the trick: perhaps because I am not a
reader of the moving picture journals.,,
My friend smiled. "A toy ship on a small sheet
of water, with waves artificially stirred into billows,
can be photographed," he said, "and that photograph
can be magnified to any size we like. Then the rush-
ing of people up gangways and companion ladders
and about the decks, represents, as you may have
noticed, only a small section of a ship at any time.
That is also a studio scene. After the different scenes
required for a shipwreck are taken they are joined
together, grouped, edited, and produced as the plan
of the director requires."
"I see; you get the necessary illusion by a
planned and completed combination. That unity in
variety, which is one of the requirements of art (ob.
tained in this instance by mechanical means) is--"
and I was just beginning to enjoy myself by giving
a learned lecture to moving picture people, explain.
ing, so to speak, their own processes to them, and
no doubt explaining those processes quite wrongly,
when that miserable gong upstairs clanged out again
and cut short my rhetorical pronouncement for ever.
Again we stood silent for a space of five or six
minutes, and again the clangorous signal rang out
the intimation that ordinary work and talk might
now proceed as usual.
I had noticed that the moment the gong sounded
all the workmen, the carpenters and others, on this
ground floor of the studio, had, like ourselves, ceased
to move or speak. "We lose a lot of time, which, of
course, means money, by having to stop work when
some talking scene is being shot," said our guide,
when the signal was given that there might be noise
once more. "WCe may have to pause several times
during an hour. But we have built a big compart-
ment where some of the carpenters c~an work all
the time making the things required for the
scenes, for when those doors are shut no sound can
escape from within.
"Would you care to go upstairs now and see a
scene shot?"

SP narrow steps which no two persons walking
abreast could possibly negotiate, we climbed to
the upper story. Some workers were pulling a pri-
son apart; that is to say, they were removing the
bars which ran for a distance of forty feet, and
which stood before apertures representing prison
cells. When you see that prison scene on the screen
you will imagine that those cells stretch along for a
couple of hundreds of yards; such will be the illu-
sion created. But as a matter of faCt the greatest
economy in the utilisation,of space and material (azid
of course, time) has been practised. The moving
picture people do not go to prison--(some of them,
however, do go). When they want to take a prison
scene, they make it. But they may give you an ex-
terior photograph of an actual prison; such photo-
graphs they can take with their camera at any time.
Their interiors, though faithful representations of
existing conditions, have to be made by themselves.
"Here we are," said our guide, and we entered
a sort of room.
I found myself wedged between a narrow wooden
frame of some sort and a big stand crowhied by an
immense electric lamp. I was standing on some
sheets of metal which rattled when I moved, and the
ground about me was littered with all kinds of
scraps and rubbish. The rroving picture director
was sitting behind the cameras on what seemed to
be an old soap box, and a young moving picture act-
ress, with lips and eyebrows heavily painted, was
perched upon the back of a chair. A number of
jacketless persons were standing or leaning about,
and to my right was an oblong strip of pavement,
looking like concrete slabs cemented together. Behind
that strip of studio pavement rose a polished surface
some nine feet high, looking like the outer wall of a
building.
"What is that?" I enquired.

corne is ah scene s owing sCharles Rueggles at a


1931-32























































;c)


.

























































cl










.1-
S.




d;
Irk


rse





in
an
of:



ult

Ithe


Irk


believe she 1-, --pe~kinl thle rlulrh. He' retir~le w'ith

we determinrr tlj h5..i ~-rtvence 11!.>n Int.-a p -->.li br*.l) 1'

at home at the timie adi nurr aallrn*-
80mewnhat ;imla r wo-, this \wates~ -, experiincll
When, one day Inl June last,. between thle br..ur
at O nine and trn InII Il ni.. m! 11 1!-. I Ian lls In

p ersonalities ofI 3i10nite.. B 1 Fl- dsi t Cl-

Jarrett had go:ne ..ut ruliln~ !...und ili- Ilplrp rn.. and


. posed of.

whe I was h Munltego Ba.\l. MI Ierart w-.

lea #lled at Cather-ine Hnll ab..ait mseilda!, lir Kr.
I'Jarrtt had just tinishedl its- b~le-ska t I t~reus
ci~oncluded that a rathana~l lnney? Ior thle Ituati~ls
.wudbring every imnprtial perl-cr t~ lll \'e\ rlewthat
AiKerr-Jarrett spent theI IlIo.' 'of. id' II..uchII'.
seven to twelve, consumnlgl blrealislt Thle mlan
edto have an insatall. Ie ppethel fo~r b~reakfast- l
Asto speak, he livedl at h19 b~leak-iagr-labl Coc.
gaal, hen a little later in thle day I r'EICj\ived an I
. wthMr. Kerr-Jarrett as soonlr as I 1. uld. thle fina
ige tionha I asked oin th.* telephs~~nr wasn wehethe
ras still at breakfast Thlis was ab.~ur **ne
:lac the afternoon. The answer was3 -n"L1:'; but
gathered that be was just then cu~nreeplating tel:
at the moment oc~cupie~d a p~r~...minentl ps.-itio:n use


PL .1 .1 T E' R 8'


PC .'s r..' H


1934


..n *- -udm 11, ~ F leta ler had been in1
shone.II rnl, n..i n~~111'' In l Ilsad left aboutll half an hour

p, i I i.w r I eligillured sweetly. She

NI.. i Iln1 rII. sk -..' s- it' tha~t settled the



i l b.II1 11.~ Il .te hImI1 li I cgalliere d thatlr Mr. Fletcher
ur~;1\ \\1 1. 1 R I~ 1- Illt *LY e bF r.~ e lunch, and


and11 Il\ra 1.. wr~it Iite. un I I vanl *.rters-si rli:it r*.s




a .11.1 P!.'I~I\ ja 11ltl l 11 lnla
..*lnrr ad probalate lael' FI r .ur n n i -*m


-i
-ra,
,.,~


''" iO..
,,

: t; .
L~2~..
:r
~.


II.,',~:.IfHI\ 4loII ~~:~~TIONf(lE;-.0Y 111 .li I .1PPFINE 1rOU f1UY 0


Ir. naII ..e-la;in~ tim~e tol I:omeii aslrusj him would be

Saritisfil thr thenl~ ias: a possibility of meeting
Mlr. Fleteliei Iher t ay [1I rs.kkedl ..f to see Mr. Ed-
man.II] Har~l !\ll*. HdI' ll 5elet~. fllll Mlr. AllanJ Hart,


full, urbane ill ls.~1I 1...kn, I 0- l hu u no1 ~ 111'! W sheartua ,
buiric nll jllain-.11 pe Ills- li- l..li ..rI sh udade dieat
.. .1. lerr l Yll-rni a Ii Il- .-quaninill.ly, Lt o pree te me i

\qus iet niliel-1 but Ilnlgar Ilied la. -0;* that hi athe
wa noIIII. I t I:I in l'Ilr i r ~lt be r .n that dy? Was he neart
or~P1 far I Mr Albree I~at' wavedll his~ avrm pslowly sym-
holie 1tllly ~ :i a lhiri;ne a ~ ? coaill all tin thou and mies
1 gathera~ll finar 111- -oil -one lite x a ato ha r

work. IIs..P sail~e s c.ll- iine prp It.1 ..r somen pherson, an
was-~rri L n otll likel r.emnate hainl labours ha day.
I ieathered! fllllluer he inac he anywld hee vauing butoTT~
in~fr t he wu-, .iilg s~erts in l e -..moubere ill th ie world.
the Rl.nr~. *Ple o Mrlnre;; 1nly :~Ilr any time hat one'
m~fightI really wan t.= --weilr them ie rsec. n
Il Ii roplr?..ked thrr..Ir- bc the I..r r M. H art's so t one.
dle-. ther were'k. soe folkf tra nl.* -Penh in thestes

Ligthosly.~n I il.,ntlly he i wout~ld ei hseitra


lan. Was .Tra rrErCHER. ONVE O)F BONTEG.0


at G3reak cas t


e/f on tego Bay r~


Lunch and Wrorke


A NonrTsmaE CITY'S


PR OGR ESS



fi1 H. G. D.
W E are I all au nllt mei vrbi (ihat peciuliar. 'In.-
W tion Iof rnialin a; rel! when w~e oIl at i b.i ~i.

but obvio~ud.1 unltrunnllll rnial.I !lht N..~ <.ne i: .
home." 11'e enlds-ar ..url rn~ .--uil- 81 (.[l..pr--len f
credence. and eutn r.. thec niald we preCtend that *1-


-'-5~-7
;; -~~. -
"'0.": ::4~';
Il~s~j~-~ c;f~x.i :-':, i-:
.-- I-
c..~j c~ I --i:
s~~C~pc~t 'KS--' ';- ;
i;;'",6~;~~~- .
:'' ';' .








PLANTERS'


PUNCH


1931-324


"C OULD you inform me," I enqluired with scrupu-
lous politeness, "whether everybody in town
either breakfasts or sleeps or goes on journeys before
the afternoon, and spends the whole of the forenoon
doing that?" Again I seemed to have puzzled the
natives; again Montego Bay must have felt that this
was a strange creature arrived from Kingston. But
the lady answered me patiently. "Mr. Lightbody,"
she said, "was away in Kingston yesterday to attend
an important conference. He came in late last night
or early this morning; so he is not yet in the office
to-day."
"Ah," I said. "Yes, I understand. It is a con-
ference about the New Constitution, or the Old
Development Committee, or something of that sort.
Very well, please give the editor my compliments and
say that I called upon him." And now, I thought, I
will go to see Mr. Eldemire.
I was going in the car towards Mr. Eldemire's
establishment, when happily my chauffeur caught
sight of that gentleman travelling rapidly in the oP-
posite direction.
"That is Mr. Eldemire," he exclaimed, and im-
mediately I rose to the situation.
"Pursue him," I panted. "Follow him if you
break every speed limit in this town, where every-
body seems to know I have arrived and everybody
is doing his best to avoid me. The secret is out
now," I continued. "It sis a scientific impossibility
that everybody whom I want to see should not h~e
perceptible to the naked eye."
So we tore after Mr. Eldemire, passed his car,
blocked the way, and signalled to him to stop.
The poor man may at first have felt that this
was a case of a hold-up by a motor bandit. How-
ever, he stopped his car, jumped out, and we had a
conversation in a drizzle. I had now been in the
town since the afternoon before and had met only
people from Kingston, with the exception of Mr.
Eldemire. I felt that it was about time to go back
to my hotel, there to wait for the appearance of M~.
K~err-Jarrett
Rain no~w began to fall in torrents, and in an
hour or two the gully through the town became a
torrent. The populace assembled on either bank of
this torrent to shout encouragement to the rushing
waters and to suggest to motor-car drivers that they
should make an effort to cross and be drowned. I
fell asleep with their distant shouts still ringing in
my ears. Then four o'clock came and "Enter Mr.
Kerr-Jarrett." We talked until six and then went
out together. I called it a day.


THAE next day all the citizens seemed to be at their
offices by daybreak. I met Mr. Edmund Hart,
who preached optimism to me. That was strange,
for I had always taken hinfl to be a pessimist. I saw
Mr. Fletcher, who collared me with a firm and mas-
terful grasp, dragged me over the land site of the
proposed railway and deep-sea pier, and then took
me to the Bathing Club to see what a beautiful place
it was. My work in Montego Bay had really been
finished the afternoon before; this inspection of the
town's amenities was supposed to be a pleasure. But
as it was raining cats and dogs and I had left my
umbrella at the hotel, I became gravely doubtful of
the pleasure.


INTERRIOR VIEW~ OF PORTER STATION ST. JAMIES UTILITIES, LTD., MONTEGO BAY DIVISION, SI11,n -
ING 200 B. H. ]P. MIRrtLEES, BECKERTON & DAY 4 CY'LINVDER, 4 CYCLE DIESEL UNIT


But Mr. Fletcher knew well what he was about.
He insisted that I should see the Bathing House. He
also wanted to show me the chart of the proposed pier.
But here I was unalterably firm. I assured him
that I had no time to study charts; I swore that
there was sickness in the home. That did the trick,
and now I began to wonder whether other Monte-
gonians would sweep down upon me and carry me
away to show me the cemetery, or the newest de"
velopments in Panama Disease. They were bestirring
themselves now with tremendous effect. They were
seriously getting awake.
I now found, indeed, that I had to apologise to
the town. Mr. Kerr-Jarrett had violently repudiated
on the previous afternoon my suggestion that he did
nothing but breakfast. He pointed out to me that
in the morning of the day I had rung him up he
had risen between five and six by the clock and
gone out to inspect his plantations. It is true he
had returned home for breakfast (a procedure which
he firmly defended) but after that he had gone into
the town to see some people, and in the afternoon
during the rain storm he was at a meeting of the
Building Society. Then he had come to see me to
discuss the potent topic of rum and its relation to
general well-being, and that discussion had occupied
at least a couple of hours. Mr. Fletcher, too, had


really been looking after some important m.lrrt-l inl
the town when I first called to see him, ad 11r~I
Edmund Hart had actually faced the perils ..t rl....si
ed roads in order to accomplish his valuati..n .11=
so forth. There was none who could nor ar\ ea
good account of himself.
"You see," said one man, "we work in jl1..n's --
Bay. We rise early and we toil late." I ..lr!!r..el
from this gentleman that they proposed rn in1...li.
iMontego Bay a model for K~ingston and ev..c-: I..-<:1
of the island to follow. I harle them go ah.. v~i 1
I can certainly say for these people that no- ~
really on the job of improving their little cit'TH-
have been on that job for scme time; and Illr: i--
going to succeed.

SHE first night I was in Montego Bay tl::- .irl I
Drove through the electrically lightedl 1: ll- '**~
the moving picture theatre, and on the follow in~ nlcht:
I gazed down from a height upon those samre -ries:1-,
noting with pleaszlre, as I had done on a talle\ieni
occasion, the illumination below. My mind~ v~cl-n
back to some ten years previously, before in.- lion-
riques Brothers had inaugurated electric lightingl inl
Montego Bay. How dark and dull seemed 100e ruill
at that time, with but the faint gleam from ~l.-l..ilne
lamps emerging from half closed windows,'\ v.Ih ~..ni'
one or two of the main thoroughfares lightled ann.I-,
the surrounding darkness being rendered -b~n;-lc InI
consequence. I remembered how there waF 1Is.r n n
picture theatre, only a tiny Club House, no Itarbin:l
Club with anything like adequate accom:n..sists..1,l
Montego Bay was a country town sticking rn fl.s
ancient ways, or so it seemed. And those v,.~.; i- LL'r
'very ancient.
But even while Montego Bay seemed -rlI... ii
was moving towards improvement. Its a? .ellrrling
had really begun.
Mly mind went back further. I rememli...re.1 1ile
town. as I had .liai~sed thbrough- it in early 1...;< is****M
At nine o'clock at night it was pitch-dark ai~ler Ils:.I1-
the curfew sounded early in the hearts and het.lel- **(
the population, if not in their ears; ther.- \ua1
nothing to do after dusk. As you drove th ....ell. .IIn
streets at about eight o'clock at night, w f ll .I r.-iv
starveling dogs yapping at your horses' kl...-1- 1. u
-might glimpse a few figures moving furtivel: .r1....11:
but the people as a whole had already ret~lco.1 .5II1
perhaps even at that early hour most of the r..v ii v..ss
asleep.
Go back still further. Go back a hund:.-d !eur.I
The topography of the Montego Bay of thilt Inu- i
shown in the! first illustration of this arth [ 7 l s
Bay; itself was as it is to-day, but a score ~-i ilill-
ships were lying at anchor in it, waiting n..~ ic~lbt
for cargoes of sugar and rum. The town Iloriledl
along the right curve of the shore, witll ri..1st
wooden piers jutting a little distance out int.. E 1I-
water, with the business offices, the stores, the --h..l. .
the residences mainly of wood, with a fer w l r
houses perched on the summits of surround ilin s. il I .
these being the homes of sugar magnate 311.1 l
considerable merchants. But while in thl Iini rel~


differences. Even in the illustration these dl~iferenles
are indicated.


3: 'ANMONTArUCOWonPRESS(IE AlND CONDENSER ICN THE ICE PLANT, T. JAMES UTILITIES LTD., HONTEGo
HAY DIvIVSox





PLAN T ER S" PUNCHED


OFr~l( 1:.\L .1D OWEB STATION BUILDINGS, ST. JAMIES UTILITIES LTD., MONVTE:GO BAY DIVISION, SITUATED ON ~IIARKET STREET


growing so rapidly that it is proposed to increase the
output by the installation of another unit.
All the streets of Montego Bay are now lighted
by electricity under contract with the Parochial
Board. The private plants have all been abandoned,
and the hotels, residences, churches and public build-




quickly than Kingston did in its passage from dark -
ness to light.

NJamaica ()ur history in the matter of lighting


but Idfe ent f m thtofoCnro hme ica f
C nral America, isethe lavish use madeer ere of oelzc

were buried in darkness after sunset. In all the
houseselier sene cit wasatile onnlyt sllmiat re ch

still grows luxuriantly electric lamps shed a bluish
white glare upon the scene, and in shacks such as
even the Jamaica peasantry are learning to discard
electric bulbs have displaced the tin kerosene lamps.
T tac idio ehaesr meeesuddenly, abruptly. It is

But in Jamaica only Kingston and Lower St.
Andrew, Port Antonio, Montego Bay, Spanish Town-
and Black River are lighted with electricity; in Port
Antonio the United Fruit Company long operated an
electric light plant, mainly for its' own business
purposes, but also supplying householders with elec.
tric current for lighting. This plant has now been
taken over by the Public Service Company. But in
the matter of the general utilisation of electricity
Montego Bay, which began to use electric lighting
only after Port Antonio, Black River and Spanish
Town had been doing so for s'ome time, stands se-
cond to Kingston now. This is an indication of the
spirit of Montego Bay; it wishes to be bright; it looks
forward to the future. And while it buys a large
quantity of ice daily the St. James Utilities, Limited.
also supplies frigidaires operated by electricity to
the hotels and to many of the larger residence:
in and around the town. Thus coolness and light,
and facilities for preserving food for days, are Lvail-
able through the St. James Utilities, Limited, and
if Montego Bay ever instituted a tramwvay service
though that does not seem likely at present--it would
be the same institution that would provide' this con-
venience.

ONTEGO Bay is growing and will continue to
gro-w. It may seem a small thing, but the new
Club House, with its golf and tennis grounds, that
was in process of construction when I visited the
town this year, is indicative of the forward-looking
attitude of its leading people. When Mr. Kerrl-
Jarrett insisted upon taking me through rain and
slush to see this building, I had no particular wish


to go. But when I got to the spot and saw the
large structure that was being erected, with a floor
space for dancing which should be able to accommo-
date some two hundred couples, with a situations
from which one could gaze down on the dark green
of luxuriant banana fields, the lighter- green of cane.



zhens ofthisd northsie city toe putu oteof Baymore
daefinaintly upn the ape tha cithad bend befrpe b

t e gl b d su rhnk eng es oar o a ngr a~o ds
r~ealsdy ctomne ed h e towas inc Mon egort aynd 1er
yheapr Iws certain rpleaseed to se mit.o ofThe ciutra-
to -da etndskeogv no deqateide ct optMneg ay <4 e
comfortel uof Clu memer tand viitos Da eeornsair
th necethssaro benhen and rak for te aning of,
cloths winh additiontchere t isi ah comnal room of

rampl rcomlmr d n e sa iatl rn Mnen o dom n itd s
an Idd undress; and there ahreug al then rehaters


Upos tairs is the reception all, whic ise alof a
ballroomt can pableof accomgmodatin smaething lie
threea hunred couples. On tiles, eawa rd ided ofths
balrom opesar en to the ler.c hie rezso the sean
clommanding a viiewof those gla orios unsetso ofr
which thmens bay of the mow i amous ado looking
downuponl thae cryastecal watersigof o the batin bech
san verndre;ahd where scres ao~f p.pe ma sit wand
enjoy efresmet and partthngipipate in thceand mus-
ment ofe converstion ais xiaatn uru
ing ais s enene edy ar aetind skand'wic sea. s
They h avabe done reomarkableing smthe building
ofthise hnde pew Batin Clbhose beteawrd ie thanI e
thllought pe they would hav dne Ires whe they weetalk
ing about it. I eieve othey ae glorintou do remark-f
ablywel alowit their prsalwtr~ojecthed ptier the bi
comm ercidal ventre fo hc scr of much~la is hopd i
Monteoy Bayehen and~ throughotthe pais~he of ~St


ins EN Monteeo Bay mirandesk upd is mi o et
VV dep wateoer piemra itl wetabu the business
w thi energy Then ClateHon.e W.Coe Kerr tooki upv
theroject; any od it ae truly bve si that hee died
worin fbor it. Mr WaleeteFlthe r r gonext d earttake
they prooasiton.H workedei haroed tor ociathe the
coppoentsa of the scheme butc it must besaiopd for

MoEnteg nto Bay that the opoiion s mnot to ae de
depwater pier, bu a t wheret shotil bhe o snsrceds
and through wan t parto the town shoud th he lines
connecing f the pir. withter Government Railwayk


HE Illumn!eg:l Ba.\ I-1 the present time is, like
Kingstojn. a plac71e If atnall yards, a town with
the house-- atra. hadi 1.. .ne another and running
Sin blocks O)n thle ctl a-.tion of Montego Bay there
are no~ lcong~el r wide -ae; amidst which the buildings
stand, withi Ireei andI1 entriens about them.





backyard In awlanib !Ire- would grow spontaneously,
and here and therec ii rthe unpaved thoroughfares
grass spr..utel free-el. Though even then dignif a




dys tH bn it I~ili- l tatstFalmomt w ulod pre
sentlhe rival Klnr.! r e.r chief dp t and empo il

Ilumtbered Il-ne~ andll l~sa funly until bsomn twen Y

ites utur erll..u;! y Rll it is within the last ten
uere Ihi IIR lle 115 prcable pr ess-
ard that IITOF~ ha .;- n Jew 1 sappicitheefla ing of

th e he l te etric: lie blt =:o l:, r r t h b y i l um n t o
and its hltel--. it wa- ,sB tugh 'h inuci
fist lulr-let there re Ilehr--had a mental as well as
a material signlir;slome since men awake in the
brightness and slumbecr III the dark.

A erverb..Jy inl .laninca already knows, it was
tBhe Hennlque. Br..~thers who first established an
eftlcient electril. Ijblghtin vstem in ~Montego Bay. In
addition, they implrolse-.1 the ice-making faellities of
the town Thenl she Henriques Brothers were bought
out by the Jamanica3 ruhil Service Company, with
its large capital in--.:..a rl its intimacy with the latest
development in th- utrilisation of electricity, anel
Its stimulating poli\y of pushing the utilisation of
electricity in ever' pa~rr ..6 the island.
.Prio~r to thle Hcnrag~ues Bros. going down to
Yolfatgo Bay. Iin I\4; !.. h~e precise), an attempt had
.been made b. 1 an .11awrican engineer to light it
with electric~ity. But although a plant was install-
ed, the whole syrntll was so unsatisfactory and
even so dangerousi that the Government stepped in
and had operations u-ptnded indefinitely. When the
Public Service Cnr~mpany took over the Henriques
plant, it did so~ b. f..1-ining a special subsidiary in-
etitution called **Thec St James Utilities, Limited,"
which now operates In blontego Bay, and to-day the
town boasts of a Inent\i-f.ur hour a day electric light
and power suppl?.y quart as good, though naturally not
as large. as that of thle metropolis.
The power plant es~lnsists of two generators of
the General Electra.. r.'s~npany of England manu-
facture. There rs also an ice piLnt oplerated. b;a 30
horse-pe~wer synchronllusl motr nih'ich 'provides all
the ice necescary fr..-~ thle town and surrounding dis-
tricts. The demanel if..r this commodity has been





PLANTERS'


PUNCH


be laid. Montego Bay was too anxious
for the pier to risk a failure to secure
it; consequently, at the beginning of
1930, the St. James Parochial Board
granted permission for the railway lines
to run along certain streets, while the
Legislative Council showed every desire
to facilitate the passing of a Private Bill
granting to the people connected with the
proposition the necessary concessions
and rights.
On the second day I was last in the
town I went with Mr. Fletcher over the
ground along which the connecting rail-
way lines would pass, and from his wharf
premises I looked along the route which
the pier would follow from the shore to
the deep water. All this was nothing
new to me; as a matter of fact I had on
previous occasions surveyed the pier
question of Montego Bay from different AN
angles and points of view. Mr. Vernon
Henriques had taken me about the fore-
shore of Montego Bay to show me where deep-sea
piers might be built, either protected by artificial
or by natural breakwaters. But I liked to go about
with Mr. Fletcher, for I appreciated his enthusiasm:
if I asked questions suggesting hesitation or doubts,
it was to draw forth emphatic explanations from
him. I did not need to be converted to the project.
I was one of the first converted.

MONTEGO Bay will remember the efforts of Mr'
Coke Kerr to obtain for it a deep-water pier'
but the pier itself, when accomplished, wNill be main-
ly identified with Mr. Walter Fletcher. For it is
his scheme that has been adopted. W~alter Fletcher
was born at Blackburn, Lancashire, and to this day
one detects traces of the Lancashire way of spea~-
ing in his voice. He is a shrewd, capable, quiet,
energetic man. H~e came out to Mr'. Thomas Sharp
in 1902 as a planter's assistant; not long after this
he joined the United Fruit Company as a bookkleeper,
and in a very little while he was promoted to be
overseer of one of the Company's Jamaica farms.
Such rapid promotion was an indication of young
Fletcher's capacity, and more was to follow. He was
subsequently transferred by the United Fruit Com
pany to Portland, to take charge of their prop~ertiBs
in that parish; then he was sent to Costa Rica as
Superintendent of one of the Company's Divisions
there. H~e remained a fe w years in Costa Rica;
thlen, after serving the United Fruit for some eleven
years in all, he severed his connection with them and
returned to Jamaica to enter business on his own
account.
He had ambition. He had long since made up his
mind that h wsoau not all his ie tedbe an em loye ,

shrewd and saving, therefore it is not surprising
that Mr. Fletcher, on his return to Jamaica from
Costa Rica, was able to take over Latium estate in
St. James from Mr. John C. Farquharson, and then
to purchase wharf premises in Montego Bay, thus
becoming at once a producer and a handler of pro
duce. He later on disposed of his interest in the ban-
ana property he had acquired and devoted his at-
tention to developing his wharf and produce business.
He became associated with Grace, Limited. on their
first coming to Jamaica, sold out his 1Montego Bay
business to them in 1917, but retained the manage-
ment, and when Grace, Limited, became Grace, Ken-
nedy, Limited, Mr. Fletcher became a shareholder
in the new organisation, retained the management
of the Montego Bay end of it, subsequently pur-
chased that branch of Grace, Kennedy and Company
and again began business of his own under the
name of Fletcher and Company, Ltd., of which to-day
he is the Managing Director. And now he is devoting
himself to the deep-water pier project of Montego
Bay.

T HE pier, when completed, will be linked up with
the Jamaica Government Railway system, and
this will' enable fruit bi'ought over by the Railway
from Marichester, St. Elizabeth and St. James to be
carried to the ship's side without the double handling
and the lighterage which at present are the costly
and somewhat inconvenient methods that have to
be employed. When a norther is' blowing, the light-
ers in M~ontego Bay are sometimes not able to go
out to the waiting ships. This occasions delay. And
however careful the handlers may be, you cannot
pass bananas from a train-car to the ground, from
the ground to a lighter, and from a lighter to a ship's
hold without, damaging some of them. The pier will
eliminate this inconvenience. It will be about 1,220
feet long, the first 300 feet passing over shallow
water. This section will be fifty feet wide, the rest
of it will be 110 feet wide. This wider section will
be provided with a shed 680 feet long by 56 feet
wide, the shed to be a steel frame with heavy gal-
vanised iron sheeting over the sides, and with roof
and sliding doors of the same material.
The engineers are satisfied that the curve of
the land to the right as you look~ from the Fletcher';;
Wharf out into the bay is ample protection against
the ordinary winds and northers that visit the bay.
Against possible hurricane .destruction there can, be


thousands of them, too, who have never
left the island. But in their own chief
town of Montego Bay they can now see
something of the great world picturised,
and one cannot doubt that as panoramas
,,of towns and cities in Europe and on
.the American continent pass again and
again before their eyes, they will in-
creasingly contrast what they thus see
with ;I~-! ..ill surroundingss and be
moved !o fInorl..v: those surroundings ;
where improvements are desirable. i
Tenorthside town, once so som-
nolent, always charming in its own
'way, will shine out in Jamaica, not
only as our second city but as a city.
of peculiar attractions. Those attrac- c
tions are indeed a part of its heritage;
otherwise how are we to account for i
the love exhibited for it by so many
UB people from different parts of Jamaica
and distant countries? Its attractions
will be increased, not destroyed, by its
material progress. For it will never lose its charm
of being part of an older order of things while be-
ing also a part of the newer order which develops
every day,




r' Le


-I















an Vi




are maintained from
childhood to old age if deli-
cious "Ovaltine" takes the
plaCO Of Ordinary beverages. !

This perfect food beverage i
supplies the rich nourishment /
extracted from Nature's best
foods-pure fresh milk, barley
jlmalt and eggs from our own
and selected farms. It con-
tains in a concentrated and
correctly balanced form all the
food elements essential to
health'

Children prefer "Ovaltine"
to plain milk because of its de-
lightful flavour. The aged find
'Ovaltine a valuable addi-
tion to their dietary, particular-
ly where the digestive powers i
are impaired. In adult years j
"Oatine" is equ lly neces-
sary. It rebuilds brain, nerve
and body, recharges the nery-
ous system with rich reserves
of health and energy, and ;
strengthens the body to resist
winter ailments.

In every home Ov~altne"
should be the daily beverage
for every member of the
family. It is the cheapest in
price and the most economical
in use of all forms of: concen-
trated nourishment.




TOI FOOD BE~VETAGE

Builds-up Brain, Nerve and Body i

Sold by all Ch~emists an~rd Storea. jjI


INTERIOR VIEWI OF THE DOCTOR'S CAVE BATHING CL1
DANCING FLooE Asn PAVILION

no additional protection except a substantial strue-
ture and adequate insurance. The pier will therefore
be adequately insured. If it is damaged, the In-
surance Company will find the money for its re-
pair. But the northwestern side of the island is
not as frequently struck by hurricanes as is the
south-eastern part of it: not often does St. James
experience a great cyclone. And though the pier's
shed might be damaged by wind, there is no reason
whatever to expect that the pier itself would suffer
any injury. Wooden piles will not be used in the
construction work, but iron screw piles or cylinders.
It will be a very substantial structure.
This pier must undoubtedly hasten the develop-
ment of the northwestern portion of the island:
it will bring more business to M~ontego Bay, and so
aid materially in that town's expansion. Already,
the wooden buildings in the business centre of 1Mon-
tego Bay are giving place to stone structures of res-
pectable size and neat appearance; this process of
desirable change will be hastened. The business sec-
tion of the town will grow, residences will mves
towards wherever there is land available for build-
ing; as a matter of fact Montego Bay will in the
future expand inl two directions: towards Lucea and
towards Falmouth. The hotels of Montego Bay have
increased and been enlarged during the last few
years. Thd tourist season lasts for only about three
months, yet these establishments catering for visi-
tors have in the past done remarkably well and will
do still better in the future. More hotels will spring
up. There are four attractions for the tourists: one
is the bathing, the next is the quaint old-world com-
aiato dfcomitr t ndotrodn whcaT h: neM oiBay
sociability of the visitors and others which mani-
fests itself so quickly in Montego Bay, the fourth is
the brightness of the little town after the sun has
sunk in a blaze of colour below the rim of the sea.

HERE is nothing so depressing to the spirits as
darkness. The lure of the great city of Europe
or of America is the night-brightness of its streets,
the illumination which inspires its inhabitants to
movement and gaiety, dispelling melancholy and
brooding. There are thousands in K~ingston who still
remember the gloom that used to settle over the city
when night fell and but a few quivering gas jets
faintly guided the pedestrian here and there. These
can contrast that situation with the brightness of
such a thoroughfare as the Victoria Avenue of to-day,
with its gaily lighted shops, its illuminated picture
theatres, its flashing advertising signs; they can con-
trast, too, the present beauty and brightness of our
Central Park and its surroundings with the deadness
and dullness of it some years ago.
Kingston is lighted with gas and with electrici-
ty; the buildings are installed with electricity, the
public lamps burn gas. Montego Bay possesses au
up-to-date and perfectly adequate electric plant, and
when the deep-sea pier is built it will blaze with
electric light, and the new hotels will shine out wyith
electric light, and soon there will be no house of any
pretensions in the town but will enjoy electric light-
ing. Thus the visitor, coming in his hundreds nid
his thousands to Montego Bay, will look out upon a
town, or promenade streets, not shrouded in darkness,
but cheered and illumined with light.

MONTEG'O Bay possesses one moving Dicture thea-
tre now; it will have more than one in the
days to come. The time was, not long ago, when it
had none. Then an enterprising American, Mr. Emery,
built the present theatre, and the people of Montego
Bay were able to see the silent moving pictures with-
out having to travel all the way to Kingston. The
talking picture came into vogue, and this year (1931)
the Montego Bay theatre was wired for talking plc-
tures. This theatre has a seating capacity of some
nine hundred, the pictures that are shown in the
Kingston theatres' are shown there also: they are the
same that are thrown upon the screen in London or
New York.
There are still people in St. James, hundreds of
them, who have never been to Kingston There are


1931-32



























































THE RUM THAT LEAVES NO ODOUR OF RUM.


1931-32


PL .41 NTERS' PI C 1(' H


S'I HIE moicst important. and in fact the only serio~us, objection anyone-
has evetr foulndl with Rum a~s a tim~ulating beverage is that unfor-
tunately certain infe~rior types of Rum leave an unplea~snt after-eff'ect
ofi -;mell.
Goold ()ld Jasmaica Rum~ however dloes no: -uch thin .. yet althougljh
it isi acklnowledged[cc the wo'crld OverT to) be~ thet most ideal~l combination ofi
refreshmernt and nourishment,. its char~ms hav'e on many1~ oCCSccainS b:een
dli rega~rdetd on account of the e~rronieou- idea that Rum .. .all Rum .
iS afflicted! with an odour nonte too p~leasant.
.111 Rumn is NOT an in on\ as~e there is no necessity w\hatever to.
takte any! chances, there was a problem once but that has b:een ~sti -
fact~rily' solvetd by Charley''s "ll'hitc Label" .. G~oodl Old Ja miics
w\ith all the good there is in Rum .. nd nolne of~ the o~dour..


irj Jamai a's un s ,

ami f I.tant N d fr
>nur on; A RL Ealr '


S


111'1
I I''
'I I 'I
.~\ \\~\


I,


SHE


WOULDN'T


LET


HIM I


THIS


DO


.i e


fOT


Charley


"WIVHI T E


LAB ~E L










I -- '


Built on a most commanding site on the hills of St. Ann, 1,216 feet above
sea level, it has an ideal climate with the thermometer very seldom going above
80 degrees in the shade and an average night temperature of 65 degrees.




S orts anda Recrreatons

y rceaichd from F07 Rat68 etc., apply to No Visitor to Jamnaica
ston by motor car spending some timel at
or train. MOEGEPO,-JAMAICA\, B. .I. this Hotel.


PLANTERS'


PUNCH


There were tour children also. But it was not con-
sidered that these were very dangerous. Still, of
course, you never could tell.
ITwas hoped that a force of 270 men would be
more than equal to one of less than twenty men
and women, and so in the event it proved. One feels
glad to be able to relate that the attacking army,
showing the utmost bravery when it found that there
was nothing to be feared, gained a complete' and
smashing victory. As the army entered the town it
was fired upon, but no one was hurt. The rebels,
Aire was returned, and two of them fell mortally
wounded. A rebel woman was seen on a hillside.
With admirable presence of mind some shots were
fired at her, but with no effect. This was unforti-
nate, but there was still hope that the women wouhi
be slain later on. A couple of hundred men can,
with persistence, do a lot of damage to eight women,
particularly if the latter cannot handle guns.
'The battle was soon over. The army was now in
possession of the city. After gathering what spoils
were available in the form of food, it decided
that the place should be sacked and burnt: always
a place should be sacked and burnt 111 Jamaica after
a fight. There was something about this procedure
that reminded the victorious forces of ancient wYar-
fare and redoubtable heroism.
The provision fields were dug up, the surround-
ings were made a waste. Justice was done, right
was re-established, a movement that had been danger-
ous, being confined to the cultivation of provisions,
had now been put down with an iron hand.
Unhappily, some of the runaways were still rul-
ning away, and the Colonel commanding the
attacking army righteously concluded that the
country could never feel safe and be at peace until
these were all captured or destroyed. So the Ma-
roons and others `were sent out to pursue the fugi-
tives, wsho were to be brought in alive or dead. The
leader of the Maroons reported that the hunted re-
bels or bandits--they became anything according to
the will of those who spoke about them--had g~t
wind of his movements, so he was not able to do the
execution he planned. This was disappointing; yet
there was always hope. And in the meantime there
was this present victory. It demonstrated once again
that, no matter how bold and villainous were the rurn-
away slaves, with their evil disposition to keep to
themse-lves, and their cruel efforts to cultivate yams
and ban~anas, and no matter how small their numbers,
they could always look forward to being crushed by
large armies of devoted ~men vowed to their destrue-
tion and proud to feel that, so long as they could
run away in time, there was nothing to be feared
from rebels.


1931-32


The Cu ad The Li
e otiup d atn P e ip"

"Lovely, Arthur; and I enjoyed myself so much,
:hanks to you."
"Nonsense, you would enjoy yourself anywhere,
rut I am glad I came over for the dance. Who would
tave thought you'd have met my uncle! And he was
taken with you; he I p..a+ to me about you after-
wards. It was great!"
"What did he say?" she asked eagerly.
"Oh, that you are a very nice girl, and that he
was pleased to have met you. He wanted to know
trow I had come to know you."
"What did you tell him?"
"I told him that a friend had introduced me to
you at the Myrtle Bank three months ago, and thlat:
we had been friendly since. H-e seemed quite
pleased. I wasti't sure whether, when he knew.
"Arthur stopped short, as if in doubt how to
continue.
"Yes?" she prompted.
"Well, what I mean is that these oldsters are
very peculiar, and as I am his only near relative I
wondered what he would say when he learnt how very
friendly we are."
"Why should he say anything about thst,
Arthur? There's nothing wrong with me, surely!"
"Of course not, Gladys; you know I don't meanl
that." His voice was reproachful. "What I mean
is .. well, hang it all, I am very fond of you,
you know; I have told you so."
"Yes; but don't tell me so again here, and in a
loud tone of voice," she smiled. "The girls outside
can hear quite easily, and I don't want people to be
saying that young men come here during business

hours mhatouer 1nl ha no p suon leo Usocia 1
sections to me?"
"H-e couldn't have any," replied A~rthur stoutly:
"but I certainly am pleased that he likes you andt
thinks a lot of you. It makes things easier."
She did not ask him what things had been made
easier; she knew. Arthur had shown for some time
now that he was gone on her; he came to Kingstonl
to see her whenever he could; he was always singing
her praises, paying her compliments; but hre hadl
hardly ever spoken of his uncle. She knew that that
was because he feared that while "the old man," as
he called Mr. Pemberton, would have nothing to say
against a mere friendship between him and her, it
would probably be very different if Arthur hinted
at a much closer relationship. Arthur had never
proposed to her, though he had made plenty of love.
He had shrunk from such a momentous step. He
thought she could never guess what was passing in
his mind, but she read him like a book; as, however,
she was satisfied she didt not love him, she suf-
fered no emotional misery, no malady of passion or
depression; even her self-esteem was not much
wounded, for she believed in herself and felt certain
that the peoplelwho looked down upon her now, be-
cause they said she was nobody, would be very pleas-
ed to know her later on. She had a great, a pro-
found faith in hler future. Her self-confidence was
superb; but for that she would not have come to this
country, alone, to make a living, and a place la
society for herself. Nevertheless, she was thrilled to
hear Arthur say that his uncle thought highly of
her, and that thus things were made easier. She
looked at him now with more thoughtful, appraising
eyes than ever before. He assumed a greater conse-
quence in her mind. Shte might not love him, but
there were other worthwhile things in life besides
love. Position, for instance .
"I am going to suggest to Uncle Alfred that he
should invite you down to Mapleton for a week-end,"
resumed Arthur, "when he has some guests there.
I want him to know you better, Glad; I want him to
think as much of you as I do."
"That will be a great deal, won't it, Arthur?"
she laughed.
"A whale of an amountt" he protested ardentlyv.
"But aren't you going to ask me to slit down?"
"No, my dear boy, not now. These things ar'e
noticed and talked about, and there is any amount of
talking in Jamaica. What about the Liguanea Club
this afternoon? Are you going up?"
"Well, yesterday I thought I should have to go
back ~to Portland to-day: Uncle Arthur doesn't like
me to stay away from the 13roperty too long, you
linow. But I guess I can remain over for a few hours
longer, and then go backr to-night."
"It must be rather hampering to have to think
what somebody else may feel and say about one's
movements," observed Gladys thoughtfully. "How-
ever, I shall see you this afternoon?"
"Yes."
"Good. Well, then, run away now. I have a
sketch to finish."
"Oh, you artists," he grumbled, "for ever think-
ing of your work."
She smiled, she was gratified that Arthur tookl
her artistic pretensions seriously. She nodded to him
g~aily as he went out. Then she began to make
marks on the sketching paper.
(Continued on Page X/I)


HO~TFEIL


MON]EAGU~JE


(Continued from Page 9)
learnt, led to the lair of the desperate characters who
spent most of their time in growing yams.
SWith grim heroism the avengers marched for
ward. They paused at about eleven o'clock for "se-
cond breakfast", then on they pressed once more'
breathing bravery and the fumes of Jamaica rum.
For nearly an hour they climbed up a mountain's
side, then entered a defile leading downwards--
suddenly shots rang out, for the rebel-runaway ban-
dits, men daring enough to grow bananas for their
own sustenance, had some guns, and with these they
had audaciously fired on the attacking party. Three
men of that party fell, two of them fatally wounded.
These two were white men, the other was black. T'he
surprise was terrible, the execution wrought was
devastating, yet did not the attackers lose theit
presence of mind. Something swift and effective
had to be done: they grasped that necessity at once.
And they did the wise, the strategic, the masterly
thing. Throwing wildly from their hands some fif-
teen guns, and casting away also their ammunitiall
(for every bit of weight is an impediment to the legs
when running), the warriors of the expedition
turned their backs upon the foe and fled. This they
called a retreat. It was remarkable for the despatch
with which it was effected.
They returned to Falmouth. Theirs had been a
private military movement, without warrant from l
Government or magistrates, undertaken purely in the
interest of law, order, and the suppression of evil-
doing. It was now recognized that the matter was far
too serious a one to be left to private enterprise,
even though the private persons engaged excelled in
running. So the very next day after the strategic
retreat a meeting of magistrates was held in Fal-
mouth, and a message was sent to the leader of the
Accompong Maroons, bidding him hasten with his
contingent of warriors to aid dislodge the formidable
enemy in possession of the town of "We Don't Send,
You Don't Come." And to the Trelawny Militia the
word of command went forth, causing six companies
of this redoubtable force to muster at Dromilly
Estate. So, in the morning of November 1, 1824,
a body of armed men, Militia and Maroons, number-
ing with their baggage carriers and pioneers 270
souls, moved towards the citadel of the runaway
rebels. These mustered nine men and eight women









_~~ ___~- ~__-~ --


- I --- c


PL .- WINTER S'


PPNCH


-1931-32


SH.1\'E beern struck for a lorngr time by the
lack in Jamaica of any' service similar to that.
pe~rformed in London for people des~iring beauti-
ful ho~mes but not havinga the~ time o~r, perhap .
the necessary equipment to eserch themslves 'r
for th Iloveily pi~ces~ of furniture which so~ en-
hance tht beauty of a luxurious homc.

SN Londo~n I hav'e had- co~nsiderable esperince c
of furnishing an interior de~coratio~n and ha'e
been responsible for planning the d-co~ratiorn lf
the homes of English 4entlepeop-le. Here. in
Jamasica. ther are~ around the rcountr!- mlny rx-
quisite p~ieces~ of w\orkmanship in the fine okI
m horga ny t ha t in tsubtstnce andl w\orkmaiinship'
is so- infinitely sup:erior to mlodern p`rodjuctions.
There are lear\ people; w\ho havec timle atnd inclinll-
tion to cserchh fo~r these piece yet there arc
mainy. who~ would ap:preciate being able to~ bu!-
at a reasonab:le prices so:me of thesec exquisite okI l
masterials.

SHA-\\E acco~rdingly detcidedc toj app-ly to` J1-
maica thr know\\ledge and expetrience I have
gaine-d in Lo:ndol-n, and to opecn herer~ a buslines-


which shall have as its object the suippl!ing or
genuine o-ld Jamaica mahogasny too those wvho
3pp-reciate- bea~utiful things.

SHERE are- three- classes- ofi peoplle to~ w\hom I
exspect to~ appe~tal--tho-i e whot already haver
beau3Ltifully\ furnishedi homnes and w\ho are always
look~in:J for an extra piece to fit into their present
scheme of dcolrantion: the newvly maririd w\ishing
to~ furnish their homle w\ith the sollid and the
IpCeautifu l Iititrnpfrnce to thr flims andl the~
eplhemeral~ l; andr to: new\comers' T to. the Island w\hlo
\\ish to hav\e in their homrs the Ilslnd's best
product io~ns. Conll~ctorls also1 will often find ;I
\aluable p~ice which their ow\n re ea~rche- might
nolt havet discoveredl.


1 H.ll'E nowv several fine m~h~ahoan dinine~-
S tab~les. wa~rd-robesc. sirlebol:ards, and dress~in -
tablLs which I hshll be happy! to~ show\ inqluiresr~.
If you~l neel a sPe'cial piece to co-mplete~ your
holme. p-leaser tell me your require~ments andl I
w\ill havet a search madce fo~r the particular article
\.ou deCsire.


KINGSWAY,


HALFWAY TREE.


J AM AICA.


"'LYNTON."


TELEPHONE 6016.


TO THOSE W/HO LOVE BEAU~TIrFUL


FURNITURE


M. MAT'ON


I


I









































































1111(111(111(111111111111111111111111111


1111 1..... ....I................ ..


ii! :ii! i!lillll!Ulilll!lrli11!!111111111111111!
--
L
~
--






I F~Df~AL =
MOTOR TRUCKS



--


--
--


i~iiii
--
~ i i i ~//~;~;%P~~?"B~a~a i I i
~1E



~
~


I: ~Qlw,


~


=



I i I i i i --
~= ,,, ~ ,,, ~
~


I I --
--


2;=
~


I, C;ENEKAL AUTO SU'PPLY CO., Ltd.,
~


---
~ --

.i$~ Oran~~ Street, o ]tairm~sa~n.



~IIIBI~IW~URIIIIIIIIIIB~IUIIIHIIIYllslll IIIIYIIIIIAIIIIIIIIIIIIIUIIIIIII~R~III iiiUl~l~iiiiiiiiglIIIIIIIIIIIIII~UIR~i


PLANTERS'


it was not yet tenl o'clock, and already three perscus
had asked for admission to this semi-private room.
But this time, instead of saying "Lcome in", she went
to the door to see who it was. It was Mrs. Smith-
Parsley, whom she knew by sight, but had never
spoken to before.
The reason of Mrs. Smith-Parsley's presence there
just then may be easily explained. She had been
driving downtown when she saw Mr. Pemberton
alight from his car and move towards the entrance
of The Art Studio. She had noticed the night beforP,
as had so many other persons, that Mr. Pemberton
had danced with the pretty Miss Ludford and had
paid her some attention. Seeing him going into Miss
Ludford's place of business so soon after, therefore,
MVrs'. Smith-Parsley was inspired with curiosity: what
was the meaning of it? It became almost a moral
duty to discover that meaning, or at least try to do so.
She ordered her chauffeur to stop at the end of the
block, then, alighted and walked slowly back towards
The Art Studio. This would give Mr. Pemberton
a few minutes to make his greetings, and would in.
dicate that Mrs. Smith-Parsley had not seen and tol.
lowed him purposely.
Standing; at the door between the two compart-
ments of the shop, Gladys looked at the newcomer
with enquiring eyes.
"Miss Ludford, isn't it?" said Mrs. Smith-Parsley.
"I should like to see some of your paintings, your
own, I mean. I--I have heard of them and I thought
-"She left the sentence unfinished. She sensed
that Gladys did not want to give her any personal
attention now. Hence her request, which could only
be satisfied by G~ladys herself.
And she had spoken loudly. She wanted M'.
Pemberton to hear her voice.
"Won't you come in?" asked Gladys, who guessed
that it was no mere chance that had brought Mrs.
Smith-Parsley there so quickly after Mr. Pember.
ton's arrival. Such a coincidence did not seem
natural.
"Oh, Mr. Pemberton, how do you do?" cried
Mrs. Smith-Parsley. "Who would have thought of
meeting you here! Looking at works of art? That's
what I have come to do too. I heard of Miss Ludl-
ford's pictures, and thought I would drop in to see
them."
"You are quite right," approved Mr. Pemberto:;
"we ought to show more appreciation of art than
we do. That is why I came myself this morning.
My nephew Arthur, who is a great art enthusiast"- -
Arthur would have been surprised to hear this des-
cription of him -"mentioned Miss Ludford's pictures


to me; indeed" (Mr. Pemberton fabricated cheer-
fully) "he asked me to come and see them."
"Arthur has a keen eye for beauty," remarked
Mrs. Smith-Parsley a trifle ambiguously. "What is
this?" she asked, fixing her eyes on the copy of the
painting in the English National Gallery.
"Nothing mulch, a copy that I made," said
Gladys.
"But how .mantiful."' ex.1a~imdc l Mr. Pemberton,
"how artistic!"
"Yes, isn't It," areePd MrII- Smith-Parsley; she
could not forget thlat Mr. Peniber't..n had, as a big
landowner and .1 nunl w~ith many business interests,
a great deal of legal work, and, after all, her husband
was a rising solicitor who desired to have clients of
just this type.
Mr. Pembe~rton fixed his eyes on the painting,
assuming a profoundly critical expression. He sumr-
moned to his assistance sundry expressions he ha'd
heard or read once upon a time in connection with
art.
"What exquisite colouring," he murmured.
"Exquisite," agreed Mrs. Smith-Parsley.
"And-er-the perspective; do you perceive the
perspective?"
"Wonderful," exclaimed Mrs. Smith-Parsley,
"perfectly wonderful," wondering at the same time
what a perspective was.
"This," said Mr. Pemberton positively, "is a fine
work of art."
"No doubt about that," acquiesced Mrs. Smith-
Parsley. She observed the enthusiasm of Mr. Pemn-
berton. Her husband was still a.young man, and
she herself had much to do before she could feel
that her social position was absolutely assured. Mr.
Pemberton could do something to assure that posi-
tion. If appreciation of this mysterious thing called
"Derspective" was a way towards such assurance, why
not take it? If agreement in artistic criticism would
help, why not agree? Be iidef. Mr. Pemnberton might
be right for all she kne~\. '' Thr- picture looked sad
and sorrowful, but perhaps all great art was melan-
choly-M~irs. Smith-Parsley did not know and did not
care.
"I should like to acquire such a painting for my
drawing-room at Mapleton," said Mr. Pemberton re-
flectively, "unless," he added, turning to Mrs. Smith-
Parsley, "you want it."
The lady hastily asserted that she did not.
Her manner left no room for doubt. Yet she remem-
bered she had professed to come to look at Miss
Ludford's work. And one hardly goes to see paint-
ings or drawings, in a place where they are for sale,


PUNCH


1931-32


(Continzued from Page 22)
Not half an hour had passed when there came
another rap at her door; she put down her pencil
and called out, "Come in."
She started up as this second visitor entered.
He was the last man she would have expected that
morning'
"This is a surprise, Mr. Pemberton," she cau-
didly confessed. "But how good of you to visit my
Studio. Won't you sit down?"
"Thank you." Mr. Pemberton took the chair in-
dicated, and glanced about him appreciatively. Then
his eyes rested on the figure of the girl, slim, in her
soft and cool white dress, with a touch of colour
about it: an elegant figure. It was singularly plea-
sant to be there.
"I have heard a good deal about this Studio of
yours, heard it spoken of very highly," he lied, for
no praise had fallen from Mrs. Beaversham's lips,
"so I thought I would drop round to-day and see
some of your pictures. I don't know much about
art, never studied it. But I can appreciate a good
picture when I see one, and things like that, yott
know. You have a very fine Studio here."
"Not bad," Gladys admitted, but she noticed that
he was looking at her, and not at anything on ex-
hibition.
"It was an excellent idea of yours, coming out to
Jamaica to teach us something about art," continued
Mr. Pemberton1 earnestly. "We know a lot about
bananas, and sugar, and rum; but art--well, we
don't pretend we do."
She politely murmured something, which sound-
ed like anything you cared to make of it. She had
not found the local knowledge of rum to be at all
deficient,
"But now," he went on, "you are going to effect
a change. I think that the better classes here have
real artistic feeling; what they lack is knowledge;
Don't you think so?"
She agreed with him warmly; she had recognized,
she said, much artistic feeling in Jamaica. She did
not go into details, such as how such feeling hlad
been manifested. Generalities were safer. By keep-
ing to them, both she and Mr. Pemberton were on
safe ground.
"When," he began again--but nowi there came
another rap at the door. Gladys thought that the
number of visitors this morning was extraordinary;






25


friends, you knowr. From Saturday to Monday morn-
ing. How will that do?"
"It will be lovely." This was the first time that
Mr. Pemberton had ever asked the Smith-Parsleys
over to Mapleton, and such an invitation seemed to
indicate developments of a promising character. Al-
ready Mrs. Smith-Parsley began to wonder how
much the half, say, of Mr. Pemberton's annual legal
work might be worth. But if she knew nothing
about perspective, and cared less about artists', she
had a cute little mind and was well aware that this
invitation was particularly for Miss Ludford. Shre
had been asked only because she happened to ne on
the spot at this moment. She had a brain-wave.
She turned to Gladys--
"Perhaps you will let us take you over, Miss
Ludford? Our car can hold four people quite com-
fortably."
"I should love to go with you," Gladys warmly~
assured her, and spoke as she felt. For how much
better that would be than going alone.. Indeed, it
was not easy to see how she could well go by her-
self, even to a house party. But now all dinficulties
had vanished. If she had been inclined to resent
Mrs. Smith-Parsley's intrusion a little while before,
she was heartily glad of it now; it was really pro-
vidential.


-


Earning Capacity


lu nine cases out of Iten, thiu is a
business rulnU's


GREATEST ASSET

aInd cann ensily be


Pr010Cted by Life Insilf80CO



U'we frprlua lj <.. ......... .,,

CONFEDERATION LIFE

ASSOCIATION



J. B. ~IlLBURN. District Mlanager.
MAlURICE: AlAIR, Canvassing Agent.
CORONATION BULDING.
rKINGSTON


if* Free POstage, when cor-



TC rSponding with the Bankr
2.Exemption from Stamp

Duty on WNithdrawals.



3.The operation at any of

itS Branches, of an

account opened at ]Head

Office or a Branch.


4. Interest at the rate of 35'

compounded half-yearly.


5. Security, based on gov-

ernment guarantee.




There are 103 Branches thiroughlout the

Island, at rehichr Deposits and Wi'th.

drearpal may Be made.


I _


-1931-32


PLAN1h'TER S'


PINCH


without omle sunr of pretense..nn to~ be a purchaser.
Illrs. Smithb-Parsley now had the f'eeling that she was
taught Co~uld dlie escape frnnm thiis place. Fhe asked
herself'. w~ithnutt hEing \' thrnllwed?
Happily. ILII. Pembherton seemed relieved that
she wh'llulti 1I.[ takeir ad\anrtae rof hlis geerosity v
in offering to~ leave to~ her 11iis Ludlford's great woirk
of art "I Ihourld Iikie to~ buy that ,*Irtulr." he ;old

**Oh. lut it is ..nl?- 3 sopy'. !\Ir. Pembecrtnl.**
Glad!ys answered.FI A- lhe pokeii he was rapidiv
ialculallnR lvwr musl hr --e ilght reta~llsonaby ask i.*r
it She u..IIld never\'. prTen~d that shte hadl done more
than ilspy the original: Flite would run noi foollan
risk. Prudence wa. parrt f hecr charter But if
aonyne wanted the thing she had dione. wilhy r,(
icourse -be w~ouldd sell ir Business w~as business.
The actuanl workk sle hadl perfo~rmed on it might he
valued at A\ive Ilound. if r?nmputed in terms4 of time.
though Ahe we'll kniew liait all artists woCuld --up
that her IImet hiad been utterly wasted If she adked
ten pounds, that 'ouldll mean a1 prolth It wasn t much,
but it wasU solmethinp lIlr Pembertosn h(we vel.
seemed keen onI the Pilture: heC was praSingll it ,,,
her face~t It w..nh~III\'i nv dl-l fl..r her Ito depreciat,
its value This might he the~I beginning of an excel.
lent repularir.*n1 amnlgn thle ulpperl .-in.les, o Jamail,
whlo would judaje ar~tistis. ..b~jeler-- almost enltirely by
their p~ri e
"A cr~py. Ilis I.usif..rd." ,.aid blr. Pentihertart
earnestiv, remembleringp thur lie wvas a hlecal Privy
Count illor anal therefore. presnumably a judge of most
things earthly. "a coip? may be better than the origi-
nal. I don't pretendl II. he an' alutho~rity, but it seenti
to me that tble beautiful paiinting has a1 great dleal ref

SmlihPareley""
Mlri. Pmisih-Pairsley .It unsie relasonisel aI uper
abundans e ofI -sul in tbe Idl~rure: Ie fell back a lort
or Ro andl gazrd at it ecstatic ally Nraw thar Phe wa<
not tc. be wranglrid int.. HIu!IinE it. bhe con~iid aff. rd
to beicjme an enrbiusiastlle llrt coinnoisceur.
"l'er\ well.'' ;avid lr Pemberteennn withi that de-
finite air hie alw~a?- a.-umledl whein 4igninge~ aCo~ntTract
for banans; olr :Ic!eine withl thle GovIernor1 In Pril'.

Ludfojrd? 1
"Oh, I I-uldnl' Lj think ..( thalt. Mlr. Pentherton." "
cried CGlad\. pcnuineol 3rslni-hed~ at the sunt of-
fered But Ilur. P''mbert..nl Ini~illd.unde~lrsto her. He
ima~gined -he thrlludtl thle anylunt iffered in..~ 11110.
and ar~str~anchta he hall a funnll? teelis ~ng somewhre
In his inside. FrI th..~uci he p124essed Plenty of
.mo~nr! he was~. larefII rl~l:al he Igh he ws willing 1...
purchase a pistiire he hadnrl eai rthl use f..r. ie
never liked to~ spend~ mus h uno anything oft ri0
obvlouS material value Yort he wculdl noit look tingy
now four (1I1 Iltfe of him. "'Please sa? whatr you~i will
take."' he sai. witrh a \er? fine air. **A hundred? I
am nra :udge ofI the value of rue-b things. except that
I know that thl< urne is bcautiful "

that woulld makie hini -thille in hereye. He ialnot
really walnt the daubll. He-hle ranlted hler go~.0d pin-
lon: he. the grear I\1. Penibelrn! Sher malle upi her
mind Instantl hier Ilun k inl(. IIrqence deltermincd


Nolt a1 penny?. And. maork; !:11. I d.=n~'t tbink it i-
wo~rth tifl\ pr~unlds."
Eve lus. ruih Prsey o- mpr---d.This
undnubtedil. wasi an unI'i.1 andl unti merely a iylcs
w~oman. AllI artists weTr hupposled to be a bit peru-
liar. eteeFntri,*. stupid In pradic rrl affairs: and -urely
it w~as ecicentrcicity. nor ti ay ctupidiiy, to? refuse a
hundred poundsj alnll inkc 1111 instread. This4 must
be the artistle tEmpElncrr m nt' uf whih Mlrs Smilth
Pursley had hea;rd iqetoal i a lebn
z E*..nishinr and even tol be depleteel. I


to establish frie~ndly relatio~nships w~ith hier, at exactly
the figure' he hiad uirigina~ll ha3d I1Inmint. And he hid
discoveredl that she wa-. n..r me~lrCenary.) that --he imal
a soul ah..veF mneylc\. midt th~ii discovered hadl herl l
madte in the priesence nIf a wirtness whs.. mIuld testif.1

pro\e that Mliss L~utllf...td was a veritable artist. o1II
of! those~ strange creatrures whoI~. li\'ed for! what was i
called art. and w\hoi so oflten dlied phorIiiouwly? of sta~l-
\'atlion. whl/i le te Fr'.we r. ofr haiinarsa nr the jealer

fine ruluinnor h\eirg rnt er qivln1.udfaei
w~hoi C.uld refuse to adlniit Inlis admnirbl~le artist inti
soml'ety. the higphest andi lilt best~ scenei~r\ And hie
hadl been indilrectly~ in--trunionial3 in estabhlishlng: hrl
clali ru Rac. uh inftyr reersenlrLi1..

he anns..uncelli, *I will taike it nlIwllgv m
rhequeu at o~nCe I feel ribut I ami a tery luckV m1an.
Nlw youII miuct promin-0r mi Untlll ine day. early. wheni

1i1n tr. see It banlens <..ti my\ dlrawin Ilr r~n s walu~ ll '
(sh. Mr1 Pembe~trtun.~ ill=u alre reall tese-, kinl''
exr-laimedt (;lad?', flushineL II w ilth pleaue
**The kindness w-ill lie oni \.riir p~art if you1 comsne,
he replied palIantly: anj llnow Alr~ Sm;nith-Parsiny.?
ofl businew1 for the leeal firm ofI Smnith-Parslit andi
Oxfo~rd. whIl, alio advanic-ine lerefseillb
pleazin@ Ilur PscnhF mhette
A.nd >...II mild~ coml~e andi see me. rloo. lIS

ano~ther. Of course~~. I sh llid have called onu pmii loc
ago.. but I haven't really blEen well. .10u know. Iwl
remedyl! my! ...mi4sion. IlI..wever~l. I -hshll Icomne to
see ?'ou Cone after~noonl this ve~ry. week. You li\e
at ?"
~lad~i mnticiiinel heFr aritire-s.
"\'ery g....rt. Yolu w'ill 4ee mle shorrtly~. You .lre
legally nialr\llillls. )u knowa. masrvllous. -such per-
51pellsiF I nceter ,oaw anythlinr like it "
**Ys..u alre simple ten kind.'" mlurmured Glad\,
w~InI.. thoiught~ !Ih thii indeed miust be her Day of
Day **Andl ?un n ill case is.. .11pletoln. a-on't ?.oul"
askedl !Ur Pcnmberton; "I hope lilrs. SmithParateiy
will I....me rino~-perhapsl~ onl Satulrda.." he added. al

w~ell have' I.ne oft hlis Tllersui'3 cal social reunions in a

'TDlelished." said M1r Smlith-Parsley; **you ar~e
asking Ruper~lt tl..u. aren r yo?'11 Riupert was her hiim.
hand s eChliStIIn Lname


Afords the undermentioned
Depositors:--


facilities to its


Motor Insurance








Effect a substantial savinoa

in cost of Insuring your

cars by placing your Insur-

anCe With






THE ARMY, NAYP &i GENERAL ASSURANCE
ASSOCIATION, LIMITED.

J. B. If ILBR N,
ATI`TOR NiE11


BE THRIFTY


The ovenmen SaingsBa.

of "aac "" ow -


I









"Well, that is settled," said Mr. Pemberton,
pleased with the ladies, himself, and all the world.
"We shall see you on Sunday."
Then he left, accompanied by Mrs. Smith-
Parsley.

CHAPTER THREE

" .OW," said Arthur, "this will never do, you know.
1Maharajah; you can't threaten to beat any-
body on this property. You will soon be getting into
trouble if you do"
He said this pleasantly, laughingly, and the short,
thin East Indian he addressed nodded his head. H~e
was not angry with Mr. Norris for remonstrating
with him; it was done so pleasantly. Besides, MRr.
Norris always treated him so very well and was the
master. To the East Indian Arthur was: a sort of
god.
Arthur's eyes travelled from the gloomy face of
the man to that of his wife, who stood just outside
of the main door of the little house in which she
lived. She too was East Indian, tall, slender, very
pretty, with the thin nose, black, smooth, glisten-
ing hair and fine eyes which the better-favoured wo-
men of her race possess and show to such advantage
when young. Her full, pouting lips were now com-

6(.>->->-----~)~O OI .-->-o<-a-a-<-


SOn your Gar, Trucki or Bus and be free from

l'Tyre Trouble. P







SCeCil de COrdova &~ Co., Distribu tors. a


topped by hanging plumes of great green leaves, half
the length of the trees themselves. In front of the
cottage ran a path which a small motor car couldl
negotiate, and beyond this path, and parallel to it,
in the shadow of another forest of bananas which
spread out in the opposite direction, flowed a dark-
gleaming stream. The scene suggested seclusion.
Arthur ftl ltthr he must intervene in this quarrel
between man %ifd wife a little further if peace wats
to be established, and had better include the woman
in his conciliatory conversation,
"Well, Mrs. Ramsingh, I am sure you and your
husband have no real reason to be angry with Samp-
son," he remarked in a friendly tone, addressing her
directly. "Sampson told me about the quarrel only
a few minutes ago, and he assured me that he had
only been polite to you as to his nearest neighbour.
There is no harm in that, Maharajah; you, wIho were
born in Jamaica, like your wife, know that every.
body here is polite to one another, and that civility
to a man's wife doesn't mean a thing in the world.
However, Sampson says that he will not even bidl
Mrs. Ramsingh good morning in the future, as you
might object. And he will only speak to you whenl
he has to. Both you and he have to work together'
on Mapleton, you know, and it will never do for youl
to threaten him. You must keep the peace."
"Sahib," replied the Indian slowly, "I go my owni
way an' mind my own business; but no man must ir-
terfere with my wife. She is mine, and I won't hav
it."
"I am your wife, but not your slave," put in th.
woman sharply. "And you ought to be ashame or
yourself to think I would carry on with an ordinary '
brown man. What you think of me?"
"You are to carry on with no man, whether
brown or anything else, or ordinary or anything
else," retorted her husband heavily. "You can leavj
that to the black and the brown people, an' the w-
he was going to add "the white people," but checked
himself in deference to Arthur's presence. "If i

"e 'oud nak like fool!" rapped out the girl, stelp
ping out into the open garden and shaking wvithl
anger. "You always threatening me, an' I won r
stand it. This is Jamaica, not India, an' I don [
know nothing about India, and I am not there. :i
you ever beat me, I will leave you, but I will marl.
you first. Don't think you can do what you lile*-
with me!"
Her husband wheeled about to face ner, movedl
to even greater anger by her flaunting defiance (01
him; but Arthur intervened sharply. "Haven't
told you, Ramsingh, that Sampson denies having hadl
any intention of taking liberties with your wift '
He has only been on Mapleton for two weeks, andl
here you are, already, trying to have a feud withl
him! If you continue you will have to go, MI
Pemberton will see to that. You are not likely i.
be as well off outside of Mr. Pemberton's emplo'.'
Inent as you are now."
The East Indian knew that well. He was 5
"time-keeper," on the property, the head of the bar.I
of East Indians wNho worked on Mapleton. He was :s
good worker, intelligent, active, though of sour'.
brooding disposition. But Sampson was a good me n
also, and Sampson had been horrified when Rarl
singh had threatened to do terrible things to him it



THE ROYAL MAIL STEAM

PACKET COMPANY
(Racyal Charter- Dated~ 1889) .

PASSENGER AND FREIGHT SERVICES
BETWrEEN~
The U~nited Kingdom and Continent
and Brazil and the River Plate. West
Coast of North America (via Panamna
Canal).

Toiurs de Luxe:
During Winter months from Southampton
to Jamaica, and other beautiful spots in
the Caribbean by large, luxurious passen-
ger liners.
Pleasure Cruises from the United Kingdom
to Norway, Mediterranean, etc.

ReyulettreFreque t Fr ight cervand
Continent, and from Jamaica to North
Paoifi Coast Ports.
Regular Coastwise Freight Service:
Between K~ingston and Outports of Jamaica
by the Motor ships "ARNO" and "ARUN"
every 1 days.

For full particurlars apply--
THE: ROYAL MAIL STEAM PACKET:
COMPANY,
PORT ROYAL STREET, :: KZINGSTON.
Telegraph~ic Address: "OMIARIUS."


PLANTER S' PUNCH


pressed in anger, her eyes gleamed as she flashed
them from her husband to the squire on his horse,
Arthur, beyond his first salutation, had not addressed
her; his business was with the man he had joking-
ly called Maharajah. But the girl was not disposed
to be silent or ignored. She broke out:
"There's nothing for him to threaten about, Sa-
hib. He is foolish. He thinks Sampson want to
carry on with me, as' if I would permit such a thing!
And he threaten to beat Sampson and me. If he
touch me-" she left the sentence unfinished, but
there was menace in her tone. She would not be
beaten without indulging in some unpleasant form of
retaliation.
She was framed in the doorway of the house,
a building of three rooms all in a row and much
superior to the sort of places inhabited by East In.
dians working on a plantation.
A kitchen garden was laid out to the right
and left of it, a carefully-f~ended garden, with let-
tuces, tomatoes, radishes, cabbages and other vege-
tables growing in neat beds; in front of the house
itself crotons and plumbago had been planted and a
few rose trees. No other place was within a fur.
long of this one. Behind it stretched a vast back.
ground of banana trees, a background of tapering
trunks rising some twelve feet from the ground and

H)a(I IoN),)a-oH'-->-.ewo- 0I*>-~g ~IH()U I


1931-32


GET




I~e


~GE~~~8 ~

R X~I






PUNCH


PLANTERS'


19;31-32


he c-onltinuedc t. he polite to his wife. Ramsingh
tiall sanel that It thecy had been in India, there woul
ha~ti been somenl person dead already, because of what
had jccu!rred. bl~lt as a matter of fact nothing of
irup..r~tance. hlall occurred. Sampson had been badly
frlihrlenedt~~. for h regarded all East Indians as ter-
rlble I'e..plc. jtrlleln to the verge of madness, ready
I.1 .Hc knIlll u~nlt m~achete in defenlce of the family

h2:.lur He hdl nl th lgtst clsr o pal o

trli~oulr thle\ mnllit behave as ordinary people dit.
He wa3 do~lrne wth Ramsingh and his wife. But the
Eas it luian v.:l apparently mistrustful of his wife,
th.:.nehl (pr~....II ..f' her beauty and appearance. His
warnine threat;~ had~ been for her even more than for
Sams.nlS~1 jlo-- so1 now warning her again.
j AXll richt,. lihen, Sahib," he replied, then glanc-
I. .ul jis I rl aI. -1. If to ask why she was lingering
rhFre 1.It.r j-l.min\ more of the conversation. His
b~~okl plainly Inilcated his thought that she should
n.n~ Icir Itere, !le house. She interpreted it cor-
i..rl. butI m crel tossed her head and continued
f13dline whelrt sher was.
Shei w\as Ires sed in white lawn trimmed with
re.] al1...ut thle nea~.k~ and sleeves, and over the backr
,,i ber Icil ad wa hrown a filmy scarf of red, which
framedl ;Indt Tet ~..nt. the beauty of her face. Strung
.au be~l r are` orntsl were some bracelets of beautifully
we~! iked silverl. !n her ears silver pendants hung. But
her nees hadl nc~r be~en pierced for noserings, as were
thoset oft mel.--t ..her of the East Indian girls about.
This as :enltuatedr l her difference from them.
She~ w~...rt trees of a somewhat delicate make,
with :t.rl kinrs ..(i artificial silk. Not another East
Indialn \\inan can the property wore shoes except
on \'iry npecia~l .1..casions, not another was garbed
Iike herl and1 I or. carriage, her pose, her look re-
, rrurl Id~ li11.1!.whhl she thought of.herself. Like her
had.and11. .L1 tIc liaI been born in the island. Her
firbel haul1 c..mei ovl\er in his youth as an indentured
Imme.I-:llnt limI~ le-~ng since served his term of years,
ha1 ~rrll w.rkd ..rl.I -aved, acquired some property, and
hjti tI hi; h~r le daughter to a school where
she I~t hd bee r rained much like the daughters of
Ithe betr-s 'l:a. native farmers. Her parents had
been I'hr.i'tianil-red. She had grown up a Christian,
butr ..nei Indianj~ 1 IItom the father had insisted upon:
sht ilnvi beenl mar;Iried to Ramsingh before she left
sls hiard. mlll-aril ..I! fourteen, though it was not until
hEII use" Il:te- II rht she had been sent to live with
herhe-..a.) He was twenty-four at the time of
thick .~ll~-- mar II a advanced age for an East Indian
matria man Pr the fact is that he was a widow-
er iall-ni be nian ied this girl; his first wife had
died in ryear -ii in.tore. They had now been married

Tile -s.-...r..l wedding had been arranged between
hilul :IIrid Mrlle a father--Marie was the Christian
name~l ..t Ill- \i ste. She had seen very little of him
behare-~ ~- I...l n iallae, had had nothing to do with the
-h...an .. Iin And this, though she was still in-
foluer .ed 111 !lell.ia customs and ideas, she secretly re-
enrltrl Sher \*.,- really the product of two cultures,
vo~nrli, lrin al .i.-s. She had made some friends
smo:rl. rl n .tt the schools she had attended
untl had~ !!I~Ial~ .1 something of their way of thinkr-
ineon. ll But her husband, though he too
hlad Il.-ier I. en ..atside of Jamaica, was almost as
mas li ..t th; E,.~-r in his ideas as his grandfather
531I..nII- 11.i.1 strongly that any woman, especial-
!.I .I ..II .li. th riaywrkes shol scl
of ther 1=: -r..-r 1... rion of women was buttressed and
: lreinf..~i I. 1 .. a naturally sour and jealous disposi-
tionl.lll .Ir.. 1. ...nprehensive knowledge of the lar
morraillri p I''\..HI everywhere. He knew he could
n..tr m!i:;r II!1.. h he wife going about veiled, but he
wih-l ie- ri.IHe knew that female honour
amon. Ib, .r. ..s..g classes was not highly regardedl
in al Iarl .I ..- sexual relationships, and he was
herlrl; Ip'!'o in!-!!ve lest anyone should thin)< that
in 11 11- -0-*l.(l'lj.1 Ihere could be any laxity. He had
his-- 1 .<11.He was of a high caste, the second
lif the.!~I .I... m-r c:astes of India, and therefore held
Llrnwif I.. I1.. ..r consequence among his own peo-
Ille 13alr bl.11ac father was still alive, and Marie
wL.4 i\ll :=*.n ll Iat some day she would be inde-
pendentl ~...t !.0 un-lband in the matter of money. Her
fathe r un- li \in-oLl to her; there was no other child.
Her hulFll band ha done very well, had a good-
Pitulation. Ilarn*l:.1 high wages, but he was not:
in heri cl.o-- fIllancially, and Jamaica was not
Indlia. 51he i!**.ubt not be subservient to him, anld
she I~r3earital nII- threats with scorn. The day he
laid har..1-- up..n her, she would leave him as she
had Iaid. -be un~uld go back to her father.
"I wnnlt ?.=.1 to come with me to Old Dingle
farm. Hom-inglltl. said Arthur, partly because he wish?-
od it nl 0a company him,apartly because h
bitter Icontinuanselir of the quarrel between him and
his w.ife **Get liur horse."
And thefn s luck would have it, just as Ram-
singh was turninga to go to where hqi horse was kept,
the bT~row ma1n. Sampson, the immediate though in-
n cent iause rof usle existing marital discontents, rode
Ir'.netw rre:*ii on Page 29).


yl111111111111111l11111111111111111111111111111111111011110111111111111111111111111111111



... ECRTESCRORTO

IIIE






ROYAL SECURITIES ORPANORATIONAR









-Offer Government M/unicipal And



..:Industrial High-Grade Bonds at Re-


-munerative Rates of Interest.-


















BRANCH MANAGERS MANTON a1 HART "

g ~R. BRAHAM HARRIS-
@ TRVELLNG RPRESNTATV~sR. A. FIGUEROA
TIYLI RPL.TIr GORDON S. ANDERSON *









I= 00MMERCIAL UNION ASSURANCE







CALEDONIAN INSURANCE COMPANY.




^UEENSLAND INSURANCE COMPANY







Fire and Accident Insuzrance.



AGENTS MANTON s ]HART





~d l;;illllllll 111111111111111 lll h llt illll llulllllll1.




PLANTER S' PUNCH


1931-32


you


of


or of


appertaining,


to their


maintenance,


your


to


V: B. Myers,
Manager.


When


think


A automobiles,


any thing


thoughts w~ill


naturally


turn


Motor Car & Supplies (1523) Ltd.





























































;J
..5~


g EST
i
I
I
j
P

i


5
5
i

1
j
j
I
j
8,,,,,,,


INVESTMENTS received on Subscription shares,
Paid up shares, and Deposits.

Liberal advances made on approved securities.

Terms to investors and borrowers equal to the
best in Jamaica.

Business accepted in all parts of the Island.
Prospectus and full particulars given upon a~ppli-

oweo to G. OWEN OVER,

(Secretary)
.On.Men ..om)O)I tNu lMelmamm NLmeness tmonum n aesno .mosse


BEEF IN H~1l EF

obtain yolur iuplies~ on- Con Cuble*. inl unsl. f'romll ('ern I. FNews Ltd..
10 HlilU h iled ll inHilca.


PL .4 NT E' T S' PUNCH


1931-32


Having finished his work, Arthur went up to
the house for a wash. Then he and Mr. Pemberton
sat on a sort of balcony overlooking the eastern ex-
panse of Mlapleton and slowly sipped the cocktails
which a maid had brought them. Lunch would be
served presently.
"The house will be full later on," remarked Mr.
Pemberton. "The Beavershams are coming, and Dr.
Crossley and his wife, from Portland, and the two
Reamster girls and their brother; and some other
people. I hope they'll have a nice time; but you
will see to that, Arthur."
"I'll do my best, sir,"' said Arthur.
"You always do, my boy; you are thoroughly die-
pendable. I wonder how some of my friends will
take Miss Ludford."
c'I don't see why they should not like her," Ar-
thur protested. "You do, I think, and you are as
good a judge of a lady as anybody else in this coun-
try."
"I hope so; I think so. But there's Arabellaz
Beaversham; she doesn't know that your young~
friend is coming, and she asked me particularly
never to bring them together. The truth is I for-
got her injunction, or I don't think I'd have asked
the Beavershams this time. It can't be helped now,
however. Peculiarly stuck-up some people are, aren't
they ?"
"And who are they?" asked Arthur warmly;
"what have they got to be stuck-up about?" If you can
invite anyone to your house, I am certain that an~y-
body else can do the sanie. Your example can al-
ways be safely followed."


III.-.e in,i- Ir lo- .I rn..net words with Sampson, or

I,....:~li~l ,.I ...\.#.1 by Arlthur's manner; he
1.11;\. is.~ rl.... 11..\ic., i'..niberton might act severely
iif Ip.~~.v..kei~. ;lthough- I he' preferred to humour good
.,,, ju,l 11- I1m1- 11.-s11. ,r 1,...il.1 r.ll,: he! iVife away from the vicinity
( III ..Int.11..0 1nip-.us though it meant the abal-
,,1sIn!II. nti ..( I:;.lllh-I1 -arden he had made and so
...a-rs.li:III.I" Hil l') 1rley was the plantation
? 11, It ibic N..IIn- n, as.led for his uncle, while at
ril- -ameII Ilil) .l~.....-nulllly throwing an eye over
Lal*(~!''* .!1d jC1" nimi-r Morley was miles away,
Is,11insi..heeyei-. orlad.Ramsingh bow-
,, 1 .i'I **It e-sen. -r a sullen glance at his wife
**~ .:. b." -1.- r....k thlis coming change, observed
.!11. -...u.11 110 ....intlllenance, and rode off with

[r \r ,- ornal.,,~; I:uests were expected at
i~l II le-r..II ri,.. ,II r.'"I I'...,lr the week-end; they would
-.l,.., ,,.- IIII jl~inil\ is..arning. Arthur had driven
iill sill\ 111, rn..IIIuneL. Ilis uncle had asked him to
,,,Ie .~.irl 1..II .s :110.ll-ton on the Saturday fore-
I,,,,,0 .10.1 r.. -ll..0<- ii !i~ll! he thought should be done
s itI ..ie ..r' r.... ..I Ilie more backward banana
lrit He- Iliae: rI.I ns Mr. Pemberton would no~t
..1.1.-. r 1.. ht- r.llkine Rar.li-ingh to Morley and putting

'T!!. Lilor~ i...11.1 .Irrive before tea-time, so he
,,, b.I~r in1--- hm hen he Darted from Ram-
-in.!1Ii, b 1 r..- the I Lns another warning. Ramsingh
I. ne t-rl I11 tha th.1... uld be no further trouble,


111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111

THE EDUCATIONAL SUPPLY C O.,

S16 King Street, Kingston, Jamaica

-E BOOKSELLERS, STATIONERS, AND PRINTERS.


|SCHOOL~ BOOKS, REWARLD BOOKS, NOVELS,8
.'l'01 ~II IT. BOOKS, VIEWI P'OSTCARD)S, STA1TOIONERY,
TENNIS AND> FANCY GOODS,
SCHOOL AP'PLIAN( Els.

=I
j ~W. R. GiblES,~S Manager.


Br0Wn S TOWn Benefit Building S00181),

BRowN'S TowN. ST. ANN.


ct

" I
U


Fsl ;Ll~y. c~ ~
i4;1. C

~ \'~11I c~n~chic\~.


that rich app~etising throu~ir which i thc mark l
of the chef.

Makes G~ood C'ookiing Hettter

OxoI gives3 th- T11avou,~r of, beefc to~ \cegetahh-l
dishes, andl makes the-m molcre who !lesome~nl---b 1:
sides saving wvork for the rcoo~k.


.INCORPORATED 1899

99,330 17 3


ABLISH-ED 1893

ASSETS


The Cup and The Lip


Gero1t n1 '..1 nt 1' nri.. s:.rin 'c 1.- is 1. i II..r p u ii *
re \~lk..I I I~Ir ~lie 1. 11 he &..1 .4l I nts: Ilit..m -n.- !! I.I

nt'I.it F.,rll ...s Il_l n .* L.IsIIIl -- ..t .lil. I(.-1211- 1

isvii I.* -jirn-a tr I14r ill Is, liri~IIr. I1 II.=-1 e...r .
Iur~r l I" 1.. hi II a~r! Hina- in l I nsli II-I ---! 1 (tII-
pa..Ian1 1 nl Iibc -.. nl .il- 1 1Is. It
Il*., fl.. I E n t 1IneIlI In .l..s la.1'1 h at Ill l 111 11' 1

v.11,.~ a- ...II rial.l.!l Ill..rlill 1...11...ks.. I1I. ,,,,
1 l. ..nr'l !1 Ihis I car- **E. 0-. nII .-,'~ ,,, 11!1 ,,
H,-ll~l r *I -.1 1 .11 In-l re: k -.11 1 1il .... -1.--11 1. I .==.*1



sle. l.Ir I. 111 -swi \.II'I 1:- ( ri n a n t*Il -1 lu t. II




al~I prt.k ac Iils: ln i
tht Ilil..\ l ie l-ll That. 1: 111 1 1 -1 -I11 a I.] th*

.1111111 1111.1 1111 l :l!-l
liall~1 11-**n 11,,,, 1 s1(-. ...., i ., 11 o ilr -n u ... i.1 .
g IL.! I ar ll 1ric 1'.1 .''1- \--... 1 .Ir '1 s. 1 I r., 1
wIll' Al l N I '. Ir I I 'lll l -* II1 -1
. rl li l 19 1 I hu ,* *lbji, .111I III Is. Hli II 1 I 11!1.. I

it*1 1 11:1..I rllIIII'- E .- I lnritan ..I I-in_ rIII tI~ I ~
ne a I ndll .I li.-r-.11..i ilel.. ~uLr ICI : Itrn 11 1' 1


La seht n krl m.*~illrl li In. rs- C. .r e i]nu -1

1i .I n .\ u H nd s h --t e-0 1 i. I-II
-staba riir\ h nowl- ---1. n n. .. t 1 --le .- --


Q~~,(IH~(I).QI(~P(iI)(I~C(i)OQ(~ ~(.~D'~~IW~UIII((~)O~)(UD
i i
I O
I ~-t~--~-T~----- P

36

~.5~L~ I

r,--i i r~-~~ ~r~~-r'-" 1

~~'~j13gg g


~A sure


Foundation


bas~is forT yourl
ilpuos. grav'ies, steave and curriie


RESERVE FUND 10,073 8









Isp( dP)( Q)( Qll.dB(.B( Q)( ~9i~( 13( 0' U(.Q~~r)O(~dOC)OO(.Q(.a~(~-('BU~)IIQI


)Q(~MI(N(Y(Il)(~)thl)O~1)QO~,l)Qll MQDI~IP(~~~(~P(1el


O I)I)~II)(~H)tUO)tUtlO )~I(BOQ )Q ~QDI)QIII~P- IC~)Q )BBOQ-)~:IQ)OQ()CD.)~OOO(it )i)~. )Q)(1BlO~OQ;)0.1~i)00~0Q00110tle(lQ


1931-32


PLANTER S' PUNCH


Channrrrin979l set inz bea~te-
tiful and exctensive
grounds, si w hund~redl
feet abov~e sea level,
offers first class acccomn-
modantion, sixz miles f~rom ~
Kimiion. Delightfully
cool all the yJear.


Qu~iet, selec~c~tl sad fc-
vourite! resort for those
seeking rest, e.i~
first-rate facilities for re-
cr~eatics, including:


GOLF--Links adjoininzg
the prrooirrr -

DANC'ING, TENNIS,
BATHING;

Okanrming Walkslr, MIotor~
trips to all placces of int-
terest in the Island.




ATE.

Proprietors:
CAPTAIN & MRS. RUTTY

PHONE 6105.


.c .e -

r. .


....-. ~r-~ "r


silver in the sunlight. Pastures for cattle, pastureii
with short, sweet grass, were situated on the other
side of the river, in them were half-bred Indian
cattle, browsing, chewing the cud, standing meditM-
tively, or lying indolently on the ground. The eye
travelled farther and lit upon great fields of green,
the banana fields with their trees of level height,
trees standing like regiments drawn up on p~aradle,
rank after rank, until in the distance the vision was'
lost in a horizon of green and blue.
To the right, a few miles away, rose the hills,
and behind these hills were mountains. Ve~rdure
clothed them from foot to summit, and over their
heads drifted islands of cloud. To the left the land
ran unevenly, and there the prevailing cultivation
was coconuts, the tall stems of which sprang light-
ly into the air, topped by drooping yellow-green
fronds and bunches of green and yellow nuts, each
nut almost as large as a man's head. The sunlight
was reflected from the burnished fronds; the sweep-
ing array of these lofty, graceful palms was beauti-
ful to look upon. Green, green and yellow was the
prevailing hue of the landscape. The scene was o~f
the tropics at its loveliest if not at its grandest
and there was wealth in those ordered farms and cul-
tivated fields. Mr. Pemnberton's eyes gleamed withl
pleasure. He turned affectionately to his nephew.
"Isn't that something, Arthur? And everything
shipshape, and my contracts with the United Fruit
Company all satisfactory. Well, my boy, it will all
be yours when I am gone."
"And I hope that that will not be for years
and years yet, Uncle Alfred," replied Arthur sinlcere-
ly, for his affection for Mr. Pemberton was genuine.
"You treat me very nicely now," he went on, "I am1
in no need of money."
"There's no reason w1hy you should be," the other
man replied: "you earn what I pay you, no stranger
could look after my properties as you do. I am
satisfied with you."
"Thanks, Uncle Alfred," said his nephew, rlap-
ping him affectionately on the back; "and now let
us go in to lunch."
"But I want to see you married," the other rz:an
continued, as they walked towards the dining room,
"you should marry and settle down. You have a fine
house at Morley; there's nothing to keep you baci.'
"I know, I know," said Arthur smiling; "we shall
talk about that later."
Then they sat down to lunch and the? conversel-
tion turned to something else.

CHAPTER FOUR

SETWEEN three and four o'clockt the guests began
to arrive. Tea was to be served in the long
front verandah, the windows of which opened on three
sides of the house. In the middle of this verandah,
looking south, was the covered balcony.
The house was of three storeys, and because of
its elevated situation could be seen miles away. On
the ground floor were store-rooms, a billiard room,
and various offices; on the upper floor were the draw-
ing rooms--two--the two dining rooms, one much
smaller than the other, a spacious entrance hall, a
library which contained no books, a "study" in
which nobody ever studied, and the verandah already
mentioned. The topmost storey contained the bed-
rooms. There were ten of these, with a bath to each
one. To take care of such a large establishment 1Wr.
Pemberton employed a small army of servants, wyith
a very efficient housekeeper to supervise them; he
also had half-a-dozen garden-boys. His principal
chauffeur was in charge of the garage at the rear
of the building, a garage capable of accommodating
several motor ears.
Not only in front of the house was there a gatr-
den; at the sides also, and at the back, were gardens;
the bedrooms and the tables of Mapleton never lackedic
(Continued on Page 87).


Mr. Pemberton expanded under this tribute to
his social position. This was just what he had been
thinking himself. After all, he knew all about
Beaversham, and there had been a time, twenty
years ago, when he would hardly have thought of
having Beaversham to stay with him. Were such
people now to set themselves up against his judg-
mnAnd the girl was so nlice, so stylishs go-
looking, and such an artist. W~hat did it matter
what she did for a living, or wrho she was? Still,
he felt a little curious as to who she really was.
He voiced his feeling.
"I wonder who she is, Arthur? I mean, who are
her family in England, and what is their position?
She speaks quite well, she has good manners, and I
am sure that if our friends knew more about her
they would all accept her. They will in time, of
course, but it is because they are in the dark that
they are hanging back."
"She is very frankr about it all, Uncle Alfredi,"
Arthur replied. "Her father is dead, her mother is
alive, her brother died years after the war through
some lung trouble as a result of gassing."
"But what was her father, Arthur, what did he
do?"
"I think he was in business of some kind;
Gladys says he made quite a nice little pot of money,
then foolishly went and invested it in a speculative
company and so lost everything."
"Well, that was his misfortune, not his fault,"
commented Mr. Pemnberton, inclined to be generouls
and forgiving as the money lost had not been his.
"'But a man who could make a decent bit of money
must have been in a good position."
"Of course he was," said Arthur positively; "you
have only to look at Gladys to see that she has been
well brought up and that her people must have been
gentlefolk."
"No doubt about that," agfheed Mr. Pemberton.
Now Gladys Ludford had stoken the truth when
she told Arthur that her father had made some
money, then lost it, that het mother was alive and
her brother dead. But she had not told him that
her father had been a master-tailor employing fve
or six journeymen, had prospered at his trade, had
sent his children to good boarding schools, being a
man of ambition, and that it was to the schools
that her accent and deportment were mainly due.
She too had been ambitious; she had profited much
by teaching and example. But the tailor's shop was
kept discreetly in the background. After all, why
mention anything that might sound unpleasant?
"Gladys went into partnership with another lady
after her father's death," continued Arthur, who
could talk with enthusiasm for hours about the girl.
"She had to do something for her living, and she
had studied art at a good academy in South Ken-
sington. But the business--much the same as the
one she has out here--did not prosper. So she be-
gan to think of something else, and as she had heard
about the Colonies she thought she would try her
luck in Jamaica. The old man had not lost absolute-
ly every penny, you know, there was the house and
a. few hundred pounds." (He did not say that th-?re
had also been the goodwill of the tailoring business,
which had been sold; he knew nothing about that.)
"She has not done badly since she came out, either."
"I am very glad to hear that," said Mr. Pember-
ten. "Come, let's go into lunch; the bell rang some
time ago-"
He rose and cast a long proud look at the scene
spread out before them, and Arthur followed his
glance with a similar satisfaction. The huge house
stood upon a knoll which sloped in front towards a
level of green sward, a part of which had been laid
Out Rs a tennis court. Between this tennis court and
the house was a garden in which bloomed tropical
flowers and coloured shrubs; farther on the ground
dipped again, again became flat, then rolled away to.
wards the bank of a broad, shallow river that was


TRAVEL BY RAILWAY. i

'Wth Hrailwayv jouneylcsR :Ill..11 th ines lct
view~s of thre! :Ind--lillll *III scenery Of tle


KINGSTONl TO Ml~ONiTEGO BA Y--
112 MILES. ,
ThI'is jour~ney takes the passenger
thrlougih Sp~anish Town, Williams-
tield (station for Ma~ndeville-'' The
English Village") over the Greenvale B
pass (1,705 feet). Between 31.I:-lc.tty
and Cataddupa the railway runow
through th~e famlous "Cockpit Coun
t-ry," a series of cir~cular hollows and
hills of great depth and height, and
of peculiarly wild formation. The 1
Ra~ilfay cuts into the side of thle
hills, and tunnels through them in a i -
bewildering series of curves, and p~ro- a
vidies thle finest views of this uniqule =
"Cockpit Country."' In no other way
canl views of the Cockpit Country be
ob~tained.
A p~articularlyr fine view is afford-
ctl of }j,,agg, ,.~ Bay, across the Bogue
Islandls. I
Monc~ltego Bayv-Doctor's Cave---one of ~
''the lIIIII-I coral bathing beaches in
the wforld. \\nn11le1IIII1 sun1 and sea -
bathingf reccommendedi by Sir Herbert I
i~lBarker thle world famous bone-set- I


SKINIGSTON TO PORT ANTONTIO |
--75 MILES. I
Thrlough the Bog W'alk giorge and
thle fertile and picturesque St. Cath-
oridje and St. Ma~ry Country. 25
niles of wonderful coast scenery. Ex-
cellent bathing at Port Antonio.
i KINGSTON TOQ EWARTON--29
MILES.

SStation for MIoneague, Golf Colurse;
bathingf at the famous Dunn's Riv-er
h~each. r

K IINGSTON TO FRANKFIELD---- 5
56 MILES. I"
Thr~ough the fertile M~inho Valle~,
aInd to thle foot of Buill Head monu 5
tain the centre of the Island. I

i TRAVEL IN SAFETY.
Tickets, available for one month, for the
w hole railway, 4 each, first class.
stations at specially low prices.
For particulars as to trains, fares, etc., apply
to the Traffic Superintendent, Jamaica Govern-
ment Railway, Kingston, or tH.C OEL

Director, Jamnaica'Government Railway.
SKingston,
Jamaica, B.W'.L
54 Sun ... ....n...n ... mon ...n.......................m ..............


T HE M A NOCR HO3U SE HOI)TE L
C ON STA NT SPRING P.O.


























__


the Emplire


1931-32


PL .4NTER S' PUNCH


:~ i


SNIPE
FlVE SEATER TOURER


FlVE SEATER HILLMVAN


s*rlllll~r '


C .


COMMER
30-40 CWT.
CHASSIS


TELEPHONE No. 3111


SERVICE STATION 159 HARBOUR STREET
TELEPHONE NVo. 3188


cABLES: LrINBERI KINGSTON
CODES ABC 51h AND sth EDillONS
LIEBERS AND BENlLEY5


BER


W~IZARDl =


Be Britishl buy British
and tradle within


BRITISH MOTOR CAR CO. LTD
1 11 HARBOUR STkEET, KINGSTON
JAMAICA




1931.


P LAN T E RS' P U K E H


I I
IWhen you buy a Dunlop product
you are sure of obtaining an article
of the finest quality, made in
England by expert craftsmen who
take a pride in producing only the
best,


Behind everyr Dunlop product is
the most highly organised service
in the world. Ajs Depositaires for
the Dunlop Rubber Co. Ltd. wve are
able to extend to customers the full
advantage of this service.


II
._i~*rllllllll~~`~
'''
:5
~~-.------ ------- ""~' '


Pneumatic Tyres, Tubes
and Accessories;, Golf
Balls, Tennis Balls,
Rackets and general sports
goods.
,.~~,,,Depositaires:

"* u\"'L'BritishRubberAgencies Ltd.


111 Harbour


~Street


KI NGSTON


JAIMAICA


Printed inl E~ngland,


11. I he 4.P. 51


******SERVI C


Buy


OU


O







PLANTER S' PUNCH


1931-32


and "Laughter," into big ones, by her great per-
formance. She is very versatile--not only speaking
and dancing well, but singing well. This little star
has had a hard time in pictures. She had many film
tests before she was given a job in the movies, being
turned down sixteen times because the producers
thought her face was too round! To-day Nancy's
face is still round, yet she is one of the greatest box
















office draws, and has been selected by John Murray
Anderson, the great showman, as one of the ten
loveliest women in Hollywood. Nancy has a good
sense of humour. I recently read the following: "A
temperamental director and Nancy (not untempera-
mental herself) were having a 'come to' over a detail
in a scene. Suddenly the irate director yelled, 'Next
to--(naming a very unreasonable star) you're the
most infuriating woman I have ever worked w~ithr.'
'How dare you,' giggled Nancy. 'After I've spent the
best years of my career earning the reputation of










I O




the most infuriating woman in pictures--you give
me the second billing!"'

ONE of the most successful of the old silent stars
is Bebe Daniels. She has blossomed forth into
an excellent character actress with a good speaking
and singing voice. During the past fewr years she
has been given a great deal of publicity, though she
is one of the few actresses about whom not a breath
of scandal has been heard. Her marriage to Ben
Lyon--and strange, as it may seem, her first--wa~s
popular, and her wedding was one of the most sperc-
tacular that has ever taken place in the movia


did, and, as can be imagined, he had a much coveted
role as he had to play opposite the world-famous
star, Marlene Dietrich. So well did he act, that it
is hard to tell which one made the greater hit. I
think great things are ahead of Victor McLagen, for
with his personality, English voice, fine physique
and varied accomplishments, it will be hard to keep
him down.


"Rio Rita," a stupendously lavish picture in techni-
colour which ran successfully for months in all the
large cities of the world.

DYNAMIC acting is all very well, but when it is
overdone it becomes boring. One does not care
to see an actor diving over the back of a bed, vault-
ing down the stairs, jumping through windows, when
there are Derfectly good doors for him to walk
through, and sliding down ropes in quick rotation,
as if he was performing in a circus rather than in
a picture that is supposed to depict some form of
American everyday life. It is childish. There are
but few actors who introduce this kind of thing into
their pictures, for if not well and cleverly carried
out it is a horrible failure. Of course, it depends
very much on the picture. Stories by Alexandre
Dumas, and Hugo and a, few others of the same type,
lend themselves to this spectacular form of acting,
as has been successfully demonstrated by Douglas
Fairbanks. But in "Reaching for the Moon" I think
he overdid it. Had it all been humorous as his ac
tions were after drinking the snappy cocktail, it
would have been good. Thle result was, Claude
Allister nearly stole the honours from him. Mr'
Allister is one of the cleverest comedians in films
to-day. He always characterizes some form of
European aristocracy in the neatest way--never
overacting.
Twio other "dynamic" actors are John Barrymore
and Frederick Marsh. While the former--who is: a
member of a famous dramatic family--has always
been a famous actor, the latter has increased his
popularity a hundred: per cent since the advent ofe
talking pictures. He astonished the public by his
excellent performance in "The Royal Family on
Broadway," with Ina. Clair'e and 1Mary Brian, a pic-


AMONG the: historical actors, George Arliss is by
far the best. His remarkable performance in
"Disraeli" will not easily be forgotten by the large
number of people who witnessed it here. Arliss is
perha.ps the only actor of his kind who is able to
breathe life into a cold history-book character, trans-
forming it into a warm understandable human being.
It was possible in "Disraeli" to forget George Arliss
the actor--he was in fact Disraeli. His voice lends
itself easily to historic portrayals, being clear, pleas-
ing and dignified. Arliss has followed up "Disraeli"


with another masterpiece, "Alexander Hamilton",
which has been judged by the American critics as
even better than "Disraeli." In this picture hie
characterises Alexandler Hamilton, and is; supported
by a good cast, including Doris Kenyon, who plays
Betsy Hamnilton, June Collyer and Alan Mowbray,
whose portrayal of George Washington is excellent.
Arliss is by no means a young and handsome man,
whose love making is calculated to make a sweet
young thing sigh and hold her boy friend's hand; he


ture which is supposed to be a burlesque on thle
Barrymore family. He has a good speaking voice,
acting ability, style, and individuality, and ,these
coupled with good looks are bound to make him suc-
cessful--provided, of course, his producers do not
cast him in mediocre and unsuitable parts. His per-
formance in "The R~oyal Family on Broadway" and
"Honour among Lovers" (in which he was happily
cast with Claudette Colber't) has gained for him, hun-
dreds of new fans in Jamaica. His pictures are al-
ways popular here.
NE of the many Enlglishmen who have made good
in Hollywood is Victor McLag~en. He has lived
the varied and colourful life of an adventurer in all
parts of the world, doing whatever work he could
get to do. Needless to say, his many experiences
have stood him in good stead in the moving picture
field. MlcLagen comes from a family of stalwart
British soldiers, and ran away from home when very
young to enlist in the Life Guards. He is a good
athlete and has a fine physiqlue--a physique which
impresses you immediately as he steps on the set,
as not only stalwart but agile. He is a wrestler and
boxer, and was once the champion of Eastern Canada.
As a matter of fact he has been sometime in his
career a professional boxer, and once fought Jack
Johnson a no-decision bout. After the World 'War,
he made several pictures in England, and then wen~t
to America. He has made a success for himself in the
United States, having played major roles in such pic-
tures as "The Beloved Brute", "What Price Glory"
and "Dishonoured." I think the last named picture
was a great triumph for him. His acting was splen-


has no sheiklike qualities; no wise cracks; neither
doces he croon; yet he has a following of thousands
of fans, which he holds and increases yearly just by
sheer genius and acting ability. A picture of his is
always a welcome change: it is sure to be devoid of
slap-stick, mush or anything trivial. And it is also
sure to hold you spellbound by the remarkable per-
sonality of an amazing man.
Practically all the stars have demonstrated that
the talkies have not been able to dislodge them. It
is true, however, that a few of the old favourites


colony. She has been growing steadily more beau-
tiful, and a little while back, was considered one of
the loveliest brunettes in Amnerica. But Bebe hlas
shocked them all. She has followed the new trend
an~d become a platinum blonde! And now she bids
well to become one of the loveliest blondes in
Mloviedom. In "Reaching for the Moon," with Doug-
las Fairbanks and that picture stealer, Claude Allis"
ter, she surpassed herself: she showed how versatile
she can be, playing the part of an irresponsible, ful-
loving ebullient and slightly domineering person.


have gradually sunk into oblivion owing to their
disappointing voices, but the majority are doing well,
In fact somne of them are reaching unpremeditated
heights, for in the silent pictures it was beauty of
face and form that counted mos~t--acting ability was:
a secondary consideration--but now acting ability
and voice come first, and to-day there are many
young stars who are dancing and singing away onl
the road to success, who would have been merely
average performers in the old silent pictures.


Her voice, though distinctly American, is good, and
can b~e very emotional. When talking pictures came
into vogue, her contract with Paramount had just
expired, so she slipped quietly away and did what
she had always wished to do--developed her singing
voice. What an asset this is to an already accepted
star, who isj beautiful, and extremely popular, can
well be imagined. Her singing screen test was so
good that RKO immediately signed her up for a long
term contract. Her first picture with them was












BA~RCLAYS BANK

(DOMINION, COLONIAL AND OVERSEAS).
FORMERLY

THE COLONIAL BANK

Incorporated b~y Royal Charter 1836.
Re-incorporated by Act of Parliament 1925.

W~ith. which are amalgamated

THE NATIONAL BANK OF SOUTH AFRICA, LTD.
A4ND

THE ANGLO EGYPTIAN BANK, LTD.
Authorised Capital 10,000,000 Subscribed Capital 6,975,500.
Capital Paid up 4,975,500 Reserve Fundt 1,650,000.
"Deposits" 31/3/;31 62,473,4993


AGENTS IN TI-E WEST INDIES FOR THE~ BANK OF MONTREAL.


Over 400 Branlches throughout British W~est Africa, Eg~yJpt and the Suldan, TraLnsvaal, Rthodesial, Calpe
Province, Natal, Oralngec Free State, Swa~zilalnd, Portuguese Ea:st Africa, South-West Af'rica, Tuneanyik~a
Nyalsaland, K~enya Colony, Maltal, Gibrldtar, Palestine and Mauritius.

WORL D-WVIDE BANKING SERVICE FOR TRAVEL AND TRADE.

T RUSTEE DEPARTMENT T-HIEA D OFFICE--LONDON,

THE BA~NK UNDER~TAKE~S THE OFFICE OF1 EXECUTJIOR. AND TR USTIEE.


1
__
I --- -=


1981-~32


PLANTER S' P TI NCHI


HEAD) OFFICE: 54 Lombard Street, Lonldon, E.C. 3.
LONDON OFFICEli (Colonial Bank Section.) 29 Gracechurch Street E.C. 3.
MANCHESTER OFFICE, LIVERPOOL OFFICE, HAMBURG OFFICE.
21 York Street. 25 Castle Street. Adolphsplatz IV.
NEW' YORK AGENCY.
44 Beaver Street.

CANADIAN AGENTS--BARCLAYS BANK (CANADA) M[ONTREAL & TORONTO
and THE BANK OF MONTRIEAL. All Branches.
BRANCHES IN THE WEST INDIES--AntiguaL, Barbados, Dominica, Grenada, St. Kiitts, St. Lucia,
St. Vincent, Trinidad.

BRANCHES IN JAMAICA-KIingston, Annotto Bays, Fallmouth, Lucea, Monteg~o Bay, Mqorant Bay,
Por~t Antonio, Port Maria, Savanna-la-mar, St. Ann's Bay.
BRANCHES IN BRITISH GUIANA--Demerara, Berbice.


P. E. N. M~ORTIMER,
Asst. 1Vanager.


REGINALD V. BUTT, ,
IVanager Jarnaica Branches.






PLANTERS'


PUNCH


1931-32




















































































































OFFICE:
No. 6 DUKE STREEF~T,
Kingston, Jarnaica, B.1V.I.


Hon. Sec. & Treas.


.. ..931-32


77~e Cup ad T LC
(Continued from Page 30).
for flowers at any time of the year. The gardeners
were East Indians, a people particularly clever at
horticulture. The rest of the servants were black
or brown men and women, the housekeeper herself
being a coloured woman wvho managed the domestics
with great efficiency*
Labour is cheap in the tropics, and it was said
fha pr Poembetesonvnennd etepn thousandlow. e
could afford to pay for abundant service.
He liked to entertain. It was a distinction as
well as a pleasure to be invited to one of his house-
parties. He did you well; the food was of the best,
the wine was good, and he took care to let his
gusseno chem la as they pleaseld.hHea dd on

carri coale guests were taken charge of by him
self and Arthur as they arrived, the ladies were
shown to their several rooms by Mrs. Prince. the
housekeeper. The men were asked if they woruld
have a whisky-and-soda after their long drive, then
they went upstairs to wash the dust off their hands
and faces. Presently all of them, men and women,
came trooping down to tea, and those who did not
already know one another were introduced. Gladys
was the only real outsider present. She felt a little
peculiar, a trifle out of ease, at this exhibition of
her unfamiliarity with so many persons of the upper
social world. But she had come with the Smith-
Parsleys, and that was something.
She was dressed in a skirt of white English spun
silk, with broad pleating. Her bodice was quite plain,
white, with a V neck. The sleeves of this bodice
were short, and over it she wore a light-green coatee
with pockets. The bodice was fastened at the top
with a beautiful gold brooch. Altogether, her attire
was very effective, and she knew it. She knew how
to dress.
The guests were grouped around three or four
small tea tables, and it happened that Gladys found
herself seated near to Mrs. Beaversham, who regard-
ed this proximity as an impertinence. Mrs. Beaver-
sham was scandalised. It was all very well for Mr.
Srm boeratohn o uac -it pi ei p bnutn gt oiny ":
world! And she, Mrs. Beaversham, had warned him
that she did not wish to meet Miss Ludford. Could
he have forgotten, or had he deliberately ignored
her wish?
Gladys sensed--almost anybody would have done
so--that Mrs. Beaversham was antagonistic. She
had noticed also that Mr. Beaversham had been cold.
while lissmBaeavers am hal been amos we hi

introduced. But Gladys was a young woman out
to make her way in the world, and she always en,-
deavoured to break down barriers when these rose in
her path. This was a ektse for another such endea-
vour.
"You have a very lovely daughter, Mrs. Beaver-
sham," she said, as that lady seriously poured te <
into four or five cups.
"Thanks," said Mrs. Beaversham. "Do you take


WHITE SANDS BEACH

MONTEGO BAY.


THE FINEST SEA arnd SIlN-BATHING
IN THE WORLD.


- --- 111111111~


YOU O WE ITTOr YOUR FAMILY


to provide them with a. Home--a rea~l Home--one they will
own outright a~nd never have to move from unless they
sell it.


THE VICTIORZIA MUTUAL BUILDING SOCIETY

1V111l provide the greater portion of the
ITOrley you need to build or buy; th~en
you do the rest.


BE Y,0Ult OWVN LANDLORD!

LOANS are granted at the rate of 71% per annum for
Interest on amounts not exceeding two-thirds of the
value of Freehold Property.

PROFITS are divisible among .Members.
SHARES cost 2/6 per month each.
THE VALUE OF EACH SHARE on maturity at the end of 10 years,
is t20 0l. 0. of which you will have paid 15 0. 0. only.
BONUS, OR SECOND PROFIT, is added YEAR BY YEAR and was
paid at the rate of 2 6s. 106d. Iast year.


-o.,-


.:...< ,.,-rr~ c ..... ,-,-2- -o~mr


urumgr


:)HnH~)t~)lm)~,(H(~H~(~H)~I~ I~(HH)~


_ C I


PLANTER S'


PUNCH


two cubes of sugar or only one, Clara?" she asked
Dr. Mayland, "I never can remember."
"I never take sugar," replied Miss Mayland.
"That is true; so foolish of me to forget."
She had poured out tea for Gladys, but neglected
to ask her whether she took sugar or milk. Still,
Gladys would not be discouraged.
I have heard so much about you, Mrs. Beaver-
sham," she observed; "everybody talks about Mr.
Beaversham, too; he is a wonderful man."
"Thanks," said Mrs. Beaversham briefly.
"When I first saw your daughter--it was at the
ConstantthSpring Hotel-1- knewith h e wat it e
she is striki gly like yu"

"So they say," remarked Mrs. Beaversham. "Alr-
thur, will you have some more tea?"
"No, thanks," answered Arthur; as a matter of
fac m did not want anythi g arom this unp ea a
So did Miss Mayland.
The latter glanced, with some amusement in her
eyes, at Gladys. She was a clever young woman,
good-looking herself, and with plenty of brains and
a kind disposition. And she had courage. She was
not afraid of Mrs. Beaversham, as so many other


persons were. Generally speaking, she was afraid
of nobody.
She addressed Gladys.
"You know, Miss Ludford," she said distinct-
ly, "I have long been wanting to meet you. I have
heard about you; and though I don't understand
anything about art, I am glad you have come: to Ja-
maica to do something to encourage it. We really
must see more of one another." This wvas Miss May-
land's method of easing the situation for Gladys.
Mrs. Smith-Parsley, sitting not far awray, over-
heard the remark. She leant slightly forward in her
eai and s id: "Thereni yadtretatalfor Il of us in
Miss Ludford's pictures is here, and Mr. Pemberton
is going to show it to us this afternoon."
"Indeed?" said Mrs. Beaversham, but felt, never-
theless, slightly interested. She wondered how the
picture had got to Mapleton.

bert ded and sindeed,1 Arabelltat"ce gr tlem
had quietly come up behind her. "You are going
to see a real work of art by a charming artist. If
you are all finished tea we might go and look at it
now."
They had finished tea. They were all genuinely
intrigued about this work of art. Was it possible,


___


I






P

t
I



O
O
O
Y
1

i
5
5



i

I

5


Comfortable, Clean. Sanitary, Dressing
Cubicles.
Large Spacious Pavilion.
Pay Montego Bay a Visit and enjoy
the Sea and Sun-Bathing
under
the most ideal conditionS
at the

Doctor's Gae hathing Club.

WALTER FLETCHER


Receipts for
1929-30

206,582 0. 11.


Total Assets at
30th November, 1930

624,372 3. 0.


Permanent Guarantee Fund
represented by Liquid Assets
at 30th November 1930
25,536 18. 5.


VTisitors to the Island
are welcomed
and
admitted to membership.


DIRECTORS.


T. N. AGUILAR, ESQ.. J.P., Chairman
M. M. ALEXANDER, ESQ., J.P., reputy Chairman
V. E. MANTON, ESQ~., LL.B.
H. E. BOLTON ESQ., J.P.
THE HON. LEONARD DeCORDOVA, M.L.C. J.P.
L. V. D.


H. A. L. SIMPSON, ESQ., O.B.E., J.P.
NOEL B. LIVINGSTON, ESQ.
H. MACAULAY ORRETT, ESQ., J.P.
COLONEL. A H. PINNOCK, V.D., J.P.
THE HON. A. E. Da-,OSTA, M.B.E.,1M.L.C.,, J.P.
SAMUEL, ESQ.


AUDITORS.
W. BOWMAN, ESQ., Chartered Accountant
V. ST. CLAIR DORAN, ESQ.


SECRETARY.

SIDNEY C. MicCUTCHIN, ESQ., M.B.E., J.P.


SOLICITORS.
MESSRS. HARVEY & BOURKE









I_ _


_ I_ I


PLANTERS'


PUNCH


gentleman had not been altogether a success; Mr.
Beaversham had been called upon to make a large-
yearly allowance to the young couple than he had con-
templated. The husband had declined to work, say-
ing to himself, no doubt, that, as death is the end of
life, he saw no reason why life should be all labour.
Life with him meant no labour; he had not intended
that it should mean anything like it when he
married Ethel Beaversham. Her father was willing
to make them an allowance; all that the young hus-
band asked was that that allowance should be much
larger than was originally decided on. He did not
consider this unreasonable. He was the cousin of
a baronet. Surely that should count for something
in the scheme of things.
Mrs. Beaversham had that experience vividly in
mind. So, if a young admiral or general should not
be possible, why not Arthur? That was the thought
that flashed through her mind as she gazed at her
stylish daughter across the tennis lawn this after-
noon. She would make up her mind later on.
The game was soon over, though it was not
yet six o'clock. The Darty separated itself into lit-
tle groups according to affinity; dinner was at eight
and there was more than an hour available for pas-
times or conversation before it would be time to
change. Mr. Pemberton, with his eyes now opened
by Mrs. Beaversham, observed that Arthur selected
Gladys as his companion for a walk, and saw them
stroll in the direction of the river as though they
would be apart from everyone. He was conscious
of indignation at this. He registered a resolve to
give his nephew a hint that he should not let him-
self be entangled into anly understanding with this
Ilady.
"We should invite Arthur to Cripton more than
we have done lately," said Mrs. Beaversham that
e ening to heer hu b nd,ew en they were dressirl o

friends don't draw him out he will be doing same-
thing ridiculous some day."'
"What I have been thinking myself," returned
Mr. Beaverrsham. "It would be a pity if such a
promising young fellow were to go astray."
"He is going astray now," asserted the wvife.
"Haven't you noticed it?"
"Yes; and I heard what you said to Pemberton.
That woman is only an adventuress; we ought to
protect Arthur."
"We are going to," said Mrs. Beaversham, with
the air of one about to resort to a crusade for some
high and holy object; and Mr. Beaversham himsel~,
rapidly conjuring up a vision of broad and prosper-
ous banana plantations, the property of Mr. Pcm-
berton, felt like a modern St. George about to rescue
a male Una from the coils of a designing dragon
whose name was Ludford. He was mightily relieved
by what his wife had said and done that afternoon,
He could read her mind. She seemed about to desert
definitely the Army and the Navy and to accept an
ordinary civilian as one worthy of admittance into
her family. That civilian would be well-off and was
of very good family. United with baronets, or their
cousins, he would stand second to none in the land.
The only obstacle in the way of this righteous plan
was something which described itself as Art, but
which surely could be brushed out of existence. Mr.
Beaversham determined to take a hand in this worki
of brushing artistic obstacles out of the way.
"I think," he said, as he tied his dinner tie, "we
ought to give a dinner party shortly. We should in-
vite everybody that is here, with one exception of
curse. That would show quite plainly what we tLhink

"It would sting her to the qluick," smiled Mrs.
Beaversham. I think that in dealing with a wo-
man like her we should not hesitate."
"Send out the invitations on Tuesday," advised
Mr. Beaversham.
"But I will mention the Darty this evening and
invite everybody by word of mouth, in her presence,"
said Mrs. Beaversham. "I will ask each of them
casually, but leave her out."
hs"That eh drnnec~essari annoy Arthur," her
"H~e isn't engaged to her, is he? If he were ve
should drop him altogether. Perhaps he isn't even
yet very much in love with her. We shall be doing
him a kindness to let him see just what the best
people think of her. Besides, I am sure Alfred
will be grateful to us."
Mr. Beaversham saw the point of the manoeuvre
and was satisfied. They both went down to dinnei
with the feeling that something had been arranged
to keep society pure and undefiled, and to save from
matrimonial destruction a foolish but potentially
wealthy young man-

CHAPTER FIVE

MORLEY was in a state of confusion. Something
untoward was taking place. Soon an authlentic
fact emerged: the big Mysore bull had escaped. This
news, spreading rapidly, created as much consterna-
tion as would the report that a lion had been let
loose. The Mysore, a recent importation, had proved
even more obstreperous and savage than most of
his kind; he had absolutely refused to yield to the


I 1,A


OUR progress in life is like a journey
through a mountainous country---a
Series of hills and valle s. Today we may
stand on the hilltop of success, but just
ahead lies a valley of uncertainty. Life
insura11CC 18 a Safeguard during business
depressions as well as in boom periods--
Iboth of which are equally hazardous. Carry
l 11e insurance ln order that ample funds
may be provided to guarantee an inde-
pendent old age plus protection for your
dependentS.
Established t887




M ANUF ACT UR ES .IFE

INSURtANCE CrOMPANY
HEAD OFFICE r TORONTO, CANADA


C. LESLIE ROBISON ....


T. E. LEVY ...


J. A. FIXZI...

V. G. SASSO ..

L. A. ROSS...

A. TIE TENQUEE ...

C'. L. DAVIS...


116i Tower St., K~gn.

Special Agent, Blacki
River

Ag~ent-K~iingston

do do

do do

do do

do do


1941t-32


/
),


---







































53, 55, 551 WEST STREET,
-



SManufactur ers' Repr esentatives s
I

- IMPORTERS OF:--
i New found land Cod fish,
II: IHerring & Salmon.
Super Seghundi &i Burma
S.Q. Prices.
Baking, M4ediumn and Shopi I
Flours.
Soya Bean Oil.
i Lard Compound.
Currants, Strawepaper.
a ~Baking Powder, Soaps.
?i ~ICY~-KOL.
Meadow Brand Condensed
2Milk.
KTOTIO Wine.

JUV/IGOR Pure Grape luice.
Holster erPilsener German


Chinese Silks and Generail
Dry Goodts, etc.

EXPORTERS OF:--
General Island Produce.

Cocoa, Coffee, Pimento,
Annzatto Seed, Ginger.

L ~ Kolanuts, Sarsapardia, Hides
(Wetc Salted), etc.



YOur Enqu~iries Solicited.

PHONE NO. 291 1.


L IS EN!







CHECK the vital qualities you


expect in a motor oil and you

will Einc them mn the









%hLO N -LAS-T INC

CAREON-FREsE



T~he New TEXACO MOTOR OIL has


no e ual--it is the only motor oil that will

give complete protection to all moving parts.


TB~ YI PIT TO-D1A Y!



ATE CO THE TEXAS CO., (CARIBBEAN) LTD.

13 PORT ROYAL STREET,
KINaGSTON.


~i~i------------~-- ~,,~,~,,,~,,,,,,,~,~. .; ~,,,, llillii~i i.iii.nirr~~


P L A NTER S' PUNCH


1931-32


not a prison make for Mysores of his description, he
had vaulted into the open and stood free, fear-
less and ferocious, looking about for something to do
that should not be of a very pacific character. F'ind-
ing nothing, he set off in search of adventure. It
wyas just then that the young English bookkeeper
at MIorley, who had not been in the island for much
longer than the bull, happened to pass his way.
The young English bookkeeper, Robinson by
name, had no books to keep but was responsible for
the observance of law and order on Morley while en-
gaged in learning the mysteries of banana cultiva-
tion. He saw the bull and realized that he had no
right to be where he was. The bull also perceived
the bookkeeper and conceived the idea that he too
had no right to be where he was. With such a sharp
difference of opinion prevailing, a clash and a con-
flict might be regarded as certain; in this instance
it was the bull that took the initiative. He lowered
his massive head with its terrible spreading horns
and bellowed; possibly that bellow was intended as
a warning. Mr. Robinson regarded it as a challenge;
in anly case he knew that he would be blamed if the
bull committed any damage, and that it was his
duty, as the most responsible person present, to see
that the bull was driven back to his pen. He was
a plucky youth of twenty-two, a public school boy,


treatment usually applied to bulls by the native
cattlemen; and the small boys of not more than ten
or twelve years of age, w~ho had been used to herding
cattle and managing them with a supreme indiffer-
ence to horns or hooves, were puzzled by the behav-
iour of this beast. These boys could not understand
why the bull showed every disposition to gore
them when they appeared within striking distance
of him, and the older men shook their heads
prophetically and prognosticated that no good could
come of an animal which exhibited so obnoxious a
disposition. They treated him respectfully, pru-
dence compelling, but they had no liking for him.
As for the Mysore, he hated them all, even the Elast
Indians, whose complexion and methods reminded
him of men he had left behind him, in India.
And now he was loose. This wasn't anybody's
fault; it was due to his taking it into his head early
that morning to leap over the low stone wall that
bounded the area of his pasture. Mysores are good
jumpers, and this one was a champion in his way.
H-e had not on any previous occasion exhibited this
particular accomplishment, otherwise precautions
might have been taken against any attempt on his
part to get away. But at about dawn this day, moved
doubtless by a desire for freedom and independence,
and perhaps wishing to show that stone walls- do


and though he had heard in a general way from
the Negro and East Indian cattlemen that this bull
was not as other bulls were, but of a vile and nasty
temper, he was satisfied that it would yield to firm
but considerate handling administered from a fairly
prudent distance. He rather distrusted the reports
of the workers, thinking them exaggerated, and he
had for the natives and their peculiar emotionalism
all the disdain of a newcomer impatient of customs
and traditions which, he held, should' be swiftly
changed to the general advantage. This bull, he felt,
could be managed by any really intelligent person.
Therefore, picking up a stone that lay at hand, he
threw it in the Mysore's direction, uttering as he did
so a loud shout to frighten the animal back
into his penn. The only result was a further
bellow from the bull and a strange movement
of his forelegs, as though the most interesting pro-
blem presenting itself to his mind at the moment was
whether he could dig a big hole in the ground with
his hooves within the next few minutes.
The young ]Englishman, recognizing that no
notice had been taken of his stone and his shout,
now fired up with determination. Waterloo had been
won on the playing fields of Eton, and a youngster
who had been a fine cricketer and sprinter on the
(Continued on Page 1,2)


PHONES-OFFICE 2534


WAREHOUSE 2836.




PLANTERS' PUNCH


Y ;~~"- :;~"sa~- -ssur~8e~-8;~---s~qT. --~j~bt~F:C- ~-~C(r-~f\~L~i~Df~~--~-~-C~~VIB~-~I~~ aj~i~;?~-~-~L"
9Pi
s ~ ya 41iY ~L~~ g 9;4 ~C~i '. if '-" ~91
rs ... *ia~- "-Ci ~g ~~ah-~i&
-;1 "~
ei;


5-
d

I
TJ~i~i
c.
1
1
"'



j.Y I
1

-14
i

, .F
i



Ll'' 1


'uasl


6crr



~P"~,
F'?
I'



i


i.
I




iZ~~~~"
E~~ip" i
%""" d





I

r;jl
j


i;ii


!II
o~:~J
Q


f



a


~.
B
i
r


~!
*c; rJI


:r;
P
d

e
ii~u


~r u LilSr~s c~llJ~sZ~,i;Jilrri-a~r=il ~
L"Y'I
3'
r
~a
bk~~ ~
;~S'a~ ~;d;~"~i"14E 'f~~Vii~ i;:l
~s~~6~ ic- .~i4 .-p x
p ~as~ B
i


I ini r ~d~SL Y~. j


"E~~ ?
*PI rfe-
*6


SOLE AGENTTS--J. WRAY &r NEPHEW, LTD.


aF GnRET AGEl
IbDewar&S~od
DISTILLERL~
-- ,, p~RERS


7--- ---~:
a
,


"W~itelabel"






I


PLIANTE'RS' PUNCH


Scotch ~Whisky which seems
to have captured the sunshine
of the barley .. the tang
of the peat smoke .. the
mellowness of great age. .. .
Whisky with a fragrant bou-
quet, a gracious mellowness,
and a genial flavour that
WarTIS the heart such is
DEWC~AR'S, a rare old Scotch
Whisky .


hteLaber
FNEsT ScoTCH WHI I
OF GREAT AGE
s!?r-~SpoDS
1'= = sr LL~s


SOLE AGENTS-J. WRAY & NEPHEW, LTD.


The Choice of

the Connoisseur:


c.... ....J=
~arr~D~B~

PE~BTli


"Whlite Label"

Aged inthe wood and bottled in Scotland, the unvarying quality of Dewar's
leaves nothing to be desired.







PLANTERS'


PUNCH


1931-31


Young Robinson fully realized that he must pre-
vent, if at all possible, that Mysore from effecting
any further damage. He was in charge of the sit-
nation now even more than he was before; he could
never plead ignorance after having been treed by
the bull: he was surrounded by a cloud of witnesses.
The distance to earth from the branch on which he
was perched was not great; he promptly jumped
down, landing safely on his feet, and with quick,
agonized movements proceeded to exterminate as
many ants as he could reach without undue expos-
ure. Then he called to some of the young folk and
bade them accompany him in his tracking of the
bull; two others he dispatched to summon some of
the cattleboys. The tracking of the bull was not
difficult; he was making no effort to conceal his
movements. But while Robinson could easily keep
the Mysore in sight, he did not know what else to
do just then. His problem, indeed, was mainly to
keep himself out of sight of the Mysore, for he was
now in a forest of bananas, and the banana tree is
something which no one can climb.
It did not take a long time now for the scene
to become an animated one of excited human beings.
The two little boys had shouted as they ran that
a mad bull was engaged in goring and otherwise
(Continued on Page li6)

" 111111111111111111111111111111111111111111111111111111111111111111111

if



-
-
-
g
-
g
E ORANGE & TOWER STS.,
...


Kmgston, Jamasca, B.W.I.



m
***
-

-

COMMISSION MERCHANTS

E MANUFACTURERS' REPRESENTATIVES
-
-
E IMPORTERS & SUPPLIERS
"

OF -
-


PROVISIONS



GROCERIES



WINES



SPIRITS



STOCK-FEED










"Service Backed by Many


Years of Experience."








CABLE ADDRESS "ALICK" JAMAICA.
-


"ilmnIIIIIIIIIIIIIIIllIIIIIIIIIIIIIllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIS


.ar these black ant-, now began a scientifle investiga-
thin of R...blus.*n. anti f..r ..ne wild and desperate
......t he w.,ndered whether la w,,uld n,:.t he wiser
to leap t... the earth and make on..User run f...r it,
rhan 1.. remain out ...f the Mysterd-, reach and endure
the r...rments of the unts.
It was then dial a voice same to. his ear, a
Unis.e fr..m the other -isle ...Ia cully whis b ran
thr.:.upil rhis sects..n of line property, dividing it in
two. The v..site was that of an ...Id black man, who.
-randine mte on (11< further bank ..I (11<- Julley. ad.
11-.11 the Ec.ung master not 1.. animpr r.. came slav.11
..Bull had. ma a." came the unsue.e----ary assus..
m=:e: an though I kne-w ants bites .1'u. It better
r., perish by the at dan 1.? de bull --
R..I.In-ssu thouubt bitterly that if he had 1..,
pers-h 3 'lul**k death v auld be preferable, but the old
inan. after Isavine thus set f...rth his views up..n
a cli..I.e ..r shall-. at ..nce Ine-ame poetical
-Huld on. massa. till I go some of slese children
liere to anne off de bull.' he shouted. then dianp-
peareal
In a minute. c.r two he- hall .....me into view again
with a but appeart-si t... be member., of bi-. family, parls
and b.:.1=. and the e. Sale ent..ids from use bull. laul
near ent..igh 1.. reas It listu. began with ..rnites anal
-&....Its in endear..ur 1.. -..are him away
N...w the bull knew list Robin---=n wo-, alonia
and in -, un rricular q uarrel j ustthenwaswith Hobin .
e...Is. But lie holed all human beines. an.1 s...ane of
these were inenItine and ann..yling him He forg..r
R..bin--c.n altogether. He made a nisit ts..nards the
.In Irina v bc. were flinguag st..ne, arid rude aries at
him. Hc. fr.und he ...mill not e...me at them: he ...uld
u...t leap that wide gully. lie ....uld net slimb sinivn
one sleep wide ..f it ansi rhen clamber up the ..ther.
he .-nidd only hollow hi- defence while the t..Ijes
-II..wered ..n hi-- head and side. Line -,tone. hilling
Islin sharpl1 near the *ye. alere-rmined his laelic-
He withdrew <.ul of the reath ..( the missiles. then
-r....d [c.rmin:able. nating for ...me..ne 1.:. <..II
withm hi-, reach. The group ..flattered b...v- and
earls n..w .hanged their plan. they scrambled down
11.1.. the sully arIII st rambled up the other isis of
it, this bringing them nearer to Elle lilyer.re. Fr..m
this next point ...( vantace they acan Mean tc. Ilurl
rhinc= as hini. alls.l Inc, beliming deal the L..rd lauri
deliver.el them ar... Ill- heerns. shamed awarly in
.
riseIr direas..n. ..uly rn see them disappear mysterl-
..u-IV fr..m elebt They Ital.l true ally-- Male. with their heads below Hie level
..fthebank.knowlingrban..bulle..ulden..mealthem
rus.re line-n the.. al.peared again. It was a little tier
User anal, and ..Is.:e m..re use ball ..( ms- al., b..ean
Again there was a ru--II ..f rb,- bull toward
rhent. anr.I nclin th.-i w.-ro ur.Lvitere t.. I>e seen. This
.108.1-10.1 the aminal. 11.- same of c.:.enal ighting st..ek
ami he felt n..Luin Ingr entals.nint f..r tw..-leged ..re:t
rnre- vn.. w...airl n..r ...me mt.. the open and ficti'
like hull., 11 (1, ..ne 1:s-1 dellant L.ell..w he rurned
a ..1 .and arts.k>.. a ....Iple ..t usualia tr..e< sn tl= -
11 inIrt. coalic kn..sking them ..ier with ..ne -weep.
ine m:.1. nient ..f lu-- hea..I Tial-- did .methine Ec,
*i--.Ire him that sle-truerinn v.u- -lill within me
in.- al.llines ... the m..rnInc. and n..w he tr..rteri .."
(.. all---tel what [ne unriti macht hold for a bull
in rtal


aIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIllIIIIIIIIIIIIIIIIIIIIIIIIIInillillillillIIIIIIllIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIllillinalls


PRESCRIPTIONS CAREFULLY at AccURATELY DISPENSED.





KINKED L1AIITED

DISPENSING CHEMISTS AND DRUGGISTS.






Dealers in Pure Drugs, Patent Medicines,


Cologne. Confectionery, Teas, etc., etc.





FRENCH PERFUMERY a Specialty.



American Iced Soda Drinks 20 KING STREET,
of Fine Flavored Syrups and KINGSTON, IAlp -A.
Ice Cream. (Oppense Bank oi Nova -cona a .


illIIIIIllululutillinuIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIniIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIIImlIIIIIIIIIIIIran"


The Cup and The Lip
it-voten.,ed reme Pope if*>
pitting fields ..fa well-ku=.wn English public sellocal
must surely be able to triumph over and dominate
any bull H., picked up another stone, and this
Eline he blirled it straight at the III.viore. advan.*Inc
al the same time with a firm and conquering de-
mealse..Ir. wills n progress was brought t.. 8 sudden
hall as the bull, with one last terride bellow. .harged
marily at him
There was no mislinderstanding the Mill s inten
ti.:.ns He meant business, and busines- ..ia distant
1.1 homes idal rype. That y...ung man. In an sustant.
fell strance and Innely and far from br-me. alone, all
all al..ne in a tr..=> land. with an infuriated bull
bearing d..wn ups..n him. 11'nterl...:. may have been
s**u c.n he DIning lields at Eton, but man.\ a war
I has lawn -.neessfully terminated only dirculph
errareeir arrests effeeled in the nick of time Thi,
I.:....ked like ...0.- of those occasions when a retreat
wa-, highly aircisable, was. Indeal. imperatise. The
h....kkeeper turned, and, as the bull stirged f=,rward.
he sped with IIghtninglike agility runartis line near-
est tree ,
He heard the underr ..,( rhr- bull 5 homes ...n
the hard ur...und as the Write dashed f..arward. he
imseined thatal r ea d y he was be ing lift ed intoThe
air by theee h..rrific horu-. The tree [... whis.h a
healthy in line had direc ted his Ilying feet eemed
va-r distan.*--- .sway. and bi- .4 if he e..uld re:s.'ll that holy and ledly am roar.\
in time. Unit an attite. athlent Enrilsh 1..urb, she.
has m.n a reputation for swiftness. rua.1 heat even
an insulent and m.In-..contemptu...Ins bull. arid -.. Plunt
R...binals. ulns..st wither knowing ir, f..nInd himself
besirilling the I..west branen ...fa substantial tree
within three -ee..nds of the Illim..re5 arrival at the
f....t of Inst pinee of refuge, anti thouvb the reature
pr.:.niptly dealr the tree s trunk a vir.inn- butr. 1110
effect ..( the stupon't merely s:au-ed him tc. ree..il in
amazement. while th-- tree -rans.I ar...cl: -till. n..t ot--n
shaken by II.e bl..w.
Here then were the tw.. pre-tage.nists in this lit
Ele drama. time .:.ne above, the other liel..w. and 1.:.r
a brief space ..f time ash t....k a survey ..( rhe air-
natic.n
H..binson found that his hands were painful anti
hiseding. This was a tree entered wirb th...rn i..ng
arent sharp thorn- thor had hithert..effectualiv pre
vented unt..ne fr...m a--rentline 11- "a makka tree"
the native- .,illes.l it AnsI 1.. de-rend. It remed lbal
) he more! Descent. however. was met the immediate
pr..hlem. --- I..nz a- the bull remain-II blow
there m...Irld be 0.. ale-r--nt Dill what at.Isite. 1., .hr
buir==I ==1 lies onlyrI..n was (Its* .4.p.-aran.e .t
elear numbers .. I parlia.ularl\ vies..ias Ill...R ant
which lived ..It the tree. and which was no:1 curisole
to make- the arrher a***luainlance ...( this arran*Le
being also had miruded himself 4.. usistenly assel
all-tairhed th.- own [enr.r of air establi-Ine*I f..rm
Inifer..IIs lsonse Ilfe The blas.W al:[ c.I .Limissa i-
r...r l...i ..neti- put its bite is scra..r.itisarily pain
ful And lit al.IIIrl 1.. penetrar.. to alm..Sr ally part
nt rhe IIllman per-=.n Rem- pr.....[ ..r cr**.st reir=s-renes.
and ... 3 bish ..rder ..1 ino-Ill;enew- A few IIIIndred































































- I I b


SST JMIES IBENE FIT BUILDING SOCIETY
:i: MONTEGO EBAY. JaMAICA. ERTY


~ESTABLISHED 1874 F. M. HOYT.SEETY




SWhy Pay Rent .
~. .
f This Society makes it possible to own your
R own 1-ome.



OT F OUT Sav~ings :


Our Deposit Branch pay7s Interest at 4 per

cent. per annum, payable half-yearly.



SEE THE SECRETARY FOR PARTICULARS.


--11111 -~ d I -1


PLANTERS'


PUNCH


1931-32


- -


N1921 the Portuguese Government bought some
British blood-stock horses, and we-the officers of
the Flamingo, of the X---Line--were very pleased
about it.
F~or the past twelve months we had been doing
the Western Ocean run-Antwerp to New York, New
York to Antwerp--until it had become monotonous
and, indeed, somewhat tantalizing, for our only view
of England had been through a pair of binoculars-
Thus we were highly elated when "Sparks," the
wireless operator, received a Marconigram to the
effect that we were to proceed from Antwerp to Hull
in order to embark some horses for Lisbon.
But England was suffering from a bout of mist'
rain and frost during our stay, which rather spoiled
our pleasure, and in spite of our previous anticipa-
tions we were not altogether sorry when we were
once more at sea.
In due course we reached Lisbon. The mate and
the chief engineer had been there before, but to the
rest of us Lisbon was new ground, and we were very
glad to have a run round. Shore-leave for us officers
was rendered possible through a technical hitch, con-
nected wihll the8 landing of the horses, which delayed
our depa'rture,~ but it was deemed inadvisable to allow
the men to land, as they were rather a mixed lot,
and had any of them got into trouble ashore we
should have been compelled to sail short-handed.
In the usual course of events, most of the officers
would have remained ~on board, and the adventure
here related would therefore have been ren-
dered practically impossible. The second engineer,
however, had extracted from an orange-vendor the
news of a local bull-fight, and thence we made our
way, leaving behind on the Flamingo only the chief
engineer and the mate, both of whom were fully oc-
cupied with their various duties.
The majority of the officers had been roving the
seas throughout the War, and it was still a favourite
amusement of ours to attach a target to the stern-
rail for the purpose of pistol practice. Most of us
used automatics, but Smith, the third engineer, was
an exception. At the outbreak of hostilities he had
joined the Army, wandering in and out of various


later, when he scurried along again, Smithy called
one:
"In trouble, Steward?"
The steward paused.
"Trouble!" he echoed, in an angry voice. "The
pantry has been 10Gted. To-day's dinner gone!"
Smithy and I looked at one another; then, almost
as a matter of course, we said: "The firemen?"
"They must have the keys, then," replied the
worried steward. "The lock hasn't been tampered
with. Come and see!"
Although both the third engineer and myself
had suggested that light-fingered members of the
"black squad" might be responsible for the theft,
neither of us really believed it, for the Flamingo was
a good ship for food. Fresh stores on a liberal scale
had been provided both in Antwerp and New York,
and for this trip the steward had also obtained extra
supplies in Hull.
We followed the excited fellow to the pantry.
"There; look at that!" he cried. "Not even a
dirty finger-mark!"
He was correct. There were no traces of a
forced entry, but whoever the raiders were, they had
behaved rather wantonly. Inside the pantry food
lay scattered in confusion, eggs and salad-dressing
formed a sticky pool on the floor, and, generally
speaking, it looked as though the place had been
used for the setting of a knock-about film. After
inspecting the mess, some instinct moved me to gaze
upward, and my eyes remained solemnly fixed. The
third engineer and the steward also looked aloft.
"W~ell, I'm jiggered!" gasped Smithy.
Above the door was a ventilation space, covered
with metallic gauze, about three feet wide and eight
inches deep. This gauze had been torn away from
the bottom nails, and from the ragged ends of the
mesh dangled four sausages!
"Well, that solves the mystery," observed
Emithy.
"Indeed it doesn't!" snapped the steward. "Could.
you, or anyone else, squeeze through that gap? It's
my belief, sir, that the ship's haunted! No good ever


'Tis Ch~rzstmzas again. Let's honour the day
And put all our troubles and wcorries away l
Feast and be merry!i Above all. don't fail '
To pled ge Father Christmasi in Youngerl's Scotch Ale.
What puts zip in Christmas Cheer Welcoming the glad liew Year ?

'gr MONKK BRAND'
KING( OF ALES
Z~u~f~~'~IRI MILK STOUT

YOV;3~-PALE AE
EXTR'IA STOUT


ddin :.


8 HANGBOUK ST.


Che Haun ting of the Plamingo


- A4N OLD SUPERSTITION OF THE SEA


units until he finished up as captain in the Iraq
region. Smith's one vice was his inordinate pride
in his Service revolver, which he considered far
superior to our modest "Brownings."
Seamen as a class are invariably superstitious,
but Smithy had overthrown most of his sea-lore in
favour of sundry Army beliefs; and it was through
this that the trouble started.
After the Flamingo resumed her voyage the
Azores had barely dropped below the horizon when
the third engineer, as usual, began boasting about the
range of his revolver. At that moment a deck-hand
drew our attention to an albatross hovering over-
head. Smithy grinned at us, and, sighting on the
1.ird of il:-oir~9n with outstretched arm cried: "Now
watch!"
Roars of dissent came from all sides, but it was
too late; emithy had fired! Apart from a few
feathers that came fluttering down, the bird con-
tinued its flight apparently unhurt. Nevertheless,
the story of the dark deed spread throughout the
ship, and in spite of his popularity Smith received
many black looks. Indeed, so seriously was the
incident regarded that a spirit of uneasiness became
apparent among the men who stood about talking
in undertones and casting furtive glances in our
direction.
The third engineer, however, remained complete-
ly unmoved, maintaining that the Coleridge legend
had been overworked; it was time such an absurd
belief died a natural death,
The second act in the drama occurred some time
during the night--off stage, so to speak, for we knew
nothing about it at the time. At breakfast the fol-
lowing morning we were rather astonished to see
our usually placid steward rush past the mess-room
door. From the fleeting glance we obtained of his
perturbed countenance, we gathered that something
or other had gone seriously wrong. A few minutes


...


By thie way, don't forget to put somea Younger's Strong
DISTRIBUTOR
LESLIIE R. M4OR DECA I, 15'


















































Al


- -- --


PLANTERS'


PUNCH


Doctor's Cave Hotel.


Thiis II..te-1 .l ini n lrm III ile- I' tlw~ Fatwllll us 11'itl

Sll in e t h a t h i **in JI all l~ l c ~ i .I 1 ( i t o: ? b e e l si tye d .


Boatinrg. Fishling.~ .lo~tor'ing. Tennis

aGInd Gall arrc ie Avilable.


**.1 Ihisin Lossition-Timly is 1"-' Phiv
bl.inal lile- it !"


RIOKTEG(~


came of shooting at albatrosses, if you'll allow me
to say so, sir."
Smithy regarded the steward for a moment in
silence; then he burst into a roar of mocking laugh-
ter. "A ghost with an appetite!" he cried. "That's
something new!"
"Ah! you may laugh, Mr. Smith," returned the
steward, shaking his head with much dignity. "But
when you've been at sea as many years as I have, and
seen the strange things I've seen, you'll be more
cautious with that gun of yours."
Marconi invented a wonderful system when he
produced wireless, but it really isn't half so marvel-
lous as the inherent telepathy that exists in a ship's
company. Within half-an-hour the steward's theory
concerning the theft was known to every member of
the crew, and the previous good-fellowship that had
prevailed among the men was replaced by an omi-
nous uneasiness.
All hands were questioned, but no trace of the
nocturnal marauder or his loot was forthcoming.
The following morning a fresh discovery was
made. The curtains across the door of the second
engineer's room had vanished, and the matter was
promptly reported by the irate "second" to his chief.
Thereupon the Captain decided that things had gone
quite far enough, and issuing orders for a muster of
the crew, proceeded to paint a vivid picture of the
fate that would befall the miscreant concerned when
he was discovered.
A twiggingg" of this kind is usually received
apathetically, but on this occasion it was obvious,
from the furtive whispering eddying through the
ranks, that the men were as mystified as the officers.
A seaman who was being nudged by his fellows mut-
tered something or other just as the Captain finished
his harangue, and was promptly called to the front.
"Well, Russell, what have you to say?" demand-
ed the Captain.
The man looked sheepish, cast his eyes down
and replied: "Nothing, sir."
Thereat the crew murmured anewv, and plucking
up courage, Russell added: "That is, sir, I heard
something cry out when I was on watch at two a.m.
today. It--it sounded like an albatross, although the
sudrist eared to come from the deck just below
"Quite possible," replied the' Captain, calmly.
"But what has the cry of a bird to do with the pre-
sent circumstance?",
"Well, sir, the third engineer, sir--. The man
stopped in confusion.
"Speak up, Russell!" cried one of the crew, in
a stage whisper.
"The third engineer," continued Russell, taking
the plunge, "shot at an albatross, and we think--"
"That will do, Russell," snapped the Captain,
sternly; then, turning to the crew, he continued:
"Let me hear no more superstitious nonsense about
albatrosses! This pilfering has got to stop, and the
thief must be found and punished. If any further
robberies occur, every member of the crew will be
kept on board when the ship reaches New York, and
will remain there until the police have thoroughly
investigated the matter."
In spite of the Captain's contempt for sTIpersti-
tious ideas, we were all decidedly uneasy. Russell
had stated that he heard a cry at two a.m., and the
time fitted in exactly with the disappearance of the
second engineer's curtains. As fourth engineer, I
had relieved the "second" at eight o'clock. Smithy
was in charge of the "graveyard" watch. The cur-
tains were in place when I came off duty at twelve


Kj

M


1.os


midnight, but were missing when Smithy called the
Eeond engineer at a quarter to four a.mn. Therefore
they must have vanished between twelve-thirty a.m.
and three forty-five a.m.
Smithy still laughed derisively at the albatross
theory, but it seemed to the rest of us that the ship
was getting decidedly uncanny. If there was a thief
on board, we officers felt sure, some whispers of his
Presence would have reached us, but as it was the
men seemed more worried than ourselves. The fact
that the Captain had ordered a search of the cabins
--without success--proved that he himself was not
entirely at ease.
The third night was more eerie than ever. At
onesthirty a.m. Blair, the second mate, whistled down
to the engine-room from the bridge and told the
engineer on duty, in a scared voice, that a hairy
hand had just seized his night-glasses!


"What?3" yelled Smithy, who was on watch.
Thereupon Blair repeated his statement, explain-
ing that he had been promenading the bridge, andl,
halting for a moment, had unconsciously rested his
arm on a box, where his fingers came into contact
with a hairy hand! The night was pitch-black, and
for a moment Blair had been too scared to move.
Then, recovering himself, he sprang back and search-
ed all rcund, but could se~e nothing, although he could
swear that he had heard the faint pattering of feet.
Further investigation showed that his glasses had
disappeared.
Next morning we learnt that a further raid had
been carried out on the pantry. A thorough search
of the ship was forthwith organized, liut it revealed
nothing. Everyone was now really scared. Seamen
are a tough crowd, and can more than hold their
own against the human element, but when they are


1931-32


CThe


iill th- I



I.. I



L._


Of Can~ada~L

ingston Branch W. A. Clarke, Manager
:ontego Bay Branch -H. W. Whittles, Manager






































DigerS Of~ eVery IDescription of-



Islan~d Prod. o


AGENTS FORE~


11 0RRI 8 I T 0RS Lt (, 0 ARS &r TRII 0KS


PLANTER S' PUNCH


1931-32


co fo eed ith the in visible you speedily get somne-

Underlying our uneasiness concerning the ill-luck
believed to attach to meddling with albatrosses,
several of us cherished a faint suspicion that some-
body on board was playing a practical joke--and most
of the suspicion fell upon Smithy.
It was true that he was on duty when Blair lost
his glasses and spoke down the engine-room tube,
but an active man would have had time~to creep up
to the bridge, scare the mate, and be back at his
post before the officer called him to the tube. Those
of us who suspected Smithy pointed out, moreover,
that all the mysterious incidents had happened dur-
ing his watch, in the dead hours of the night.
We talked matters over very seriously, and finally
told Smithy our thoughts, but his resentment satis-
fied us that he knew no more than ourselves. As he
told us, it wras scarcely conceivable that he would
risk ignominious discharge for the sake of a silly
"rag."
Thereupon we went into general committee and
decided that somehow or otlier the mystery that over-
hung the ship must be solved. Everybody's nerves
were on edge, and we knew that the crew were talk-
ing all sorts of nonsense in their quarters. In conse-
quence, the night watches were becoming a real or-
deal, for no man cared to walk two paces alone
without casting a furtive glance over his shoulder.
As the result of our deliberations we officers
arranged to maintain a special vigil. When I came
off duty at midnight I was to keep on the prowl for
the next two hours with the third mate; the second
engineer would do the hours between two and four
a.m. with the mate.
The third mate kept to the deck, while I pa-
trolled the engine-room alleyway and below-decks,
but nothing untoward happened. It is true that one
of the coal-trimmers whom I encountered on the
stoke-hold fiddley, declared that he had heard a
sound like the whimpering of a baby in the starboard
bunker, but after exploring it with the aid of an
electric torch I decided that he was suffering from
a touch of imagination, and told him so pretty for-
cibly.
I had been in bed about an hour after my spell
of sentry-go when I suddenly awoke. Instantly I
broke out in a cold sweat, for I was certain that there
ta something lying on the cove n ersF ar ula 1

hiAlbs !before I realized it the thing had gone,
and while I was groping wildly for the electric
light switch I heard a patter of feet, followed by a
terrific hullabaloo in the alleyway. I flooded the room
with light and stared eagerly round, but the cabin
was empty. Then I ran to the door, and looking
out, perceived the Captain approaching, his face red
with rage.
"Did you see it?" he demanded.
"No, sir," I answered. "I've seen nothing. There
was something in my bunk when I woke, but before
I could switch on the light it had gone.
I waited for a second, expectantly, and then, as
the Captain made no reply, I added: "W~hat was it?"
The Captain glared at me. "I don't know!" he
barked, and stamped off.
a m:::n la::': :.:::::":: e::iee =am ":"
was, and upbraiding me for not being quicker withl
the light.
At breakfast time we learned that the Captain
had awakened during the night and, sensing that
there was something lying on his bed, had cautiously
reached for the light-switch. Before he could touch
it, however, there had been a scuffling sound and
the "something" leapt away.
Thinking he had heard it make for the alleyway,
the Captain hastened in pursuit, but saw nothing.
We were all warned not to mention the matter in
the hearing of any of the crew, but we soon discov-
ered that they were already in possession of the
facts, and one and all swore that they would "jump
the ship" at New York.
We kept to the arrangements made the previous
night as regards a special watch, and once more the
third mate and I spent a fruitless two hours. Just
as I had got into my pyjamas--at two-fifteen a.m.--
I heard a sound which I took to be the bursting of
a water-guage in the stokehold, and grinned un-
sympathetically as I visualised the third engineer
cursing while he fitted a new glass. My merriment.
however, was cut short by the second engineer pok-
ing his head out of the engine-room door, shout-
ed excitedly: "Come on, Fourth! I believe the Third
has got it!"
There was no need to ask what "it" was, so,
hastily donning a pair of shoes, I rushed down the
engine-room ladder and throu h into the stokehold,
where I met Smithy just emerging from the star-
board bunker.
"You can't beat an Army revolver, old chap," he
said, airily. "Bullet went as true as a die."
"What did you hit?" I asked, in bewilderment.
"I hit the mystery," he answered exasperatingly.
"You can't beat a Service gun. I've laid our 'ghost,'
so you can go back to your bunk and sleep sound,
old man. We'll go into details in the morning."


General M~erch nts







Dealers in -


J N('LU (J )NG *


c~Offe~e, dlscoa, Pim3~ento, Ho~ney,


armdL


E~xporters to every part of the Globe


_- -- _- -a --. z= =- = _- __ ,,, ~~

11111111111111lll111111111111111111111111111111111111111111111lfilll111111111111111111111111


I When an Kingston, refresh yourself






-And do not forget to obtain your Grocery Supplies there.
It iS the most convenient place to shop.

PLAZA CO)MPANY, LIMITED 93 BARRY STI'REET.

011111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111U
"Look here Smithy," I said, "if you don't tell "What was it?" I demanded.
me right away what you have killed you won't need "Hasn't he told you?" inquired the second engin-
that gun any more." eer. "Well, it wvas a monkey! The beast was just
He grinned at me mockingly, and in despair I disappearing over the back of the coal when Smithy
turned to the second engineer, who had just come fired at it. It must have been a lucky shot, with
out of the bunker. only the trimmer's flare to help him."


]LUMB~~ ER ~

PANT ~h~~~a


RUM7~1

M ER~ C E _HANDIS E


L~ogwood,


CdDOCORauaS,


Fustic


~MRA-P Bd 4











The Cup arnd The Lip
(Continued from Page 12)
maltreating Massa Robinson, and everybody within
hearing, on learning the direction of the interesting
spectacle thus advertised, had rushed off to see how
Iblassa Robinson was standing the ordeal, with, of
course, every intention of lending a rescuing
hand. Some of these, appearing directly in the path
of the bull, found it advisable to fly for their lives'
the gloom of the banana forest greatly favouring
them. Two cattlemen, scornfully cursing the bull'
ran boldly towards him, only to find that he in his
turn rushed still more boldly towards them, thus
compelling a wild movement on their part in diag-
onal directions. The bull now seemed more resolved
upon scaring people out of his wvay than on inflicting
any actual personal injury. The banana trees
greatly impeded his movements; his charges were
carried to no completion; when his antagonists had
put some spaceobetween hid ad dthnm, I pcue hand

1 e was goig but1 ee steheameld dder~m nd u 'Peoth r
Arthur had hitherto heard nothing of all this
noise. The Great House of Morley, in which he lived,
was some distance away from, the spot where young
Robinson had enco entered theeMy ore, and thisomeoxra

part of Morley, to inspect a patch of bananas affected
with "Panama Disease". Sampson was in a respon.
sible position at Mapleton, where it was important
that "Panama Disease" should not break out, and
Arthur wanted Sampson's help. The brown man had
driven over in a Ford, neither he nor Arthur, of
course, giving a thought to Ramsingh, whose remov-
al from Mapleton had taken place three weeks before.


probable that the "ghost" of the Fkamingo would
have remained an unsolved mystery.
The American Government, of course, would not
allow the stowaways to land, and accordingly we were
compelled to take them back, working as cattle-men,
on the return trip to Antwverp, whence they were Dut
in a train for Lisbon.
The "albatross legend" died a natural death after
the shooting of the monkey and the discovery of the
stowaways, and the crew, with the exception of the
Portuguese trimmer aforesaid, forgot their previous
intention of "jumping" the ship in New York.
And so ended the haunting of the Flamzingo!


~1931-32


PLANTER S' PUNCH


They were riding towards Ramsingh's cottage at
about the same time that the Mysore, feeling much
bucked up with having scattered so many enemies in
a wild disarray, emerged into the open ground that
fronted the coolie village of Morley.
And then, from many directions, came people
and more people: those who had first heard of these
strange and unusual events, and those who had 11ed,
and those who were suddenly apprised of them. It
was an arena with a green setting of banana trees
on three sides, and, on the fourth, the village with
its huts and its one wooden cottage of superior des-
cription. The bull paused as he came to the edge
of this arena, his head carried high and proud, hia
mighty horns standing out sharp and cruel, his eyea
alight with the flame of battle. He saw, to his
right, two horsemen; he saw, all about, scores of
black and bronzed and brown people gesticulating
and shouting; and, as fate would have it, he saw
Ramsingh, who had hurried into the open on hearing
the sound of this extraordinary tumult.

manm iangh ofnahs ngapoct rf rtimek epr," or
dal sed lyedwhat seemed to sbeo a lacknof hdiscipie

that, for him, it was going to be a flight. For he was
clothed in a simple pair of trousers and a scarlet
shirt; which flaming scarlet looked very picturesque
ut occasions amidst etp oe ar irepntof the ba~nanas.
our Mysore was no exception to the rule. He
perceived in Ramsingh's brilliant apparel a deliber-
ate injury and insult, and he was no more able
to prevent himself from hurling his vast bulk to-
wards that flaunting, incarnadine insolence thah a
shell can stop itself from flashing out of a/tannon's
mouth when the expelling lever is pulled. It was
dlli nat iahg of te eye-he terro-strice w re
tent upon goring the poor wretch to death, and Ar-
thur's swift, instinctive spurring of his horse towards
the infuriated brute. Arthur had taken in the sit-
uation at a glance; he would strike the bull on the
head with his heavy riding crop and so divert his
attention; the animal would charge him, but his
horse could easily outdistance the bull, and, besides,
the cowboys about could be trusted to capture the
creature. But Arthur was no trained bull-fighter; he
miscalculated the rush of the bull and the speed of
his horse. He did get in between Ramasingh and the
M'lysore, but only to feel the horse he rode almost
lifted off the ground as the Mysore's horns ripped
into its side, and then horse and he were flung
heavily to the earth.


"No! Not a lucky shot," objected Smithy. "It
was a quick eye and a jolly good Service revolver."
As it was my watch from eight to twelve, I was
unable to leave the engine-room in order to help in
the search for the mysterious monkey. The weather,
moreover, was decidedly boisterous, so that my time
was fully occupied in watching the engines and keep-
ing the bilges in working order. I was in the midst
of cleaning a bilge-box when one of the firemen came
rushing through to me.
"Quick, Mister!" he cried. "Stowaways!"
With that I abandoned my job and hurried into
the stokehold.
There I beheld the third engineer with a dead
monkey in one hand; the other gripped the coat-
collar of a very woebegone specimen of humanity,
while the second engineer had a firm hold of two
more strangers. Going back to the engine-room, I
passed the news up to the bridge.
When the sorry-looking trio had been handed
over to the Captain, Smithy came down to relieve
m hile h lo t soaas ing
ae. Teh bhu kear in hi 1 t ey waad 'ereed ten

sevs hhade not e el tcerd huakdi elyo iha 1 r

u derby the ventilator, there was a sort of pit, lined

At the bottom ofti dgot efudsnr

crans. Foo thde de k-vniao ea diem hn
down. This, we found, had served as a ladder for
te monkey when he went forth on his marauding
expe iins; the boatswain said that on several oc-
casions he had to renew the canvas screen of the

ha he stowaways, it seemed, were Portuguese who
abdence a e rd e rned uofiia ly,Lat a Puorr gou s
coal-trimmer had deserted the ship at New York,
that he had planned the whole affair when he joined
the ship at Hull. Relying upon being granted shore-
leave at Lisbon, he had prepared the "dug-out" in
the coal for his friends, to whom he had written in
advance. Although he didn't get shore-leave, he took
advantage of the fact that practically all the officers
went to the bull-fight in order to smuggle his friends
on board and down into the bunker-
The next difficulty that arose was the problem
of obtaining food, and one of the new arrivals hit on
the bright idea of utilizing his half-trained monkey.
'The animal, however, proved insufficiently experi-
enced in the duties of "scrounging," and played a
few "monkey tricks" of its own; otherwise it is quite


Hoatin Power-7



CIVS HE NEW CHRYSLER PLYMOUTH-





"'THE SMOOTHNESS OF AN ]EIGH~1T"
"'THE ECONOMY OF A FOUR"
In addition to FiLOATING POWER the New Chrysler Plymouth Combines all of these ADVANVCED
FEATIU RES.

FREE WVHEElING-W~hich is the talk of the Industry and a distinct contributor to economy.
EASY SHIFT' TRANSMIISSION-which eliminates all gear clashing and makes the shift from High to
Second easy and noiseless.
56i HORSE POWER-Dleveloped wvith no increase over previous piston displacement.
SAFETY--Contributeda by C'hrysler Plymouth Hydraulic Brakes and Safety-steel Hodies.
DOUBLE DROP FRAMiE--Provides more beautiful Lines and lower, safer centre of gravity without
Loss of Road Clearance.


P IvNever Before a Car in Thnis

Price Class With so Mlany


Quality Features.



]E. M.g MARTIN,

1" 76 Harbour Street
Sport Phaeton








Sampson," said Arthur, "and then we shall go back
to the Great House and eat what canned things that
fool girl can give us. Sorry I won't be able to offer
you a decent lunch today."
"I hear your cook leave you, Sahib," remarked
Marie Ramsingh as Arthur prepared to leave.
"No; she is only sick; it is my butler who has
left: gone to Kingston, as all of them like to do. So
I am in a hole till I get a new butler and my cook
gets better."
"Sahib," broke in Ramsingh diffidently, "if you
will excuse the liberty, Marie is a good cook-"
"Surely you are not offering me her services!"
laughed the young man. "Fancy your wife the cook
at the Great House!"
"What I was going to say, Sahib, was that if
you would so condescend, Marie could cook some
lunch for you here, and you could eat it when you
riding back this way, if you didn't mind. She can
do a nice curry and other things."
Arthur grasped that Ramsingh wished to make
some sort of return, to show his gratitude, for having
be Laed a omd n sb l, iandh dud so glash oo

"But it is not I alone," he pointed out; there is
(ContinuedE on Page 50)

I I


I:THE COMMUNIlTY STORE,


_q__ _


A etter St~ore

:"For Better Goods~

ForI Bett~er People.


Please remember to give us a visit whenever you are in the city.





~-~ .~- ~b-~C"LIIF. The nlit cst COS O Mofor









Oi is ou i h

.cpi Bl














SH. D. HOPWOOD & CO.


PLANTER S' PUNCH


And now it was pandemonium. The Negro
workers shrieked their consternation, the less demon-
strative East Indians cried out also; a dozen black
men rushed forward, two with upraised machetes,
but the Mysore had already drawn back for another
blow, and it seemed that Arthur could not possibly
escape.
Then it was that the brown man Sampson prov-
ed again the resourcefulness which had made him so
valuable a servant. He too had spurred his horse
towards the bull, accompanying Arthur, and the mo.
ment the catastrophe occurred he grasped what had
to be done to prevent a dreadful tragedy. In an in-
stant he had torn from his back the blue-black jacket
he wore, and, sharply pulling up at the bull's side
when the creature was preparing to drive his horns
into the struggling mass before him, he flung the
dark cloth over his head, thus completely blinding
him for a second or two.
Startled by this sudden, inexplicable eclipse, the
Msoree cmelling deosirpe torid Hiein of ehe i ck
ness that had descended upon him. He swerved; for-

aa,1 sa tme ing n e hpoIeol in t es ptin ha ie h
was thrusting through the bananas, his head quite
free from the jacket, which he had tossed off as he
swerved, but his sudden fright persisting. It had
been touch and go, but the momentary blinding of
the bull had saved the situation. Young Robinson,
shouting to some of the cowmen to follow him, start-
ed off again in pursuit of the animal, and Sampson
dismounted and hurried' to see whether Mr. Norris
was hurt-
He was not. Arthur was an excellent horse-
man, he had managed to swing his leg free and
upwards when his horse went crashing to the ground,
and though he had inevitably fallen with it, the
earth about here was spongy, hence he had sustained
a few slight bruises only. But the horse was badly
gored; it was clear that the most merciful thing to
do was to shoot it. Arthur, however, had been shak
en; so Sampson insisted upon his going into the
nearest house for a glass of liquor, if procurable,
and to see if any serious injuries had been inflicted
on him. Sampson, who genuinely feared Ramsingh,
because he believed the East Indian to be capable


of terrible things, did not because of this hesitate
to lead Arthur into the best cottage of the neigh-
bourhood, which happened to be Ramsingh's house.
But Ramsingh, himself was profuse in his solicita-
tions that the Sahib should enter and make himself
comfortable, and he showed no objection whatever
to Sampson. Ramsingh was only too well aware how
narrowly he had just escaped death.
"There's nothing the matter with me," Arthur
assured Sampson; "I'll be all right in a few minutes.
Has anyone gone after the bull?"
A voice informed him that young Robinson had.
"I hope he'll be careful. My uncle would be mad
if anything happened to that Mysore; it cost a lot
of money. You had better get a gun and shoot my
poor horse, Sampson; try and kill him with one shot."
"I'll send up to the house for a gun," said Samp-
son; but Ramsingh announced that he possessed
a gun which he thought would do quite well. Samp-
son glanced at him as if saying to himself that all
East Thnodi Ino co Id threaten otherosro 90btly

ous than he had thought. But he took the gun and

Isa bu rers errse ordered to tak aa the Sc cse ahd
bury it.

CH-APTER SIX
SAHIB, you not hurt?"
Arthur noticed for the first time that Marie
Ramsingh was in the room and looking at him an-
xiously; he smiled an acknowledgment of her pre-
sence, and, for answer, rose out of the easy chair
in which he had been deposited and shook himself.
"You see?" he said.
"Thank God, Sahib," said Ramsingh. "If it wasn't
for you, what would have happened to me?"
"And if it hadn't been for Mr. Sampson I might
be now in a warmer place than Jamaica," said Ar-
thur lightly. Hle was rather embarrassed at this
direct reference to his saving of the East Indian's
life.
"Mr. Sampson was great," admitted Ramsingh,
turning to Sampson. He was as cordial now as his
disposition permitted.
"Well, we shall have to go about our business,


7.'7" n
"


I


1931-32


Millos. .

HaVe proclaimed It a

perfect food rich in

food value.


FR Y' S



Breakfast




COCOA




J3 Dride for Health!i


T. GEDDES GRHNT, LTD.,
AGENTS.

141 HARBOUR STREET,
KINGSTON.





lillllllllu llllII1lillilllilllli lllalu lllilliIIIli l lillilillllulII1lll1lliuilllli lallllllllllllllllllllllllllllilllll1lIIlili1llilillill1lilillllllillli l ii llllllllllilllliillllilllllllllllllill11111


1931-32


PLANTER S' PUNCH


The Jamaion Mutual Life


Assurance Society

(ESTABLISHED 1844.)


DIRECTORS.
Col. A, H. Pinnock V. D. Chairman.
Hon. Leonard DeCordova, DeButy Chairman.
T. N. Aguilar Esq., .H 'ot s
L. P. Dowener Esql., Hon. Sir William Morrisonl,
1 ~Hon. J. H. Phillips, -F. M. Kerr-Jarr-ett Esq..
Hon. Percy Lindo.



LAdvan tages:-
The many advantages this Mutual and Local Society offers, its steady
and remnarkable progress, coupled with the high standard of its investments,
must commend the Society to you and enable you to decide that this is the
office in which to place your, Assurance,

Prompt Paymnent of Claim~S:-
The Society has earned a unique reputation for its very prompt
payment of claims.
Bonus:=- r
~ Triennial Bonuses have from its inception ranked amongst the lar est
declared by any office.
Protection and Investment also absolute Security provided by its Policies.

For rates, etc., apply to=
= ~SPENCER THOMSONP, or W. D. SOUTAR,
Travelling Agent. Ast ry.Aet


ERNEbST B. NET3HERSOLE, Secretary.






:~~
I (


~IIII


PLANTER S' PUNCH


1931-32


rran


OBTAINABLE IN LONDON FRO.VI
The Army &r Navy Co-operative Society, Ltd.,
105 Vrictoria St., Westminster, S.W\. 1.
The W'est Indian Produce Association, Ltd.


. -'


14 Creechurch Lane, E.C. 2'.


The Golofina Tobacco Company,
14 Creechurch Lane, E.C. 2'.


Herbert Merchant, Ltd.,


25 Denmark St., WT.C. 2.
and many other
leadingE Tobacconists


Is


MANUFACTURED EBY
B~. & J. BE. MA~~~lCHAD 1~DTOBACCO


KI N GSTO N, JAMAICA, B.VV.I.


GOC~LOC~FINA'


LA


TROP~ l[-ICAL


JAM~


AR~E


QUAT~nLTY r


CIG~-ARS.


Their Quality in
their Fine Aroma


Workmanship and
are Wlorld-Famous.


CO~e., LTD.]I~










The Cup and The Lip
(Continued from Page 47)
also Mr. Sampson, and two are a large order, Ma-
harajah.
"Mr. Sampson will be very welcome," said Ram-
singh; "but it was for you to invite him, Sahib." A
remark which showed that Ramsingh appreciated the
wide social difference between his employer and his
employer's assistant.
"Very well, then, we accept," said Arthur hearti-
ly. "W~e shall be back about one o'clock," and Marie
smiled brightly to show how pleased she was that her
husba d's hospital al rould ae ba r oris" ake

Sampson as they rode away, a new horse having
been brought for Arthur. "The coolies here don't
use that expression as a rule."
"They are many cuts above the ordinary coolies,
Sampn nso I suppose they like to use words that
"You don't suppose that Ramsingh will take this
opportunity of poisoning me, do you?" asked Samp-
son jestingly. "I never imagined that I should ever
enter his house, and I never wanted to."
"He has probably got over his stupid jealousy
by this," said Arthur. "Perhaps it is natural for a
man in his position to be very jealous. His wife is
certainly very pretty and has nice ways.

and sleek and loely su sdhe ram p and Inr so
use her claws, I have no doubt. They are a danger-
ous pair.
Your analysis and vehemence show an rxtra-
hrdnary unres otnt tt e maud Sampson," teased
"God keep me out of their way!" exclaimed
Sampson earnestly, but after the forenoon's work
ta 1 er and ttcheed eob xkrltoaRameingh's c ttage' h
preparations at the table. And he noticed that his
simile of a cat was remarkably just.
The table was laid for two, for of course the
East Indians could not lunch with the two men, and
even Sampson sat at table with Arthur Norris by
special courtesy. Arthur was the master, the others
were his -servants (or the servants of his uncle), in
different grades of employment. Marie had been
cook; now she was butleress, with the help of lier
husband, who had gone out to his work but had re-
turned in time to do honour to Mr. Norris. The
East Indian was obviously proud to have such a
guest as Mr. Norris, if only for once in his life; he
was an ambitious young man and this event would
place him still higher than he stood in the opinion
of the East Indians and Negroes on the planta-
tion. The soup was tasteful, the chicken curry was
wonderful, and some whisky had been provided.
Arthur thought he had never enjoyed a meal so
much for weeks. It was like a picnic, he said. And
this reminded him of something he had been dwellin?
upon in his mind for quite a while.
He had planned only the other day to give a
picnic at Morley, for some of his friends ostensibly,
but really for Gladys. The sickness of his cook and
the defection of his butler had made the realisation
of his~plan for the present impossible. But seeing




CRICHTON BRos.

MONTEGO EBAY.




Hardware &r IVotor Car

Su pplies
Garage, Storage &r Repairs
ALSO
IVanufacturers of Concrete

Roof Tiles, Building Blocks,
Pottery, Drain Pipes,
Balustrades, etc.



Estimates & Terms for new ,

roof, or replacing old roofs
weith tiles, given free on

request.


how well Ramsingh and his wife could cater, it came
into his head that they might help him in his difll-
culty. Hle broached the subject.
"Look here, Ramsingh, perhaps you could do
something for me," he began, and the E~ast Indian's
face manifested interest.
"I want to have some friends come to spend a
day at Morley, and dine there, but I can't do it with
two of my house people lacking. Do you think that
you and your wife, who seems able to do everything,
could take charge of the arrangements? Both of you
would only supervise of course; you could choose
your own assistants; but I must have a couple of
people I can depend upon."
"We should be very pleased an' proud, Sahib,"
said Ramsingh," his face reflecting the pleasure he
el.His bele in te bseei-isolation of a wife was
entirely gone out of his mind at the moment; but
then it had been coupled with the proximity of other
East Indians and with brown men, never with folk
like Mr. Norris and his friends. These were in a
world' apart, and Ramsingh would have been bitterly
angered had his wife declined to accept this offer.
It meant good money, too, and he loved money. It
was a great passion of his life.
"That's fine," said Arthur; "you come up to the
house to night and we'll talk it over."
He left the cottage feeling much happier than
before; he would be able to have Gladys at Morley,
after all, and with some nice people. He had been
through sme nasty hohuerse andd days inhthei as: Pu
of Mrs. Beaversham to everybody except Gladys; and
after that there had been one little scene, quiet and
apparently insignificant enough, but it had open-
ed his eyes to his uncle's attitude towards him in
connection with the girl. He recalled it now, as he
had' recalled it often of late. After the dinner at
1Mpea onw outwhlsh,k w soe rearrang den o bthe
placed near him) they had gone for a walk and
he had chosen a spot at some distance away from
the house, where they could sit and talk undisturbed.
It was a little clearing, shut out of view from the
building by rows of Royal Palms, but open to the
sight of the fields below and the glistening river.
The moon hnd risen, a great orb that lightened
the landscape almost with the brilliance of sunlight;
it rode high and it touched with the gold and glow of
romance that silent, wide expanse of green that flow-
ed away Ito rise in the far distance into low hills,
from the heights of which twinkled lights from other
residences like Mapleton. There was a garden bench
beneath the Royal Palms, and on this they sat,
Arthur rendered bolder than usual by wine, Gladys
somewhat quiet and subdued.
"At last we are alcue, Glad," he said, as they
sat down, "and away from all the others. They can't
overhear a word we say to one another. You don't
know how disappointed I was that you didn't sit be-
side me at dinner; it was that idiot, Brown, who
must have changed your seat."
Gladys shook her head slowly: "Are you sure it
was Brown?" she asked.
"Who else could it have been?"
She had a shrewd suspicion. She was sensi-
tive to changes in the social atmosphere; she had






lIh Se OTsS,


Our Stock consists of a large Range of
High Grade Woollens,
Worsteds, Flannels,
Blue and Cream Serges,
M~ohairs, Silks, Assams,
Palm Beach, Etc.

SUITS MADE TO MEASURE
AT SH~jORTEST NOTICE.
FIT GUARANTEED.


:i: BOOTS & SHOES
FoR -

LADIES, GENTS & CHIILDREN.


DOK[NTUFO E sT 8 ihmn


19 132


PLANTER S' PUNhrCH


not failed to feel that, in some way, Mr. Pemberton
was different. His manner, while still eminently po-
lite, had become just a suspicion colder, a bit eon-
strained; he was not hearty and enthusiastic any
more. She had had her experiences; she knew that
someone must have been talking about her d'epreciat-
ingly--indeed she guessed who it was. Perhaps she
ought to have expected something like this; life hadl
already taught her that great joy is often followed
by depression, that a triumph sometimes ends in
something like defeat. She had been uplifted during
the whole of the previous wveekr, and especially that
afternoon; then had come the chill of Mr. Pember-
ton's manner and her inevitable reaction to it. And
there had been something worse.
"Mrs. Beaversham is giving a dinner shortly," she
said, as if changing the subject Arthur had intro-
duced.
"So she told me; she has invited everybody here."
"Everybody except me, Arthur."
"Except you? But that is impossible. I would'
have noticed--"
"You forget that just before we came out here
you went to send a maid upstairs to get my wrap?
Well, it was then she gave her invitation, and she




FO R-



? 1YSt Grade


Mer ch and se.



















83 KING ST,


REMIEMIBER,


IlOlESTY IS 01111 POLICY,


Street.


COMPLETE GENTS'
::OUTFITTERS. :


i. Boots and Seoes


2. Gents' Outlinting


3, Lggieg' })?883 G0048


4. HOUSeilold G0048


5, Fancy jDpggg Trimmi


6. H0818[}


8, Haberdashery


8, li lner


27 King












WH~ Yi HA





Nale DeoCme A flouseholti

WOrd. IR The ISland?




1. BECAUSE of their trading




2.BECAUSE they anoreciate

the fact and oractise it, that

integrity begets confidence.


3. BECAUSE they and their

aSsistants are proverbial for
COurtesy.


S4. BECAUSIE it is well known

that their stock of Dry

Goods and Boots and

Shoes is large varied, and

DC111g COntmnually replen-

1Shed With up to date

gooas.

*5 BECAUSE it is realized

that the Best Values are

Obtainable from then.


6. DDCUS odOterS are care-

Tully anQ prOmptly attend-
et tO.


/ onCAUSE they are ever
m111QIul Or the fact that

Success depends on satis-
fied U iiStom~ers,


O8. J.>C PUSE they are grate-
tul to their customers for

their patronage and desire
a COntinuance of it.


7. DD 1USE CVery, principle

fOr successful trading is

faithfully observed mn the
above.











WOlesale Dry Goods Merchants

111Harbo0r offree.


PL A NT E RS' P U N CH


only spoke to you about it when you came back. I
was ignored before everybody, and it was purposely
done. I am not classy enough for her, you see; and
perhaps she has other reasons."
"Her reasons be damned!" exploded Arthur.
"Well, I am not going to her dinner. You would
think the woman was somebody--you would think
that a lot of people here were important, they have
such an infernal cheek. Anyhow, if she won't have
you she won't have me, and that's all there is to it."
"But why should you do this?" she asked, really
touched. Here at least whas one who was true and
faih'u know as well as I do, Gladys; it is because
I love you."
"What's the us~e?" she asked pathetically.
"Every use. I am asking you to marry me,
Gladys, and I will tell my uncle about it this very
night. I will tell everybody, if you accept me. And
you will, won't you, dear? You know I love you.
You are so wonderful-"
"Every girl is wonderful when a man is infatu-
ated with her," she laughed, somewhat bitterly. "But
you see, my dear boy, your uncle would have a diff-
erent opinion from yours, and where would you be
then ?"
"Uncle Alfred? W~hy, Glad'ys, he would be de-
ligh ed; he thinks the world of you."
"As an acquaintance or even a friend', perhaps,
as someone he canl be nice to without hearing who
likes it, for he has nothing to lose. But as niece?
Nuo, Arthur. He is not the same towards me to-night
as he was this morning; I have seen that. I am a
woman, and I have an instinctive feeling of such
things. It is all right, I suppose; I must expect it.
I have no position, I have to work for my living; I
am nobody among these people-though, so far as I
can see, they would' be less than nobody in England."
She tilted her head upwards,. anger dominating her.
Her fighting spirit was stirred. She wzls English,
and, whatever her social origin, she refused to con-
sider herself inferior to any Colonial. She would let
Atthur at least know that.
"You are perfectly right, Gladys," he cried with
an indignation equal to her own; "but why do you
worry yourself to think of them? I am sure you are
wrong about my uncle; only to-day he was speaking
in the nicest terms about you. But even if you are
right, even if he has changed, what need that mat-
ter? I can always earn my own living. Marry mre,
and, if he is annoyed, leave him to g'et over his an-
noyance or to continue in it; we can get along pretty
well without him. You have confidence in me, haven't
you ?" .
"Why, of course, Arthur, but--"
"But what?"
"It is all very well for you to talk about not car-
ing wvhat your uncle might do; you may feel that way
now, but Kow would you feel if you lost everything?
You would hate me!"
"Gladys!"
"You would miss your position, and you would
find how difficult it was to serve under any other
man, with no prospect of a for tune at the end. You
would be poor too, Arthur, and I am sick of poverty.
I couldn't stand it out here."
She was talking now as she never: would have
talked in a moment of calmness: for the tiine ishe
had thrown discretion to the winds. Restraint was
relaxed. Out of the bitterness of her heart the truth
came surging,
"It is different in England. There one fits in
with one's class and circumstances; here there are
very few people of any consequence, and I want to
be one of those few. If you had nothing but a sal-
ary, what could you and I do with it? You would
be miserable, and I would be miserable, and we
should both be nothing at all. I couldn't face that,
and I don't think you could. It is better to go on
keeping a shop for a while."
"I suppose you don't love me, Gladys?"
"I don't know that I love anybody. But I like
you immensely, Arthur; you have been very nice to
me, and you are a gentleman. No; I suppose I don't
Jove you, or I might be inclined to make a fool of
myself, and a fool of you too. But, I am not going
to."
"I should be sorry to think you are mercenary,
G~ladys."
"Mercenary? I don't think I am. But I want to
have a good time, and I don't want to remain a no-
body, and if I have to work all the days of my life,
at any rate it won't be for a whole household' of
children with a future worse than my own present.
lfou are shocked, Arthur? But what's the sense of
talking poetry when everything is pure prose?"
He was shocked, for there wras a romantic streak
in his composition. Gladys cared more for money
anid position than she did for him and his devotion!
This was a revelation that startled him. She was
applying business principles t~o love and marriage.
"If my uncle had no objection, you would have
none, I imagine.b He said this wvith some sarcasm.
"I have told you that I like you, Arthur, like
you very much; I can't tell you what I should do if
circumstances were different. I don't know. And
you dorr't- know either tvhat you would do if your
uricle made it clear that he would disown you it
(ContiLLved on Page 53)


CECIL, BOSWELL, FACE


ONE OF our younger businessmen, yet already one
of the best known and respected men of busi-
ness in Jamaica, is Mr. Cecil Boswell Facey. He
is just about forty-two years of age, looks younger,
and is one of the most energetic persons in the local
commercial world as well as one of the most success-
ful.
Strangely enough, the present writer first heard
of Mr. Cecil Facey from an American visitor. This
American, who was in the island on a business visit
for his own interests, asked the writer if he knew
Mr. Cecil Facey. The true answer was in the nega-
tive. Then the American began to speak of Mr.
Facey in enlogistic terms: how he had had business
relations with him for some time; how satisfactory
those relations had been; how willing he was to ex-
tend them; what a fine character Mr. Facey had.
After that we thought it very necessary to make Mr.
Facey's acquaintance; since when we have known
him for a number of years, and our appreciation has
grown with the passing of the years.
Cecil Facey started life very early. His father
died when Cecil was only seven; he had to go to
work when he was thirteen, after a comparatively
brief period of schooling. In those days you were
not paid to learn any branch of business. He did not
begin at ten shillings or even five shillings per week;
his first week's pay was a shilling only, but after
that it became a little more. Young Facey, however,
had pluck and ability, and after working in the late
Colin Hogg's boot and shoe establishment for eighteen
months he joined the staff of Mr. E. C. D'Azevedo,
then went to Mr. J. R. Smith in 1906. He continued
with Mr. Smith until the firm became Sherlock and
Smith. Then in 1919 he resigned and started busi-
ness on his own account.
This was a little over twelve years ago. What
were his assets? When Mr. Facey was asked this
question by the writer he replied: "A desk, two
chairs, a small amount of brains, plenty of determin-
ation and 30 in cash." But last year he formed a
Limited Liability Company with an Authorised Cap-
ital of 50,000, of which over 40,000 has been sub-
scribed. In the light of this one must correct Mr.
Facey's statement in one particular: for "small
amount of brains" we substitute "plenty of brains."
Let us add also, "indomitable pluck."
For how many young men, occupying a position
with an established firm, and trusted and liked by
the principals of that firm, would have thrown up
his position with but thirty pounds in cash had he
not possessed courage of a very uncommon kind?
Remember, he had not been a rolling stone, getting
a new job every twelve months or so. For thirteen
years he had worked with Mr. J. R. Smith. That
showed stability of character, persistence; but his
was not a static disposition, but dynamic and adven-
turous, with the result that he is to-day the head of
a well-known Commission House and a factor in the
business life of Jamaica.
"Planters' Punch" congratulates Mr. Facey on
his success, feeling that he deserves every bit of it,
He has undertaken big responsibilities, and has shown
himself well able to handle them. For fourteen
years he has been a member of the St. Andrew Par-
ish Church Committee. As time goes on, and he wins
some leisure from the arduous demands of his busi-
ness, he will doubtless undertake duties such as fall
to the lot of energetic, intelligent and trusted men of
business who are regarded in Jamaica as amongst
the leaders of the local commercial world.


1931-32


T~HE EXCELSIOR M1O TTO









































an alR O-Onerall li




DnSUIanc C Ompany, Limited.










e IN .A..J.






Head Office: H. M. BURKE

No. 10 DUKE ST., KI.N STON. Manager and Secretary.









S. C. LINDO

40 &e 42 ORANGE STREET,
OR
31 OLIVIlER PLACE, KINGSTON, JA.


FOT :o


The Cu ad T L1'
(Continued from Page 51)
you married me. You really believe that he would
do nothing of the kind and so are willing to take the
risk. I am not. I cannot. We should both be
laughed at, and--and--Oh, what's the use of talking
about it! I am sick of everything. I am sick of
life. But some day I may get even writh all the
people who pretend to think they are better than I;
some day I too may be able to look at them as if
they didn't exist. The swuine!"
Arthur would have said something more, but
just then there was a sound of footsteps and voices;
some people were coming their wvay. It was Mr.
Beavershamn and Mr. Pemberton. Mr. Beaversham
knew Mapleton pretty well; he had observed the
direction taken some time before by Arthur and
Gladys, and his shrewd mind had guessed that
Arthur, if at all in love with the young woman,
might propose to her on such a beautiful night, when
the effect of moonlight, distant gleaming water, wan-
dering cool winds and champagne would move even
the most phlegmnatic man to the adoration of a really
lovely girl. This would be embarrassing, if not pos-
itively disastrous. As soon as he conveniently could,
therefore, having in mind the crusade to which he
had set himself, he suggested a walk to his host and
led him in the direction taken by the younger peo-
ple. And now, there they were, sitting by themselves,
away from every other guest.
"Hello," he cried out cheerfully, "Arthur and-
er-Miss Ludford. Enjoying the moonlight?"
Mr. Pemberton said nothing, but glanced' at his
nephew and Gladys. Gladys had quickly got her
feelings under control, but Arthur's face showed
strong emotion. Mr. Pemberton leaped to the conclu-
sion that Arthur had been making love to the girl;
that Arabella Beaversham was right. Again
spasm of anger shot through him; he was bitterly
resentful of his nephew's conduct. What a fool the
boy was making of himself! He said nothing; he
could not forget that he was their host. But even
Arthur perceived that oalloluash eotx wl it he

now appeared on the older man's face.
Mr. Beaversham and Mr. Pemnberton continued
their walk; there was silence between the younger
people until the others had passed out of earshot.
"You see, I am right," said Gladys.
Arthur did not reply, but his heart was heavy.
And he realized with surprise that Gladys had seen
much farther than he did; he realized that, with his
uncle plainly displeased with him, he could not now
urge an engagement on the girl. He did not wish,
after all, to bring about an estrangement between his
uncle and himself. Was he, then, despicable, was
he himself mercenary, was he putting his prosi~ects
above his love, counting the Pemberton properties of
greater value than Glladys? He resented this sug-
gestion; he concluded that he was only showing pru-
dence, a willingness to bide his time until his uncle
should come to see Gladys as he did, and be willing
to welcome her as his niece. That could not be long
he assured himself. Yet somehow he did not feel
very proud of himself.
"I know Uncle Arthur better than you do, Glad, '





J. R. BR ANDON & SON

80 ORANGE ST.,

KINGSTON, JAMAICA




The leading WV~holesale
Warehouse for


GR-~~IEEN~ SEAL O~LD~I RUM~JB

DIPLOMA OF HONOUR v WEMIBLEYi EXHIBITION, 1924.


PUNCH


1931-32


PLANTERS'


he said at length, a little lamely; "you leave him to
me. You are not going to drop me because you
think he mightn't want you to marry me, are you?"
"Oh, no, my dear," she answered; "that would' be
foolish. I will drop neither you nor him, if he is still
inclined to be friendly. Why should I?"
"That's good, and everything will work out
right; you wait and see. I have a feeling that it
will."
"W~e all have that feeling when it suits us," she
replied, rather sadly.
"Wait and see. And I am not going to accept
1Mrs. Beaversham's invitation.,,
"I am glad of that," admitted Gladys frankly,
"You can't be too nasty to those people, if you wvant
to please me."
"l shall be as nasty as I know how," he declared.
"l hate them."
She smiled satisfaction, and his arm stole round
her waist. He was leaning towards her, his face
close to hers. Well, why not? There was no one to
see, and he loved her and had always and probably
would always be nice to her. He was a good fellow.
She liked him immensely. What did a kiss matter?
Nothing much to her, perhaps, but he remember-
ed it now, as he had so frequently done since that
night, and also the kisses that followed. He had not
gone to the Beaversham dinner; but an invitation to


a second one had come, and this time his uncle him-
self had asked him, very nicely, to accept it. "What's
the use of slighting old friends, my boy?" Mr. Pem-
berton had said.
"I don't like my real friends to be publicly hri-
sulted," Arthur had replied with spirit.
"You mean Miss Ludford? It was a nasty thing
for Arabella to do, I admit that," agreed Mr. Pemb~st
ton; "but you know what a catty disposition she has.
We can show what we thilik of Mliss Ludford by in-
viting her again to Mapleton."
"You mean that, Uncle Alfred'?" asked Arthur
suspiciously.
"Of course; but you mustn't make a fool of
yourself over her, Arthur. That is all I ask. If
you want to marry-and I think you should--why
not propose to a girl like Hazel? She would suit yett
down to the ground."
"Mrs. Beaversham has been suggesting that to
you," said Arthur positively. "Well, I don't care for
thle girl, and that is that."
"But you'll go to this dinner with me?"
"Yes; and I shall give a picnic at Morley after-
wards and ask Gladys," said Arthur defiantly.
"I shall be glad to come too," remarked Mr. Pem-
berton with great cordiality: "will you ask the Beav-
el shams?"
"No."


READY MLIXED.


GOODS,


FINE &r MELLOW.


LACES


20 YEARS


OLD.


5 YEARS OLD.


Best Value

an~d lowTjest prices.


PILANTCERSg PUNCH E-


TWHIT'CE LABI~E~EL, OILD RtUM


FANCY


S3rWHIT]rE KIGHI~WI~T RU TRY THESE TWO

WHTITI[~E HORIESIE ,, AND BE CONVINCED.


H ABE RDA SH ERY,


ETC.


TFHRjEE STAR~"l~ O~LD~ RUM b~

B~L~ACK~ SEAIL OC~LD RUM %I


































































Milli0HS






EShllor





* Use




Good Year







chie wen iteenst
no more to say: "I
will buy only the
leading make of
tire."
GOODYEAR leads
in volume of sales
because GOO D-
YEAR leads in
value-giving.


H-. R. H. TH113E


PRINCE OF WTALES





was supplied with






HE INE KE N" S




BEER




During his tours in Am~erica and

SiOuth Acfricat


PLANTER S' PUNCH


1931-32


"Rielent a little, Arthur; ask Hazel at least, for
my sake. You must think of your old' uncle some-
times. Leave Arabella and her husband out if you
like--that man always reminds me of a fox, though
he has never been able to get the better of me. He
is really a crook at heart, and in practice whenever
it is safe. But the girl is nice, and we can't go to
people's houses without being hospitable la, them in
turn. You will invite Hazel?"
Arthur knew that this request was almost a
command; his uncle would resent refusal. He
,agreed: and then had come the domestic dislocation
at Morley: with butler and cook away there could be
no adequate catering. But Providence had now inter-
vened, in the form at first of a furious Mysore bull,
and then in the form of a grateful but usually mor-
ose East Indian. Still, wonders might be performed
in a mysterious way, and anyhow his path was now
clear. That very afternoon he would send' out the
invitations. This was Monday. He would invite his
guests for the following Sunday. C
CHAPTER SEVEN

ARTHUR was satisfied that his lunch was a great
success; everybody was in a jolly mood, his
uncle particularly so. The one fly in the amber was
Mrs. Beaversham, who had not been invited but who
had come along with Hazel, explaining on her ar-
rival that she took the liberty, as an old friend.
and as a woman almost old enough to be Arthur's
mother, to accompany her daughter. In addition, she
pointed out, it would hardly have been possible for
Hazel to have come over alone. Arthur cordially
agreed, and made excuses for not having invited
her, declaring he had thought she would not have
cared to travel all that distance to his ill-equipped
place, and so forth. The truth is, of course, that he
had hoped Hazel would refuse the invitation, and
that he did not want to see Mrs. Beaversham within
fifty miles of Morley.
But here she was, and she did not tell him it
was Mr. Pemberton wvho had secretly pressed her to
come, under promise that she would say nothing
about his intervention.
Mr. Pemberton had whispered to Arthur, just
before lunch:
"This is an informal business, my boy, so I
wouldn't trouble, if I were you, about any regular
seating of your guests. Let Arabella sit where she
likes, but put Hazel beside you. I will look after
Miss Ludford." And though Arthur would have pre-
ferred to have Gladys beside him, he was pleased to
see his uncle ready to be nice and cordial to her;


."Five," said Artimr. "You would, you know,
Hazel."
"Nonsense, you are not going to tell me you are
not in love with her?" (This was said in a tone in-
tended for his ear alone; instinctively both had
lowered their voices as' the conversation continued).
"I like her very much, if that is what you mean,"
he replied, somewhat embarrassed; "but then I like
you also, Hazel."
"Humph; I used to think you did, but I am not
so sure about that now. I am on the discard,
Arthur."
Damn it, he thought, did girls not mind in the
least what they said? He had never seen Hazel so
much like her mother before, her mother who spoke
what was in her mind, and even more, as though she
were licensed as a superior person to have her say
regardless of the feelings of anybody else. Hazel,
evidently, had the same characteristics. A queen
could not have been more self-confident. He knew,
too, he must be careful as to what he said to her
about Gladys. She would not hesitate to repeat it
to everyone.
"What are we going to do after lunch?" she
asked suddenly.
S"T'hose who want to go rafting on the Rio
Grande can do so; I have arranged for some rafts.
Those who want to play tennis may; those who want
to drive about the parish, if they have never yet
been over it, will find that I have provided guides.
And so on. What do you want to do, Hazel?"
"I'd like to go rafting; I have never been. Will
you take me?"
"With pleasure."
"How is it arranged?"-but she already knew.
"Two on a raft, and the punter, a native, stands
up and steers the contraption down the river, and it
there is an upset I shall have to swim to the bank
with you."
"And save my life! Most romantic, Arthur; so I
wish that an upset may happen. Of course I can
swim, but I wouldn't in the circumstances. I will
let you play the rescuing hero," she laughed.
Other couples and groups were busy making
their arrangements for the afternoon. Arthur would
have liked to have Gladys as his partner on the
raft; but he knew it would not do for him to devote
his attention too exclusively to her; it was much
as it was to have her there, and it was pleasing' to
observe that she was getting on extremely well with
the other guests. She was accepted by them-that
was evident. She had not slipped back socially in
spite of Mrs. Beaversham's obvious effort to push
her backwards and keep her there. And Mr. Pem-


he was sure that if these two only came sufficiently
together, Mr. Pemberton would speedily lose any
objections he might have to Gladys, objections purely
silly and snobbish, which would be dispelled by a
closer acquaintanceship with the wonderful qualities
of the girl.
Maharajah presided over the three boys who
served at table, watching with vigilant eyes to see
that they acquitted themselves well. Now and then
his wife also slipped into the dining room to see
if things were going as they sl~puld, her husband
being really a novice in the art of a majordomo.
On one of her appearances, still wearing the scarlet
headdress she affected, Hazel caught sight of her.
She asked Arthur:
"Who is that pretty coolie girl you have here'
Arthur? She is very striking."
"She is the wife of the man over there who has
taken charge of my bachelor establishment for the
present," Arthur explained. "But for them I couldn't
have had you at Morley to-day, which is my chief
reason for gratitude to them."
"A very pretty speech," flashed back Hazel;
"only it isn't meant. What you really mean is that
but for the help of the coolie and his wife you
couldn't have had Miss Ludford over here."
S"Meow, meow," laughed Arthur, and the man
sitting on the other side of Hazel, who had over-
heard the remark, laughed also.
"Oh, I am catty enough," admitted Hazel with
great calm. "Cattiness is only another name for
truthfulness, you know. Don't you think I know
why you didn't comne to the dinner we gave after
spending the week-end at Mapleton?"
"Do you think your mater acted nicely in in-
viting everybody and pointedly ignoring one poor
little lady, and a stranger at that?"
"I don't, Arthur; I didn't like it"--which was not
true-"but you don't want to quarrel with old friends
for new acquaintances, do you? Besides, I counted
upon your coming to that dinner, and you didn't."
"I came to the next one."
"Only through politeness, frigid politeness. And
you and. I used to be such good friends once! How-
ever, that is the way of the world, I suppose."
"You know such a lot about the world, don't
you, Hazel? You are aged and worldly-wise, quite
burdened with experience."
"I am not quite a fool, my dear; that's all; and
when I see a young fellow, an old friend, not caring
for his old playmates any more, and I see a pretty
girl in the offing, or rather nearer--why, I put two
and two together and make it--"


Sole A4gents


- Hi. SARG;OOD &: CO.














MAHlltlE YOUR CHFRISTMASc~




YOn can~ do most of your shnopping under


ASSilverware, Cutlery, Fancy Glass W~are, Brass,
00d Manicuring Sets, Toilet Sets, Photo Frames, Linen,
Clocks, Etc.


All1 the High Grade Makes, Fancy Boxed Sets,
Beautiful Perfume Atomizers, etc.


You will find a Large Assortment of High Grade
Sweets, and Biscuits, all Fresh and Pure. Get
Your Xmas Candy H-ere.


The Largest Assortment of Books in K~ingstonI.
Children's Books, Prayer and Hymn Books, and
Latest Fictions.


GREA TE ST VALUE IN T'OY S.

UR Stocks of Toys This Y'ear Surpass in Variety, Quality,
and Value Anything That Wie H-ave Offered Previous-
ly-You Need Not Look Further Than Our Toy De-
partment when You are Requiring Toys: The Children
will revel in the wonderful variety that we are offering.


T~HE T~IMEI[DS HDIIEPT.r $~STOE
8-12 KN TET IGTN


P LA N T ER S' PU NCGH


....931-32


berton was making up for any previous momentary
coldness he may have shown her; he was now all
attention to her. Better so, thought Arthur, than
that he himself should be with Gladys all this day;
it was more important that the old man should be

sed an dhilormati iet crhu tuft quite ::
tented. And next to Gladys, of all his guests he
would prefer to go rafting wiith Hazel. She was an
old girl friend, after all, and she was vivacious, she
was pretty. "I am going to enjoy this trip with you
very much," he assured her as they rose from the
table, and his look was bright and sincere.
"I hope so," she answered, flushing with
pleasure; for Hazel objected to Grladys, was jealous
of her gs far as her insolent and imperious nature
would allow her to feel conscious jealousy of any
woman of her acquaintance, and had quietly
made up her mind to take Arthur away from
Gladys. i It was now a trinity of the Beavershams
ta ami blieu ragaint sh inart st Hand1.the most
She' walked over to where Mr. Pemberton and
Gladys stood, waiting to follow some other persons
out to the back porch. She smiled quite pleasantly
at Glady~s, a friendly, happy smile. "Uncle Alfred,"
she cried--she always called him that--"Arthur has
asked me to go rafting with him, and he has pro-
mised that if the raft upsets he will see that I do
not drowvn."*
"Doh't you swim?" asked Glildys directly, know-
ing perfectly well that the information just given
was intended for her.
Hazel pretended not to hear, and Mr. Pemberton
took up the thread of the brief conversation.
"And I," he remarked, "have just arranged to
take Missd Ludford over to Port Antonio and show
her the place. Then we are going to the Titchfield
Hotel for tea, and afterwards coming back to Mor-
ley. I hope to give Miss Ludford a good impression
of Portland, though no doubt it would be nicer for
her if a younger man could take her about."
"You are fishing," protested Gladys. "You know
how pleitsed I was when you sug ested this treat. I
didn't gu~ess you were so vain." cj
"Vain as a peaeock," gibed Hazel, shaking her
head reerovingly at Mr. Pemberton, but with appre-
ciation nevertheless. She knew that Mr. Pemberton
had definitely fixed matters so that Arthur should
not be G adysasn companion t1 dayh aand se etwel,
from hdir mother Of Mr. Peniberton's irrevocable ob
Section to Arthur and Gladys being anything more
than ordinary friends. She realized that if the old
man were going to take an active part in keep-
ing Arthur and the girl shopkeeper (as she
thought' of Gladys) apart, there wasn't very much
chance for Gladys, especially as she, Hazel, had now
definitely made 11p her mind to have Arthur as chief
and indeed as onlykstringtot hr b w.tighr m

th rush-l his with an air of proprietorship.
"Yo~ur uncle," she said, "is looking after Miss
Ludfordi, and she appears to be delighted with the
arrangement. Perhaps you have a rival in him,
Arthur," she added.
Both of them, knowing how snobbish and vain
was Mr.: Pemberton, laughed in unison.
"If ever there was a confirmed bachelor, he is
Uncle Allfred," answered Arthur; then paused for a
moments in his walk to the porch on seeing that
Marie 14amsingh evidently wanted to speak to him.
"Everything all right, Sahib?" she asked quietly,
glancing piercingly at Hazel, who was scanning her
with frank admiration.
"Perfectly, Marie," said Arthur, dropping uncon-
sciously into a more familiar form of address than
he had hitherto employed. He saw now that Marie
had got, up herself especially for this occasion, and
rather too much so perhaps. Polished silver bangles
glowed on her p~rms, and her headdress was fastened
with a golden pin. She had evidently wanted to at-
tract attention; she had succeeded too, for some of
the younger men had been enquiring about her, and
more than one of the ladies had' observed her par-
ticularly. She was aware of it. And she was proud
of it. Now she wished for a word of commendation
from the master of the house himself.
"We have put up thermos flasks with tea an'
punch, and parcels of sandwiches," W'he explained.
"Ramsingh is putting them in the cars now. But tea
will also be here, ready, if anybody come back. And
dinner will be better than lunch: you will see."
"You are a treasure, Marie," commended Arthur,
"you and the Maharajah. I couldn't have done
without you both."
He moved away then, and again Marie looked
searchingly at Hazel. This young lady, she thought,
had taken possession of Mr. Norris; she hung on
his arm as though he were hers. Marie saw inten-
tion in Hazel's look, in her air. She wondered: was
this tall, dark, handsome girl to be the mistress of
Morley?
The party began to go off in twos and threes
and fours, except a quartette who had made up their
minds to stay in the house and play bridge. Mr.
Pemberton settled comfortably in his big car with
(Continu~ed on Page 57)


. O a O P *


CVOTy~~g


y ars


]}o lz


Orme TPOOT


]Let UnS hengp JOR Sellect gifts $O


OYl~e O.


Pef


o**' mr~
IO


Staioery Ioushod ri El0trical Goods, Gameras, Fi ms, Sporing 0088.


*1 LET R.C.AI.-VICTOR

bringg you matchiless

rrr~ Yule-tidei JoEY.

i~jcP"Here's a gift for your loved ones .. for
your own delight .. greater than any
ar Other gift.
Let us demonstrate R.C.A.-Victor Radio and
Electrola with Short Wave Adapto~r. It's
to-day's greatest Radio Value.' Best terms
!r -easy to pay for. You will never regret
;Bf7\buying an R.C.A.-Victor.


ir(~
s/3* -C


MrE~S IE T *


They're first quality tyres, and not only
SAVe you money in the long run, but cost
you less to begin with. You can't go wrong
when, you purchase Riversides--they carry
an unlimited guarantee--
A Practical Gift.






I I
s LI I"s
I ,


UNITED ]FRUIT COMPANY

Steamship Service



PASENER AD REGH


I I


PLANTER S' PUNCH


~1931-32


THE WELL-KNOWN, FINELY APPOINTED. FIRST-CLASS STEAMERS OF THE

GREAT WH~tiITE ]FLEET

maintain a Frequent and Regular Service between JAMAICA and the United States,
Cuba, Panama Canal, Costa Rica, Colombia, Spanish Honduras, Guatemala and British
Honduras.
CONNECTIONS at Cristobal for San Francisco and the West coast of Central and
South America, Au~stralia, New Zealand and the Orient. Prepaid Bookings and Reser-
vations on connecting lines can be arranged if desired.
THIROUGH BOOKINGS can be made at our ticket office by rail from New Yfork to
any point in the United States or Canada, Pullman Reservations may be arranged by Radio
from our Steamers before arrival at New York.
By arrangement with the CUNARD LINE and ELDERS ac FYFFES LTD., tickets
can be secured at the Booking Offices of any of these lines for a TRIANGULAR TOUR
good for Round Trip embracing Jamaica, Englarid and New York or Mlontreal--start-
ing at any point and travelling in either direction Time limit---one year.

Head Offices, Jamaica Office,
Pier 3, 40 Harbour Street,
North River, Kingston.
New York.






-- F Y FFIIES LNE
]FI RST CLA~S S P A S SEN GrER SERVC
Frequent Sailings DIlIEC;T to ENGLANDI Also via Trinidad and Barbados,
K;ING~sTON TIO AVONMOUT'H INi 18 DAYILS.
Modern Steamers, specially built for the West Indian Trade.--All outside Staterooms Spacious Pub-
lic Rooms and Promenade Decks, Swimming Pool, Large and Airy Dining Saloons. Suites, Rooms with
Bath, and Single Berth Rooms available at moderate rates.
Head Office:-- Agents in Jamaica:--
Elders & Fyffes, Ltd., The United Fruit Co.,
31-32' Bow Street, 40 Harbour Street,
Lqndon, W.C. 2. Kingston.





1931-32


PLANTER S' PUNCHI


iAyrtle Baltz 31stel
CI NGSTION














=~~OTL IN TH TROIPIC Fr1rS.

REPET WIH VEY DTAL O SRVGE NDEQUPMNT










1-oT L~ TCFEL OT OI


THMA G. S. HOOKE,
RESIDNT MAAGER
Unite Frut Co's Htels
i % IJamaica, B. W. I.

= ilill Ilillill|11llilillllilll lil .l li Ill1 -ildillll IIll I1|il li illiilililill|illi Ili lililIliilll lillilla, ll-% 1 Illi l s ll| | ilil ll |Ilil I IB l srl f 'l l l Ilill lllil l d lin ill illlliilll l lila ll








should occupy a splendid and independent position,
It was such a position that he could give to her. The
thing had moved her irresistibly to a burst of laugh-
ter that was really a p~aean of triumph.
But she saw that he was wounded; he had mis-
understood her.
She put a hand on his knee: "Thank you," she
said; "you are a dear. Of course I want to be nice tio
you."
But she did not wish that he should say any-
thing more just then: the chauffeur, though the car
was a huge one, might overhear. She affected to be
interested in the town which they had now
entered.
The shops of Port Antonio were closed for the
Sunday rest, but at the windows of the little wooden
houses lining both sides of the streets through which
they drove sat women, black and brown and lighter-
coloured, gazing aimlessly at nothing, and in the
streets themselves lounged little groups, of dark-
skinned girls and young men, chattering indolently,
and the sunlight was thrown back from the hard
white surface of these sordid thoroughfares littered
with fruit skins and scraps of paper. Presently
they were climbing the Titchfield Hill, with its finer
residences: its tall two-storied houses of wood and
burnt brick, and its bungalows.
The hill rose steadily. Higher up they came to

I


-R. WB. TALOR & CO.,


GElNERALI MVERCH~ANTS ~--



DEALERS IN


Haberdashery, Hosiery, Fancy Goods,

fi7narnelware, Tinware, Hardware,

Glassware, China-ware Earthenware.




~~ LADIES' HATS AND' FLOWlERS,

MEN'S OUTFITTING ARTICLES,




S38 SOUTH~]EI PAR~~AD~~E, IGTN


__


PLANT E R S' PUNCH


1931-32


me down' at Mapleton, or even be here with me to-
day--that may sound conceited, but I really believe
that one of the reasons why you came to this house-
party is because you knew I was coming--"
"That is quite true."
"It iE:; and though one of your motives was to
see that Arthur did not stick too much to me, and
perhaps make love to me, yet I am sure you like
my company. Very good. I tell you that I am not
trying to catch Arthur, as the Beavershams believe.
They want him for Hazel, don't they? You want
Hazel for him, too, don't you? And I want a nice
time with nice people, and you have helped me to
get it lately; it is through your inviting me to
Mapleton last month that I have become acquainted
with some very nice people, and I can sincerely
thank you for that. We needn't spoil everything
now. I tell you that I like Arthur, but I am not
in love with him, or trying to hook him. That is a
vulgar remark, but quite appropriate."
"Gladys, what sort of a girl are you to say such
things ?"
"Merely a practical young woman who has to
earn her own living and who does not want to let
any nonsense prevent her from making her way in
the world. A business woman, though young. What
else should I be?"
"You ought to be something else; a great artist,
for example, or a lady in a splendid and independent
position."
"A great artist? I am not so foolish as to think
that. I try to keep sane, anyhow. A lady in a fine
Position? That means money, and I am a working
girl. So, you see, your kind wishes on my behalf
are impossible. But now that I have set your mind
at rest in regard to Arthur .."
Mr. Pemberton startled himself by his answer to
this; he heard his own words with a shock of stir-
prise--
yu en uanddyA~rthur, and everybody eso! bDn'
nice to Arthur because I hoped that you could be
nice to me?"
She started. She glanced swiftly at his face,
which now was eager, enquiring, almost passionate:
the face of a lover. She was surprised, flustered.
This, at any rate, was something she had never ex-
Spected, though she had known that he liked her.
"This is very sudden," he said, and she atsto-
nished him by bursting into laughter. "That is the
old, old comment of a woman," she cried, and he felt
Sthat-~ he had ~made a ,fpol pf himself. But her latigh-
ter and exclamation were really the result of a swift
stimulgtiop aid e..ibilarallron of her whole ermotiornal
being; she had received a shock, but it had exalted
her;, thlrilele her. abnd s61444 fu~lndl ;eprssioy Fn that
peal of joyous sound. She was not laughing at him,
she was laughing out of sheer exuberance of spirits,
for the fact that had with the swiftness of lightning
impinged upon her consciousness was that this
colonial magnate, this confirmed bachelor, this man
so proud of his prestige, his position, his wealth,
was making love to her with a deadly seriousness,
was the rival of Arthur and of every other man
whatsoever, and was not the sort that meant nothing
when he spoke as he did. He was in earnest; she
could see that. He was offering to make her his
wife. That was what he had had at the back of his
mind when he had said, a minute ago, that she


The ~~~Cu ORd Th
(Continuced from Page 54)
Gladys at his side. His chauffeur knew every
mile of the parish; the drive would be an interesting
one. He felt animated, happy, at having so pleasant
a companion. All his admiration for and his interest
in her were fully revived once more,
He had taken a little more stimulant at lunch
than he usually allowed himself; this had bright-
ened him up considerably, had energised and em-
boldened him. He knew he was taking her with him
so that she should not pass most of the day with
Arthur; Mrs. Beaversham had suggested this, but he
would have done it even had there been no such sug-
gestion. He disliked seeing Gladys with Arthur now
as much as he ever did before. But a clearer
realisation of his feelings and attitude had come to
him at lunch. There had been a young man there'
to Gladys's left, a handsome fellow who worked in
one of the big accounting firms in the city and was
one of Arthur's acquaintances. He had made him^
self very pleasant to Gladys at lunch, and Mr. Pem-
herton had been conscious of some resentment at
this. It had made him feel, he said to himself, that
he was only playing the part of an old interloper,
and was only tolerated because of his position. So
now, with the effect of cocktails and whisky still
upon him, he voiced the thought in his mind.
You are going to be disgusted with my taking
you away from the brighter members of the party,"
he said; "it would have been nicer for you to be
with that young fellow you were talking to at lunch
-Cuthbert I think his name is--or with Arthur, or
some other person like that. But I won't monopolise
you tonight, I can promise yocu."
"Now I know you are not fishing, but deadly
srious," she interrupted, 'ad I t nlk' yoneare very

agreeable to coming with you I could have made
some excuse? You are not the host to-day, are you?"
"No; a guest like yourself. Still .."
"Yes, I know. You were going to say, but
stopped in time, that you are Arthur's uncle and
that I may have thought it wisdom to be on good
terms with you if I want to continue on good terms
with Arthur: isn't that it?"
"Oh, how could you think that!" he spluttered:s
MPy dear Gladys ..."
"I have only expressed what you did think, and
there is not the slightest use your pretending
that you didn't think it. Well, you are wrong, and
that is all there is to it. I am by no means as in-
terested in your nephew as you and Mrs. Beaver-
sham, and Hazel Beaversham,. belidie. I likre him,
he is a nice fellow, he is a good friend. No danger
in all that, is there? I am not setting my cap at
him. Hazel needn't worry."
"Good God!" exelaiined Mr. Pemberton. "How
uraU oor girls dou thaak! 1n hln~ do you get the
"What you call reserve was a pre-war product,"
she answered, lightly. "Reserve as you call it
means that you and I should be at cross-purposes
when a little plain speaking would put everything
right. I know you like me; if you hadn't you would
never have tried to encourage my work or have had


Us Us HADL a

89 King Street.






Pan 6XGSe 7SaLfl




; Compass Flower

b cause inal~l~ :eathters, Winter
and Summer, it turns its flowers
to the north; rains beat upon it
and snows cover it, but it never
Swerves from its fixed direction.

There are men and boys like that.
Niot long ago a lad picked up a
letter that a lady dropped sn a
street car, and, raising his hat,
handed it to the lady with its ad-
dress turned down.

A gentleman sitting nearby said
to another: "I'll bet you that boy,
had a good mother."

The trifles of conduct in this Store
every day tell people what kind of
store this is.






SHOP HANDAL'S and


See for yourself that flandal's

will not be undersold.




LADIES' AND MEN'S OUT-

FITTERS -- BOOTS & SHOES






































































Some Day




A Hurricane Will Strike Jamaica!










A QU~TEST I ON IS it not far better to pay a fixed sum of money --

TO ~yearly for insuring your crops against 1-urricane

Damage than be faced with months of worry
BANANA ~
through lack of funds necessary for replanting?

AND1
The cost of crop Insurance when apportioned over

CO CONUTI- each tree is infinitesimal.


PLANTERSWrite to us for particulars of our schemes.









R. S. GAMBLE & SON LLOYITS AGENTS, KINGSTON.


PLANTER S' PUNCH


flowering shrubs; soon they were within the pre-
cincts of the Titchfield Hotel, and had drawn up
at its principal entrance. On the wide verandah,
painted a deep green, guests were lolling in rocking
chairs; a porter hurried up to them to help them
out of the car. Mr. Pemberton dispensed with his
services, assisted Gladys to alight, then together
they walked to the other side of the building, coming
out on the opposite verandah, immediately in front
of which the ground broke swiftly towards the shore
and the glistening sea.
The blue and silver water of the harbour swept
away, a pale blue sky overhanging it. The earth
in front of the hotel just here had been terraced, and
on these terraces a tropical garden of palms and
lofty shrubs, and evergreen trees, thick and' umbra-
geous, had been planted, a garden rich and resplen-
dent in greens and scarlets and reaching steeply to
the! foot of the hill. Long flights of steps with in-
tervening platforms led downwards. G~ladys glanced
enquiringly at Mr. Pemberton. "Shall we go down?,,
she asked, and he assented, though such adventures
were not easy at his age. She must have understood
this; she walked slowly, and he accommodated his
pace to hers, grateful that she did not attempt
quick movements to show a girlish agility. They
found a bench below and sat upon it; it was
she who reverted to the conversation in the car.

sad'Sol you were j aous uofuthe hunger men? she
"You can't mean that--do you mean it?" he cried
eagey uI do so muocldolder than youst twhy you
should think that only boys would interest me. I
am older than you think I am.,,
"You look so very young.,,
"I am older than I look, and you look younger
than you are; you are fifty, I suppose?,,
"I have taken good care of myself all these
years," he answered with smug satisfaction. "Per-
haps, without knowing it, I was waiting for you to
appear. You understand now why I hated to see
Arthur making love to you? I had, I could have, no
objections to you; you would adorn any position,
You were too good for Arthur, too good for me; but
I could not help loving you, though I did not think
of telling you so. I would have done it some day,
though; it was bound to come out. Do you think
you could like me?"
"I think ever so much of you," she replied.
Neither of them spoke about her loving him, though
that did not strike them at the moment.
"Then. .?"


"You are sure you want me to marry you?"
"Very sure. I never was more certain of any-
thing in my life."
She pondered. She was not in love with him;
how could she be? But she was in love with no one
else, so far as she knew: love did not seem to matter
much in life as she had found it. He could give her
much that she desired, craved for, had believed it
would be so much worth her while to win. Nobody
else that she knew could do that. It was a splendid
prospect that opened before her; but if she said
yes at once she might seem, even to him, precipi-
tate; he might afterwards think she had accepted
him for what he possessed, and that would be a bad
beginning. There was another consideration, and it
affected her decision. Were they to return to Morley
that afternoon, engaged, Mr. Pemberton might men-
tion the circumstance; his very attitude would pro-
claim it. And Arthur would know. Arthur--poor
fellow! He would be hurt to the heart at the very
moment he was so happy. She could not allow that.
It would doubtless be a fine revenge to see the faces
of Mrs. Beaversham and Hazel when they heard the
news; but she could savour that revenge later on.
She must spare Arthur now .. poor Arthur.
She made up her mind.
"I will tell you later. You must think over what
you have said. You may want to change your mind."
"Never," he asseverated firmly, and the set of
his mouth and chin told of an unshakable determina-
tion.,,
"Still, we can wait a while. When you next
come over to Kingston I will tell you."
"Then I shall come to-morrow," he said.
"You don't waste time, do you?" she smiled;
then thought of another scene. Arthur, whom she
had refused, had nevertheless kissed her that night
with passion. His uncle, whom she had now given
every reason to hope, made no effort to offer a caress.
This was reticence, a reserve that had come with
years. The difference slightly chilled her.

CHAPTER EIGHT

ARTHUR was lounging in an easy chair on his
verandah at Morley, pondering the news he
had heard from his uncle a few days before. Mr.
Pemberton had been jubilant and jaunty; he would
be married in a few weeks, he had won the
most beautiful girl in Jamaica, and now his cup of
happiness would overflow if only Arthur would fol-
low his example. He had again suggested Hazel
Beaversham. He exhorted Arthur to go in and win.


Arthur had gone to Kingston for an in-
terview with Gladys. She was disposing of her
studio; art had' served its purpose and would now
only conflict with matrimony if persisted in. She
had been very kind, but firm and businesslike. Yes,
she was going to marry Mr. Pemberton, and she
hoped to make him a good wife. She would try to
make him happy. Arthur himself would marry some
day-
"Hazel Beaversham, ch?"
"Who said that, Arthur?"
"W~ell, it is Uncle Alfred's suggestion, so I sup-
pose it is yours also: uncle and aunt would agree,
wouldn't they?"
"Don't be silly, Arthur." She was thoughtful for
a moment, a frown appearing on her brow. "I don't
want to interfere with your uncle's plans," she con-
fessed, "I am. only an outsider. But Hazel Beavers
ham, Arthur? She is purse-proud and pretentious;
you would never be happy with her. Why should
you be in a hurry to marry?"
"I amn not," he answered bitterly; "but I don't
see why it should matter to you now what I do. You
are only marrying for position and wealth, Gladys.
You don't love my uncle."
"I am not in love with anybody else," she an-
swered evasively; "but don't do anything rash, Ar-
thur. Don't throw yourself away. And I can always
t ut yocn't I?"
ru"Be tercahan I could ever trust you," he replied
bluntly, and because she knew the cause of his rude-
ness she did not resent it.
"Then promise me you won't repeat what I
have just said to anyone."
"You don't want it to appear that you and my
uncle have different views. Is that it?"
"Yes."
"I promise," he said, with a laugh that was
three-fourths bitterness.
"I knew you would; you are a good fellow."
Thus had the interview ended. He had not seen
her since, and now he was thinking of that last talk
and of previous meetings and conversations. Every-
thing was over now, even before anything had well
begun.
"You look sad, Sahib."
Marie Ramsingh's voice broke in upon his medi-
tations; she had come out on the verandah from the
room behind, a lithe figure in white and scarlet,
with her silver bracelets gleaming on rounded arms.
She stepped quickly into the gloom of the ver-
andah, to his right; from where she stood her form
could hardly be seen by anyone passing in the


193032




































ARE YOU FREE FROM AHXIETY?1



If not make yourself at ease~by carrying an
Insurance Policy in


THE



Nonc Of I i n0 Fif6 Inuac RS S0 o CietyI


Lt1. Of NcfWIilh E Rgl80(I


This company will set your mind at rest

in regard to Fire, 1Motor, Burglary, Personal

Accident, and Disease, Tlhird Party Drivers'

Indemnaty, Fidebity Guarantee, Earthquake
and Hurricane Insurances.



Write or call on the Local Agents at once

and take out the Policy you require; and

remember that in going to this Company you

are going to an old established Company,
and that you will not have to wait months i


LIVINGSTON & ALEXANDER,

Agents,

20 Duke Street. Kingston, Jamaica,


grounds below. She evidently wished to avoid ex-
traneous observation,
"You here, Marie? I thought you had gone off
already," he replied.
"I am giving a last look round before going. I
noticed you didn't eat much dinner, and you hardly
eat las' night either, or the night before. An' you
look sad. You are in love, Sahib?"
"Marie!"
"Don't be vex: don't say I am forward. But you
look so sad .. "
"Oh, I am not vexed; b~ut I am sad, very. I
didn't know I was showing it, though."
"I am right? You are in love?"
"You shouldn't ask such a question, should you?"
"No; but I feel sorry to see you so sad. You
look unhappy, an' I am not happy myself, so I sym-
pathise."
"But Ramsingh loves you, Marie."
She said nothing to this; then, concluding that
he was not just then inclined to confidences, realis-
ing too that she might easily presume too far, she
bade him good-night and left him to his thoughts-
She wras certainly rather bold, he reflected, though
without any resentment. She and her husband
were in charge of Morley Great House now,
promoted to that position since the successful picnic




Jarnaica's


Leading


Grocery

THE: PREMIER HOUSE FOR
FOODSTUFFS IN JAM~AICA.
The high standard of QUALITY7
maintained in all lines of~-
STAPLE GROCERIES, POI
SIONTS, HAMIS & BACON, CHEESE,
BISC UITS, TEAS (all blends),
WINES, LIQ UEULRS and every
DELICACY~ for the table, at

Eetter Prices

Keeps us in the front.

And the-UTNPARALLELED SER-
VICE--makes this establishment
"LThe Housewives' Rendezvous"

EUTTER

Our Specialty
Newe Zealand C eameryl Butter-Best

Bluenose Butter in Tins.
Canadian Brook~field Butter in Ti~ns.
Come and inspect our fine range of
Christmas Supplies.
Christmas Crackers, Santa Claus
Stockings, Balloons, Starlights,
Chocolates, Confectionery,
&c., &~c.
"A Qualified Service at Your Service
Always and All W~ays."


JAMES DUNN

89 AND 104 ORANGE STREIETI`
Kingston, Jamaica, B.W'.I. '
Quality --Seorice --Price.


PLANTER S' PUNCH


1931-32


of about two weeks before. He had discovered that
they could arrange things as his other helpers had
not been able to do; besides, his butler was not
'likely to return. Ramsingh's situation on the planta-
tion itself continued as before; it was really Marie
who had been put in charge of the house, with her
husband's grateful consent. It meant more money,
and Ramsingh was too true an East Indiian not to
love money. Also, the work was light, being one
of supervision, and Miarie could still look after her
own household affairs. Marie went to the House in
the morning and left finally after dinner, being free
in the day to go to her own cottage, her new cottage
which was near to the Great House. This arrange"
ment suited Ramsingb. He hoped it would continue
if and when the Sahib got married, as, somehow, it
was being rumoured on the plantation that he shortly
would.
But Marie Ramsingh had recently observed a dis-
tinct change in Arthur's looks and demeanour. Things
were not going well with him, she concluded. Hence,
greatly daring, her question of to-night.
He himself was thinking of the marriage that
was to take place so very shortly, a quiet wedding
at the Halfway Tree parish church. He had been
asked, of course, and go he must, since he could find
no good reason to give for abstention. But he felt


much as he imagined a man awaiting his execution
wYould feel.
Some of his uncle's closest friends had found' ex-
cuses for not accepting invitations to the wedding.
The Beavershams had discovered that they must be
in the country that afternoon; the Eversleighs, an-
other family that vied with the Beavershams for
social leadership, had originated sickness in the
home; the slight cold of a younger daughter had ver3
cleverly and obligingly become influenza, and no
humane persons could ever, of course, deliberately
take with them the germs of influenza to a bridal
party. And so forth. Mr. Pemberton understood
these people very well indeed, but he was not per-
turbed. He knew that they were puzzled as to wvhat
they should do, but he was confident as to the line
they would eventually take. They disapproved of
his marriage, but they would come to heel in time.
-He was too important AE man to be ignored socially
He could dispense with the recognition of quite a.
few of them and yet have enough people of the best
positions ready to be friendly always. As to the
Beavershams, he determined to teach them a lesson:
It would be he and Gladys who would cut them in
the future, and that would be for good.
Two weeks later the marriage was solemnised.
Arthur vias bestman. Lily Reamster had gladly on-


as all


for the settlement of your claims

claims are settled locally.








































































168 HARBOUR STREET, KINGSTON.


_ --1 -1III~ -L


PLANTER S' PUNCH


1931-32


would not be left penniless, that was a possibility
not to be too much counted upon by reasonable and
businesslike persons.
It was this new situation that Mr. Beaversham
had already discussed with his wife. Now that his
worst fears were confirmed by Arthur's own admis
sion, he was conscious of a coldness towards the
young man, as though, Mr. Pemberton having com-
mitted the sin of marriage, the fault was somehow to
be attributed to his nephew. The Beavershams had
determined to ostracise Mr. Pemberton and his bride
--until, at least, it was plain what the Courtlands
and some others would do. Should these decide that
the artist might be accepted as one of themselves, the
Beavershams would graciously relax. Meantime
Arthur could be treated as a man betrayed by his
elderly relative. But the keen business intelligence
of Mr. Beaversham now warned him that to show too
much sympathy with Arthur, to encourage him to be
a frequent visitor at their house, would be a grave
tactical blunder. Arthur had been infatuated with
Gladys; it would be easy for him, to turn for
solace to Hazel. And she, being young and presum-
ably romantic, without as yet enough time and oppor-
tunity to develop sound business principles, might
te strongly inclined to heal the wounds in his heart
-to offer first aid, with disastrous consequences.
That would be stark folly; it must be prevented. Mr.
Pemberton had greatly wronged his nephew and the
Beavershams, but the latter must not wrong them-
selves. Two wrongs never yet made a bad marriage
right.
"Do you propose to remain your uncle's planting
attorney now that he is married?" casually enquired
Mr. Beaversham, and waited eagerly for the answer.
"I suppose so; there is no real reason for me to
cease."
"I don't know that, Arthur," earnestly remarked
M4r. Beaversham. "If you are no longer his heir--
and you should know--it would be a mistake for
you, I think, to waste your best years working for
another man. By the time you look this way and
that, you will be forty, and then you may still be
only an employee. Without presuming to give advice,
I would say, strike out for yourself. Make your ownl
way. You are young, you have ability: why waste
your time now that everything is changed?"
"But I can't go in for a profession at my ago,
Mr. Beaversham; I only understand agriculture."
"You would get on splendidly as an agriculturist
in a country like Canada, Arthur. You could get
some land there and make something of it. This
may be your great opportunity."


sented to be chief bridesmaid. There were thirty
guests, and the reception was at the Myrtle Bank
Hotel; it had been arranged that the honeymoon
should be spent in Montego Bay--a fortnight only,
for in April Mr. Pemberton would take his wife for
a trip to the United States and England. Everybody
admitted that Mr. Pemberton looked extremely well;
he stood erect, ten years seemed to have fallen from
him; the prospect of matrimony had apparently reju-
venated him, though he had always been a well-pre-
served man. Gladys looked lovely, too, said the guests.
though somewhat older than usual. But this was
rather an advantage, since it prevented any striking
incongruity between them, in the matter of age, from
being perceptible. There were three or four persons
present who had' thought Arthur particularly keen
about Gladys, but in his demeanour at the wedding
nothing could be discerned that might give rise to
entertaining gossip. H-e was calm, composed, and
when toasts were being drunk at the hotel afterwards
he made a neat little speech in which he expressed
the proper and conventional sentiments. As for
Oladys, she was the perfect bride. She carried off
her part admirably. In her wedding garments beside
her husband she looked like one boi'n to enter into
great possessions, completely used to them in fact.
She was already the colonial lady of position and
generous means.
Arthur remained in Kingston that night. In the
evening he went to see the Beavershams, who had
already returned to their home. (That is, Mrs.
Beaversham and H~azel had, for Mr. Beaversham had
never left it). Arthur was in need of someone with
whom, he could intimately discuss this new turn in
the affairs of his uncle and himself; and perhaps
because he knew that the Beavershams were antag-
onistic to Gladys, an antagonism which he him-
self was now conscious of sharing, he had se-
lected them as persons with whom he could
talk freely-
They expected him. Before his arrival he had
been discussed by Mr. and Mrs. Beaversham, who
were somewhat perplexed about his future. What
were now his prospects? How should he be allowed
to stand in relation to Hazel? They had decided
upon certain tactful investigations.
Mrs. Beavershiam gave utterance to her state of
mind that evening in the drawing room, there
being no strangers present.
"I can't imagine, Arthur, how a manl like your
uncle should have made such a mistake; he must be
clean off his head! And none of us ever suspected
it."


"You all thought it was Arthur who was falling
in love with the lady, didn't you?" laughed Hazel.
"You didn't suspect sly old Uncle Alfred."
"If Arthur had done so that would have been
more natural, though equally foolish," said Mrs.
Beaversham. "Arthur did seem to be paying her
some attention: didn't you, Arthur?"
"Just ordinary attention," the young man replied,
not desiring to appear as a sort of slighted lover, a
part which he felt to be ridi-ulous.
"It might have developed into burning, passion-
ate love," Hazel teased, "but perhaps you were too
slow. We do things quickly these diays. We rush
'em; but it is Uncle Alfred who has done the rush-
ing this time."
"I prefer deliberation myself," observed Mr.
Beaversham quickly, startled lest Hazel should be
thinking of getting in some quick work herself. "I
like to look around me and know where I am. It
is none of our business, of course, but we have known
Pemberton and you, Arthur, all our lives"--a bit of
an exaggeration-"andl. I can't help thinking that this
marriage is hard on you."
"How do you mean?" asked Arthur, who could
not conceive that Mr. Beaversham should ever have
wanted him to marry Gladys.
"Well, if there should be a son, you know .. .
you were your uncle's heir all this time but now
it seems a little different, doesn't it?"
"Oh, very different. I don't suppose I shall ever
be a pauper, of course; indeed I couldn't be, for I
understand my business. But my uncle is not really
old, and his wife comes before me, and his children,
if there are any, must be adequately provided for. I
am out of the picture so far as inheritance is con-
cerneid; I have realized that all along." That the
prospect did not please him he showed by the mirth-
less laugh with which he concluded his remarks. ~I
Mr. Beaversham's feeling underwent a severe re-
vulsion. He had imagined that things would be as
Arthur had just depicted' them; but there was
always the possibility that Mr. Pemberton, who
had thought so much of his nephew, might have made
some definite provision that would make Arthur, if
not as rich as he had once had reason to expect to be,
at least in a very comfortable and enviable position.
He could have given him Morley, for example; :
deed of gift might have been executed. That would
have meant much, if by no means all. But Pember-
ton hadr apparently left Arthur in precisely the posi-
tion he had always occupied, and though it was to
be supposed that at the older man's death (which
might not occur for another twenty years) Arthur


PATENT

MEDICINES








WAKiEFIELD
ELECTRICAL CASTRIOL
MOTOR
GOODS OILS








SSTANDIARD SNIYTARY WArREI




MANUFACTURER S'

REPRESENTATIVES























































E THEIllAlT 110TEL
IONTEGO BAY


One of the best
-_4;E~-C~~l~~~g~~I; Hotels :o stay at
in JRalRica.


Pet YOleum



Prd It


"It is a fine idea," agreed Mrs. Beaversham, wel
aware of what was passing through her husband's
mind.
"Poor Arthur!" exclaimed Hazel; "fancy his
burying himself in the backwoods of Canada."
"There are no backwoods in Canada," asserted her
mother positively. "And Arthur has to think of his
future. He has been shamefully treated by his uncle
and an adventuress."
"I had never thought of Canada," said Arthur
thoughtfully; "but the suggestion appeals to me. I
am inclined to act upon it. I think I will. After all,
what is the good; of my staying here?"
"No good whatever." Mr. Beaversham was posi-
tive. The emigration of the young man would ob-
viate the necessity of his being shown that he was
not welcome to the Beaversham's house: to save
people from doing unpleasant social actions was one
of the reasons, clearly, why countries like Canada
existed. "No good whatever. It would never suit
you to continue as your uncle's employee. You can
never tell what his wife might want him to do to
you."
"She is going to try to geteeverthing he has for
herself," added Mrs. Beaversham, who implicitly be-
lieved this. Then a kindly feeling for the young
man, partly the result of her own sense of disap-
pointment, swept through her. "I am sorry for you,
my boy," she said sincerely, and for a moment her
husband wondered in a panic whether she was about
to weaken. H~e did her a grave injustice.
Arthur had arranged to drive himself over that
same night to Morley. This necessitated his making
his visit a short one; it had lasted less than an hour
When he bade them good-night he did' not notice
that neither of the older people suggested that he
should look them up when he was next in town.
though Hazel did. The Canadian business was up-
permost in his mind now; he wanted to be out of
Jamaica, he did not relish seeing Gladys as the w~ife
of his uncle, day by day, month by month. Besides,
his position was greatly changed; he must see to
his own future now; it would not do for him to be
a dependent. He craved to be his own master. He
was grateful to Mr. Beaversham for his suggestion.
He compassed the seventy miles to Morley in less
than three hours that night, thinking all the while
of his frustrated plans, for he had planned to marry
Gladys. He thought of Canada, which was now to
be his goal. Hie had sufficient money to set up there
as a farmer; indeed, he could set up for himself even
in Jamaica, for he was not at all without resources;
but he did not to wish to remain in Jamaica;
that would not be pleasant for him. He would make
enquiries about Canada, and then, when his uncle
returned from his visit abroad, a few months hence,
he would leave the island. That was something to
look forward to; it filled his mind with a purpose
And he would try to forget Gladys, his unce's
wife, who had sold herself for money.
He arrived at Morley before one o'clock, a light
in the house informing him that he was being waited
for. He had had a strenuous day; he felt empty
rather than hungry; he would have a bit of supper
and then to bed. His arrival was known; the door
to the rear of the house, which opened into the din-
ig room, was thro n op~ehr andRaamsi radow
suit-case up to his room, and Ramsingh himself pre-









Wholesale

Dry Goods,





149 HARBOUR STREET,
KINGSTON~.






RIGHT GOODS

SAT ~


RIGHT PRICES

TO SUIT THE TRADE.


Ship's Bunkers ex Pier or ex Lighter

WE CAN ADVISE ON LUBRICATING PROBLEMS


THE SHELL Co. (WEST INDIEs) LTD,

KINGSTON, 'JAMAICA.


PLANTER S' PUNCH E


pared to put the car into the garage. He went up
the steps, and Marie came forward with a smile
of greeting.
"You shouldn't have waited up for me, Marie."
he said pleasantly, "I didn't expect you to."
"I am glad to, Sahib," she replied softly. "I kept
supper-for you. You are tired?,,
She was looking into his face, in her eyes a light
of genuine delight at his return. He renrarked it
it made him feel that he was really back at home.
She made an attractlive picture, with her scarlet
shawl and smiling lips and shining eyes. He had a
feeling that it was rather comfortable to have a
pretty woman in the house who could look after
things as the ordinary servant never could.
He washed his hands and face quickly and came
back into the dining room, and she waited upon him
herself. H~er husband hurried in, as soon as he had
locked the car in the garage, to assist her, but
little assistance was needed. The meal was swiftly
despatched; Arthur bade both the man and his wife
good-night. Her soft, "Good-qight, Sahib," was ac-
companied by a flash from her eyes which was in his
memory as he threw himself down upon his bed.

CHAPTER NINE

'`HE neighbours said that the Pembertons were
"doing things in style". There was more than
a touch of envy in this remark, for none of the
immediate neighbours were on visiting terms with
the Pembertons. After their return by way of Amer
ica from their honeymoon trip to England, GladyB
had persuaded her husband to buy and furnish a
house near Kingston, a comfortable residence on
the northern sideo of the Hope Road. Gladys had
no disposition to pass most of her days in the coun-
try grazing at a wide prospect of banana fields ana
shining river, and listening to the sing-song voices
of East Indians and Negroes as they went about their
workr among the cattle. That sort of thing was in
teresting at intervals, but monotonous if unvaried
by change. So she suggested a town residence to
RIVr. Pemberton, and he frll in with her wishes good-
naturedly, though, more than ever now, he preferred
to reside in the country.


He bought Delva and fitted it out; he and his
wife would occupy it when they came to town. To-
night they were giving a party there, a party planned
by Gladys. He himself would have liked it better at
Mapleton.
The house stood well in from the road, the
grounds were gaily illuminated, a fountain threw
a silver serpent of water high into the air. There were
rose beds about the garden, and on either side of
it ornamental trees with laid-out walks among them.
The moon was glorious in a sky almost cloud-
less. It would have been warm, but for the altitude
at which Delva stood--some six hundred feet above
sea level, and but, especially. for the sweet breeze
that stole down from the mountains to the north
and pervaded the plain below.
There were some seventy persons at this party,
though none of these were the people in the im-
mediate vicinity. These were not personal friends
of the Pembertons, they not being quite of the type.
considered in terms of wealth and position, with
whom Mr. Pemb~erton wishedi to mix on a platform
of perfect social equality. The result was thac
though they bitterly admitted that the Pembertons
did things in style, they were very energetic in
analysing the character and intelligence of Mr. Pemn-
berton and in dwelling upon the origin of his wife.
Somehow, something about that tailor's shop
to the north of ]Lond'on had got about. How do
these things emerge from a discreet privacy into a
disconcerting publicity? That is one of the mys-
teries of social life; but Mr. Pemberton himself,
while in England, had met Gladys's mother and had
inad'lvertently learnt that Gladys's father had plied
an industrious needle and scissors in his lifetime;
and it may be that he had talked over the matter
with his wife, not in censure, but with some affec-
tionate regret. He may have been overheard by the
English maid they brought out with them, or the
maid herself may have acquired the information in-
dependently. However that may be, first one per-
son in Jamaica, and then another, had learnt some-
thing about it; not everything, of course, yet enough
to raise the suspicion that Gladys had no right to
call herself an artist when her father had been only
some sort of a tailor. What the one thing had to


SHELL MOTOR OILS
SSHELL ENGINE OILS
SHELL CYLINDER OILS
SHELL MOTOR GREASES
REFRIGERATOR OILS
MARINE OILS
ETC., ETC.


ER)


1931-32


R0011 With Private Bath
25/-


GASOLENE
AVIATION SPIRIT
KEROSENE OIL
(lLLUMINATING & POWER
G~AS OIL
DIESEL. OIL
FUEL OIL
ROAD MAKING MATERIAL










Q~OI)~)ON)~I~(N1INU((II~H)~)(N(m~)t) I


v -<-<-<- ->-a-a-wm)L~(NtO-a- .o- -oma

of the property. I consider it as practically his
now, and it will be his. He gets a very fine salary
in the meantime; he needs nothing."
"You didn't hear about this Canada idea of his,
then, Alfred?"
"He said something about it when I came back
from England, but I told him it was all nonsense
and he didn't press the point. I don't think he was.
ever keen on it: just a passing idea."
"I wonder why he gave up the idea so readily,"
mused Dr. Croseby.
"But why do you think Arthur seriously wanted'
to leave Jamaica, Bill? He may have thought for a
moment that he hadn't much to expect from me after
my rharriage; but he could never have believed that
for long. Why, Gladys is as kindly disposed towards
him as I am; our regret is that he will hardly come
to Mapleton. I can't see the reason .. "
He broke off suddenly. His quick mind leaped to
a very likely reason for Arthur's having wished to
go away and for his abstaining from visiting 1VMaple-
ton. Of course! Arthur had been in love, or nearly
so, with Gladys. He may have been so much in love
with her that he wished to put a great distance be-
tween her and him when she could not possibly be
his. That was it! Yes; that was it: that was the
(Continued on Page o17)


1.931-32


PLANTERS'


PUNCH


CAPITAL


AND


RESERVES


Bon-Ton


81 H-ARBOUR STREET

is the IMost Up-to-Date WC;oman's

Shop that Jamaica has yet Seen.







The establishment which

caters for the wants of a large

and very fashionable clien-

tele--And although every-

thing is run on an advanced

standard yet my prices are

not in any way ahead of

similar stylish shops in Lon-

don or Paris.







REMEMBER


thtat a hearty welcome is al-

ways extended to all my

frien s and patrons--

to call at



BON-TON


At No. 81 H-ARBOUR STREET,

Kingston, Jamaica.


MLADAM~ IRENE WHEATLE,

PTOpfietfeSS.


do with the other it would have been difficult for
the critics to determine; yet there was felt to be
a certain incongruity between the two statuses, and
those who knew nothing about art had a good deal
to say about tailoring. These were chiefly the per-
sons who were not invited to Mrs. Pemnberton's
parties. Those who were guests at these delectable
reunions were silent about needles and scissors ex
cept in their own homes. They did not even talk
publicly about art, since it had once been locally
connected with a shop.
People passing along the Hope Road in the elec-
tric tramcars stared in at the gaily lighted grounds
of Delva to-night and had a glimpse of fashionably
attired ladies and men in swallow-tail coats strolling
about, or moving swiftly indoors to the strains of a
uniformed orchestra. This was life, they thought,
especially as they knew that never, except in dreams
would they take part in such a party. In the dialing
room wvas a buffet, where one might get whisky and
soda, brandy and soda, claret cup, sauterne cup,
various sandwiches, delicate cakes, cigars and cig-
arettes, and between twelve and one o'clock there
would be a regular supper on tables set out in the
garden and on the verandahs of the house. A supper
with chicken salad, lobster salad, cold turkey and
ham, caviar sandwiches, perfectly iced champagne,
hot coffee and old French brandy, to say nothing of
a choice of liqueurs. The dance would last until
about three in the morning, but some of the younger
people counted upon the good nature of their host
and hostess and planned to remain until live. Then,
before leaving, they would be regaled with bacon and
eggs, toast and coffee, and would retire home to pass
some hours in sleep after a perfect night.
Mr. Pemberton was feeling the strain of enter-
taining. The revolution that had occurred in his
mode of life had affected him; his hitherto fairly
placid rural existence had become almost a necessity
to him, but Gladys was essentially urban and enjoyed
crowds and gaiety and constant movement. Thus
there was a conflict between her wishes and those
of her husband, but it was he who had subdued his
inclinations in order that she should be pleased. He
was proud of her beauty, of her adaptability; he
believed that no one knew of that dark shadow
formed by a tailor's shop which stood in the back
ground of her life; he was delighted that His Ex-
cellency Sir Arthur and Lady Mugsley had' wel-
comed her as though she had been born in the pur-
ple and that she had treated the Beavershams anc
Buxtons as though they were inferior beings. On
her return from England, when Delva had been pur-
chased and a host of callers had demonstrated that
the social path of Gladys was to be as smooth as a
polished floor, the Beavershams and one or two other
exclusive families hadl quickly made some tentative
advances. They had adopted an initial policy of
smiles and bows; had these been reciprocated they
would have followed them up with formal cahls and
thus have shown that large-mindedness and bene-
volence of spirit which the success of others so fre-
quently induces some of us to show. But Gladys was
in an uncompromising mood; she had once been con-
signed to the nether social darkness by these people;
she would now prevent them from entering her own
particular circle of light. She too would be a lead-
er in society and antagonistic to them. They would


still maintain their old position, of course, but she
could easily hold hers without any recognition on
their part. There would be more than one chief in
the republic. Beavershams and the like would be
dished with their own sauce.
To-night Mr. Pemberton was happy enough,
though a trifle weary. Everything was going well.
Gladys was a perfect hostess. Later on, he thought,
she would probably settle down and be content to
live more in the country and come up to town less
frequently; at Mapleton she could give all the house-
parties she liked. Let her have her fling for a, while,
If there should be a son a little later on .
He was sitting on the western verandah of Delve
and talking desultorily to an old friend of his, Dr.
Croseby, who had specially come over from Port-
land for this dance. The music had ceased for
an interval; most of the dancers were sitting in the
garden enjoying refreshing drinks. A few were
walking about. Two of these, a, young couple, emer-
ged suddenly from the shadow of the trees some dis-
tance away and came towards the house. Mr. Pem-
berton recognized his wife and young James Cuth
bert, the clever accountant, whom Gladys had in-
sisted upon inviting to Mapleton and Delva on the
ground that he was a very pleasant companion and
danced divinely.
They were laughing heartily, these two, and were
evidently appreciative of one another's society. Cuth-
bert looked strikingly handsome in his well-fitting
evening suit; but indeed he always looked hand-
some. Gladys was lovely and radiant in her favour-
ite yellow satin; they made a fine pair, a couple
worth looking at, and there were not a few at the
gathering to-night who thought so. The same
thought came into Mr. Pemberton's head. And with
it a feeling, peculiar and unpleasant, though he did
not recognize it at once as a spasm of jealousy.
"There is Arthur," observed Dr. Croseby, as Ar
thur Norris passed alone from the rear to the front
of the house, walking quickly. "I haven't seen him
for some time.,,
"I had to press him to come over to-night," said
Mr. Pemberton indifferently; "he does not leave his
property in Portland often.,,
"His property?" queried. the doctor. "Have you
given it to him? I was hearing some time ago that
he was going to Canada; I think it was the Beaver-
shams who told me.,,
"Those Beavershams know too much about other
people's business, and perhaps too little about their
own," retorted Mr. Pemberton. His eyes had fol-
lowed Gladys and James Cuthbert until they had dis-
appeared into the drawing room in which the danc
ing took place. The musicians had now struck up
another dance. Gladys, he guessed, would again be
Cuthbert's partner. As soon as he could turn his
chair round unobtrusively, so that he would face the
drawing-room, where he could see them, he would do
so. He felt that Gladys, as hostess, should not show
particular favour to any one guest. There was no
need for her to dance more than once with this ac-
countant fellow. He wasn't so very high up in so-
ciety, anyhow.
"No, Bill," he continued, "I haven't made over
MLorley to Arthur, though I had it in mind to do
so. He is still quite young, and when I am dead it
will be time enough for him to take full possession


THE CANA DIAN





BA


CO M M ERC E


KING STON, J A.,


F. V. LU MB. MGR.













THE GENIUS OF HENRY FORD










ALITrTLE over 40 years ago the first motor car, as we
understand it now, had jiust begun to run about the
roads of France, to be followed soon after by its in-
troduction into other countries. The idea of the in-
ternal combustion engine became international pro-
perty and among those whose imagination was fired
by it was Mlr. Henry Ford, at that time an engine mechanic in the
prime of life. He was a man with a vision that reached further than
that of most others and he saw at once the immense advantage it would
be if the millions of people in the world could have rapid and inexpensive
transit between the centres of population.
Henry Ford immediately began to develop the engine; and, in 1890,
'91, and '92, was working far into the night on what he called a "gasoline
buggy," until in the spring of 1893, he records, it began to run satis-
factorily. ]Experiment followed experiment and finally the Ford Motor
Company was organised in 1903. The famous Model T was not brought
out until 1908 and then the manufacture began in serious earnest. In
1908-09 six thousand cars were turned out, in the next year eighteen
thousand, while on 31st May 1921, the five millionth car came off the
assembly line, to be followed in the present year by the twenty
millionth!i
The idea. of simplicity was Henry Ford's objective from ~the start
--to make a car which should be easy to buy, easy to run, easy to re-
pair and therefore easy on the pocket. It was not his idea merely to make
motor cars, but to provide economical transportation for the people. With
the coming of the Ford car that cheap transportation became possible to
men in all walks of life and not merely to the well-to-do; and there can be
no doubt that this has immensely increased the prosperity of thousands
of people. "We do not have automobiles because we are prosperous--
we are prosperous because we have thenn"
To-day with all its improvements--with all its new beauty of line
and colour--with all the betterments and changes--the Ford is still the
car for the people. Business of every sort runs faster because of it, while
outside business hours it brings to countless homes an extension of op-
portunity and happiness with priceless hours of relaxation in thne open
air.
The car no doubt may be looked at as a great miracle but so are
the machines that make it and the methods which make it possible to
build such a fine machine in large numbers at a low price. Millions of
parts turned out so accurately that they fit to very minute fractions of
an inch when assembled in the car--men by thousands and the hundred
thousand in one plant alone--are the outcome of this wonderful organ-
isation which displays to all the world to-day the genius of Henry Ford.


I I


r __
1. --- -- -


1931-32


PLANTERS,' PUNCH





Strand T"heatre


Movinxr Pictures and
Vaude ville


Western Electric Sound
System ~Installed.




Eldemire's No, 2 Wharf

General W~harf Business, also

Gasoline

Kerosene

Grease Oils

Etc., Etc.



~A. WV. ELDLEM~IRE,~
PROPRIETOR.


_ I ~


~,1931-32


PL A NTER S' PUNCH


o'clock. Said he had to get back to Morley early as
corl hdsome pressing business to attend to this
"I didn't see him before he went," said Mr. Pem-
berton.
"He didn't want to attract any attention to his
leaving. He met me just before a dance and told
me he was going; then slipped off. I said I would
mention it to you later on."
"But you didn'tt"
"I hadn't la good opportunity. Did youl want to
know particularly?" al
"I can't say I did."
"Why are you talking so coldly, Alfred? You
are not quite yourself. Are you tired, poor old dear?"
"I am not more tired than ~anybody else would
be after sitting up nearly all 11ight, Gladys, even if I
am a poor old dear. My age has not yet become
senility."
"Alfred, what is the matter with you? You are
angry-you 11eedn't shake your head; I know you
are. And after such a glorious night! What is the
matter ?"
"Nothing, except that I think that, as my wife,
you might pay some attention to my guests generally,
and not only to one or two. That doesn't look very
well, don't you thinkZ;
Gladys paused lin the brushing of her hair. She
was already well acquainted' with ebullitions; of peev-
ishness on Mr. Pemberton's part, and always she
found them trying. But she usually controlled' her
temper admirably, though sometimes it was tried to
breaking point.'
"I paid due attention to everybody. They all
thought I was a ~good hostess. You have nothing to
complain about."
She said.this very quietly, but there was a strain
on her nerveson,
"You danced nearly all the time with the same
man. Was thakeo~eufeouou to the other men?"
"I danced' just four times with James Cuthbert;
all the other d;Lnces I gave to other men. Jimmy is
an excellent dancer, and I don't see that, because I
am hostess ait Delva, I am to deprive myself of some
good dancing. I don't see other women doing that."
"Your position and mine--"
The tension at this hour of the morning, after
such a hectic night, during which champagne had
played.a stimulating part, was just a trifle; tdo much
even for practised restraint. "Don't you ever get
tired, of -hi~nkingl about, your position, Alfred?"
she cried. "After all,; it is not so high and mighty, is
it? Other people have position also, but it doesn't
seem to be always in their minds."
"Indeed! Very well, thank you! You behave
a4 you ought not to have done, and then you become
insulting. This is your defence for giving most of
your time, to a,dressed-up puppet like Cuthbert who
hasn't an idea in his hleadl qud who would be a pau-
per i~f kicked ouit of hisjob tomorrow. All that I
have to say is that I don't wish to see Mr. Cuthbert
again in my house and I shall be much obliged to
you to remember that. If: he ever comes here or to
Mapleton again I shall kick him out."
"And all I have to say to that is this," firjM
back Gladys, riow roused at last. "I intend to habe
pleasant friends, and I refuse to allows you to choose
all my friends for me. Some of your people of
'position' are simply stuck-up bores; I feel like


him to go away for a couple of months? What's
the good of coming oto me? ou cntdo anything."

"What are you driving at, Bill? Is there more
in your mind than you have meanl~ntole '
Dr. Croseby hesitated, then said: ''There is
nothing definite in my mind: only a feeling that
SArthur's mode of existence isn't normal. I suppose
I can never forget that I am a doctor."
But three weeks before he had dropped in at
Morley Great H~ouse to ask Arthur to give him lunch.
Arthur had not yet; come in, but he had seen there
a pretty ]East Indian girl who had mentioned that
she was the housekeeper and who, he had observed,
moved about with a subtle air of. proprietorship. He
would not have remarked this had not the girl been
one to compel attention; but he? had thought that a
single man, with such a young woman about, might
easily fall into temptation. This, he felt, would not
matter much if the girl were not married, as he had
afterwards discovered that she was. She was not
only married, but her husband was an Elast Indian:
there might be complications. He liked Arthur; he
would do him a gootl turn if he could. He must not
interfere too deeply in other people's business; it
would be ruinous to a doctor to be known as a, paul
pry. But he wondered' whether Arthur's rea~diness
Ito, give up his plan of emigrating to Canlda muight
.not have been connected with the presence of Marie
Ramsingh at Morley.
H-aving nothing further to say, Dr. Croseby
twisted round his chair to watch the dance then pro.
ceeding. This nwas just the opportunity Mr. Pemnber.
ton had been longing for. He followed the doctor's
example; as they both settled themselves in a posi
tion From where +thy could see the couples .as
they moved across the brilliant oblong of the high
door opening- on this part of the verandah, James
Cuthbert and. Gladys came into full view. The eyes
Sof both men fell upon this ^couple at once, and imme,
diately Mr. Pemberton was sized wivth a desire to
know whether Dr. Croseby thought it in any way
peculiar or sliggesjtive that Gladys should be danc-
ing so often with the young Englishman; for this
was their third dance together. But Dr. Croseby
saw nothing whatever in the circumstance, and in
any case Mr. Pemberton could not ask him what he
thought. H~e scanned the doctor's face closely, but
that betrayed no sort of feeling beyond a slight in-
terest in the dance. That look might be only a mask,
however, reflected Mr. Pemberton; the doctor, and
many others, might be thinking things which were
derogatory to the dignity of Mr. Alfred Pemberton.
The night was spoilt for Mr. Pemberton. He
was now not only a little tired, he was distinctly
annoyed and perturbed. He-did not like this man,
James Cuthbert, and he felt that Gladys had not
acted as his wifet should have done. He stuck it
out, however, and outwardly continued amiable, but
he was glad when some of the older guests began to
take their departure. He passed word to the orches-
tra, ami at half past two o'clock it played the na-
tional anthem. In another half-an-hour everybody
had left, and Grladys and Mr. Pemberton at last
could go to bed.
"It's been a wonderful night," yawned Gladys
happily; "everybody; enjoyed themselves."
"Oh!"
"Except Arthur possibly; he left at about eleven


manufacturers of:

Aerated Waters

Syrups

Native Wines, Stout &

White Eagle Old Rum.

"Our Speciaity":

Dry Ginger Ale

& Cr stal Soda Water



"WCe Stand Alone in Quality and
have no close relations."


seltl tnum
!lrrd the
freshn~ss

Klim.


F31-8


Th1e Cup and The Lip
(Continued from Page 62)
explanation ..But then, though Arthur hat
given up the notion of leaving Jamaica, he had
not once been to M~iapleton since then. He had
made no attempt to come near Gladys; he shunned
her company. Therefore he could hardly have re-
mnained in Jamaica so as to be able to see and meet
her:. why, even to this dance Arthur had refused to
come until pressed by himself in person. Mr. Pem-
berton, these reflexions~ concluded, w~as conscious of
a feeling of relief.
Dr. Croseby resumed.
"He lives all by himself at Morley, in a big house
and with hardly any friend visiting him. As yrou say,
Alfred, he doesn't go about much. He has his work
to do in the daytime, and that keeps him' occupied,
but at night he must be solitary and lohely .. if
he- has nothing to occupy his inind. It-Eian't healthy.
It won't do him any good. You should insist;inpon
his changing his habits, Alfred." a
"Insist? But, good God, ^Bill, Arthur isn't a
child; he is a man. If you think he is unwell or
something, why don't you tell him so and advise











Stea 88 M g g Co

EETABLIsHED 1888.


Easily Digested...



Nourishing...

THE: BEST MILK FOR BABIES.

Choose Klim as the milk for your baby.
4 It is nourishing, easily digested and al-
ways pure and safe.
Klim is simply rich, fresh milk from
healthy cows grazing in rich dairy-lands.
It is powdered and packed by a special
process, so that it keeps sweet and pure.
Only the water has been removed. Add
water, and Klim. again becomes liquid
milk--as rich and pure and wholesome
as when it was first produced.
Klim needs no refrigeration. Its spe-
cial vacuum-sealed tins keep this nourish-
ing milk always fresh and safe.




Sole Agents *


105 HARBOUR STREET.




1931-32 PLANTER S' PUNCH
1111/1! 11)1(1 11)1 111 1111 111 111 111 111 1111 111 1111 111 16 5



I LAS Y f9L









HlU M BE R


~I 1~1
'"'Ci


~v- I ~~~
~1 r~l[
L ~_1l


~I -- -I Ir


P~A N-T:E R S' ~ P-U N C:H


1931-32


I


TH~E "ALL BRITISH-" HlOUSE.

and accessories only, because their quality
make them the most suitable for Jamaica.


British Cars

dependability


and



and


Every sale is backed by thorough and efficient Service
a spare parts and repair organisation second to none.


Liebers and Bentleys.
Ref. 786/A.P./9/31.


ons.


Printed in Eingland,


Telephol


AU STIN


~Y

L--r*~-r~~*r~--nI--~~


T-~ 1
i!"

~r~ ~g r


BRITISHl MOTOR CAR Co., LTD.
IllI, H-1ARBOUR STREET, KINGSTO N,
JAMAIC A.
SERVICE STATION, 159, HARBOUR STREET. Cables: Linbert, Kingston,
ne No. 3111. TELEPHlONE NO. 3188. Codes: ABC 5th & 6th editic

















































































~';* 1' "iMUtH: M' ** *1*:H


*. MONTEGO BAY, JA., B. W. I. t
........,..,..., ., ............:..-W~~~W -- ~ : :..:.4,.g.:, 44.:..44444 .. 444444..g..:....:..:..,g.,g. ..:...: ..


PUNCH


6i7


-1831-3'2


P LA .NT E' R S'


.11111111111111111I111111111111111111111111111111111111111111111111111111111111Hlihll11111111111111111111111111111111111111111111111

MONA GREAT HOUSE HOTEL


Ic ~ THE OPEN DINING ROOM
This Hotel is situated 5-) miles out
of Kingston on the Hope Road, I .,~_;~~ .~*'S is immensely appreciated by visi-
and within **..'al~ingi distance of _-.tors, the large treesaround it pro--
Hope Gardens- testing it from the glare of the sun

The Scenery( and Climate are unsurpassed SIMIGOL
~'-a~~lrc~zesP*~bn I Hot and Cold Running Water.
Most Delightful Walks in its own Grounds

The Cuisine and General Appointments! l)j7,;'_-"SfZJillRlq l( Intel ot~rac~termtsall~ran 8aiS -teamers
WIRE OR WRITE MANAGER~--
are thoroughly first-class and will
appeal to the most fastidious tastes. M. B. AUSTIN,
There are also small Bungalows. Lignanea, St. Andrew,
each with its own bath.
Jamaica.

IcE CREAMY REFRIGERATING PLANT INSTALLED.
11111111111111111ll1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111?


"H-is wife looked pretty like she always do?"
"Oh, yes."
"You never go to Mapleton since she married
him, but you usettto go .before. And she was here-
the day when I first came here, when you give the
big lunch: you remember?"
"Quite clearly."
"Why you never go to Mapleton now?"
"Would you like me to go?"
"No! But I wonder. I hear people about here
say you did love her, but your uncle cut you out.
True?"
"People about here should mind their own busi-
Sness and be careful how they talk! Whom did you
hear say that?"
"Never mind. You want to sack them? But
that show that they are right. I thought at first the
dark-hair young lady wanted you; in fact she did
want you. I saw how she held your arm, how she
look into your eyes, how she take possession of

ot er oe, yur I cl's tife it ws sere mou anted
no? He took her from you. Then I got you. You

"No, Marie; but I wish you would' stop talking
nonsense. I didn't drive some sixty miles to-night
to listen to this sort of thing. Did we arrange i
should come over frotm Kingston for: a conversation
.of~this sort?"
"'No. But I was thinking to-night how you
never go to Mapleton, and' I think I find out the
reason. And you know why I wanted you to come
back quick. I thought it was a good chance for you
an' me to be together for a long time, with nobody
to bother about: that's why I arrange it. And now

She nestled up to him, kissing him passionately
on the lips. It would have been easy for an observer
to see that she loved him with a fire and aband'on-
ment that he himself did not reciprocate.
(Conztinu~ed on. Page 70)


bananas, miles of dense greenery and pouring rain.
The rain was a deluge, but, he knew his course.
At length he sensed rather than saw the big bulk
of Morley Great House, and drove into the yard at
the rear of the building.
The doors of the garage were standing open, but
there was no boy to meet him. He seemed to ex-
pect none. He piloted the car inside the garage him
self, turned off the lights, shut the doors, then rush-
ed up the backsteps of the house. The door opened
at his touch; inside a solitary light gleamed. Stand-
ing well within the room was a human figure. He
closed the door, and the figure came fully into vriew.
"I promised I would be back early in the morn-
ing, Marie, And here am I," he said:, "it was quick
work."
"You got wet!" she exclaimed; "come into your
room and change; you are hungry?" -
"No; and only my suit is wet, but I~wlill change.
You haven't slept?"
Com was waiting for you; I didn't want to slkeep

anShe ledttheewayh eohis rum iturnedhon one lig t
dress suit he had travelled all the way in, and put
on a dressing-gown. She herself wore a loose robe
of dark material, and not a single piece of jewellery
now adorned her neck and arms. Outside, unless she
stood in an open space where there was light,. she
would not be observed. In the shadows she could
move about without fear from prying eyes.
"You not hungry?"
"No; except to see you."
She smiled at that; and when he sat down in a
great leathersn.armchair she placed herself on his

e int his lee a mldr, then icinesd her ead ad
kissed him.
"You enjoy the party?" .
"Hardlly. I had to go; I couldn't refuse after my
uncle pressed me; but I was glad to get away."


1Ve are also:-

General Hardware M~erchants,

PTOduce D~ealers,

Commission Agents~.

Agents for Fire, Life, Motor Carr and

1frn In80TSUraHOUS.


& SON


The CupJ and The Lip
(Continued from Pe~rlr: '.i,
"You mean that you prefer to be alone in your
country home than to be with us, Arthur," she said
wistfully, for it was only too apparent that since her
marriage he had been avoiding her.
He looked at her fixedly. His look said: "How
cclld it be otherwise?" but his lips said, "A4 country
busha has a lot to do about this season of the year,
Gladys." So he took his leave, her eyes dwelling
upon him as he went off to get his car. She wonder
ed if he still felt her marriage deeply, and then, while
hurrying to join her other guests, she wondered whe-
ther, after all, she was as happy as she tried to perx
suade herself that she was.
The roads were clear and' he drove rapidly. Up
to Constant Spring where a background of lofty
honttn Iswung frorm eat t west and so ou,n a

ont.heA trnnsto te dlet mn n wantinu on tw hn
ever rising road. And now to his right deep preci-
pices began to yawn and the path twisted like a

writ peks,s cu tinte d nr fotad, a vsioen rofbe 1
for those with eyes to see.
But he gave it not a glance. He was accus-
tomed to the view, andi his mind was preoccupied.
He reached Stony Hill, a village now asleep, and
from here he began the descent that would take him
to the plains again, the plains on the northern side
of the island. But the descent was gradual, the pre-
cupices continued, the road wound and wound' about,
never straight for a quarter of a mile; and now there
was a rushing, foaming river to his right, a river
that ran southwards in a canyon formed long ages
ag by some tre endous earthquake that had riven

Now and then he must slacken his pace as the
warning toot of an approaching car was heard. First
the far-flung lights of this car would be seen illum-
inating the road, then the car itself would dash by
him, the driver skillfully avoiding contact in spite
of the narrowness of the way. Sometimes he must
slacken his speed to pass without an accident some
motor truck piled high with goods, and, on top of
these, peasants and small townsfolk returning
from Kingston to the country. Sometimes a cart,
drawn by sturdy, plodding mules, trekked onward and
must be negotiated with care. He ran risks at his rate
of speed, but he was an admirable driver, and he knew
that the Negro drivers of trucks and motor cars
were highly skilled also and could swerve out of
danger when a collision seemed imminent. He was
in a hurry to-night, and they were always in a
hurry. But his and their nerves would! be equal to
the occasion.
It grew warmer; he was nearly at sea level now.
To his left a wide river flowed, dark-gleaming, to the
northern sea, a waste of white sand on either side
of it. On an eminence beyond was Ml~apleton, but it
was all in darkness now; farther on was the sea, and
the tang of it came to his nostrils. Presently the
sound of its pounding on the shore assailed his eair,
in spite of the noise of his car, as he came within
full sight of it and drove almost along its edge. The
moonlight threw into silver relief the spreading ex-
panse of moving water, with its far horizon, and the
hills to the left were touched to a shimmering bright-
ness by the rays of the moon.
He seemed alone on the road to Portland to-
night. His powerful roadster was doing fifty miles
an hour. Suddenly the light dimmed, the moon was
obscured, clouds began to creep across the canopy
of heaven; they thickened and a drizzle began to fall.
He did not slacken speed, even when the rain came
down in a torrent and all the wiay was dark.
And now he turned inward, away from the sea.
and was driving throu gh thic k forests ofcu 1tivated


RBNGEFINDER RAPIER


Steel% Shafted


gecry a onretn



Sille Stock of all



Sporting goods.



SAIMUEL HART


(1928) L;TD..




















__ ~


PLANTER S' PUNCH


1931-32


SRUSH the cobwebs from your mind.
Erase the cares of home, workshop, of-
fice. .. Drift d~own the stream of someone
else's life. .. Relax!

Very near to you is your favourite moving
picture theatre, where a ticket changes the
scene. You step into adventure .. romance
.. o ar-away lands perhaps .. with un-
known people .. to glorious peace and
relaxation!

Anrd when you come out once more into
HXere and N\ow your horizon is widened. ...
your vision broadened .. and your own
life seems different: brighter somehow. .. .
Relax!


PALACE MOVIES


- AIETY




PLANTER S' PUNCH


1931-32


E VERY night they shine for you ... .
your favourite motion picture stars at
your favourite motion picture theatre .. .
From the stage of the world's capitals .. .
from Hollywood, Elstree .. from the ends
of the eart they come .. .Playiig in the
kind of stories yon refer, under expert direc-
tion and in the most lavish productions.


~~O~a "


At least SIX big new Pictures every week
to entertain you like a prince ... at the

PALACE
MO VI ES
GAIETY
and thanks your Stars for it !


THANK


YOUR STARS


for nights of rare delight!





"He cooled down, for he knew you had
gone to Kingston and there was nobody here, and he
believe you wouldn't come back till tomorrow. But
it wasn't about you he was thinking. He respect
and he is afraid of you. He says you are a great
man, a big buckrra, and he know you saved his life
when the bull charge him. I believe he thought Das
wanted to insult him about nothing at all--nobody
about here like that damn coolieman--and that Das
brought me into it sideways; and Ramsingh don't
like any man to refer to me. ]He seem to think
I am a sort of slave."
"I will wait to hear what Robinson has to say.
Naturally, I can't take any notice' of what has hap-
inned until eit istreported tuo me ufor Idam no esup-

;Marie. It maLy hlave put ideas into Ramsingh's head.'
"I don't like it either." she said thoughtfully.
She fell silent for a minute, then resumed, with a
note of defiance in her voice:
"But what about it if Ramsingh think any
thing?"
"What about it? Don't you see that he will
make a scandal?"
"You care? Why? You are master here; youl
canl sack him. Even if he divorce me, which is the
worse he canl do, what I care? I wish he would! I
am sick of living in the same house with him! If
am sick of seeing him every day! I don't like him;
I hate him! The sooner we separate the better! I
feel sometimes like telling him everything--every-
thing!"
She had wrested herself free of his arms as she
spoke, and was gesticulating vehemently. Her
face was aflame with feeling. Arthur realized that
it might be but a matter of time when she would
break openly with the dour East Indian to whomi
she had been married when hardly more than a
child. He shuddered inwardly.
"I am afraid I do care, Marie," he insisted. "You
see, if you were a single girl it wouldn't matter how
we stood to one another. But you are married, and
I don't like a scandal. It wouldn't be pleasant."
Her lip curled.
"Would you be the only one? Don't a lot of
such things happen, an' nobody take the slightest
notice? What could you lose?"
Hardly anything, indeed nothing he admitted
to himself. But his thoughts flew to Gladys. What
if she should hear of this intrigue and its sordid
sequel, if there should be such a sequel? She would
condemn and despise him; and he knew that he want-
ed' her to think well of him in spite of all that had
happened.
"I want to be divorced," said Marie doggedly,
settling herself once more against him.
"And I want to avoid that," he replied quietly,
"and I expect you to help me. You understand that,
Marie did not immediately answer. He put the
question again, and then she said "yes," with a faint
intonation at resentment.
Pr""",ary "woho youe afri ig he ake ouse
my uncle would be annoyed if it was said that I had
taken away the wife of one of my assistants?"
"Humph. You been afraid from the start. I
(Continuled on Page 72)





NOmh er n OnmaicO CaH JOH

Obitain fner quality Building






TE





188, HR DOUR~~rrr STREET

Kingston.






Quality at low cost with

service that pleases.


___


PLANTER S' PUNCH


1931-32


the night to Mapletcn, Tom. Das laughed, and some
coolie women laughed too, and Das asked if he was
going to take me along with him or leave me alone
in the Great House. Das didn't know that you had
gone to Kingston, but of course what he said could
ssonn quite innocent. It was his laugh, and the
way the coolie women laugh when he did, that madr
what he said sound funny. Ramsingh :elt so, and
he turned and ask Das what the hell he mean. Ant1i
Das only laugh again."
"Hurry up; tell me what happened," insisted
Arthur impatiently.
"Ramsingh pick up a stick and made for Das.
He a g ind ttoodit im otutmi waswnear aad ca

saying, for he couldn't mean anything. An' as Ram-
singh know that he and me are in charge here, and
that you had gone all the way to Kingston for the
night, he wasn't vexed with me. But he wanted to
fight Das, and he shake me off, and there would
have been trouble if young Mr. Robinson hadn't come
up and stopped it. Mr. Robinson heard the whole
story, and he said he was going to report it to you'
for Das is a qluarrelsome manl and always provoking
other people on the plantation. Perhaps he will tell
you about it later."
"And what did~ Ramsingh do?"


The Cup and The Lip
(Continuted from Page 67)
He put his arms about her and they lay in the
chair hugged close. Then she eased her position a
little, and said:
"I want to tell you something."
"Yes? Out with it." .
"Ramsingh made a row before he go to Mapleton
after you went to Kingston."
"My God! Not about .. not with you?"
"Not directly; an' I don't mind.',
"But I instructed him to go to Mapleton to see
Sampson about the treatment of Panama Disease on
Farm Number Five, and he was eager to go. Samp-
son hardly comes here now, so it could not have
baeen- "
"I told you to send him somewhere for to-night,"
she interrupted, with the air of a woman who man-
ages an intrigue to perfection, and is proud of it.
"And he wanted to go to Mapleton. And' it look well
he .should go while you were not here, though it
might have looked bad if you had stayed here. He
didn't suspect nothing; but after you went away and
he said in the Coolie Village that he was going for


*From the very first day that ISSA'S
was opened to the shopping pub-
lic of Jamaica .. ISSA'S was the L;EAD-
ING dry goods retail shop in the island.

It just had to be so!

Backed by ISSA'S mighty resourceS ..
37 years of unmatched experience in the
wholesale business, and the determina-
tion to provide the value-thirsty people
of the island with merchandise of the
highest quality at the lowest prices pos-
sible, it would have been impossible for
this not to have been the case.

And starting from the top ISSA'S has
been climbing still further upwards ever
smece.

Everyday ISSA'S brings you new mer-
chandise.. .. new styles .. new shopping
comforts .. at new low prices!

Everyday more and more!










:ISS





PLANTERS'


PUNCH


lish. This he still does. He has travelled all over
France. Oswald too has done some travelling in his
time, having been in America, France and England.
Oswald was made a Director of Wray and Nephew in
1930. ,Charles is now-he was twenty-one in October
1931-a Dirt'ctor of LascellBs, deMercado & Company,
Ltd. As is well known, his father, trained as a
lawyer, entered commercial life after having prai:-
fised law, aild made a success of his new career. Hi.-
two uncles, the? late Charles E. deMercado and Mr.
Lionel deMercado, have been amongst the most promi-
inentt of our Jamaica businessmen. Therefore
Charles, like Oswald, inherits business ability and
a strong foundation of those qualities which make
for considerable practical achievement.
Both these young men have work to do which
calls for initiative and compels them to exercise
judgment. Naturally, at their age, they like and
enjoy the pleasures of life; but this writer remembers
meeting Charles D'Costa in Montego Bay some
months ago, when he was with some friends. He had
gone down chiefly on pleasure, but there was one
particular piece of business which he had undertaken
to perform. He had to see a Chinese merchant
about something, and it was not easy to find the
man. "But I have to find him before I do anything
else," said Charles, and directly went off on his mis-
sion. That incident was an indication of character
which pleased us immensely.
Of 'Oswald, too, it may be said that such men as
Messrs. Cecil and Percy Lindo would not have put
him in the position he occupies had they not per-
ceived that there was good stuff in him. One does
not make a young fellow a director if one feels that
he cannot be relied upon, and the Hon. Percy Lindlo,
who is directly in charge of the Jamaica business
of the Lindo Brothers' undertakings, and whoe is
himself an extraordinarily hard worker, would have
no itse for drones. That sort is not encouraged by
the Lindo Brothers.
Once Oswald Lindo was asked to describe his
accomplishments. He wrote "Personal friend o~f Her-
h~ert George d'eLisser. An authority on Jamaica
Proverbs. Reader of Random Jottings. Loving dis
position. Rather dumb but happy." We think we can
say with certainty that H. G. deLisser will never for-
get that claim, and may add that Oswald' is no more
"dumb" than is H. G. D. He is indeed a very mlodest
youth, far-seeing, with a quietly humorous Dower of
appraising those he meets. The man who does not
like Oswald Lindo must have something wrong with
his mental and moral equipment,
In reply to a question about himself, Charles re-
pi;:ed that his virtues were "a knowledge of French
tind a good knowledge of English literature, thanks
to Cyril CourncileyT." It was very nice ind'eed of
him to pay this tribute to his late tutor. He added,
"'I have been working with Lascelles for eighteen
months, I have travelled considerably; the rest you
know." And the rest that we know is cheering, for
it convinces us of this young man's successful future,
especially in the life of the Jamaica of to-morrow.
The world is to the
young. It is they (whom
go -2 s ener the older ones are very
I-JM'" prone to criticise, and
sometimes even to despair
of) who must carry on the
work which their fathers
and forefathers have had
to lay down, and it is they
who must do that work bet-
ter than it was done be-
fore. Better. However
that word may gall the
older generation, it is the
one which must be uttered
and emphasized. For all
perfection does not reside
in men of over forty.
The world is to the
young. The future is theirs-
Therefore we never in
dulge in idrle lamenta-
tions about them, knowing
that their faults are hu-
man, their failings, no
worse than those of their
forbears, their spirit per-
haps superior, more finely
touched to a recognition of
fundamental social obliga-
tions, their intelligence
more informed with the
flame of new ideas. The
Jamaica of a quarter of a
century hence will not he
inferior to the Jamaica of
to-day; the probabilities
are that it will be superior.
And that improvement and
betterment will largely be
due to the efforts of our
younger men, such as
:O., LTD. fl ose written of here.


M ANY years ago Mr. Lionel deMercado remarked '
to the present writer: "Where are the young
men who are to take the places of the older ones
in the future?" Our answer was: "They are growing
up; they are all around us though we may not see
them; the little fellows of whom we take no particu-
lar cognisance to day will be ready to step into our
places to morrow. The question you now put must
have been asked again and again in the past, and
the future has always answered it."
We are reminded of this now when writing a
few words in the way of character sketch and appre-
ciation of two of the younger of our Jamaica men at
the beginning of their business career, one of whom
happens to be a nephew of Mr. Lionel del~ercado.
These two are both very young, Oswald Lindo be-
in~g but twenty-four years of age and Charles D'Costa
only twenty-one. They are what men of fifty and
over would generally describe as boys. That is a
way that men of fifty have, although they themselves
seriously object to being described as old men. Nor
are they old men; but neither is the young fellow
who has attained his majority merely a boy; he has
entered manhood, he is by age qualified to vote for
anly unworthy candidate in a Municipal or Legisla-
tive Council election, he may sit on a jury, get mar-
ried, contract debts, and be held fully responsible for
their payment. But what is a real test of one's man-
hood's estate is whether one can be trusted with the
exercise of any responsibility. The answer to that in
the case of 'Oswald Lindo and Charles D'Costa is
that already they both occupy positions of considera-
ble responsibility, and that they fill those positiolns
to the satisfaction of their chiefs.
We know these young men very well, and like
th~em. If asked what is among their chief qualifica-
tions, we should say without a moment's hesitation
that they are gentlemen. Now to the obtuse it might
seem that the quality or condition of being a gentle-
manl has little to do with capacity for exercising
responsibility and becoming a success in business
life; and it has to be admitted that many a successful
businessman is decidedly not a gentleman. On the
cther hand a good education, refinement of manner,
consideration for others, and a high standard of ree-
titude are qualities which must greatly assist any
man to make his way in the world and to make it
in such a fashion that he wins the regard and res-
pect of those with whom he comes into contact. To
possess these qualifications is to be a gentleman.
We do not think that any one who knows Charlie
D'Costa and Oswald Lindo will deny for a moment
that these young fellows possess these qualities.
Oswald Lindo is the son of Mr. Robert Lindo,
the Manager of Wray and Nephew of Jamaica, and
the nephew of Mr. Cecil Lindo and' the Hon. Percy
Lindo, who have been so largely identified with Ja-
maica agriculture and with Jamaica business. The
Lindos have energy, ability, pertinacity, application.
Oswald has inherited these characteristics. He went
in to Wray and Nephew's in 1925, when he was seven-
teen years of age, after having been seven years at
Jamaica College, where he
received a good education.
Describing his school
career he has laconically
stated, "Did not like it."
He has also assured' us
that he has "no peculiari-
ties except a love for
steak." But he liked school
sufficiently to pursue his
studies with respectable
diligence, and he is able
to put a proper check up-
on any impulse to gor-
mandise in steaks. He has
also been devoted to man-
ly sports. He was CaP-
tain of the Jamaica Col-
lege tennis team and was 5
in the football and cricket
eleven of his College. But
though he loves these
sports he realized early
that life is not merely one
long game. Consequently,
on going into business, he
set himself to master, in
a thorough spirit, the rules
and details of what was to
be his life's occupation.
Charles was educated
first at a Preparatory
School at 'Westgate-on-the-
Sea; then he went to the
great English Pub 1ic
School, Marlborough, where
unfortunately he met with
an accident at rugger
which necessitated his hav-
ing to leave for some six
months. But that semester
was not wasted. Charles
was fortunate enough to ME~. CHAR


ans. UYwaLU LUng
of Hessrs. J. wray & Nephew, Ltd.


come under the tulelage of Mr. Cyril Connol-
ley, a very plain but extremely clever young
man who has already made for himself a name
as a writer and critic in England. Cyril Connolley
is a brilliantly educated man and he took a real
liking to Charles. Therefore he did his best with
the lad, who responded to his efforts. On leaving
Mr. Connolley's educational care young D'Costa went
back td Marlborough, then from Marlborough he
went on to Lausanne, Switzerland, and began to
study commercial subjects.
When he went back to London he studied char-
tered accountancy for some time with the English
firm of Deloitte, Plenders and Grifiths.
His application was marked. The question w~as
whether he should embark on a writer's career or
enter business. His uncle, Sir Eliot dePass, advised
business, and Charles wisely decided to enter busi-
ness. Wisely, because that is a most interesting call-
ing, and also because any one with a strong impulse
to write will make the opportunity in later life to ful-
fil that impulse, and will be all the better for having
already obtained some practical experience of the
work-a-day world. Thanks to his own inclinations,
and to Cyril Connolley's guidance, Charles read
well and widely, and his residence in Switzerland
enabled him to speak French as well as he spoke Eng-


LLES D'OOSTA, OF MESSRS. LASCELLPES dleMERCADO & C


1931-32


BU~TSIN~ESSMEN, JUNIOR ~

































































I


I I


PLANTER S' PUNCH


1931-32


tral India's jungles. She held out her hands to him,
caught his, and pulled him up out of the chair.
She walked to the table and extinguished the
light.

CHAPTER ELEVEN

HE rain had ceased, bu t still was dark at half*
past four in the morning. The moon had
disappeared below the western horizon. In the pas-
tures the: cowmen were already stirring, but the
pastures were far away. Round about Morley Great
House only two persons were awake; one of these
slipped furtively out of the house, wrapped in a dark
cloak, and made her way hurriedly but with caution
to a little cottage at not much distance off; keeping
within the shadows she could only be seen by some-
one who might come? within a couple of yards of her,
and even~ then she might not be recognized.
On his part, Arthur went down the backsteps
of the house, and carefully, and as quietly as might
be, backed the car out of the garage. He was dressed
in his ordinary working clothes. He then went to-
wards the servants' quarters, situated at the other
side of the building, and rapped loudly at the door
where slept the boy who looked after the car. His
rap awakened one or two other servants also, and
these heard his voice summoning George. George
was out of the room in a jiffy, and hurried off to
wash down the car; quickly after him came a couple
of other domestics. George muttered an excuse
about not expecting the Squire much before lunch-
time; the other servants busied themselves abolt
preparing breakfast for the master. One of these,
a woman, went into Arthur's room and found the
great four-poster mahogany bed as she had left it,
with no appearance of having been occupied. Marie
had thoughtfully seen to it that it should be so.
Arthur drank two cups ~of coffee and ate some
food, then said that he would have a little sleep
before going about the day's work. He sent a mes-
sage to young Robinson, telling him to come up to
the house for a talk and intimating that he should
come at the luncheon hour. Now and then Robin-
son, being by birth and upbringing a gentleman, was
made a guest at the Great House, a distinction not
enjoyed by bookkeepers and subordinate assistants
as a rule, and therefore highly appreciated,
Arthur judged that no one in Mlorley could have
the slightest suspicion that he had returned earlier
than five o'clock and had been in the house for nearly
three hours. Yet, as he lay down to snatch a little
rest, he was plagued with a sensation of shame and
disgust which he often experienced' these days:


these subterfuges he was forced to employ were
supremely distasteful, he could feel only loathing in
adopting underhand methods to deceive an East In-
dian employee and his own house servants.
whe Haed whe ver careful eve sin e tti da

nor ad dtmor evheiru tebewer together (she ha
in a whisper how much she loved him. She was very
close to him; they were alone; they could easily hear
if any one entered the house.
He should, he told himself, not pursue the con-
versation further; her words were as emphatic as
words could be and not to be misunderstood. But he
was lonely and depressed and still filled with his
purpose of leaving the country; and she was beau-
tiful to look upon, and dangerously alluring, and the
woman he cared for was beyond his reach forever.
He craved for sympathy and affection such as only
a woman could give, and this one was offering all
this and more to him; her eyes were fixed on his
with a strong, compelling appeal; he yielded' to that
appeal when he asked:
"What do you waLnt, Marie?"
"Love. YoZG. Don't you see that. Don't youl
know it?"
And now she was so near that their bodies
touched, and with a quick movement his arms went
round her and she was pressed against him. Their
lips met; a few seconds after she was standing yards
away, speaking in a calm matter-of-fact voice about
breakfast, for a servant had come into the dining
room. But just after breakfast, when she had found
an excuse for sending the maid outside, she had bent
down towards him. as he sat at the table and kissed
him again and again. And thereafter they had
become lovers, her fertile, ingenious mind forming
plans for their meeting alone by day and at night.
Unknown to himself, she weaned him from his
projected cutting loose from Jamaica. While his
uncle was away he still believed that he would carry
out his plan, but he never mentioned it to her.
And when Mr. Pemberton returned, and Arthur spoke
to him about what he imagined was still a strong
desire on his part, his uncle's casual disagreement
(for Mr. Pemberton did not take him seriously) was
sufficient to make him abandon altogether the idea
of Canada; it was just some such discouragement
that he had been unconsciously hoping for. Mar~ie
gave him something that he wanted, a w~oman-
interest, and she was informed with a passion which
sometimes startled him. She worshipped him, and
she showed it whenever she dared, whenever it was
safe to do so. She would openly have severed


R .


Ir








I


ondon I


E. R. SQUIBB & SONYS N~ew Y
SQUIIBB'S DENTAiL CREAM
PHARMACEUTICAL & HOUSEHOLD PRO-


DUCTS
ALEXANDER SHANKS & SON Ltd.
"BRITISHIER" LAWN MOVERS

PLAISTOWE & Co, Ltd.
JAM~S & CONFECTIONERY

GENERAL HILK Co., Inc.
FAVORITETA" & "GL;ORIA" MILK

A. J. CALEY & SON Ltd.
CHOCOLATES &: XMAS NOVELTIES


London


!ork


W. P. ]LOWRIE & Co., Ltd.
"LLOWRIE" WHISKY


G~lasg~ow /


EWART & SONY Ltd. Le
OIL, & GAS GEYSERS

SAUNDERS & CONNER (Barrhead) Ltd.
BATHS &: SANITARY FIXTURES


THE I10>> SIDE BREWERY Ltd. MTanchester
*ToPwER. BRAND" LiAGER BEER


'I



*I


II


London



Rheims



Epernay


Bristol



Belfast



Edinburgh


PYRENE MANUFPACTURING: Co. Newrk
"PYRENE" FIRE EXTINGUISHERS


RALEIGH CYCLE Co. Ltd. Nottingha~m
CYCLES & MOTOR CYCLES


NATIONAL CARBON Co, Inc. New York
"EVEREADY" BATTERIES & FLASHLIGHTS


L~ondon( BOORD & SON L~td.
IIOORD'S DBnY GIN


New York


Norwich


PIPER-HEIDSEICK
CHTAMPAGNE


PERRIER-JOUET
CHAMIPAGNE


JOHN HARVEY & SONS Ltd.
PORTS, SH1ERRIES &: WINES


CANTR1ELL & COCHRANE Ltd.
MINERAL TVATERS


Wm. YOUNGER & Co.
"M~ONK BRAND"~ ALES & STOUT


THIERMnOS (1925) Ltd. London
THERMZOS FLASKS &~ LUNCHEON SETS

DOT1~I(rox OIL CLOTH & LINOLEUM Co., Ltd.

OIL CLOTH & LINOLEUMS MOirSI

CROWN WIL;LIAHIETTE PAPER Co.,
San Francisco
PAPER. OF ALL DESOBII'TIONS


WOOLMER & BROWNING: Ltd.
LADIES' & CHILDREN'S STRAWT HA4TS


]Luton


WILSON & STAFFORD Ltd.
LADIES' 8! MEN'S FIELT HATS


Atherstone


ALEXANDER KING: BROWN & Co., Manchester
COTTON PIECE GOODS


T Ca ad '7 Li
(Contintued from, Page 70)
saw that youuliled me erom soon a tre cme h re

me an' Ramsingh, about Sampson, at Mapleton. I
didn't care a fig about Sampson--I wouldn't even look
at a brown man like him. But I wouldn't let Ram-
singh boss me as he like. Then I saw you an' heard
how you talk to Ramsingh, and I fall in love with
you; and when I came here I make up my mind to,
make you love me; an' you love me now, don't you?
"Of course, Marie, you know I do.
"But you love somebody else too, and better; I
can see that every now and then. I guess who, too.
I guessed it to-night. But it don't matter, for I have
'Sou. Only if she was to try an' take you away
from me--"
"Will you stop talking nonsense!"
"I would kill her."
She pressed closer to him. She kissed him again
and again to prevent his making any comment on
this threat of hers. Then she resumed.
"At first it was me who had to make love to you.
That wasn't right."
"Well, I did like you very much, you know."
"But if I didn't waylay you, so to speak, and
talk to you often, and then kiss you one day, you
might be going on foolish still."
"I was afraid, you see; I tell you so frankly.
You are married."
"But now?"
"Well, in for a penny, in for a pound. Don't let
us dwell any longer on dangers and risks, we'll meet
them as they come. You are sure nobody knows you
are here to-night?"
"How could they? An' I'll leave before day-
break; and Ramsingh won't be here before twelve
o'clock. So everything is all right. What you going
to do about Das?"
"If Robinson reports him and Ramsingh com-
plains about him, I will send him away. He is only a
hired man."
"I will tell Ramsingh to complain," she said vin-
dictively, and again her arms stole round him.
"You going to stay all night in this chair?" she
asked after a few minutes, and he laughed.
She rose and stood before him, a beautiful, lithe
sinuous figure in bronze, with passion blazing from
her eyes. Her finely-cut face looked down upon him
intense: the thought flashed through his mind that
she had a kinship with the tigresses of her ances-


LES~


;LIE


MORaD ECeA I


58-160 HARBOUR STREET, KINGSTON


COMMISSION MERCHANT


& MANUFACTURERS' A GENT


SOLE D IST RI BUT~OR


&r AGENT


FOR


III--~ I I

































I


I I I I


AGRICULTURAL



I MP LE M ENT S











"CATANOOGA"


D. HENDER 8 0N B C 0., LT D.


1


PLANTER S' PUNCH


sion and had given a hint of it, however obliquely.
His view was certain to spread among East Indians
and natives alike.
What was to be done about Das? That would
depend upon Ramsingh and upon what actually had
happened the day before. Robinson would stress the
incident if he thought it in any way serious. If he
did not, no notice could be taken of it.
Robinson came in to lunch, and after he had eaten
heartily and the maid had been sent out of the room
--Marie had only come in at the beginning of the
meal to see that everything was right--Arthur asked
him casually how work had gone on the day before,
"Quite well, sir," replied Robinson; "everything
in order."
"Nothing happened to the cattle?"
"No, sir; the Mysore bull tried to break down
the walls of his pasture but didn't succeed; he always
tries to do that, now that he can't jump them."
"That gentleman doesn't learn from experience,"
laughed Arthur; "he is like most human beings. The
labourers all right?"
"Quite, but there nearly was a row at the coolie
village."
"Ah; nothing important, I suppose?,,
"No; I put a stop to it" (Robinsonl said this
with pardonable pride); "but there might have been


a nasty fight if I hadn't been there. Ramsingh has a
violent temper, and Das is very provocative."
"Tell me about it."
Robinson told the story. Arthur made no com-
ment; but suggested that they might go on to the
coolie village now; Ramsingh must be back and he
would have to take the diseased banana field imme-
diately in hand. He had told Ramsingh to wait for
him at the village.
They rode towards the coolie village. Most of the
men would now be in the fields, of course, busy cut-
ting fruit that was to be carted to the railway sta-
tion on the following day for shipment. They passed
some of these on their way, dark figures deftly
wielding the long knives, or, rather, short heavy
broadswords, which are known as machetes or cut-
lasses, and which at one blow cau sever huge bunch
of bananas from the parent trunk, or shear an arm
from a human body. But for this latter purpose the
machete is rarely utilised in a land with an incul-
cated fear of the law; and though strangers to
the country sometimes shuddered when they saw
these long, dangerous, deadly-looking weapons in the
hands of peasants on the roads or in the fields,
Arthur always laughed at them for their groundless
fears if they happened to visit Morley.
Natives and East Indians alike were cutting
(Continuedl on, Page 75)


all e.nonectio: n writhi R-smsj U~ing Ual Xlrrtalsr nt nl-
Sjisted ulpon mere~lt.1. but able nece+,i? y forl scrlely
galled and shamerd hlim f'ar molre than~ any\ sense of
wr.:.ng-doing inl his relationu withh the young East
Indian womvnan, there was somnethinig mean abirut it
whirb hi dlislikerd anid resenited,. and1 at the hasl k of
his niindl wa5 fear.
He tlreadIed disoery.l Rmsniinlgh m~uld make a L
mserlle If' he Iis ew. the liaison ws..ubl bees..mee the talk
of the pluratoln.. perhaps .. Vthe i nleigbhbouring plaI-
tatio~nc. Thecre might even bet a uit folr divu~rse,
thoupb that wa Inot very) likely. forr Rumminghi. wrhen
his .singer had somewr\ hatr crnled, coJuld problab~ly 13
bo:ugl iht off- a ri~e po:sjses ed himt. Bu lr.P rle-
tenll might be~ar of rbis episode,. through actually that
michi nolt ma~ttr mui h. whlirat wuldl mll:rI was
iif U~ld.v. eli~ld bear oft it. W\hat would she think
That was always' the qluesionI inl lis ruind. As
IIlF we~~ ks wnt by! hre had girown to. le~..ukng foirward
I.. rseeing Ma~ril ahl...ut the to.luse onI1 olthlel r occaii n s
bpel-ore nl1icaliae, : he miissed her when he wsn~nr
there. Becsause he had imlposled upon hter clhe
need folr .auriicln. he had thoughtrl out ant i pt into
prilracie little plans fear prevent~ingp juspideio. I..me-
time hIe wo~uldl ak hier hlusbanndJ tc gor ul to tbHe
tirnn ofr her own'I prIvaBte doimeStic wolrk. She had
doni this on Iine oir two~ late af'teriinoons when she
knew tba Hr Ramingh had snnmethingn of` his ownl to,
do, II. 1IunnectI...n w~ith the n-gEetable garden he was
IIeatinF (Once ojr tw'iCe, when'L +Ih had a;ked hier
hlusbandl (c. put inl his ahare I...f w..srk at the G:retl
Holuie. he ha.d demnurredl. folr thle garden wai v'ery
near 1.-. III healrt and he dwlFlt with elee lio thle
mnicvnt he wcnuldjl mhak out of' its pro~duie. But :-he
ha~d Iins'ilil. a1llms to. the verre o-f a ri~w. anid had
carried hter sprint: and though ihe longedr o:n thcee
evecn;Inern- hI e w'Ith Arthur. andl eniviedl heri husbandl
a pr .xiniir y w~hliu meant nothling toi himi. she nevr\i-
tE' !Ir itrlrr n \t 1 ait ala r a sder b er trute ee
writh wrhiII lbe couldl blinid the naturall? ilupicious
-and suru R;I nainghi. Besides. ehe lovedl tol lis;tenl to
ArthelI'r lese 'hen she told him how~a she hadl mai-
8** Attl11'i~ar bad ome r tto c fe el eu ret c-~r ninil..st j:
b'ut III~.H UfI1Ienl.. IIre ,Feemel to en-e .an arm.
phele'13 h:fla~rWa[ ba T.=ml Da; mentcll by\ [btLl
the G~rear IIt..Ise hi lie h e wet off` re- a thll eirl part.[
ral flii* Iwfunfll. Nu..(hing Pe~rhaps~ but a general.3 re-


foirt. it Ii.e i d mea1 n~ n alIIL. 1Ine pcII, (I,,.
Arlnlll. Iheni It irs ic~lel thant 31lane andtl he lIa01




( C i rlj I i. **1 Wa-~ll Illi-r"*=nfl i- : 191*** n lysllill t 1111 Ill Sir
hre real.rn -1 ~! l O* halr.l it~ In nig l nti \ e l..C i ..I i .-



re~s~tire .. 3 : es..iee!. ng Cm~nt3 -I ,ul.iI








E ~Honest Plices!



~ hhoe~ 31 sr ,hblt Hrds\ ~e >u i

onilult with us folr HIIGH GR.-Lt'ID
a nd Il'HOLE.SO.11E

GROCERIES. PROVISIONS.
WINES. SPIRITS. ETC.


"Our Servi c1 atllll you Srrvice."'.





THE ARMY & NAVY STORES.:

1.36 Harbour Street. Kiingston. ..
sv


------
I O


gHNESNg O


LTD,


W~e Solicit Your Orders


CANh~E


MCIILLS


123 & 125 HARBOUR STREET,

KINGSTON.





_ ~_ _) I
I I


D OD B B ROTH ERS
;r I X AND~ El 1- [5HT



LEADING CONCERNS

IN ALL .INDUSTRIES, HAVE TESTED
TH ESE TRUCKSFiOR YOU i


PLAiiNTE S' PUNCH


1931-32


There are many ways ydu can definitely appraise the value of the New Dodge Six and New Dodge
Eight. You can see their beauty, feel their comfort, thrill to their smooth, vigorous perform-
ance, test the positive stirety of their weatherproof internal-hydraulic brakes, and sense the
quietness and strength of their iMono-Piece Steel Bodies. And beyond these things is the
knowledge that you can rely upon the dependability of any Dodge Brothers Mlotor Car.


JOHN


CROOK


DISTRIBUTOR DODGE CARS AND TRUCKS DESOTO CARS


96-100 HARBOUR STREET, KINGSTON.


DOD GE TRUCKS
D EP EN DA B LE EC ON OM I CAI ___A_L~ C P LE







































































_ I L-s


_ __


PL .-1 'T E'RS'


PCNCH


-4831-32


female would be frightened to be alone in a big, big
place. There was no harm saying dat?"
Arthur knew that Das was lying, for Mlarie was
never supposed. to stay at night in the Great House.
But how to contradict him? And, considering the way
he had stated his case, it would seem. stupid, as well
as manifestly unjust, to deal with him harshly, and
stupid and peculiar also to cross-question him
closely. Indeed, it had been made to appear as
though Ramsingh had been in the wrong. Ramsingh,
too, showed no desire to suggest that Marie's honour
or reputation had been seriously assailed by any im-
putation of wrong conduct; he simply objected'to
Das' mentioning his wife lightly. Here was one of
those cases into which no one cared to go deeply.
Things were hinted at Intrlier than said, and the
hints might mean nothing.
There was not a thing to dismiss Das for. Das
had assumed an air of perfect innocence. Indeed, he
lookertas hug ihalehad a, grievancknwwatt o
At that moment Marie appeared upon the scene.
She had not been able to resist the temptation
to be present. She was vain; she stood head and
shoulders, socially, above the coolie women of the
village. She loved to show off before them, even at
the risk of their bitter enmity, especially now that
she was no longer living amongst them. They want-
ed Das punished for his impudence. She wished to





Mi HEF FES & COMPANY,

S146 HARBOUR STREET,

I~i KINGSTON, JA.

r ~WHOLESALE

SDRY GOODS MERCHANTS





SWe carry a large and varied s~tock.

#62 NeffrivalS by every Steamer.

SRighat Guoods at Right Prices.


COURTEOUS SERVICE*

CORRESPONDENCE INVI'CTED.


. p I)O--<-sawns.


VISITTORS TO JAMLAICA

are cordially invited to cacll at


The 1081'181 BuFrilu

ROOMS 1& 2


The Jamalca Imperial

Association lhlildlill,

87 Barry Stree~t, Kingston.


Free Lite~rature anld Advice.


Correspondence should be addr~reshed:

The Secretary,

Tourist Trade Development
Board,

Kingston, Jamaica, B.W.I.


had never s~een <*r1 but Icarcel remlembllered. The

The~ Indlian llagI1Re liie had bee~n traudtelrred to
Jamaic~a. but w~ith chlanues and1 arRi~tation. There
w-ere Iblabommeul~sian andt Hinldu pr'iesta in sllmei of
the-e 4.entres. Liut the Chrival~n mniisiter wa; potent
;1lso.1 andr ini timel w'...nid be dominant. Yct LIurtom,
Inte:re tenatiocus than dea~trinle. heldl sway in thi svil.
laue~ rn M.=rlle? HIIre thc woman belonleed to her
man1I withl a >~.rtf ..II 9Lubmissianll thatl i~law never~ ~lthe
rann~c il an!y pure(\ naivl\e \illaee olr townu.
.Itaaniinshi oucbt ton hbite been hlere already."'
:~.lhur n,,b-seredI toj .voungi Hobiinseu; **nha~t iuld
Iia\-e keplt him?**




lin --Il ~gleenct eel- Arthu. and ley rod ... toi contlinue

Paini th~ey cae back.~ A1-lthrwsHrpiel11





**PF,,rn iit\' hat your tiei~r -ol< .1 Ilnd Hamaint l Huuld
me.l I Ithoup'l it1 I111 had'l~~l bete mIne ovrl to" e hs






have. I th ,ink. Ir., inl ... thel Glovernment Insp tor





"\'-ll \r.... Sarl ul pp.=n.-l Itlr I I1 l e \'~ l [L l*Ir (ag 4(
li~\.i` I. I I-'1 U* llj


HIDE .S,


L E ATH ME ~.


OTHER TANNING MATERIALS.


CABLES:
* LEGARSIA."


CODES:
BENTLEY'S.
A.B.C. 5th EDITION.


ENOUIRlIES SO ,LCITE D1_.


The Cup and The Lip

bananas fr..r ther -ship that wa~s toI sil nex\t dar from
Port Ault..iub Fir--t. IhI;enr dhn-.11. lireu*onder stent

chete: then,. as w~eighed daown~l by the heavy'! Iluni b af

and severelj It fromll thle zstemn wir a slingle blow~.
The IIII11i1h ':.ime Is'.lLc n lIj..=.l! ia on nu-- Condi 19le
at the fot'li of ther frle. unblruii e d, r.i be Fathere l
Later, withr certie~r-. jlllr.. bil a. n dl thati liated ait..
moto~r trunIk or< .a Irt 1.r ful~l-ilsortatl~Io Thle iur 1-


as tli.~ ra..ele aLllc.* i R.in n a he w ntb


17.l'ui hadI- b~!Ette 1ell h1 Ini io.n l..i~ R nll--th~t

le, if >..8 think eli t 1n ..1 lakIde tlny n tlicl ie of hP
hct~ctle unHseletrr

Ht9trl..b In ..n wa- nl.. Il.ath ll.. have Useni tred.e lu.

a~nd l il II1.- lnut li Dos ,. .i rn thelr i I..He IIL lage II

It ar -ri E. Aliblif l vI i l .~I I. nc :I.*r I[11.* E~~ l f ~ilre Othe!



Eastri!.ll In Ian 10..rae -1I rrl nlan: 1 .~i rai r a n-ul y at ~1

II. L ifu Ittl [ il l c. I III 1 i~ll: ,( 11 n lllillie be hrilJ th.
bm lill Is.julle~\r l 1111 InaInl He 1 1 II 3ml.d r,


hathi '. I11 1I t imi llt' il ft nl. .111r--1 n P l**

jhme t-- ln l [s? 1 .11- l l i.l II th ll s, Ii. li rh .I late'

rji\t. I...e11I IIr l~Rl. In-inch .~Ilj ..l 1 jt ea r ;1 1 ..lt
TheCii lif- of flii fI, r l i.lll'He.11 *ts I niCt~j 1. \IIII n=I I.*


tumbl ed I bli t I ~ In 11- o i cIII' flr! i~l~r '-n of tive I li ttlll *
rea l iiteirit*II;. I i m e~l -l in ;1le I1111\ n'in ..n Il enl It I-rr**d-


* *. RSp


43 Hanovler Street,


Kingston, Jamaica B. W: L






































































































MODERN HOME S

ALTV~AYS NEED NE;W IDEAS I
I SEE AT ONCE IF ANY OF YOUR

HOUS] EHOLD) N~EC<:ESSITIES~t~:

ARIE WVA N T ED

BY VISITING

l'TAYLORZ'S CROCKIERYY & FURNITURE STORE.

101-107 PRINCESS STREET,; KINGHTON, JA.
... .. .. .. ... .. .... ... .. .. .. ... .. .. .. ... .. .. .. ... .. .. .. ... .. .. .. ... .. .. .. .


PLANTERS' PUNCH


1931-32


Capital 1 2,400,Q000
SReserve ,600,000 ;L

Total Assets f 5,000,000


General MIanag~er's Office,

E' ~TORONTO, Ont. ~'l s~~~Cep, ~I


297 BRANCHES IN CANADAh ~ ~ ~ a d~~b"i~
S12 BRANCHES IN NEWFOUND-
LAND
BRANCHES ALSO IN THE 1_ N'11ITE
STATES


N'EW YORK, CHICAGO & BOSTONU c;aD~;$;p~s


LONDON, ENGL~ANDI, AT
108 ld roa StretE.C 2.THE BANK'S BUILDING IN KINGSTON, JAMAICA.


EKARANCHES IN WEST IND>IES:.

JAMA1ICA:-Kingston, Christiana, Black River, Mlandeville, Mlontego Bay, Morant Bay, Port Antonio, Port M~aria, St. Ann's
Bay, Savanna-la-Mlar, Spanish Town, MaI~y Pen and Brown's Town.

CUBA:--Hav~ana.(4 branches), Santiago de Cuba, Cienfuegos, Camaguey and Manzanillo.

PORTO RICO:--San Juan, Fajardo.

DOMI~NICANU REPUBLIC:--Santo Domingo.

Every descriptionL of banking business transacted. Dranfts, Letters of Credit and Truavellers' O:hequles, issued anzd negotiated. Collections
mzade at favorable rates.

(111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111ll l l l l llsl


show that, as the person chiefly in charge of the dom-
estic arrangements of Morley Grreat House, she was
one to be reckoned with. Prudence might have
warned her to leave this affair alone. But Marie was
prudent only under compulsion, and she perceived no
reason for any special caution here.
She went up and stood beside her husband, as
though seeking his protection against insults. She
glanced scornfully at Tom Das. "Sahib," she said to
Arthur, as though telling him something he did not
know before, "this inan, Tom Das, insult my husband
and me yesterday, an' you should give us satisfac-
tion."
Ramsingh drew himself up proudly. He argued
that if Marie had had any guilty intentions--he
could not see how she possibly could have had any- -
she would not be acting as she now was. She was not
trying to hush up anything; she was deliberately
seeking publicity.
"I have heard the story, Mrs. Ramsingh," said
Arthur, annoyed, "but I don't see anything in it to
get warm about. I don't think Das meant to be
rude, and--"
"Das is always rude, Sahib," boldly interrupted
Marie, knowing that no one else there, except Samp-
son, would have ventured to do so. "Das provoke
people by his impudence, an' then pretend he don't
mean nothing. He provoke me husband yesterday,
an' if Ramsingh had injured him you would ha' heard
it was Ramsingh's fault."
"Quite true," muttered an elderly coolie woman
who detested Tom Das.
"Das does seem to be provocative, from all that
I have heard," admitted Arthur, "but I can't see that
he said or did anything yesterday of a deliberately
mischievous character. What is your opinion, Mr.
Robison auses a lot of ti'ouble in this village, sir,"
spoke up young Robinson boldly. He had heard of
Das before.
"Sallib, Squire,"` Das began to whine, but Arthur
cut him short. The weight of opinion was certainly
agI t onmt Daacs you, Das," he said, '"for I doh't see
that you have done anything calling for such a pun-
ishment. But you are evidently not popular here:
you heard what Massa Robinson just said. I think
I had better remove you from` here; that will
help, you. And don't let me hear anything more
about you again. Robinson, put this man in the
cattle pastures."
Das glowered; he had a garden in the village,
that would be lost to him now. Ramsingh was
pleased ; there had been some punish reent mat ed out


after all, and it seemed as though 1Massa Robinson
was responsible for its infliction, an opinion which
Robinson also shared. Das thought otherwise; he
attributed it to Marie. So did a couple of the women
around. And so did Sampson.
Sampson was thinking as he rode off with
Arthur and Robinson. Why had Mr. Norris taken
such a personal interest in a matter which, normally,
would have been left to a subordinate? And what
had Marie to do with the Great House?
He ventured a question; he was a man of inde-
pendent disposition and he knew his worth as an
overseer.
"Why, Mr. Norris, did Das say anything about
Marie Ramsingh and the Great House? What have
they to do with one another?"
"She and her husbapd are looking after the
Great House for me, Sampson."
"But she doesn't live there?"
"No, in the cottage near by."
And yesterday and last night Ramsingh had been
in St. Mary, thought Sampson. Where had Mr.
Norris been all the night? Sampson did not venture
to ask such a question, of course; that would have
been impertinence and might have drawn an insult.
But it suddenly came to him that he did not like
this thing, and that Das had decidedly meant much
more than had been said.
"These coolies," he remarked, casually as it were,
"are a peculiar lot of people--from Gandhi down-
wards. And Marie Ramsingh looks like a devil.
And her husband is a mad fool. And Das is mis-
chievous."


"What on earth are you talking about now,
Sampson?" asked Arthur, laughing.
"If I were you, Mr. Norris, I would turn Das
and the Ramsinghs off Morley to-morrow."
"And do an unjust thing, and make a fool of
myself?"
"It might be wisdom," said Sampson, soberly.
"And I don't know that it would be unjust."

CHAPTER TWELVE

1T IS not wise to say "'never". The fates seem
Resolved to show how often futile are the
determinations of human beings; to demonstrate the
irony of final resolutions on the part of creatures
conditioned by circumstance. Mr. Pemberton had
declared, in an access of jealousy, that James
Cuthbert should never again cross the threshold of
his house; with that he had dismissed the matter
as- settled, for he prided himself upon such re(
solutions. He knew that he had' had to revoke his
decisions on many an occasion; but it did not occur
to him that such a revocation could ever possibly
apply to anything he might say about so compara-
tively insignificant a person as James Cuthbert.
Cuthbert was not quite so insignificant as Mr.
Pemberton chose to think; he was a partner in the
big firm of accountants with which he ~was connected,
He was an able and energetic young man, and he hap-
pened to have a liking for Mr. Pemberton based on a
few meetings with that gentleman. He liked Gladys
Pemberton also, had known her before she married,
regarded her as a sensible and companionable girl,





































a-----,.,------mU(I)(IO->->-----*--<-o.,-oo..owIa->r-a-U


FOr BOOts and Shoes



R~ .~ HAN NA & SON S,


BESTI QUALIT Y, LOWEST PRICES.




*.HNA OS


I


-


I


PLANTER S' PUNCH


1-931-32


tomorrow, it was clear enough that Gladys had known
nothing about his intentions.
"I hope he is competent," he went on, "for when
!...u hat~e banne n+ retarh~~ns with driengis you can't
treat them as you would strangers. However, he is
coming, and there wye asre. We must try and give
him a good time."
He spoke heartily. What is more, at' the moment
he meant every word he said. He felt he had' been
foolish about James Cuthbert, and had suffered in
dignity in consequence. He must try to show himself
in another and finer light.
"On the whole I am very glad it is he who ij
coming," he continued. "I can talk to him more
freely than I could. to a stranger. And it will be
nice to have a visitor in the house--one. of our own
sort.(ia.1 n enizi1y pleased; this was a wel-

come change in Alfred's attitude. But she was too
sensible to show how she felt. She took his remark
calmly and as a matter of course. She did not men-
tion James Cuthbert again that night.
He came the next day at h~ine, and after greret-
ing his host and hostess warnily and washing the
dust off his hands and face, went straight into Mr.
Pemberton's little office to workr., He was an expert;
involuntarily Mr. Pemberton felt himself entertain-
(Continuled on Pagie )j


and was glad she had made so good a match. Cuth-
bert, though still young himself, did not consider the
disparity in age between Gladys and her husband as
anything of importance; Mr. Pembrerton -was a hale
and healthy man wvho had not, so to speak, allowed
himself to grow old; Gladys was a young woman \qih
had very wisely not permitted, herself to remain
too young. She had a balanced mind and tempera-
ment; James thought she had done well in marrying
Pemberton. It never occurred to him, it could never
have occurred to him, that Mr. Pemberton could pos-
sibly be jealous~ of any friendship between him and
Gladys; if anyone had suggested that to him, he
would have laughed at his interlocutor for saying a
perfectly silly thing...
Mr. Pemberton had not for some time been sat.
isfied' with the firm of accountants who audited his
accounts. He thought a change necessary; it really
was not, but it was his work, and so his decision
was final. He offered his auditing to the organiza-
tion with which James was connected and suggested
that they should' send down to Mapleton a responsible
person to look over his books and papers. If the
firm's representative came on Saturday morning,
wrote Mr. Pemberton, he might be able to finish the
work by Saturday evening, and could stay over until
Monday as a guest. This was -hospitable, but Mr.
Pemberton was always hospitable. Whoever was
sent by the accounting firm could depend upon nice
and friendly treatment.
The matter was discussed in the Kingston office
and James at once offered to go over to Mapleton.
He thought this would be regarded as a compliment
by the Pembertons; he also thought he would enjoy a
day in the country among friends. On a Friday
night, therefore, when his mail was delivered, Mr.
Plemlbe tnb nI eo oc J ameshC ohlboer ngo d beh al
only did he remember that Cuthbert had something
to do with the new auditors he had engaged. And
this man was to be his guest for some two days.
He could not send over to Kingston to tell Cuth-
bert not to come; there was no way of reaching that
gentleman save by a special messenger despatched in
a motor car. And what explanation could he give for
so strange an act?
But why was Cuthbert coming? It looked as
though he had' seized this opportunity of visiting
Mapleton;,if that were so, what was his real reason?
Was it not to see Gladys? What wras more, Gladys
had known of the change of auditors, Gladys had
known that someone might come from Kingston to
go over Mr. Pemberton's books. Might she not have
communicated with .. but Mr. Pemberton would
not permit himself to go farther with the suggestion
that Gladys had been engaged in such an intrigue.
He would not put his ugly thought so bluntly into
words. He felt ashamed of the thought, yet at the
back of his mind the mean suspicion lingered. Nor
could he see his way to believe that Cuthbert meant
nothing more than any other person would have
meant in deciding to visit Mapleton. Suspicious per-
sons hardly ever see things in their obvious and
ordinary significance.
"Your friend' Mr. Cuthbert is coming here to
morrow morning," he observed to Gladys in an even
1:"te, a":Co::adi g ove the lte wce.w ndaemo' l

in."Oh!" exclaimed Gladys, really pleased, for it
had been somewhat dull at Mapleton of late. "Did
you ask him?"
"In a way I did."
She glanced at him keenly. She remembered his
outburst against Cuthbert after the dance at Delva,
and he was hardly the man to have forgotten it him-
self. She put herself on her guard.
"Will he be working on Sunday as well as to-
morrow ?"
evrNoodySuzuay will be a holiday for him as for
"Then why is he staying until Monday morn-
int was his turn to eye her keenly. Was this
real indifference, an ordinary question, or very good
acting? It must be acting, since he had told her
that the accountant from K~ingston would' probably
stay until Monday morning.
"You forget I mentioned to you that if the
Richardsoli people sent a man to Mapleton to-mor-
row he would spend Sunday here."
"I remember that quite well; but that was a
clerk. I didn't know you were inviting Jim. I think
you might have consulted me about that, Alfred. A
clerk is different; you don't have to make any spe-
cial arrangements for him; but a man you meet
socially as an equal~-well, the invitation should
av gnle frohmrme,uI tthon supposett I din' ca
venient to me? As a matter of fact I don't think
it is."
He knew she was right, in so far as she knew
the facts; he had known for some time now that she
had a faculty for putting herself right and him
wrong in little things, things which did not much
matter but which left her in the superior dialectical
position. He did not know that she purposely re-
frained from pressing more important points, know-


ing that that might lead to ,unpleasant, disagree-
ments.
"You are quite right," he admitted; "but the
truth is that-I didn't actually know they would-send-
Cuthbert. He, is coming chiefly on business. I won-
der that he should come on such an invitation and
such a mission."
"He knows you and me, and regards us as
friends: 4that~ is; ~ifollaly his reason. Brit you have
said you don't like him, Alfred, and c-lan't hark
visiting friends you don't like, any more than you
should have friends I don't like. Now what is to
be done? He is going to be our guest for two days

"Oh, I don't mind him," asseverated Mr. Pem-
berton, feeling that there was absolutely nothing to
bec done, and also feeling mightily relieved by the
way Gladys was taking this affair. She had just
made it clear that each of them must conform to
the other's likings as to friends; if she had said
that she; should do so and had left him free to im-
pose his companions upon her, a doubt as to her
sincerity would have lingered in his mind. Biut she
was insisting that they should stand on a platform
of perfect equality in this respect, and she had' asked
him how they should act in regard' to James Cuth-
bert. So, although that gentleman may have wangled
that he and no other should come down to Mapleton


ALSO


FOR

DRY AND

FANCY

GOODS

AND

ALL LINES

OF

STAPLES.


WCBOLESAIE DEIPT:
RETAIL BRAN:CH-ES.
K(IN;GSTON



THE~ "IIUB"

COUNLTRY. BRANVCHES:


46 Port Rtoyall Street.


~31, 33 &c 79) King Street


1 K~ing Street
Port. Maria and M~ontego Ba~y.


60 PORT ROYAL STREET,
KINGSTON, JAMIAICA.


H


W ~se?


native


PHONE 3065. CABLE
CODES
BENTL


ADDRESS KALPHAT
ABC 5TH EDITION
EY'S


tVHOL~ESALE & RETAiIL


; A -


WOuld you be Hanny, Healthy and


READq "PLANTERS PUNCH")


D INKE SRIERI

((AK EL U


MIHQTE TRIP R5


Ex >orter of the above blends and also

(DineS of all kinds.







I__I
L ---- ~---------


rS--- c I -.--s ~- -- -- --rr --


78


PLANTER S' PUNCH


1931-32


THROUGHI crowded cities --across fertile valleys
and desert sands -to the tapof snow-cappedmroun-
tains--wherever the long Ltrail leads, you will find
the Ford car and cheery words about its
When you notice the people who are driving
the new Ford, you will realize that it has found
favor with those of unlimited means as well as
those of modest income. You are as likely to find
it inl thre driveways of big estates as in the garages
of unpretentious cottages. The flashing, colorful
beauty of the Ford gives it distinction at the Country
Club, yet it is no stranger to deeply rutted roads
and hard daily usage inn far-off places. People have
decided that the new Ford is a great car to own and
drive--even where price doesn't count.


In speed, safety, comfort and appearance, the
Ford brings you everything you want or need in a
modern automobile. Its low cost is simply the
result of the Ford Motor Companly's established
pcolicy-passing on to the buyer the savings made
possible by efficient manufacturing methods and
unlimited resources.
The sturdy strength of the Ford, its reliability
and capable performance, at all times and under
all conditions, reflect its enduring quality and the
care with which it has been built. By its constant,
faithful service through many months and years--
and by the excellent company it keeps--you will
know that it is a value far above the price. Ask the
nearest Ford dealer for a demonstration.


Even where price doesn't count


FORD MOTOR COM PANYJ~














82-84-86 Hat Our Street,
KINGSTON. JAMAICA.



T 1Yl OSt Complete Automo-

bile Accessory House in Jamaica

FORD PARTS

CHEVrROLET PARTS

Tires, Tubes, Pumps, Bulbs,

Brake Lining, Bulb Horns,

Electrical Horns, etc., etc.


EVERYTHING FORI

CARS AND TRUCKS





GS AlND 0 1


Day and Nightf Service.



HARDWARE DEPARTMENT

For Builders, Contractors,

Estate Owners, Penkeepers,

Housewives and Ship Owners.




WE CAN SUPPLY





THIS HOUSE GUARANTEES YOU

PROMPT ATTENTION,

SERVICE, QUALITY,
ANJD COURTESYY.


COUNTRY ORDiERS RECEIVrE
SPECIAL ATTENTION
AND QUICK DESPA TCH4.

Deal weith

The Rapid Vulcanizing: Co.,

and you weill be satisfied.


THE RAPID VULCANIZING~ CO.,

82-84C-86 Harboour Street,
A. C. CAMLPBELL, PROPRIETOR.
Teleplhone: 2733.


19:31-31


P1'N'C'H


P L .ZNT ER S'


I'iig h-r Inmlon nn r,,...bablyl he expes ted tha3t the
mas-rer ref the hous~ee \r..ildd retire 1... ieep. 11ell, that
wasR wat13 the ma-ter ref~ 3laplet;!oln wa nest preparred
to- do~-. But therrc wa a w:.\ inl whb~it the mart
nngli~t hr' (ntertarnLl~ and at thle 3aine1 time closely

see his liepirew-. iiad felt 1lse netd four n rntlersationD
abil te p..nrtl wircih would go farther
thanunvamont .( crrep~anion~e.St. the thliree of
then] onuldl dri\e i.\er t.. Ill.rlev fori tea. C'utbbert
tlt n,.t kun=. thii, par! .af the~ clluntry ;Indl the sup-
ra~tion thaRt he ~hnulrj drIve' thmijSIh It wea.llld -eeni
cluite natural t., binsi
At Id~lan 111 i lllll k I n made !i, ~ ug ** .ell,
Clllllbtift 1 jcildle. "I an] !Ilinking ?youi might lik:
nie to dra \e I.au nshri 1.. hllurley. wiher~e Arthur i: ne
i.uldI get thcrt- quit. In1 rimez for tl'L alndl has k here
inl timr f .~r li int r 11 ul o li ha

exsclulmecd: "I 11.11.1d b.Le rJ ee ...met hanle .t siourr










.11 1 Am i~ 1 In 11 b 1 .lift bef...re. iial' Ir.-! Di] .I Gladj .


'l. c Illiv. In 11. .a111:1 1 1 ( 1 L] L
Il**-~ ~ ~ ~ ~~~!.1; [.I'1 1t f. Pl 511:.

ft fl la (,1!' W111 111F Ili '-! 11 I- i ialp ?**II 111* I ;aI
1 11 ?*li~ ;\t1 III11 nll ill tlilli~ t I l !In *dil ol pfln1
II1 Li ~ II. Il** '.1 Ir i INi H illsell !. .it] it b l

L t 3. li..; ,l~l ir ,,' .,!";\ ,1', ;II~II ie "' ~
Il -1 ; I11 t~! Ll r Ii -1 .i It~"I-\ :1 11. 1 pilII \. ini **


.I~ ll lI p..I lln it r i il. *' a ls.lt e 1
\. 1 [:II ll a~tI n ld \a L f ll. ,Isil P ,II l l-. 1.1it :Int


The Cup and The Lip

ing a rt;sptct fr~r thils very) g...-~~l.d I ...i ngF ?ung mn ~
ii I1. "hi~i 'lll-CI 3 ::d 1 l. rI R. n udl n-r Ir anlp
I(arter tr. Ine. w~hen lie wecnt ton wash up before gajine
ii tr.Itinlll. Illr. Ptllembet onl ball by~ then realized
1113[ C'uthbetrt hadr cri-m e dsl.=wn' r.= do, narkl, and us(.'
Onll*nwense abut it. He expanll- 10.1 IUtlun.I .~ A very
plzeisant hour was passed.
C:uthberrt w\ent batkl tlr tb~ Othe at two.ls andl Ly
t..ur inl the aftelrnoon be bad Iluirte romplcted l i
n. rkked trint a little mapM belre 11 1 rr Penuld I fon
unuffelteril.1. But bie turned Immeldiately antI asked
G~ladys whe~ther he would noJt likce a game oft tennii;
they! mlighlt play singlesi forll all hojur olr two~.. if sh

r1~.. r adtily to, his Cg:~oin to- belt.
"That!' a Fn...d idea." he as.): "it's biterl tan

Lx nId Ish .*/ a II av~ennt Culbert

.1.I~1 1..r. It dian1 matt ter 1..1 hIntI wheth Illr Pem- ~'1



T ,ait 110 = ~ II he ll. r 1m I lfe Iall i==lr II H.
The- (jillnia.- wo- Il E fi le~ a- rIII btI d Ltin ts.. l
file I I ti !'il hlj i ht-* I~I. (:1.1.1 11 8 !'j~l itIl **I 0~l.11

.)II Ii .*III 1 rf~ lim11 I '* li 11101 -1 lining|1 11 .l....<(- ,t ff a ij

1!I O I ll [ irII. ll** 111( s- 1.1 p *1 1 1.' rs e ~ ll '! 11. 11.. .1 .*
lllII III 1 1 T l lll:i .s I 1 11==11 .111 hr a l if litlli 1 i11 i\nur


I kn.- 1 I 11.1- l 1- I Ilirl Il *** Ili n .II 1 1 I II~i
F .1. -il' lll Il- -i: l ('llll?~ j.1 i fill.~i l~l* I E -***i
llllrt'lll \*1* Mill I II .n pE. iem.
Tln l~ nti- IIII1 r\fb Irnin .Il I~ Jl.aa u lu : .. I ~
h Il l l lue 1 ~ ll ) r n l..11- tl
,,,, ,i .11 "lr "i~i~~t ,,l~rr c! ,:,.1"I' "n.!rl 1II



.1.. is. ie la th1 la l a. .It[rIII.:1 Ju n I1III ri
rlnal.1 ..t LII-l ., 1 II r. h- le ~ Iln t... risn t il~s I l
kLLO.1 rner. .a1sl! -- thl 6 ..l1=i- 1.< full. m e t 1. rl ~ \~~



































































I



FOR QUICK AND EFFICIENT SERVICE

jUSt keep this name in front

for


ALL INSURANCE BUSINESS

(Except Life)




Support Local Org~anizations


And Keep The M/oney


In farnaica.


Board of Directors:

LWISAL. ASHIONHEIMO(Chairman)
O. K. HENRIQUES
HON. ALTAMONT DACOSTA, M.B.E.
LESLIE R. MORDECAI
ALFRED E. DACOSTA
WILLIAM GAMBLE
VINCENT H. AGUILAR
HON. R. EHRENSTEIN
PERCY JUNOR
ELLIS LEVY



1 Secretary and Manager: CYRIL D. MELHADO

THE INSURANCE CO., OF JAMAICA LTD.,


THE JAMAIC MAhIN IeS kNCE CO., LT`D.
11 CHURCHI STRlrEETI KING~STON


1931-32


P LjAN T ER SL PUN H


her perfectly, though she had never given her a
thought since the day of that house-party at Morley.
She had never thought of her as being permanently
connected with Arthur's establishment: she realized
the position now withl something of a shock. -
"This gentleman and I will have a whisky-an~-
soda,"'said Mr. Pemberton in a tone of command:
it was always at the back of his head that Morley
was one of his properties and that he was master
there as well as at Mapleton. "Will you have any-
thing before tea, Gladys?"
"No, thank you, dear; but I think we'd all feel
better for a wash."
"Exactly. Show us to the guest room, will you?"
he said, addressing Marie, "and take Mrs. Pemberton
to Marse Arthur's room."
Marie, not appreciating his manner, nevertheless
bowed and obeyed. She knew who 1Mr. Pemberton
was.
She took Gladys into Arthur's room. Gladys, at
the first quick glance, noticed the little arrangement
of flowers on the dressing table and knew at once
who had put it there. In some other ways, also, the
room gave indication of having been looked after by
someone with a taste quite unlike that of the com-
mon domestic servant. And this East Indian girl
was so pretty!
Before Marie could leave the room Gladys said to
her,
"We came over for tea, and to see if Mr. Norris
could give us dinner. But of course if he is not going
to be here before six o'clockr, dinner is out of the
question. But I suppose we can have some tea?"
"Yes, and dinner too. There is plenty of time:
I will give orders to the servants."
"Yes; but, you see, Mr. Norris not being here "
"It will be quite all right. I will arrange it."
"Oh, you!"
"Yes; I am the housekeeper; me and my hus-
band are in charge. You can stay to dinner."
Marie was not aware that she was speaking as
one in full possession, and almost as though she could
decide whether they were to have any dinner.
She was not conscious that she was obeying an im-
pulse to let this English lady understand that she
was in command of the M-orley domestic arrange-
ments, had a claim on the house and its master, was
a personage in the establishment, was practically its
mistress. Yet that was the impression which her
attitude and tone conveyed' to Gladys, who was
alive to a quick feeling of hostility towards this
bronze beauty who carried her head so high and
apparently ignored the circumstance that she was
speaking to Mrs. Pemberton. And Marie too was


hostile; she experienced a sudden quickening, of her
dislike for Gladys. She had been thinking much
about Gladys and was satisfied that it was she
wihomn Arthur had loved, and perhaps still loved; she
had declared that if G~ladys attempted to take
him away she would kill her; and now this white
girl stood there and was looking at her with steady
eyes which said quite plainly, "I don't approve of
your being here." Had Marie dared, she would have
ordered Gladys out of the house, she would have
driven her out. As it was, she must control her feel-
ings.
Then Gladys spoke in quiet, cutting tones.
"What is your name?"
"Mrs. Ramsingh."
"Ramsingh, ch? Well, Ramsingh, if I decide to
remain to dinner I will let you know later on so
that you may have time to prepare it. You can
leave the room now, and remember in future, in,
speaking to me, that my name is Mrs. Pemberton."
"I know it is Mrs. Pemberton."
"Then say 'Mrs. Pemberton,' or 'missis' when
you address me! I am not accustomed to servants
addressing me as an equal. You may go."
Gladys had an instant's impression that the East
Indian woman was about to leap at her throat.
There was a subtle movement of Marie's body, like
that of a snake rearing itself to strike. But at the
same moment Marie realized what would be the
result of any open quarrel with Mr. Pemberton's wife.
She took a grip on her temper; she did not even
answer. Yet she had her own method of retort; it
was conveyed by a slow lingering scornful smile, a
languorous turning of head and body as she gave her
back to Gladys, a kind of contemptuous saunter as
she moved to the door.
Gladys saw, understood it all, yet knew that
she could not very well complain of a smile and a
movement, and that it she even repeated the talk
between herself and the girl, everybody would say
that she had taken advantage of her position to be
rude, since Marie, as an East Ind~ian wvho was really
not a servant in the ordinary sense of the term,
might have meant no rudeness by not saying "Mrs.
Pemberton" now and then in her answers. It
would not look well to have a quarrel with
Arthur Norris's housekeeper on the occasion of an
unexpected visit. But she knew without anyone
saying it that this girl Marie had good reason
for taking herself as a sort of mistress of Mlorley;
Gladys's mind had leaped to a conclusion which
nothing could shake. So this was what Arthur
was doing! This wras the life lived by the man
who had professed to love her so deeply!


up quite a lot. But I can undif-stand you would want
to keep a promise to Arthur now that you are in his
neighbourhood. I'll tell you what we can do. I am
sure Arthur can get up a dinner for us at short
notice; let us crash ih~ upon him and ask for' tea
and dinner, then Gladys and I can leave you at
Morley between nine and ten o'clock tonight, unless of
course you would prefer our room to our company
over there."
"Shame!"
"Thanks, old fellow. But there is a string .to
my suggestion. If we let you stay over at Morley
to-night, you must give us here and now a definite
promise to come to our next hodse-party. .We will
take no refusal, will we, Gladys? You see, she agrees
with me. You will have plenty -of notice of the
party; I promise you that. Is it bargainn"
"This is really too kind of you," cried Cuthbert,
appreciating greatly the courtesy of the arrangement.
"I am not such good company as all that, you know.
But of course I accept--rather. Irideed, I feel like a
cad for haviing suggested that I should' go over to Ar-
thur's for the night, but it is really true that--"
"I understand, my good fellowr" Mr. Pemberton
beamed. Hle was quite reassured now; more, he was
convinced that he had acted in the last few moments
with wonderful tact; not even Gladys could possibly
suspect all that had been in his mind. He became
gay. And Gladys, pleased with this exhibition of
commonsense and hospitality on his part, felt her
spirits rise also. Perhaps she had gravely misunder
stood him; it seemed so. Then they were going to
see Arthur, and she had been thinkrlng of Arthur for
some time. She realized that since that night at
Delva she had been wanting to see Arthur. What a
splendid idea it was, to go and see him to-day. Per-
haps they would be able to drag him out of his shell.
James packed his grip, and by three o'clock they
were on their way to Morley in Mr. Pemberton's
seven-seater, James's car being driven by one of the
Mapleton chauffeurs. But when they arrived at Mor-
ley they found the house closed. The boss was away,
said the servant, but she believed he was returning
later. She would go and tell the housekeeper of the
arrival of the guests.
Marie came over in a little while, a white head-
scarf flowing over her shoulders, her smooth soft
arms exposed. She greeted the newcomers gravely.
Mr. Norris would be at home about six o'clock, she
said. Would they wait? Could she get them any-
thing?
James looked at her with admiration: men usu-
ally did. Mr. Pemberton remembered her; a darned
pretty coolie girl, he thought again. Gladys recalled


3 1111111111111111111111111111111111111111111111111111111111111111111111111

HERE TH RE
























BE NJAM~ /IN' Sc2

KHUSS K~HUS



GROWS 1VORE POPULAR EVERY DAY

Start using Benjamin's KHUS KHUS' yourself and send a bottle to your
friends abroad.


WE ALSO OFFER


VAPORiEX. ICY KOL BAIYT RUM
Best thing in Jamaica Cooling and Exquisitely
for Colds Refreshing Blended


Only the finest materials Blended to an exacting standard of per-
fection are allowed to come to you bearing the name BENJAMIN.

P. A. BENJAMIN MFG. CO., LTD~1.
151 H~arborur Street.
11111111111111111111111111111111111111111111111111111111111111111111111111









--- I-
~i----------------- ~


~


wife, even if that man was only an East Indian
employee on the plantation, Arthur was clearly
wrong, especially as there were so many unmarried
girls to pick and choose from. There was a great
deal in Gladys's point of view.
He had never imagined Arthur as strictly celi-
bate; he himself had been a bachelor, but that was
not at all synonymous with celibacy, had no necessary
connection with it. But G1ladys was right; Arthur
was making a grave mistake. Besides, the less one
had to do with East Indian girls the better. He had
once almost had some reason to think so in regard to
himself.
(Continued on. Page 83)




iiR. MGahfood & Bro.

SA name which is well-knowen throughl-
Sout the Commercial World.
a]We lay the foundation of our business I
011 5 points:--
f i1. 90%0 of our purchases are


2. Expert knowledge and ex-
I perience in the requirements
i ~of the trade,
i 3. Large shipments by every j
i ~steamer, which keeps our
i ~Stock up-to-date.

4. One price charged,--~and
that the lowest.
1 ~5. Personal attention of both
partners, Messrs. R. & H.
i Mahfood, assisted by a civil
C and courteous staff.

1 30 HARBOUR STREET,
5 ~KINGSTON, JA1MAICA.


....931-32


PLAN TER8'


PUNCH


Service










: I




















Suppliers of:- H 4RDWA
B UILDEI


'ALITY;
buildings


IRE of Endluring VAILUE; LUMhBER of Finest QU
RiS' SUPPLIES and 2Mill Work suitable for large or small b


LITTLE PRRT ROYAL


KINGSTON,AMIA


He was worthless, miserable, contemptible! She
would not wait to see him. She and her husband
would leave James Cuthbert to await the return of
Arthur; both of then would go back to Mapleton as
soon as they could swallow a cup of tea; she would
insist upon it. She knew that though Mr. Pember-
ton might want to have a talk with Arthur on busi-
ness, he would do what she wished. As for James
Cuthbert, it would be no hardship for him to remain
for an hour or two alone. She would say so quite
plainly if necessary.
And she did say so five minutes afterwards, when
Mr. Pemberton was protesting that it woulld not be
fair to leave Cuthbert to wait for Arthur alone. She
would not compromise on the subject; she was de.
finite. Mr. Pemberton found himself reduced to apol.
ogising to James for this cavalier treatment, and to
wondering how on earth he had ever .imagined that
Gladys cared much for the young man's society.

CHAPTER THIRTEEN

"WI-I AT'S the matter?" asked Mr. Pemberton-
VVHe had noticed, as indeed no one coula
have failed to do, Gladys's tense stillness as they
drove homeward, the set expression of her face; re
thought (very foolishly) that by now he knew all
her moods, but this one was new and inexplicable
It was not until they were home again, however, that
he asked her what was the matter.
"N thian,"n selrepliedyo?"
"No."
"But then, my dear,"-he paused. This could
have no connection with leaving James Cuthbert
behind, for that was her own suggestion; yet it was
nonsense for her to say that nothing was the matter
when something so obviously was.
Mr. Pemberton, being touchy, felt irritated. It
seemed to him that it became increasingly difficult to
understand his wife. If he had thought that mar-
riage Inant anything like t1i nAturshus?,

She law Gladysoswho re umedM rheconveor at n.
she felt compelled to express her feelings. It had
suddenly occurred to her that she might say some-
thing uo me.Pemb rton wih very marked effect'

"Yes; the coolie girl. You noticed her, of
course.,,
"Of course; devilish good-looking;- some of -these
East Indians have wonderful figures; hers is splen-


did. She is sensible too; no nose-rings and other
disfigurements of that sort. She--"
"I didn't ask for a photograph of her, Alfred;
you seem to have been eyeing her up and down, you
know so much ttbout her."
"Good God! I only saw what you yourself must
have seen! Is it she who has given you the dumps?"
"I don't know that I have what you call the
dumps; but I object to going into any house where
a young married woman of the lower class is in
charge and acts impertinently. What is she to
Arthur? Have you considered that?"
"Talk quietly, Gladys; she is Arthur's house-
keeper, isn't she? That is all right. How does it
concern you or me?"
"His 'housekeeper' in the peculiar Jamaica sense
of the word, isn't she?"
"No! You don't say you are thinking that? Why,
she is East Indian and married."
"Would that make anly difference here?"
"It might with the coolies. And I don't think her
husband would like it. So there can be nothing in
what you think, you see. It never occurred to me,
I must say."
"Isn't it quite apparent? The woman acted as
though she were the mistress of the establishment,
as I suppose she is. Yoix know that Arthur hardly
ever pomes to Mapleton now, and I understand that
he hardly goes anywhere. He doesn't need society
so long as he has his coolie girl, a married girl, too.
What a nice situation of affairs! And I was taken
right inao the midstsof ietteodda ."hol oveto
Morley," replied 1Mr. Pemberton earnestly; "but I
had no idea of this girl."
"Well, what are you going to do about it?'"
"Me? What canl I do about it? I can't very
well go to Arthur and ask him if he is living with
a married woman; he would say no, and I would
feel like an interfering fool."
"And how would you feel if any scandal should
occur?"
"Scandal over that?" Mr. Pemberton thought
tha sftherethwere going to scandal uode things
at peace for a moment. Gladys had much to learn
re.Hme ouelrd ao itackE some dt enty ears himsel(
she had not been married. Yes, that m~ade a great
difference: she had not been married. He felt very
virtuous as he dwelt upon that fact; he could ex-
onerate himself from all moral reproach. Marriage
was an estate which should be respected; if it were
true that Arthur was carrying on with another man's


LThe


COROO VA


House


of


andl Satisfaction Guaranteed.


LEONARD de~CORDOVA, Lim~ited.





PLANTER S' PUNCH


1931-32


SY ROYAL WARRANT OF APPOIN~TENT
TO HIS MAJESTY KING GEORGE Y



He's sleeping quietly now -

Bless h5im !

Baby looked old before he was young.
r But what a change there's been All
3~'~~$$,those little puckers of pain softened and
~ smoothed away!i That anxious harassed
;b~d~l. B~ b Li~~i~jl~~look gone! You don't see it now. He's
1 come so round and rosy. Mother and
Father would tell you they've Nestl6's
Milk to thank for that. They say it wvas

like a rainy day clearing up when they
I;. put him on to Nestl6's. Simply because
SNestl6's Milkt agreed with him. It was the
first food that did. It gave him the feeding
nourishment of good rich full cream milk.
-- But it was milk which the NestlC's pro-
cess had made digestible easily di-
gestible--by a delicate babe.


NESTLE'S MILK

'C ~ ~Nestl~'s Milk is mlilki. Milki at its purest and safest. MZilk ~ /\
Df; with all the vitamins in it. Only water is taken from it
and only a correct proportion of wholesome sugar is ad-
ded. And it isso prepared that it can be digested by a
child whto cant digest nothing else.


Nesle sand Annglo-Swirss CondenrsedB MilkB Co.,
102 .HAREBOL.R STREET -- KING STO N, JAMAICA.


-----










. ..


81B KiING3 STCREE~T


We carry an extensive and varied stock of Tropical Goods
fOr Ladies and Gentlemen. .


Suits made to measure at short notice.

SATISFACTION GUARANTEED.


Keep coo! in one of our Indian Pith Helmets.


Select a Suit of Shantung Silk, Lmnen, or Light Palm

DeacII IOr tropical wear.


~


It Will be our pleasure to ensure Your Goodwill.


S AlSSO & ILE

TIHE HUEOF~ VALUES.






THE~i GARDEN GOCR

CORNER CHURCH~ A. BARRY STREETS


I


19:3f-2


PL2;ANtT E RS' PUNCH


KIi4GSTON,


JAMAICA.


HEADQUARTERS FOR :-

High Class Groceries, Provision~s, Confectionery,
TOilet Preparations, Etc.


Our Prices a re M moderate.

P~HONE 2928.
HENRY FUNG, (PROP.)


absolute right. But Arthur was angry too. He had
heard about the visit of the day before. Marie had
told him, had given him her version of it; had
caused it to appear that Gladys had treated her like
a dog and then had declined to remain in the house.
"She want you to turn me away," Marie had sail.
"But as she is married to another man, your own
uncle, what has she to do with you? I don't inter-
fere with her."
Arthur had bade the girl be silent; but he had
been disturbed by this unpleasant turn of events.
Gladys had been there, had seen Marie, had probably
guessed more than he had ever wanted her to do;
this was humiliating, maddening; he wished that he
could find a way of escape from so miserable a situ-
ation. In his heart he still craved to please Gladys;
but what he had not expected was to-day's visit from
Mr. Pemberton, who had quite evidently come to
dictate to him, who had probably been sent by Gladys
to exercise over him the authority of an employer,
Against this he very definitely revolted. She was to
be free to do what she pleased, but he must do what
they pleased. And why? Because, no doubt, they
were thinking of their position, of appearances: that
was always in his uncle's mind, and now it would be
the same with Gladys, who had married for appear-
ances and for position.
What did they take him for? A nonentity? He
would show them.


"What is the object of this conversation?" he
asked Mr. Pemberton.
"I want you to give up this young woman."
"You are asking me to dismiss someone who does
my personal work to my satisfaction? I absolutely
refuse to do it."
"By God, boy, do you forget whom you are speak-
ing to?"
"I might ask you the same question."
"Indeed! But I can dismiss this man, Ramsingh,
to-day, and his wife must go with him. Morley is
mine: remember that."
"So long as I am in charge of Morley you can
dismiss no one here who was hired by me. I am res-
ponsible. You can dismiss me, of course, but don't
forget that I was willing enough to go the other day.
and you did not want me to. I can go quick enough
now though, and perhaps I had better."
This was not what Mr. Pemberton had looked for-
ward to. Apart altogether from the fact that Arthur
was an excellent attorney, he was the nephew, the
only male relative of Mr. Pemberton, and it would
surely get about that he had been turned out of his
job by his uncle, or had had to resign because of
something his uncle had done to him, and then
people in the colony would condemn Mr. Pemberton
roundly, unless they knew the reason why he and
Arthur had parted. But even if they knew the reason
there would still be many .to seay that the older man


The Cup and Thle Lip
(Continued from Page 81)
**W'h\ doesn't the fellow marry!" he exclaimed
petulant~ly.
**Considering that you did not marry when you
were his age, I wouldn't make that a grievance if I
w~ere ?.ou."' said Gladys. "There is no reason why
Arthur Ihould marry if he doesn't want to; but
there 4 no, reason either why he should be living with
an East Iludian woman so publicly. It's disgraceful,
and ).1u sought to tell him so."
"I'll ee if I can. As you say, this thing is too
puh~lis..
**1 ;aid nothing of the sort"-G-ladys was too
deep~lr annoyed to be tactful now in answering Mr.
Pcnmbe-rt.o.. "If it were so private that no one could
evenl suspct it, it would still be awful. Can't you
br alie IIberton could not. He was thinking
rlhiefly ..f appearances, not so much about morality.
Ytr use1 I..rcumstance that Marie was a wife did con-
Ilnui to influence him. In a way, too, he was: pleased
that GI:rl~tivs was- so uncompromising on-the subject
1-f us...ral1 conduct; he could not have appreciated a
I..rnd..nine attittide toward gravely illicit relations on
Thre par! Iof a young and pretty woman who was his

[ n ill go over to Morley to-morrow and have a
talk \ ith~ Arthur about this affair," he decided. "You
lire sitle right, Gladys; he ought to be ashamed of

it w ..io hguaese that Arthu 1otl knkw wrh sh:
private business; but she did not care. She was
hulrt andl angry to the verge of imprudent action;
hr was;r aut to the quick; she despised Arthur and
-11+ lum be-d and hated the lithe, impudent, beautiful
Ea-~t India~n who had scorned and defied her as though
lanalllteably certain of her hold upon her man. Both
wantorln hasd understood' one another perfectly: they
"iln:~lned expl en tns o rofs rto convince sthe
vas~ sw II'I and sure. Marie felt that Gladys Pember-
lrn r~tegarded her as so much adulterous trash.
Glaid! nacs maddened by the conviction that Marie
na~ re~j..i..ing over her, challenging her to a struggle
uhillhl might only end in a shameful defeat.
The t ery next day Mr. Pemberton went over to
liarey e took care to get there about lunch-time,
and, as- lIe had hoped, he found Marie in the house
sulper\islng Arthur's luncheon. A place was imm~e-
dlate~l ilaid for him at the table, and after he had
luns t~ied -sd they had gone out on the verandah to
smleike. hle opened on the subject that had brought
him ovrtr
"TDia!' sa very good-looking girl you have about
here. Arthlur. Married, isn't she?"
'\ Y..u mean Marie Ramsingh?",,
'Ye-. that's her name, I believe."
'.lshe'sism vedy od-looking."
"Yu~I are a judge of looks, I understand, Uncle

Thii was not exactly encouraging. It seemed to
hint at --..me secret knowledge. Mr. Pemberton was
not really ashamed of anything in his past, but he
did n..t desire that ancient history should even be
dlisantl hinted at. The higher duty of the social
histril~anl. or of the commentator upon morals, was
le~arl! !... forget or ignore anything that might refer
Lu thel antecedents of distinguished persons.
** I ni a pretty good judge, Arthur, and I canl
rtell your that this Marie Ramsingh is stunning.
Damniell pretty and all that; perfectly fascinating."
M~r Pemberton was waxing enthusiastic. He
had \r:. closely observed Marie but a little while
beforep andl had been more than ever struck with her
appearane. H-e did' not doubt now that Arthur had
beenl clearlaed by her: who would not be? But of
cou:lrne rhlere were appearances to consider, and
C;lad!'s's objections also. H~e had a duty to perform.
'But do you think, Arthur, that it is exactly wise
ibr !ouI to have her about the house?" he concluded,
as o~nr man of the world to another.
**Whe~re is the unwisdom?"
**Ther~e is her husband; he cannot like it."
**He does like it. He is my butler or major-
demo: It is he who is really in charge of the G~reat
House. an1d Marie assists him. You see now, I hope."
~Dr. you think that at my age I am a fool,

"W'hi sent you here to discuss this matter with

"NoI one; I came of my own accord."
Do you think I am a foorl, Uncle Alfred ?"
**Yes. I do. You are a fool to be carrying on
with an East Indian's wife; you are a fool to be
sinkinp down to this sort of life, when you could do
muchl better for yourself; and you are a fool to think
gou can deceive me as to what this coolie girl is
to youl "
.11r. Pemberton spoke warmly. He was not ac-
customeld to being treated like this by his nephew;
he was conscious too that he was going rather fa,
and thlat of itself inclined him to be angry; anger
was a good substitute for a calm conviction of


Sasso &


Miller


Tce Crea r Supplied to H-~ornes

in W~hOlesale QuantitieB
also

Retailed at our Counter.









































'


Your financial resources are invested in your

Q orse you intend to clear off all indebted.
ness some day and have funds to educate your
children and retire in comfort.
But death or disability can suddenly thwart
~-the ~best laid plans.
The Dominion Life Policy provides protection
for your family that neither your death nor dis-~
ability can. thwart--and at minimum cost, be-
cause of the exceptionally low rates. Ask us
for full particulars.

GERALD MAIR, A.L.A.A., Chief Agent.
LISTER MAIR, 1
R. E. L. MIAIS, 9Taeln ersnaie.
D.J. LACEY, j )II~lrJ Rysnoi n
CORONATION BUILDINGHs, KINGfSTON.




36eDINI N LIFE
ASSURANCE COMPANY
nr AD OPPICEs WATER O Q ONTARIO


I I


1931-32


PLANTER S' 'PUNCH


had acted unreasonably, and that he himself had not
been above reproach, and Mr. Pemberton did not like
to be ill spoken of~by people. He was too vain to
relish that. Then ife was not as young as he used
to be, and he felt less able or inclined than before
to give that constant, close, personal supervision to
the affairs of his plantations that they required;
but Arthur could and did look after these affairs as
well as he himself could do it, and it would be
difficult indeed, perhaps impossible, to replace
Arthur. -Th~ere was also the last and really the
greatest consideration. He had loved the boy as a
son these many years; the old affection, the long
associations, could not easily be dissolved now, not
even though a woman had entered very intimately
at last into his life. H-e considered himself strong;
he hated to have his will made nothing of. But
now that Arthur was laying down an ultimatum he
feared to press the young man too far. Someone had
to give way. It was better that he should temporise
than that he should' have anything to regret later on.
"I don't know what the devil you are talking
about," he said: "you seem to be bent upon clearing
out, though nobody is suggesting that you should, or
wants you to go. I am simply trying to keep you
out of trouble, and up to your proper position; but if
you choose to ignore my advice, well, you can do as
you please."


than I did; but I will teach that young cub a lesson
he'll never forget to his dying day. I antgoing to
look around for a good man to put in his pla~e, and
I shall alter my will this very week. Not a penny
he will get when I am. dead; not a farthing. I was
leaving him Morley and some money; the rest is
yours, and it is a good lot. Now he can starve, so
far as I am concerned. When I think of all I have
done for that fellow, and of how he treated me to-
day, I feel positively mad. The ingrate! His mother
would turn in her grave if she knew what he has
become. But I will teach him, a lesson. And please
never mention his name again in my hearing."
Mr. Pemberton apparently believed that he dis
posed of people by commanding that their names
should not be mentioned in his hearing, and this had
always secretly amused Gladys. But now she knew
'that he was hurt to the soul and meant even more
than he had said. He would disinherit Arthur. And
she had been the agent to set his wrath in motion,
since she it was who had e~gged him on to coerce and
dominate his nephew.
If outsiders ever heard of the part she had
played, they would say that she had plotted to bring
about Arthur's ruin for her own aggrandisement, be-
cause she wanted all his uncle's property and money,
and was jealous of him. Well, she would not care
what they thought or said: after all, she deserved
everything she would inherit eventually, and she
might be a middle-aged woman before she should' be
free. Her husband might live another twenty years.
In half of that time she would have paid again and
again for her position and prospects: she was paying
dearly now: she had never anticipated so great a
price. She was not happy. She was especially un-
happy since finding out how unfaithful Arthur was
--for she thought of his conduct as unfaithfulness.
This was not the sort, of life she had pictured for
herself, though she knew she had deliberately en-
tered upon it by marrying Mr. Pemberton for what
he had to give her.
But perhaps she could change her life somewhat:
she would endeavour to induce her husband to go to
England to live, during the summer months at any
rate; she might find diversion more suited to her
temperament; she would seek forgetfulness and ex-
citement. Since they had plenty of money, why
should they not spend some of it now; and' if she
would have all the more because of the dis-
inheriting of Arthur, why should she regret
that for a moment? Her marriage had been a
business transaction. Very well, it was good
business to get all she could out of her bar
gain; it would be bad business to lose anything
that might legitimately be hers. Her face became
hard as she thought; nevertheless there were stir-
rings of self-contempt in her heart. She knew that
her dominant desire was to be revenged on Arthur
for taking up with this girl, a girl so utterly below
his o~wn station that his act was an intensive insult
to one ~to whom he had professed to be devoted. And
the insult was all the deeper, the keener, the more
terrible, for that he had been ready that day to give
up more for this girl's sake--or so it seemed to
Gladys--than he had ever appeared disposed to sur-
render for her sake.
She hardened her heart. Not by one word
would she try to dissuade her husband from male
ing Arthur a beggar. She would encourage the old



D. C. TAVTA REIS
Phone 2831:- REAL ESTATE AGENCY,
27 EAST QUEEN ST., KINGSTON, JA.
A Saf6 PilacO 0fo 8 InpY08etOi &Bd f0? 1)iuid6Bds.



J I



A Hor~ne--Real Estate.
in re um he cas-mc or li no dividendao
time, why not invest it where it will both AI>D to
your income and SUBRrAhCT from your worres ?

My offers are always of the same Primeo- quality
that I have maintained over many years. Each i
secured by graded properties here in the Corporate
area--the capital city of JAMAICA--Kingston, and
wt hief outlying suburb, SAINT ANDREW espec-

Properties quickly 1nil bargains made. NO
rE s'J'PE---business done in a dlay from 50 up-
----o--
Part purchase price a necessity, balance on
M/ORTG'AGE or approved security, if required.
-0-
Each carries out my full GUARANTEE backed by
CAPITAL fund of HONESTY, INTEGRITY,
DEPENDABILITY and local EXPERIENCE.
-0-o
More safety than this you simply can't find any-
time, anywhere
-0-
Property prices are written for the exact amount
you have to invest from; 50 upward.
-0--
My interest begins immediately you interview me.


"That is exactly what I propose to do," was
Arthur's sharp and unnecessary rejoinder.
Mr. Pemberton did not reply. He had backed
down as far as he could, a2nd Arthur had not taken
this new attitude gratefully or even kindly. He was
still inclined to be rude, though he, Mr. Pemberton,
-showed himself conciliatory. This was a new
Arthur, and by no means an admirable one: he had
never hurt Mr. Pemberton's pride and vanity like
this before. The older man rose and remarked that
he was going farther into Portland that afternoon:
would Arthur send for his car? Ile could not bring
himself to offer to shake hands as he left.
"You ought to have insisted that he should get
rid of the woman," was Gladys's comment that even-
ing, when he told her of the result of his mis-
sion. "Even if he had said he would leave your
employment. As a matter of fact I don't suppose he
would have left. He would probably decide tp remain
wherever that woman is."
"Then what would have been the use of my
insisting?" asked Mr. Pemberton logically.
"Well, he doesn't think much of you; that's
clear," she retorted, ignoring his question. "He has
defied and insulted you, and all for a coolie girl!"
The stab went home.
"I'll give him cause to regret it," snarled Mr.
Pemberton. "It did not suit me to go farther to-day


You Had Better face

T~he UCeStiOD NOW









































ROBERTSON STOTT & Co., LTD.

WHOLESALE &e RETAIL

LUIjMBERB AND H-ARDWMAREI DEAi~LER S


DED A TIEN TC


FURNITURE
CUT GLASS
CHINA
CARPETS
LINOLEUM
SADDLERY &
LEATHER GOODS
PAINTS & OILS
SANITARY
FITTINGS
SHOEMAKERS'
SUPPLIES


111111111111111111111111111111111111111111111111111111111111111111111111111111111111111IIIlII





i----M~ANUFA CTUR~ERS OF---~-


HIHRIOa r F SCYVCS and Pickles


GU~AVA JELLYt Green Turtle

Pre paration s


Sun D~ried Turtle


T'e"^ M** Orderf 8 1 8 ill ally quantities to all Parts of (118 Wlorld


EstOllsflea OvCT Flffy Years.




Winners of Seven Gold and four Bronze Medals at various World Exhibitions
ALSO AWARDS OF MERIT


SLEVIEN & SH ER~LOCK
a '72y & 74 Harbour Street, KIangston. Jamaica; B.W.1,
~11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111


193S1-32


P L A Wr;T E R S': P.-- N CH


man in hli determination against Arthur, should he
need enrouragement. Arthur deserved nothing better.
.i --1nl? hope he will do nothing to disgrace Us
further." BIh said, after they had both communed
bittI~:herly with themselves, but for very different

"Y e~lu needtn't fear that," said Mr. Pemberton;
"*it isl't Iiscrlace that I am worrying about; it is
ingra~tlitue and defiance and rank disobedience.
Tbr'I'er" no Ipoticular disgrace ipt what he is doing."
**N... Ilh-race in having another mzan's -wife, and
a icommi...Is man's wife, a woman who is only a ser-
vant, in bi-- bouse?"
No'~t as hie does it. The woman doesn't live in
the samer pilo.e with him, and her husband is equally
in chlarge noti the house with her. But don't let us
Italk; about tha~t now. I see your point of view and
J ayrree with it. And Master Arthur will see my
poinlt of \viewg when it is too late for him to do any-
thing about it "

CHAPTER FOURTEEN

SRIITIO)LIR ran through the coolie village that
MaTric Rarnsingh was no longer in charge of the
domestI le arrangements of the G~reat House. She and
her husbarnl had come back to the village, and for
the pa-t weeFk she had not been up to the Great
House ~n.c.n. neither she nor her husband. The
I:sher us~-~maxl glanced at her curiously, wondering
abar hadl hralpened. But they knew better than to
tLEk lier. tbriev would only have invited a rebuff.
broliri aw u\tdi a fulteeping heheown couns: ,
lejsl. brt zs..Intimes letting it slip when her husband
said 10 herl anything that rasped on her nerves. She
hid evenl. th~augh with an injustice of which she
herse~lf was fully conscious, accused him of being the
reas..n a~b! lur. Norris had said he would no longer
[ requilr- herlll services, not for a little while at least;
she hadl I~ltiel~y suggested that some neglect of his,
some stulpjilVt, had brought about this dismissal.
She knlioca I a sn't so, but she had been maddened' by
the Ialmne-si. indeed the satisfaction, with which
Ramlsinc~h !l.1 accepted the dismissal.
Ma~rlie wo-, well -tware that it was Gladys Pem-
berrt..m's infulnce that had moved Arthur to ef-
'eit thi~s .:Isanlge. But she would not believe that
hi4 resu~l\e w..uld last and' abe wanted her husband
Inbtr. sh... th he wished both himself and his wife
to c~?lontinu to be attached to the Great House. She
feared tha!t ile quiet readiness with which Ram
slugh! hlld b..wed to the Sahib's decision may have
suggested rha~r Ramsingh, much as he loved money,
was n.:.t r'aver any more for the position at 'the
Grear H. 0 er. And this might influence Arthur in
the li utur. lie might see in it a hint that Ramsingh
had latterly no~t been easy in his mind.ii
Mlarle recallled that more than once Arthur had
questiioned he~r about her husband, wondering whe-
ther Ramjingh might not have grown suspicious.
Ramaineh hadl~ now acted in a manner to indicate
that he wasi not displeased that the Great House
w'OUI ld n.:.w him and Marie no more.
Arthur had revolted on the day of Mr. Pember-
ton's \'isit am:.inst the dictation of his uncle, against
what liie e..n idered to be the insolent attempt of
G~lad!s tor dlrtet his life, after, as he thought 'oitter-
ly. shie had I..ld herself for property and social posi-
riron. Hi Itit he had been easygoing long enough,
that at last he must assert himself, must show that
he wa~s nobo~.dy's man, but his owrn. He had done
so. !'et wiithl the next day had come reflection and
tie old feeling of dissatisfaction and shame; self-
cojnte~mpt .Int, self-reproach.
So? pe.:.ple- were beginning to knowv, or at any rate
to gue all.I. above all, Gladys knew. The thought
jtung hnim It was largely the realisation of her
kinowi ledge 4 his present life that had* angered him
yesterrday Iint defying Mr. Pemberton so violently:
Giad! .ir-pi-ed him, and when that fact took hold
f hils mnlld the result was an assertion of uncom-
pr*.mising Indiependence: he wouhil do as he pleased
sndl all ..lr;hlers could go io hell. But the mood
died down'l .and it was with Gladys in his mind that
he had~ int~imated to Ramsingh that he would not
require h;- -ervices or those of Marie any longer at
the I~Ireat H..use. He shrank from being verbally
tinal in thel dlisruption of relations. He so phrased
his w..~rds 3 to let it appear that, later on, the old
ronnelctil.n might be resumed. But he had no inten-
lion 1of rtl uming them.
He a ..ul.1 not avoid an interview with Marie;
withi hier h endeavoured to be diplomatic, mention-
ing. somel-thilli of what his uncle had said, and sug-
gestin: that1 they had better humour him for the

Malri; wenot straight to the point.
**Ir is noit your anele," she said very definitely;
''it i 111, nwhe. And it is her you sending me away
eo.Sh Isk le hre u dn loak e upuala down, ad
y'ou d.:. this. A4n' yet you said you loved me. Do you
treat me riiht.?"
He felt he was not treating her rightly; and yet
it was nort right, either, to continue to have her as
his mistree,. she who was not even a single woman.
But he did not attempt to deceive himself; he did
not pretend to, himself that a sudden high regard for


morality was the motive of his present actions. He
was in reality doing something which he hoped, it
and when she came to hear of it, G~ladys would ap-
prove; he was striving to reinstate himself in her
regard. The leaven 42~ romantic feeling in his Nature
was working. But he hated to seem like a callous
beast in Marie's eyes. That was against his disposi-
tion also.
"You doing this to please her," said Marie. "What
is she going to do for, you?"
"She will do nothi g," Marie went on, speaking
quietly but tensely. "You will find that out. She
want everything, but she gIrve nothing--that is her
sort. And you? You will come back to me. I love
you, and I won't let you go. You want me, too!
To-day you think you can do without me, but you
can't; I don't give yo7 a month before we are together
again like we have been. WOait and see."
W~ith that she had turned and left the house,
holding her head' proudly, lithe and beautiful as ever,
her red mantle draping her head and shoulders,
and bright as though it had been new-dyed in blood.
He felt at once relieved and' depressed when that scar-
let figure had vanished. He resolved to avoid the
vicinity of the coolie village in the future.
He hadn't noticed that Ramsingh seemed quite
contented with his dismissal. But Marie had ob-
served it. She had thought, now and then, some


time after his quarrel with Das, that her husband
gazed at her sometimes with troubled, suspicious
eyes if she happened to remain rather long up at
the Great House during the day and he became
aware of it, or if she suggested after dark that she
had to go there to complete some of her work. But
she had managed cleverly; he had never been
able to lay hold of anything against her. She knew
that Ramsingh could hardly, without sulticient rea-
son, inform Mr. Norris that they wished to give
up the position at the Great House, since that might
be to risk his situation at Morley. Ramsingh's mor-
ose and questioning looks, therefore, she had disre-
garded; and all the more so because she would have
welcomed an open breach with him, a separation
for ever, if only the Sahib would have agreed to that.
Now, seeing that Ramsingh, in spite of his cupidity,
did not bewail this change in their fortunes, Marie be-
came convinced that the seeds of suspicion sown
some time before by Tom Das had been slowly but
certainly germinating in the always distrustful mind
of her husband. This clashed with her wish that he
himself should endeavour to get reinstated in the
position of majordomo.
Marie sensed that the women of the village were
discussing her, talking of her never going any more
to supervise affairs at the Great House as of one
who had suffered a debacle. They did not like her,


-( -ING STON1~


SOLE AGENTS FOR


Aladdin Lamps
Red Star Stoves
Berger's Matroil
Darne & Personne Guns
Diamond Irons
Western Cartridges
Peterlinium Wood Preservative
Teolin Enamels and Varnish
Harrington & Richardson-Revolvers
Fayette R. Plumb--Hammers and Hatchets
Devoe & Raynolds--Paints
L. & S. Starrett Co.--Mechanical Tools
Adams & Son--Crockery
Henry Disston & Sons--Saws, etc.
Josiah Wedgewood-W;edgewood Ware


114 HARBOUR STR~EET.













With a Progressive City



Results are Certain


OUR~ OBJEllCT'

Is to assist in the

development and

welfare of Jamaica

by turning dry and

arid lands into

fertile farms, anid

co-operating with

cities and towns

with their water

supply problems.


~
I_ -


Ramsingh out of the way for a time? Because she
hoped and wished the latter, she believed it.
It was about ten o'clock the following night, and
Arthur was sitting in his dining room, in a favourite
old leather armchair, reading, when one leaf of the
folding door was quietly pushed open, without any
preliminary rap, and a figure swvathed in a black
Inantle glided in. He started: Marie stood before
him, her eyes anxious with enquiry, her breast ris-
ing and falling quickly with apprehension at her own
boldness. She had heard not one word from him
during the day, had not seen him, but she had made
up her mind to act. 1More than a month had passed





WHto RHd Wilon

35 ST. JAMES STREET,
MONTEGO BAY, JA., B.W.I.





DRUGS,

PATENT MEDICINES,

TOILET REQUISITES,


Groceries, ~iquors, Cigars and

Cigarettes, Etc., Etc.


.PT-DT SOAFUNA


PRESCRIPTIONS ACCURATELY
PREPARED.


PLANTER S' PUNCH


1931-32


OUtr W~ORK
Pure Underground
Water Supply Systems
for Plantation Irriga-
tion, Townls and In-
dustrial Plants.
The Governme'nt of
Jamaica, Large Agricul-
tural Companies, and
progressive Banana and
Cane Planters are using
our system with success.
A water supply sys-
tem11 consisting of a large,
deep and properly con-
structed well, and a
"'Byron Jackson" pump,
directly connected to an
electric motor is sim-
plicity in itself, eco-
nomical and an indis-
putable asset to all who
require water.


KLINGSTON, JAMAICA


P.O. BO~X; SOT


TELEPHONE 2682R


therefore they would rejoice. at this change in her
fortunes; in their eyes she had abruptly come down
in the world after a very sudden and unmerited ele-
vation. Did they suspect that she had been more
than1 a sort of ordinary housekeeper to the Sahib?
She believed that they did; hence they would now
see in her a lover rejected and discarded as well
as an unfaithful and unworthy wife: one who had
fallen as a wife and then had been contemptuously
thrown out as a lover. This lacerated a vanity almost
insane; to have to endure a taste of the contempt
she had shown for others was wormwood, poison,
something bitterly intolerable to Marie. She thought
of the white woman who had been the cause of all
this, the great lady who lived so many miles away.
If she could have done so with safety, and the op-
portunity had offered, Marie would gladly have poi-
soned. the rival who looked down upon her from so
ineffable a height of superiority, who thought of her
as so much dirt. She would have killed; she had
it in her to kill. But she was impotent for action
~of that sort. And mere hatred of Gliadys Pemnberton
Ioud wi h owihe babk ke ur anafor s hom she was
It was he whom she wanted, above everything
to the exclusion of everything else in the world.
She must have him back; she would take any risk to
get him back. She would rather die than lose hint
forever, would die to have him again, if for never
do hor intime.soThits she repee to h rsl agan
eyes fixed upon her with a puzzled probing stare, and
then she won d return hisnecru ena et .a look asa cd

him. But for the fact that to leave him now would
necessitate her leaving Morley and the parish of
Portland as well, she would desert him. As it was,
she must remain,
HoAnd ArthursNorris never came to the village now.

tht e dan 12e since he had seen her. She k e
from the outside world had come to visit him, and
by no one she meant one wvomtan only. Surely, then,
he must miss her, must long for her, brooding up
there all alone. Was he note longing for her as she
for him? Was he afraid to send for her? If so,
should she be afraid to go to him? Would an oppor-
tunity for doinic so evei' arrive?
A few more days went 177, two weeks, then three.
Marie was still waiting, still hoping;, but by this
the angry look had faded from her face; with the
fatalism of her race? she bowed for the time being to


the decree of fate; she conquered her impulses, per-
ceiving that she must patiently wait on chance. She
went about her ordinary duties as though the Great
House did not exist, and Ramsingh ceased to stab
her with his eyes in a quest for knowledge. Ramsingh
breathed freely again. He could understand anyone'a
disappointment at a change which meant a definite
pecuniary loss: now that his mind was partly re-
lieved he began to appreciate that disappointment.
He even wondered now and then if anything in his
attitude and behaviour had been the cause of their
ejection from a very lucrative post. With the fear
for his honour and his morbid jealousy somewhat
lulled, the loss to his pocket became poignant. It
Legan to afflict him like a cancer. H-e could not cease
to think of it.
Then to him, one morning, came a message from
Mr. Norris; he was to come up to the Great House
at noon that day. He said nothing about this to
Marie, but obeyed' the summons.
Morley could do with a few more East Indian
workers, Arthur said to him; and Arthur had
just learnt that, s ngato the 1spresado of tPan man les
distant, the labour force there was to be decreased.
There were a dozen coolies on Clifton Castle who
would therefore be available for employment. It
might be a good thing to hire them for Morley, but
a man who knew good workers would be needed to
se mhemoand make prelimina~ryearra gbements with
"Well, Sabib, re lie dthe East Indian, delighted
at these people, but that would hardly do, Mahara-
jah; they would get too stuck up if I did, and demand
impossible wages. And you know your own people
better than anyone else on Morley. What do you,
thinou better not go, Sahib; it wouldn't do. I
will go, quietlike, and hear what them say. I will
tell them I trying to get them work on Morley. That
is the best way."
"Absolutely. When can you go?"
"To-morrow will do, Sahib?"
"Yes. Do the best you can for me."
Ramsingh told his wife of his mission; he would
set off early on the morrow and be back some time
during the day after the next. A couple of days
should suffice for what had to be done.
Marie affected unconcern to hide the sudden joy
that surged up in her heart. Did Mr. Norris really
need these labourers? Or was this but a ruse to get


L. AN T ONSANVT I




































































~ ~~ ~I~ ~ ~ ~. ~ ~I.~~.~ ~ ~. r, ~ ~ ~ ~ ~ ~ ~~~~1~~~~ ~ ~~ ~ ~. ~. ~1~ ~. ~ ~. ,,.,.,..,.,,,.,.,., ,.,,. ~
i


19:31-32


PL AN1TER S' PI' CH


s;ine het had .sent her awayv. She linow Rstated there.
allurine as always. anld they~ We~F 1re do. If' he had
Smlis ed her half us miuchi as she- had missed iim.
Sure~l' Ilie wals certainly .f a web~ll. me.
Y...I1'" hie exclaimel.
Shet n..rddeal her hlead and tlrewr nearer. Shte sand
on her-r knec Ileside th~e low rhair.
Youl dion [ miss mie all this timie?" 4he miurmiur-
ed. "I fee-l ;a:.metimesj~ thot I woiuld( rather die thian
.go, .no liiing like this. w~itnfat yoJu.'
Y1.II ;II..ldnl't ha\e comne." lie aonswered; but
evern w- lie spr..ktt he patted lie~r head genitly. and she
tanitfi hiis handi~ ind k~issed it. He~ hadl hadi nc ult-
er....r ol.;ses inl s-ending Rumm~inelh ntt i f thle prn~lert?,
had e~Fpe..te un. limit fr..mn illarle: brut she was hecre.
anti her1 pr..xsimit\- was \er. pliaSanlt: it SFneeme t=>

to~uc11. 11 nI IeCpe h~atl inricll~c been t.-rrib~le. c'he- had
ap~pearrcd ;ilently. Ilke a .-lindrawu .. Lil~e a ishadow h
she -III'P.pd awayF ri-out hllure lattr beF'lie !Ith suI1

AnIi~ earlr the nexst m. mil~e. helr.re thle dawn
hadl riii-tei~ l el e halaless ..f dai~rknes whliic shrei~udetl

carliter of r~iper- (<= ther Diant,]ri.u., hall Iegun to p.

again isliplln n.ut ..i thle G~rrst II..=11 inc tr.m AIrthur a pre-mislle to r I~emplle.) hetr antI
hel Inchainal11 Iin Ilth ir. ..d p..siti .n-, ha\-i ine n...n what


t~nri. .he wentism l tsl? nthe vl'la~! c limful~ of- js.=.\.




hcurram -lie( A-- a m n -u in n te ltl iie


r.....m. a !ri Rlid I lecr ?en.: l jmp burine ..n11 the


taLs 1. O w il h e wr....l She hal~lledI.II Iiiarriedj. ll


th.=urht be miimit -triker h-r. be Illokedd it.. unlv. ~ut
'Ihe fll th Ir would be at leastr his manclh in phrsical
trength and hlis L:uperiorlt in c~..ura;ge;. Sie mer h1I
Pre boldl?. fulriously: hle could emilre and finid out
r\halt hie linked. Shle w'..auld oul~tface~ hIm re thille laqt.
As ar maittr ,f fact. cn he~r waya to the G;reat
H-.ui- In ( night. she had sto)pped rnI -nylare ifter

mn11 c~n nrl:lorle.. MiIn wasr mel..mentl?- expecting a
hab\. aniti ihe hadl remlainetd rbere for c~me time. f~r~r
Inoth1I'er se no~r A~rthur swished any..~ne t.1 see- her
9mail ;,. rjir- (;reat H..use ~henl ,he hlad noI reg~ular
I~u-.int -t 1.. rakie li1IIr thre Sr.~ If Ranlillngh dlid ..-n
iaiuir;. he w..ulld be tild that she~ hadt been .virlh
thle sleie at31 w...man: IIInly if h1e p~CBree hlis inqijSi-

notd taedEl at lure'. Cellitchll?' U ll nlight. anid lis in-

he~r threlr-lic hal:1 left bef..ire -he did--nor hlr.
Crutallly. whrllnm Riimsilyll would never be allowedtl r~
Qule-ltill jus~t nnow Fori thi present. Hlir. ehe felt that
il1i wasl -afe. But shle dild n,-,t feel he w.~.uld ~e
abhle ~I~to blerate him \cery mluch Ilonger.
Itamani chil I..ntrr.Iled hiimelf wiltls a miehty
tOff..rr If' he trucki her. 11 bie; even sP..ke what it
u'd inl his mindl !.: pe~ak, threi~ic wuldl 15@ an awf~ul
scene jln iI allbe \illage wo~-uldJ presentrly Le a WHI-
I10=< ..1 it: Jind it mnieht just haippcn that sher hadr
poken the trulthl. Indeed. be dliil Inot ee hoiw jhe
er..uld hav1\e da~rtdtl b e about thle n..maln w~ith the
1.3h!'. know~iing as she must how~ east it un~uld h~e f..r




theLa.auhng re~k s .1..rey.He wo~~uldl please Iris
jobl. AIlcn w-ubi~ll baret him. and no: onle aoubl l~
wirsh tb I.1 D nlple~! mentn to~. na u man wh.hllc +..~ fr n
t..Igottl ers hln-ims l; asL a.sus. Uinin IV?. a 1.1? whlite

rinl ..111. rina~lll-. the triut







St.l~tl Mary i hit unfe ha bir-en~~t wlit tciher Ralll. ant he
had nearI1IIliy bean Dosll fo:re hris ienaili- igeto.


he I.ould change91 his plani andI return to~ hlnrler soocner
than he was~ expeCctd. arl might hllr. Noirris have donelt
...nai (1 .rmer 11ciasion.1 He had burrTied back andl had
arturdl- friunal Ilane~ outi at that dasrk hour ofr the
rn.;rnine He hadi arrived bur a coulpler of miniutes
her..re~ her return: hld he no~t e.=mne in ju1t then he
wo.ubli hia\e et I.ff ti rlbe G~reat Hoiuse to prow~al nbout
and spy
Antl is n. I~e would wa~cit a f~eu ll hours. and he
n..ubiI Ji-cove r the truth.
lallait waited a whlile to- see wh~lat he~ would do:,
rhen~i rki~unced away'. She miust hav\ e a talk w~irit !Ur.
rN.rrls a little later IsI. She maiin ~R. tc. Mlr. C'rutlch-

clit folk ..fe e ulstantial farmer t?pe. wou~lld w.:.nde~r
abr Raniingh houhi h-e questinning~ Ipeople about
her~i. She muust cnliit their sympathie~ls by tlling

all.ne hr s.. nte Ibery.They woulldd symnpath~ie
w~ith lier anti ~n*uid sendt hiim awayv witb a inr in
bla crr lii~uldl hc \rinturet ti. ask thiem an\tE'le abri-ut
h~er nameme~lnts Thle. themslelve rnjll?ed ntreal11...t
anel1 -1he knlew- that they~r reYgalrded~ with a ;s..rr of~

n1..i1\nI IIf h E-rl Indi1an1 it sinen~ li\pd.

CHAPTER FIFTEEN

V ERYl .-ally thatr ntrl~nine Ram-inhel ro~dr. c~n thea

nit tht winner iidt; .=th e1 roast which tn!rmel rone of
lile ir.llunldaris .f It Mll..rley illerie wannrted tr. be rhere

--w altll.~\r n.w e f.=r~Lesa her pro-ljlable nlir.Lementa. But

-aCi i r...-nouire hi~..w the Ri.k mamanll nwo andJ whether

".1, thait lie ~a, eniialiirin r t~..r hiis wltFe. wh.~.. hie



a.,*iw Rali-in~li y. Innad bi~iee thr ll.t diaC'U~lr n iat.
Chli i \n lt :hly hunslf came our I'imiil ndlC Ithankied



himfo bl ifer crutaliTy was.:~t~ pr!'epain to go


~54 KING SzTR~EET &s SG~ BARRY~ ST'REET,

KINGSTON









Conanlliission & Insutrance Agents, Sugrar- & Produtce


Brok~ers.







I ~~~E STAB LI SH ED 1 91 0.










A~. S. BRY`DEN &C SiONS, H~arbados &~ Trinidad.


B RYDI~EN J


& EVELYN,








The Close of Another Year Finds Kielly's Still Supreme


G~ranade Reserve, ~White Label, Pineapple,
Gold Seal, WNhite Ship, Blue Funnel, als~o
Planter's Puncht arnd% Milk Punch.


Products of THE KINGSTON LIQUOR STORES, LTD.
Wine & Spirit Merchants, 90-92 Harbour St., Kinston, Ja.


PLANTER S' PU XTCH


1931-32


P |



I~I


to the coming year to bring increased prosperity
again,
In such a changing world how good it is to find
somethmg unchanging. .. something depend-
able and constant, the enjoyment of which a
man can look forward to without misgivings.
Such is the wonderful quality of


The past twelve months have brought many
changes, and with them disappointments and
triumphs in every walk of life. ... Thrones
have fallen and new governments arisen; busi-
ness ventures have smashed and world-wide de-
pression has made itself felt, In Jamaica we
have had our share of hard times and we look


K ELL Y'S

JAMAICA


RUMS,


OLD





1. .


Sole Distaibutors For:


Tyson & Co., Ltd.
Revolver Brand

Soap



Pansy Condensed

Milk





''Fabshang" water
white K~erosene
Oil.


I I


1931-32 -


PL .-1 N'TER S" PL~CNCH


89.~


Mari sen'I~~ t in t [b RdU1linl dine re~ sil:hm
We'll, wha1t bingslle ?..u htre ;again e, s..cnn?" he
;like I lishtll.. tlien he taughtli si hr ofI the tense f'ace
;rnd f1tetlingi oft :Mlprlcr llljnsiI. seized himi.

14e oik mF wrhere~ I u~n- all thle nchill I tnlhi himr
Rj..
all. : al..


..8.11 therre mu-r have I~rcin a laur e and other'



th.! ni. I mc.ie fr..ring hre~ t... bwiie theme Raining
I hni nk l~a. it g..ne lred Itr 11F ..illd b\e niet irsk~t Iin


(hance."
.. a ;Isandal"
..He iun'r prove I Ra.3 Iiere 13-t nich n.. as!u
.Raw me Then Malls is be to ~ -a-? He I:ou~ldln't dare
-ay I w s ill yo sp. ialy f I.in.V it He :an
onl' EIusPes1. andl that ILothn imatter. He been us-
pectllne a I~nny rimec.
..nhel ut !oul neter -511 llrtl atng abnutt that
to me Y..~ kep ( iiuly~ worrry 1..ilrse~lf' ajboutl notin g.. I te~l )ll you now
I~erau11-e Ranisingh is mor-~le suspilcionls thanu b~efore.
But ?.10u can put a wr**D 1. evertingtlin
--1 wrish .1..8 nW.ulll tell m-- how~r." .aid Arthulr hiit-
tel Ie fe~l dizimaye~id at thi miiserablel turni c.(
**Di~iischrg Rant~ingi~h ThnIillaehm.
HIIt rl e hlere as ?our housekeeper.II~ Thecre 14 D~:lbing

.Ptll it inl Ili: pipey and .nmo:ke It. 1-h' o a
trllkinie ni...nsen e' Howr cs n I dlis itanrei a mnii f.:.r
I hadc- -.eut him Irway? H..w woulld rbal loseek? Be-


1-. 111 Perhap tLush 't kn..wi thalt~:! 1ie "it A;n





I~~~~~~~~ ]tU [ ll l1 .ue tiW
1 h l 5 .n t ..u t I R n -i al ...I w n
him i e :.k in e e a .. p .m -d e ls
n lIt ..n11 n..M.I.i Indl the;\n ..ffer. hIime a big


Enquiries Solicited
or throuah


Direct


T Cu ad T L p

in ~ ( .ntt huf Iss~ oniild Pt 9)nK ifha~e h

state? he clr~uldl harldly' put a lir-ect qlue -tic~.n
"My1~ wif'e .tny\ Ilng Iliere Ilast nI/ht.'
"'She was7 \er' leind tr. .:s.=me. said Cru'ltchlI.
t"Tel her \e hop~re "Afte~r sitting up:1 alcl igt .dlr veLry lireal I.:l.day," l
continued Rms isngb.
'iOh. ne don't expjc t her Illtj!..-d aid Crutchlr.
nieht m.,veme~nts and dliil noit grasp that thi~ lst

Then1 R:mI;IInChI 9?C eyes trellledt inlti the inleriosr
sick nw..man'i 111husb d somed. andl he nloriredl Dr.
Cro~sely -tanding there. Thie <1...
ward and Interrulpted thle .nnversathan ti ~a! a wo~rsI
..r twor to ('rutrlhlr, and HRsusiighi was iiblieed to>
withdraw. But be Ilunvered rnu!idee until Dr'. C~rnneby
came olut, thien timidlls. ret \\ifl h st DulTrp.-le. ap-
Coachhed the do~c!tor h; the Iltter was abou~lt 0I.. ge
He defer~renialls 1-ade thi- d...tor grated ny.Ining:
le was~ briErly answerrd He ri'Oj.d a detainiinr hanld
"W'ell, m!y FIIIee feI.I~l l,. do you an t tr.. see me?
Anybody silck?
an'8~ [j~ltala(.e 1n in ne w~ife was~ here la t night
''l'ell. tlid thati harm her~"
her baby! i thli- morrning."
""Andt yes~u base; heardl. But yo:ur' wife mlust have
tolld you1 the\' were ciric.In \'ery? well. 11bat are yo~u
anxzious about."
"Y..u~ 1~.....k as~ If \l.lu were.' returnedl Dr. Cro~seby,
granting at Rainsingll l~i more cui:usl thani bief..re.
"You Iraik tro~ubled. W\ell. there i, nothing oe wn:.rry
about; y...u ma?- tell !'11ur wrife tha~t.'
The doc:~~~ t..r dra~e away?, altl Rame~ingh tr..[ted .~t..f
knowing thor any' Illrtherl Ilngrinel in thle \-isinity

ing sat...ut water hailur b~eri t...Isl that IIlr4 Criurchly
and her hahJ\ W'el'e (Jr.ll tl\ \ 1Ur Rut 10e WHS Ill.if
saristibr h e.isishd aeldsyse il
night. \'rt he liadi Isrr nasked Ilhrectly~ If' e lIall b-een.
and InI an.\ Iue hie kinri thal ther dl...ctor a.=uld n't
questhe~n In rlCIts nicatimet 110 must goI about lii3

the \'illage`. andl f..unld that llarnis- wasu nior in tle
house.

was all earl.! Ileerl: she \\alli d l ul klyIII\ to: thet Gricl ~l
H 9i~, t 1 nc rlie Ii ie 0~t Iintinc Ranin ri 11 ehir ,
since thast was~ ort merely~l thle nlyu\. but prs~:.baly3? tle


AUGUST ASCHER SOHN
















EX PORT ERS

----AN D---

IMPORT'EIRS





Speiailil0 ill 110 811pply 01.

IlallelWare, Cl~aSSWal'6,

Chmna, Earthenware, Cut-



Household Articles.







TilS, Bat S, Sanitary Fit-

tingS and all Articles for

Builders and Contractors.



ALSO

Labels, Crown Corks,

Bottles, Capsules and all

materials for Mineral

Wa~rter Factories and

Breweries.


YEUNHING FAHSHANG 00, LTD.

MANUFACTURERS' REPRESENT NATIVES






General Importers

and

WhZolesale Pr~ovision









35- 6 37 P V YCSS S7REET.


GEORGE &- BRAEHA

MIENTS ?011R JAMAICA,

5 ~ ~ *OTRYLSTIGT







































~~'OHO E M DERDN aP 1 C





MODERN EQUIHPMENT


WVe are speciaists in ofiie furnishing and

Supplies .

Below we list a few of the items for the

making of modern office efficiency .

1. AI1R MAIL PAPER-British Manufacture.

2. BURROUGHS ADDING MACH-INES,
Portable and other makes to suit every type of busineSS.

3. "'ROYAL" TYPEWRITERS-T~he world's leading make,
Embodying the revolutionary segment shift feature.

4. "CROWN\" BRAND, CARBON PAPER & TYPEWRITER
RIBBONS, for every make of machine.

5. DESKS--of steel and wood, for the official and the typist.

t;. STEEL FILING CABINETS & CARD TRAYS, TRANSFER
CASES, SAFEGUARD DESK. FILES.
7. DUPLICATING M/ACH-INES.
A modern necessity for the printing of your circular letters
at a minimum of cost and time.

8. GUIDES, CABINET FOLDERS, CECURE FOLDERS,
LETTER FILES.

9. VISIBLE INDEX CABINETS.

The latest method of maintaining hand posted card re-
cords--every entry at a glance!

10. DUPLICATING PAPER--light sheets in white, pink, yellow.

11. STEEL STORAGE CABINETS--for the storage of almost
anything.
12. MIARCHANT PORTABLE CALCULATORS,
The greatest calculating machine with a figuring perform-
ance that is 100%o accurate. It will add, subtract, mul-
tiply or divide. The machine does all the mental work; you
merely move the levers.


See us for fitting out your office in? good style.
'Phon~e 2761.

OCFfice Appliances Department.

T. G"EDDES GRANT, LTD.

141 Harbour Street.


cept exposure by herself? But suppose Rainsingh
refused? What then would Ramsingh do?
A scene? Separation? Divorce? Did thges
things threaten? But the East Indian loved money.
That was his ruling passion, his besetting sin. Well,
if money could save the situation it would be poured
out freely enough.
At about one o'clock Dr. Croseby dropped in,
"for a spot of lunch," he said. The doctor had many
patients in this neighbourhood, and no fewer than ,
three childbirth cases to attend to just now. As the
District Medical Officer, with a Government subsidy,
his services were in wide demand; he was an efficient
practitioner too and was liked for his genial matn-
ner and the interest he showed in his patients. He
was Arthur's doctor; but above all, he was a friend'
of Arthur's and an old croney of Mr. Pemberton's.
He could come and go at Morley and Mapleton as he
pleased. .Ae
The two men went to lunch; Arthur much pre-
occupied, as Dr. Croseby observed. But the doctor
said nothing. Arthur, too, had not only a cocktail,
in which the doctor would not indulge, but three
wfhiskies to Dr. Croseby's one. Arthur was usualiv
abstemious in working hours. Of a surety, thought
Dr. Croseby, something must be the matter.
Lunch over, a servant came in to tell Mr. Norris
that Ramsingfh had returned as instructed and was
waiting to be seen. Arthur thought ;1 moment, won-
diered whether he should see this man in his office
but decided that he might come to the dining room.
The doctor offered to go, but Arthur, hospitably,
would not hear of it. Only a little matter of business.
he said; it would be over in a few minutes.
Ramsingh, after all, would not dare to make any
rash accusations on the strength of a mere suspicion,
thought Arthur, to whom the whisky imbibed had
afforded resolution.

(fo::h ha e jyed i lnc)"wa s eome
the pretty coolie girl who was here some time ago?'
"She left for a while, but I am thinkiilg of get-
ting her and her husband back," said Arthur. "Ram-
singh is the husband, you know."
Ramsingh came in. The doctor knew him for-
the man who had been around the Crutchly's cot--
tage that morning, making enquiries. He was dress--
ed as he hadabee nalie- r in fhed :koho i~ trous
jacket, under which showed plainly a scarlet shirt..
He held a broad-rimmed jippi-jappa hat in his hand.
His manner was respectful, but morose. He seemed'
Under some sort of tension. There was a look about-
his eyes which caused the doctor to stare at them~
curiously. Dr. Croseby also noticed that Ramsingh's
hade eold wistchin. He had been to Clifton Cas-

tle eheth dt seethe overseer th 1 end h~ad been al-
be available for employment at Morley at any time
now. And they would be willing to accept the wages-
usually paid at Morney.
"A very good piece of work, Ramsingh," said
A~rthur, with an effort at warm appreciation. "You
must charge your expenses at the end' of the week,.
and we must make you a little present. You have done
splendidly. I am going to give you twenty pounds
fourth jo."(Continued on Page 93)




Deal with


KWLBONG YEE TAI &i 01

135-137 HARRY STR'EET',
KIN GS TON.




General Importers of

English, American,

and Chmnese Groceries,

Patent Medicines Etc.


LOwest PTices

an~d

High Quaily M2erchandise.

Give us at trial and be convinecd:

? PHON'E 3062.


1931-32


PLANTER S' PUNCH


if I have to ask Sampson to come here. You can
go with him, and then he will have no further rea-
son for suspicion. That seems to me to be the best
way."
"You mean you would send me away from here?"
"I wouldn't put it like that, but-"
"It means the same thing."
"Well, but a
"I won't go
"Won't go "
"No; if you treat me badly again I will refuse
to go with Ramsingh. But I will tell him openly
that you an' me--you know .. Then he may leave
me, and I will look after myself: I can go back to
me father. But he will know, an' everybody else will
know, and I won't care. I love you. And I am not
giving you up so easy."
He stared at her stupefied. Yet even as he did
so it came to him that she was acting as he ought
to have expected her to act; for this attitude was
of a piece with her disposition, was the stand which
he should have known she might take at any moment.
She had gone away quietly some weeks ago, very
quietly. But that was because she believed he would
take her back. Now that he proposed an end for-
ever to their relations and her departure from the


plantation, she was rebelling and' was prepared to
fight. She was quite fearless, regardless of conse-
quences. It came to his mind that there was much
of the tigress in her, the tigress which stalked
through the jungles of the ancestral India she had
never seen, and which could be so merciless in at-
tack.
"Hire Ramsingh up here again," he heard her
saying, as he stared in mingled wrath and perplexity
at her. "Pay him well. He believe I am his, proper-
ty, so he will want money for me. He is a poor,
worthless beast!"
So she turned and left him, a prey to indescrib-
able emotions.
He went into his office but could concentrate
his mind on nothing. He told himself that the sor,
did crisis he had always feared had come at last.
An hour or so afterwards he was told that Ram-
singh had returned from Clifton Castle and wished
to see him. He sent out to say that Ramsingh must
come back later; after lunch, about two o'clock: he
could not see him now. H-e knew he would have to
face the probably infuriated East Indian, but there
was time enough for that. Meanwhile he must try
to think out something. But what was there save
Marie's cynical and even revolting plan? And what
wvas the alternative to the adoption of that plan ex-






Th~Le Homre of


Ir ~~I*r 1

--- -i ; i---i~:


-- -------- I
I ,,


1931-32


PLANTER S' PUNCHli


PA RK LO DG E FA CTO RY


OFFICE AND RETAIL STORE


B. &r J.


TO BAC CO


C:O MPANY,


Ktingstonr Jlamaica, B.W7.I.


G-olofiana


and ER ITsapical

ica cCig ar s


Jarman


B. MAZCHEADO


LIMITED,





4 E~STAB~ISHE;D 1 825 "

RU~M BL END ERS (
WINE ANO SPIRIT MERCHANTS

22i-28 PORT RO;YAIL STREET,
KINGSTOBN, JAMZAICA, B. W.I[.


1,000,000 CALLONS


II


1931-32


PL A NTER S' PUNCH


CABLE a ADDRESS:
NEPHE1V, JAMAICA


WVO RL D


F AMU n J


JAMAICA


RUM3r/I


OF ALL- AGES
ARE STORED IN OU~IR PRIVAT E TVAREHOJS ES


GOVERNM ENT


BOND


UNDER


RESER VE


BLACK


SEAL


SPECIAL


APPLEMIONY
GREEN SEAL
BOOTLEGGER
ROYAL ROSE


VERY SPECIAL


OLD


THREE DAGGER
TWO DAGGER
ONE DAGGER


GOrLDEN STAG


ON APPt~LI~CATJION~


SCAMPLB~ES


AND QUOTATIONS


NEPs~E~s


OF THE


Our Specialties Are Bottled Under The Following Brands:


BULK RUMVS FOR IMVMEDIATE DELIVERY IN ANY QUANTITY












Phone 2740 W. SHIM CHUN
cable Address: Managing Partner.
MANCHUNTON, JAMAICA.
codes Used:
A.B.C. 5th & 6th EDITIONS
BENTLEY'S.


RNIANN CHUNG TONG & CO.


120-122 BARRY STREET, KINGSTON, JAMAICA, B.W.I.
ESTABLISHED 1902.


Our IVotto is Plain and Straight.
Reference:-The Bankl of Nova Scotia, Kingston, Jamaica
and information rnay be obtained at the Banksr in the
Principal Cities.
RE~PRESENT:

THE-~ MIDTLANUD FLOUR. MILLING CO. THE M\AN~ITOBaFLOUR~ MILLS, LTD.
KiANSAS CITY, BlO. U.S.A. NEWC YOglK CITY, U.S.A.


FL ETCHERf & CO., LTD.


IMPORTERS : MNE BAY', EXPORTERS :
JAMAICA,
OILS, WAX,
EB.VV.I.
PAINTS, GINGER,
LUMBER, COCOANUTS,
FENCING' GNS-AMIABNN PRODUCERS' BITTERWOOD,

ROOFING, AND ALL
ASSOCIATION LTD.
GASOLENE, JAMAICA
FISH-STUFFS, PRODUCE.






MERCHANTS. COIMIaSSION AGENTS, WHARF OWNERS. INSURANCE.

RADIO:- SETS, PARTS. SERVICE.


;SPECIALISTS INtSUPPLIES AND MATERIALS FOR ALL

BUILDING PURPOSES.


PLANTER S' PUNCHI


THE NEWFOUNDLAiN D PROUCEi:CO. LTD.
CjT. JOHINS, R'EWFOUNDI/'AND.
FISH 1' XPOR1TERS.


THE CALGARY M[ILLING CO.
JIONTR1EAL, CAhNADA.


CANADA TEA CO, LITD.
HALIFAX, N. S., CAN~ADA.


FOREIGN FIRMS SOLICIT ED.


else, you would be severely punished by a judge if he
knew you had been using ganga?"
"I don't use no ganga, Doctor," replied Ram-
singh s r 11 a liar. You have been smoking it for
some time. Now I warn you, stop it. Do you hear?
Stop it."
Dr. Croseby waited for no answer, but returned
to Arthur, whose manner now uwas very different from
what it had been an hour before. Arthur looked like
one from whose shoulders a grievous burden had been
miraculously removed. The doctor it was who looked
grim and thoughtful.

CHAPTER SIXTEEN

Twas about a week after Gladys and Mr. Pember-
ton had' paid their visit to Mlorley, with Mr. James
Cuthbert, that Lady Mugsley came to spend a few

doe aitmM beoeb the Pe b rst ns, dheb d harl
expected' an acceptance but had thought the chance
`well worth taking. The Governor's wife, however,
who sincerely liked Gladys, had written to say that,
if convenient to the Pembertons, she would be able
to go to stay with them for about a week. She had
never spent so long a time in anybody's house in
the colony; naturally, therefore, this visit wasJ con-


"Yes, Sahib."
"Then when canl you and Marie take charge?
You will have, of course, to remove again from the
village into the cottage near here. Your old cot-
tage. It is still untenanted.
"We can come whenever you want, Sahib."
"To-morrow, then. You can borrow one of the
trucks to remove your things.
"Thank you, Sahib.
The man bowed and went out, stolidly, not show-
ing any joy at his better pecuniary prospects. He
was already down the steps when Dr. Croseby said
suddenly--
"I want to say something to Ramsingh, Arthur.
Just a word. Will you excuse me?"`
He did not wait for the reply, but walked quick-
ly after the East Indian, overtaking him in a minute.
"Look here, Ramlsingh," he said quietly, staring
into the East Indianz'd eyes, "don't you. know .that
ganga will drive you mad?" <
"Ganga, Doctor? There was a note of fear in
Ramsingh's voice. "I don't know nothing about it.
"You can't lie to me, Ramsingh; I know too
much about you people to be deceived by you in this
---nd too much about ganga too. You have been
smoking to-day; I can see it in your eyes. Stop it.
You know, I Suppose,, that, apart from everything


..,1931-32


'The Cup and The Lip
(Continu~ed from, Page 90)
Dr. Croseby lifted his eyebrows. This was gen-
erosity indeed. Ordinarily such work as the .East
Indian had done would be considered as part of his
regularly remunerated duties'. What could be the
matt m gh's uy 6l1 uwdtl for a moment, "Thank
you very much, Sahib," he said, "you very kind."

handshe "hoe en ds Cr ei lyh sow up e, Dohetor?
he asked, though this wvas not the place for such
personal enquiries.
"As she was when you asked this morning, Ram-
singh," said the doctor: "did you expect any change?"
"No, sir; my wife was there with her all night
last night .the whole night ..
"Yes ?',
"You, too, Doctor; my wife see you .'
"I do not usually remain all night with my pa-
tients," said the doctor coldly;. "as for your wife,
she-"
He paused suddenly. This man, it was now so
evident, was seeking for information about his wife's
whereabouts last night, while seemingly making as-
sertions. JIt was all quite clear: but why this me-
thod? The doctor noticed that Ramsingh was gaz-
ing furtively at Arthur; he noticed constraint in
Arthur's countenance. Was Marie Ramsingh reallY
at Mrs. Crutchly's during all last night? He knew
that the nurse had been, and another woman, they
were there now. And if Marie Ramsingh had been
there also, surely he would have heard of it. He saw;
he saw everything plainly. And he felt that he must
speak in such a way as to dissipate the man's dan-
gerous doubts.
"As for your wife," he resumed deliberately,
"she mustn't let her sympathy and kindness deprive
her of the rest that she may need. Tell her not to sit
up again all night with a sick person unless she ab-
solutely must-; tell he?. I say so. She had better get
aeWhorsas ttalok dae ret that he saw on the East
Indian's face? The doctor hoped so. He hoped the
incident of Marie's whereabouts last night was now
clsethur seemed relieved also, distinctly. Dr.
Cr~oseby had apparently confirmed Marie's explana-
tion as to where she had been last night, and who
would dare question his word? Arthur's spirits
rose, then fell immediately as he remembered that
M\arie had resolved that she would not leave Morley;
more, he believed she would come again to the Great
House as she had done on this occasion. Well, there
was one way out, her Gwn plan. If Ramsingh should
refuse his offer of reinstatement as majordomo, events
would have to take their course. If he accepted,
that would demonstrate that there was no trouble to
be expected from him, no trouble, that is, that money
could not meet. It would have come, practically, to
the buying and selling of a woman--a miserable
business. It made him, as purchaser, feel contempt-
ible.
Arthur made up his mind to speak at once. This
was as good an opportunity as any, particularly as
Ramsingh had just completed a satisfactory piece of
work for the plantation and his reinstatement might
look like additional reward.
"See here, Maharajah," he said, casually as it
were, "you used to qterve me very well in this house,
Ind I miss your helg and Marie's now. As you see,
too, I haven't got a new manl and the servants are
doing what they like. Would you like to come back
to the Great House?''
"Me alone, Sahib ?"
"Well, both of you. If only one did I should still
have to get another person. Besides, you both work
well together."
"What do iMarie say, Sahib?"
"Marie? Why, I haven't asked her. You are the
one to decide, isn't it?",,

"S oI ~tink. I tahibyou what, Maharajah; I will
give you a pound a week more than I did, and I
will raise Marie's pay too. How is that?"
What in the devil's name was this? thought Dr.
Croseby. It was not payment; it was a bribe. Any-
one could see that. And again the doctor fixed his
eyes intently on Ramnsingh's face.
The East Indian, conscious of that scrutiny,
held down his head as it in thought. Arthur Waited
anxiously for his reply. Arthur felt deeply humiliat"
ed, like one forced to traffic in obscene things. He
knew he was bribing this avaricious little man, and
he was ashamed of that and of the reasons behind
the action: he was sure it couldn't last, this sordi
deception, this disgusting intrigue. He must end it,
he would, even if he bad to clear out of Morley and
sotoCanadahas he had lodce intended. That instan
the moment the situation must be met, the immediate
difficulty dealt with. Ramsingh, meanwhile, still
seemed to think.
At length-
"Thank you, Sahib," he said.
"You take the jobJ, then?" said Arthur, striving
to keep his voice from expressing jubilation.









spending some days at King's House, it was quite
evident that those persons not asked to a Pemberton
ball might be considered as not in the very inner
circle of society--a very terrible situation indeed.
Mr. and Mrs. Bezversham were sitting on their
verandah one Sunday afternoon, she with a novel in
her hand, he with a newspaper over which he glanced
casually. They knew one another's moods, did this
couple, and Mrs. Benatersham was well aware that
something was on her husband's mind which he
wanted to tell her, though hesitating as to how she
might take it. She waited patiently, for she knew
that he would' bring it out at length.
"Do you know who I saw in town yesterday?"
he said at last, laying down thle news sheet.
"No; who was it?"
"Pemberton. He had run up to K~ingston on a
little business. I met him near Barclays Bank in
Harbour Street."
"Well, and what had he to say for himself--you
spoke, I suppose?"
"Oh, yes; we always pass a word or two when
we meet" (the truth being that of late Mr. Beaver-
.sham never neglected to have a conversation with
his erstwhile friend whenever they were within
speaking distance of one another). &
"And I suppose he was full of Lady Mugsley and
her visit to Mapleton; bored you to death with it?"
"He was full of it, of course; you know what a
snob Pemberton is. But I dilln't mind' listening to
him, for, after all, for over twenty years before this
woman came we were friends. I used to like him
immensely, and he was very fond of you too. I must
say that I miss his company sometimes."
"Well, it wasn't our fault that we ceased being
friends."
"I know that; yet it is a pity that things should
have fallen out as they have. It only shows that you
can be certain of nothing in this world." His tone
suggested that the occurrence of the unexpected con-
stituted for him a serious grievance against fate or
nature or whatever it might be that controlled events.
"No, you can be certain of nothing," agreed his
wife; "I have noticed that all my life. Did Alfred
say anything about his wife?"
Only that she wvas quite well and~would be up
here next week. I said that the change would do
her good."


The Growth of a Bucsmess
netermines ats competenCg
to Ser *
The increased business we are
doing to-day proves conclusive-
ly that Ladies prefer to shop
in privacy, and men have al-
ways shewrn a distinct prefe-
ence to shop at a Mlan's Shopi.


U


S3egg, ~roton'd Rnesiautaat
95 BARRY ST. (upstairs)

HOME MADE

P~ork Pres and Sausages top Ord~er

Public and Private Dinner-Parties Catered for


Cutlery, Linen, Etc., for Hire.
5. ........................... ....,,,*0**m un a...as.........n.......ses....n.o1n..m mm n ou..............,..,,,,,,s


PLANTER S' PUNCH I


sidered a high honour and a notable social distine-
tion. It was chronicled in the papers. It was com-
mented upon in various social circles; in some of
these, with remarkable bitterness. A
Lady Mugsley and Sir Arthur had been in the
colony just a little under two years; perhaps that was
why, said' the critics, Sir Arthur had not yet found
out that Mr. Pemberton was a fool. These persons
forgot that Mr. Pemlberton and the Governor met
fairly often in the Privy Council, where Mr. Pem-
berton's usual agreement with His Excellency could
not possibly be interpreted by the latter as rank
folly. As for Lady Mugsley, though she felt that a
Governor's wife should not show preferences defin-
itely, she was of a sufficiently independent disposi-
tion to please herself as to how she should spend her
holidays. So to the Pembertons she went.
She passed' a pleasant week with them, dur-
ing which time Mr. Pemberton and Gladys were too
much occupied, and, if the truth must be told, too
exalted, to give much thought to Arthur and his
affairs. Had they been on good terms with Arthur,
he would of course have been invited; as it was,
they held no communication with him. Btit a few
distinguished persons were invited to meet Lady
Mugsley at Mapleton, and picnics and excursions
were arranged, and the island heard of these through
newspaper correspondents. Mr. Pemberton began to
look years sprightlier. Nothing was such a tonic to
him as close association with the great,
Inevitably the B3eavershams heard of these
things, and Mrs. Beaversham pondered them in her
heart. They kept Mr. Beavorsham awake at nights
too, he could not help thinking about them. What
puzzled Hazel was that in none of the accounts of
the entertainments given by the Pembertons was
Arthur's name ever mentioned. This seemed to in-
dicate that, as her father and mother had so plainly
stated to her, Arthur was now definitely down and
out. She fblt sorry for him, but she did not allow
his downfall to worry her greatly.
Lady Mugsley left Mapleton and returned to
Kingston; and the report went about that the Pem-
bertons would very shortly be coming up to Delva
for a week or two. There they would receive their
guests, and of course there would be a dance for
the young people. A4nd now that Lady Mugsley had
stayed with them, and Gladys might at any time be


"How did he take that?"
"You. mean .. ?"
"I mean, did he seem pleased at your showing
some interest in her? We have kept ourselves aloof
from them, you know, ever since I noticed that she
was inclined to be uppish. We were polite to them
after their marriage: I always made it a point to
bow to her when we met, and I would' have called
upon her but I saw she was giving herself airs. Then
I dropped her, of course."
There was a note of injury in Mrs. Beaversham's
voice; .she spoke as a person who had tried to be
kind' to some erring one who was not quite worthy,
and had only been rudely treated for her pains.
"You have to make allowances, my dear," mur-
mured Mr. Beaversham sympathetically; "the poor
young woman never had many advantages. There
are people you must forgive, you know; after all,
forgiveness is a divine injunction."
"But does she look or speak as if she wanted'
our forgiveness; does Alfred give any suggestion of
that ?"
The question was asked with some eagerness.
Mrs. Beaversham's manner suggested one who was
bursting with a desire to forgive her enemies, or,
rather, one particular enemy, and to forget every-
thing that had occurred, even to the point of den;-
ing that anything unpleasant had ever occurred.
"'Well, you could hardly expect him to say any-
thing; remember, the woman is his wife. But he
was genuinely glad~ to see me, said how very seldom
we met now-a-days, and all that sort of thing. That,
I think, shows a great deal."
It was quite true that Mr. Pemberton had greet-
ed his former friend cordially. Mr. Pemberton was
feeling very cordial towards all men just then, was
full of peace and of goodwill to humanity. He did
enjoy meeting Beaversham: it wras something to re-
mark (Oh, quite casually) what an excellent woman
Lady Mugsley was, hlow simple and easily pleased,
and how she had forced Gladys to promise she would
go to King's House for a week in November. And
to this was added, naturally, that both the Pember-
tons would be in the Governor's party at the next
race meeting, and then Mr. Pemberton had' hinted
that Sir Arthur himself thought of going down to
Mapleton for a week-end shortly; which Sir Arthur
may have thought, though certainly he had men
tioned to no living person what was in his mind, a
circumstance proving that Mr Pemberton possessed
many of the qualities of a clairvoyant. Mr. Pember-
ton, in fact, had been so pleased to be able to boast
to Mr. Beaversham, and to show how easily the Bea-
vershams had been passed in the race for social suc-
cess, that he warmed towards Mr. Beaversham' and
actually felt towards him as in the days of old. He
pressed his hand' on leaving and called Beaversham,
"old fellow." His previous relations with Mr. Bea-
vershata had almost been resumed.
"He has come to his senses, has he? Well, I
hope his wife has," observed Mrs. Beaversham se-
Iverely.
"We must make allowances for her," insisted
Mr. Beaversham, repeating hisf generous observation
of a few minutes before. "She must have got used
to her position by now and become sensible. That
is why I don't think we should let her suffer for her
early folly. You can afford to be gracious, Arabella."
Mrs. Beaversham assumed an attitude of gra-
ciousness3. She became graciousness personified. Up-
Dermost in her mind at that moment was a picture
of the next Pemberton ball at Delva, at which the
Governor and his wife were certain to be present,
and all the leading persons in society--except the
few whom Gladys hated and would strive to hurt.
Amongst these the Beavershams occupied first place.
In such circumstances, surely a woman of the world
should be prepared to forgive and be gracious, not
seven times, but seventy times seven.
She did not deceive herself; it is a very difficult
matter to deceive oneself. But she strove to deceive
her husband as to some of her own acts and their
meaning, and he did precisely the same. These peo-
ple actually posed to one another, struck attitudes
of dignity or of injured innocence; they hardly ever
spoke outright about their conduct towards others
and their reasons for it. If they insulted other folk,
as they had insulted Gladys, they found an excuse
to give to one another, though together they had
previously plotted the affront: the fault was the other
person's, or there had been some misunderstanding,
ordsonehig a 7 boy el m gt be a nobeo

tect. Perhaps in this there was a striving after
the preservation of self-respect; this posturing to
one another may h~ve had its better side ill a desire
that each should not clearly admit to contemptible
actions even in the close privacy of their intimate
lives: maybe they wished to save their faces. But
it led to ludicrous lying, though the comic side of
such lying was never apparent to their own conscious-
ness.
"They will be at Delva very shortly," continued
Mr. Beaversham.

sot woould ers kind you were to canl formanly
(Continuedl on Page 97)


i


21 K'in St

DEVOTED

EXCLUSIVELY

TO IELAD E

APPAREL



HOUSEHOLD


GOiODS


25 K ing 1

THE

]E LUSIV


Ff r





BSOY p


FURIHIGSgy


1931-32


H


Et f






--


PLANTERS' PU17N CH


1931-30


Lay the foundation for smooth, silent motoring for a
long time to come by lubricating with "Standard"
Motor Oil.

Mlade from the world's finest crude oils, "Standard"
Motor Oil protects every moving part of your engine.
It sets up a protecting cushion of oil between all mov-
ing parts--shutting out friction and producing velvety
smoothness of performance. It makes motoring quieter,
pleasanter, and more economical.

Refill your crankcase with "Standard" M~otor Oil
every 500 miles--and prolong the useful life of your
car by many years.


A real foundation

flor brou~ble -free performance


"~Let this sigpn be your guide"


STCANDA~RD


West India Oil Company

" STA ND A RD" M OT OR OI L













SThe Jamaican Home


-- -- -


1931-32


PLANTER S' PUNCH


~ I


I)


34-38


of the ~J~ew Ford ear





.I:
Q_ ---"

r ~a~ie,




~ ~I
? I"-----
"-
~



t .
F'
ri~ I~-T~f~i~L~e~GP rr r -- 3.
'';-' '-
--------i rr
---- -
_
-"- .II,. -~. -;.~;i~;;;r~L~,"5ii111111~
---~~:9-U
.iri~l~~h~ K;ngston,
---- -~--- --- -;;~,~;c;~ ,r~l;~Y~Stfl~~3;~.~
-ii
;I ~
5~,
L:sl: -~
Jamaica,
ri r I
'P. .i;~;' ;c" ~:14-:4 ~~; ~i.~~_~~ ~" .
." .. I' .'~L~~-'h'l~srJ'
:n C r
3: :--~;r
~J7'FL*-U``- B.~I. I.
"''~"~ ~t~ .~
---l-a- ~-..~ ~ ..
rjr J ~K
r. y r. -*riC

TE-~E) K~NG~iTON IN;DU~TIK IAL


Th2e Recognised Headquarters


farnaica.


DEPOT FzOR THE SUPPLY OF
E V ERY TH I NG FO R THIrE M OT O RIST.


1. FORD M~OTOR C.4RS--The cars which fill every
requirement you can ask of a modern automobile at
the minimum first and subsequent cost.

2. FORD IMOTOR TRUCKS--Used everywhere in
Jamaica and the best to meet needs of every truck..
user in the Island.

3. LINCOLN MOTOR CARS--America's best.

4. GOODYEAR TIRES--which give you long, trouble-
free, economical mileage.


5. GOODYEAR TUBES--Built by latest scientific
methods, airtight and reliable.
6. GENUINE FORD BA TTERIES-MXIoderate in price
and like Ford Cars the best.
7. RA YBESTOS BRAKE LIN~LVG--Always ensure
safety.
8. CHAMnPION SPARK PLUGS--Never miss-fire.
9. HENRY WELLS' "GERM" PROCESS MO7TOILS
--In all grades. The best you can buy.
10. GASOLINE CONTINUOUS SERVICE.


Mlany Country Residents make it a Practice to
call and see us when they come to the city.
Weu hope you will jon their number and whether
you ivein Twn r Cuntry will frequently call at

THE KINGSTION INDUSTRIAiL


GARAGE,


Kingston, Jamaica.


34-38 Church Street,


For every M~otoring Require~pment including Repairs.


TH 1E H OUE B ll 3UI LT' BYP INr'T E G R I aTY


II
1

----
`~er~r~nr


i II


for Motorists in













4 KEinng St. ~HARDWARE~SI Store



A Few of our Specialties.


ATLAS "A4" WOOD PRESERVATIVTE

BURRELL'S "DODOINE" DISTEMPER

BURRELL S & SISSON's MIXED PAINTS

"GYPRoc" FIREPROOF WALL BOARD


WALL ED.
a ~~~ ~~~~"Q,"1go'BAR EMI-RO
y GENASCO LATITE SHINGLES

REMINGTON RPTNG. ARus
cv4~ CO'S PRODUCTS
B.S.A. GUNs & AIR RIFLES

SILVERWARE

REFRIGERATORS

LINOLEUMS

gh ENGINEERS)

go ~i ~ TILONTE s x'

METAL TILES



SHINGLES
~1 BLCK &DCKER"ELECTRIC
CYPRESS KL CEDAR TOOLS."


WINDOWS 'Q

SASHEs & DooRs a


REDWOOD 'P/OULDINGS

REDWOOD CORNICES & CEILINGS


REDWOOD BDs. & SCANTLINGS

PITCH PINE LUM~BER--ALL SIZES

WHITE PINE LUMBER


DOUGLAS FIR LUMBER--ALL SIZES

BOAT GRADE CYPRESs LUMBER





Marine Gardenms ]LUME Yard.


1931-32


PLANTER S" PUNCH


(Continued from Page 97,)
I:.0 t hem, you and Hazel; if you held out the olive
blnsut s oppose they were to refuse it?"
.1 shiver went through Mr. Beaversham, a shiver
I..( anguished apprehension. The same thought had
v.~. ..lrtedi to him. To have a Beaversham olive branch
leject:ed would be an insult hardly to be borne; and
.\st. Just possibly, the thing might happen. But he
thought down the idea; it suggested an inferiority
Is..niplex, which would be a disgrace to a family in
thr- !iabit of asserting its superiority. Besides, what
Iir v.lrth having is worth striving for, insult or no
iuiilt.
'They would' never dare," he laughed uneasily;
"1Ihe. are not tools."
\1rs. Beaversham detected the falseness of his
mistis;; yet she too felt that risks must be taken in
the- iscial world.
'I imagine not," she agreed. "Very well, I will
.all oln them when they are back at Delva. I can
neatr forget what close friends Alfred and you and
I iwere."
So when the Pembertons went back to Delva,
Lll 5. Beaversham and' Hazel, on the afternoon when
IGlast ls was "at home", formally called with cards
stil1 were ushered into the drawing room, where they
I1..und several old friends and acquaintances. Dr.
31luiLind, knowing well how the land lay, raised
-licillly interrogatory eyebrows and was secretly
anorled. Mrs. Smith-Parsley wondered if the Pem-
i..ert..us and Beavershams were going to be friends
~...ns.e more. Gladys was eminently polite, formally
i'. lirc, in a manner of speaking she was much too
p.-.Ille. She was genuinely surprised to see Mrs-
E arlersham and Hazel in her house, glad of it in a
\1 a1. for she did not for a moment imagine that
lbrhc\ could seriously think that they were recognizing
nll ad accepting her at long last. Indeed, she guessed
a ens ately the reason of this visit. Lady Mugsley
lhild much to do with it. And then, of course, there
rna, the ball.
It was Dr. Mayland who in the course of a
F:-ner'al conversation mentioned the ball; Gladys had
r...1. her that the invitations would be out in a day
..Irt o.
"'You are having a large crowd, Gladys?" asked
bl;is Mayland, who took the privilege of a close
trind to ask the question.
'About a hundred and fifty people, allowing for
th.:l1:r who won't be able to come."
"A big affair, and it's going to be very enjoyable;
aill 'iour parties are.',
Thanks, Jane. You will help me, I know, to
entertain."
"I will do my best, anything to be useful. As
I Iln...k like becoming an old maid, I had better begin
rt... devote my life to servicee"
--You are not going to be an old maid, unless
~,1I .. choose to be, and you are always serving other
people; I have never known you otherwise," laughed
CGiadys. "But I want you to dance and enjoy your-
telf, too, and not to be only a hostess at my dance."
She did not continue on the theme; every wo-
naln there knew that she would receive an invitation;
recerybody except the Beavershams. Truth to tell,
theyr~ had' not guessed that the invitations were going
t.. be sent out so .shortly; they felt uncomfortable on
hearing the news. It would look as if they had called
In; the hope of being invited, which happened to be
largely the truth. However, there was no help: for
it n*:.w; so they' made themselves as sociable as they
Iould in the circumstances, stayed for half an hour,
adll when they bade Gladys good-bye they pressed
her to come and see them soon. They showed by
thieir manner that they wished bye-gones to be bye-
grlanes, that they were anxious that the dead past
should11 not only be dead but obliterated. Gladys
thaniked them for their pressing invitation, while
tbink~ing it strange that people ~who were so per-
tec t in the ways of society should not have left it
to helr to return their call without so earnestly sug-
Retsting an early visit. She smiled as she perceived
that their desire to be friendly was as marked, and
as disgusting, as their former determination to be
rude.
A couple of days after this her invitations went
. ~ut. and none was received by the Beaversham;.
It was in the seclusion of their bedroom, after
w-aiting for three extra days to see it any invitation
w~as Coming, that Mrs. Beaversham said to her hus-
harnd:
"I see that that shopkeeper woman is leaving
us a a~t; it is quit clear that she intends to be rude
andl impertinent.
'Our time will come," promised Mr. Beaversham:
o'ne generally gets even with people of her sort:
Ithese upstarts never see far enough ahead.
'I can wait," staid Mrs. Beaversham, "and if I
get a chance to pay her back for her insolence--!"
But it is hard to be patient fhile your contuma-
cilous enemy, a woman you were prepared to forgive
for not having done you anything and for having
bieen insulted by you, is entertaining the representa-
tive of roal~ty and the cream of society. To find


yourself an outsider, after you have been prepared
to take a real outsider to your heart--then indeed you
know that there is something worse than the sting
of death and more bitter than the victory of the
grave. Meanwhile, one night at Delva, the orchestra
played for the dancing of scores of couples, and the
fun was exhilarating, and the Governor and his
wife were gracious and in the best of spirits, and
Mr. Pemberton and Gladys were genuinely pleased.
James Cuthbert was among the guests. After having
entertained Lady Mugsley for a whole week at Maple-
ton, Mr. Pemberton could not feel the slightest ob-
jection to James. When he had seen Cuthbert's name
in the list Gladys and he had gone over prior to the
sending out of the invitations he had passed it with-
out a word or look of objection. Gladys had known
that he would. She had included James Cuthbert,
since not to have done so would have been an insult
without even the shadow of an excuse.
The ball was not completely over until the sun
had almost risen above the hills to the east of Delva.
It was a thoroughly weary but quite satisfied couple
that walked up to their bedroom to snatch a few
hoh~rs' sleep. Grladys had not danced' with James
once, but she had been the Governor's partner twice.
Mr. Pemberton had stood and watched His Excel-
lency steer his wife in and out of a maze of dancers,
and his heart had beaten high with pride. There were


no heights to which she, with him for husband could
not rise. That was clearly demonstrated now.
It was not yet nine o'clock in the morning when
a servant came to the bedroom door, knocking imper-
atively. A telegram had just arrived; it had evi-
dently been rushed. Mr. Pemberton opened it and
exclaimed--
"Good God!"
"What is the matter?" cried Gladys.
"Arthur! Something is seriously wrong with
him, it seems. This is from Dr. Croseby; it must have
been written last night and sent to the telegraph
office very early this morning--you know what that
means."
Gladys took the paper from his shaking hand
and read:
"Dreadful occurrence here. Arthur concerned.
Come over at once. Croseby."
"Arthur! I wonder if he is killed."
"It doesn't say that," said Gladys; "it only says
that Arthur is concerned. Shall I order the car for
you ?"
"Yes, the roadster. You come over later in the
sedan, if you possibly can. What can be the matter?
--I feel that Arthur is dead."
His voice broke, and Gladys, white-faced, helped
him to get ready quickly. She kept a grip upon her-


7The Cup and The Lip r















































































~nnnnnnnnnnnnnruu2RRRRnnnnnnnru~2Nurnnnn


IC
~i~i~ii~;?~RhRRRR~aRRRRRRhRhRRRRRh


PLANTER S' PUNCH


the black one, which might suggest too plainly a
desire for sombre concealment.
She got to the Great ]House just in time to find
Arthur preparing to go out. He was in the little
room he used as an office, selecting a walking stick.
Its window opened on a patch of garden to the
south.
"You going out?" she asked in surprise, for she
had hinted to him not long since that she might pre-
sently be back.
"Yes, Marie, for a walk. I am not feeling very
bright; a slight headache."
"But I told you I was coming.'
"You weren't quite certain. And, anyhow, I
should prefer you not to remain to-night. You and
Ramsingh have just come back, you see. You have
told me he knows--"
"And don't care."
"I am not so sure of that. Besides I care, and
that is something. At least you might try to be care-
ful."
She narrowed her eyes, her face flushed with
anger.
"You beginning all that foolishness again?" she
cried. "I thought we had finished with it long ago.
I am careful, but perhaps what you mean is that I
am to stay away altogether, though you know I
won't. Or perhaps you don't want me here now be-
cause you going out to see another girl! That may
be it, ch?" She scanned his face keenly, then
laughed. "No; that is not it. You are only nervous,
Sahib--and afraid."
"Yes," he replied' very simply, "I am afraid."
"Of Ramsingh?" (scornfully).
"You know quite well I am not afraid of the man
in any physical sense, but I am not satisfied about
how he takes this--you and me, Marie."
"The same old thing," she said wearily; "always
the same thing. So you going out?"
"Yes."
"For long?"
"No."
"Then I wiill wait for you."
"Why ?"
"Just to talk a little before I go back and go to
bed. You say you won't be long, an' if you knowr I
am waiting I am sure you will hurry back."
"And Ramsingh?"
"He's not at home. He is gone to the coolie
village or somewhere else; he mightn't come back
till twelve. But I won't be so late here, if you come
back soon. I didn't come here to stay long. I didn't
come for anything. But you can't treat me so badly
as not to se~e me or talk to me at all, so I will wait
here if you go out, no matter if Ramsingh know I
am here and want to raise hell about it. I am pre-
pared meself, as I told you before, to tell him every-
thing and let him do what he like. I only don't do
it because you don't like it. But-"
"Quite so, Marie. It has come to this that I must
do whist you wish or be openly scandalised. But,
remember, it will matter more to you than to me."
"What happen to me won't matter at all if I am
to lose you," she answered passionately, looking at
him with eyes that held in their depths possibilities
of self-immolation of which he had never dreamt.
"I make up my mind. I am prepared for anything,
even death, if I am not to have you. You understand
now?"


what she wanted. But it was not money she thought
of now. It was the man, the sahib, Arthur Norris.
Ramsingh would expect further bonuses or pre-
sents, and he would get them. He would make money
quickly now, as he had' always wished to do. She
smiled contemptuously as she thought of this.
Ramsingh loved gold, land, material possessions;
he saved everything he could, though he had stinted
her nothing. But then she had helped him greatly,
for she had her father's ability to see opportunities
and to put them to good service. Even Ramsingh,
for all his old-fashioned, Oriental ideas about women,
did not deceive himself into thinking he would have
done so well financially without Marie's help. He
lent money quietly to the workers at Morley, but it
was lent in Marie's name; it was she who transacted
the business. They had begun to sell cloth and hab-
erdashery on the instalment plan to the people
around; that also was Marie's idea. Ramsingh, she
argued, must have guessed by this what would be
his loss if he interfered with her freedom of move-
ment. And though he had seemed disposed to do so
three or four days ago, when he had returned from
Clifton Castle suddenly and found her out in the ear-
ly hours of the morning, he had since then subsided
into dull acquiescence. Gold had quieted his jealousy.
And he would hope for more and still more of it,
Her lips curled in scorn as she thought of him.
Fancy to prefer money to her! What a low-minded
beast! Yet, though she scorned him for it, she? was
glad of it, for she detested his very presence. She
was delighted at a settled and understood arrange-
ment at last, for that gave her liberty to love Arthur
almost without concealment. Nevertheless there
must be some concealment; the Sahib insisted upon
it; Ramsingh, too, would think of his position and
reputation among the coolies and creoles of the plan-
tation: he would not have his wife traffic openly
with his master. She must act so as to save his
face; unless she intended to break openly and finally
with him whichh Mr. Norris would not like), she
must pretend even to him that she was merely a
chief help at the Great House, nothing more.
And she sat in her little sitting room, thinking
and waiting, waiting to go back to Arthur, she
thought she detected a peculiar odour, a scent re-
miniscent of something she had known before, but
not so familiarly that she could readily detect and
name it now. The odour was faint, as though it
came from far away: vaguely illusive. It tantalised
her memory; then it awoke in her a queer feeling
of disquietude. As the aroma of incense will linger
in a church long after a service is ended and the
censer has grown cold, so this odour floated upon the
air as though it had been stronger in the room be-
fore. But nothing was burning. She looked about her
keenly so as to detect any scrap of paper or rag of
cloth that might be smouldering. Nothing. And,
anyhow, this peculiar smell, though so faint, was not
to be confused with the scent of ignited cloth or
paper.
It was half-past nine. She arranged on the
table some food she had brought with her after din-
ner from the Great House; that would show Ram-
singh, if he should return before she did, that
she had not remained up there all the time
with Mr. Norris, but had come back to the cottage.
And since she might not be away for more than a
half an hour, she took her scarlet mantle instead of


self, but in her mind also the awful question framed
itself incessantly: "Arthur--is Arthur dead?"
In a very few minutes, after gulping down a cup
of coffee, Mr. Pemberton was on his way to 1Mapleton;
two hours later Gladys too had set out. But she had
remembered that James Cuthbert had said the night
before that he was going over to St. Mary that fore-
noon, and as she did not wish to travel by herself all
that journey, to meet she knew not exactly what
at the end, she had telephoned to James and asked
him if he could take her over to Mapleton. He had
come up for her gladly. He was a friend upon whom,
she instinctively felt, she could rely. And her hus-
band, now, could have no objection to him.

CHAPTER SEVENTEEN

ITWAS two days since Ramsingh had moved back
into the cottage he had occupied as majordomo of
Mlorley Great House; he had informed Marie of his
reinstatement calmly, and she, acting a part to ob-
lige Arthur, had received the news as unemotionally.
She resumed her duties in the house at once, as
though she had never suspended them. She found
things in a state of confusion, with the servants
doing much as they pleased and helping themselves
to the Squire's food in the sure and certain hope of
non-discovery by him. She put an end to all this
immediately.
But Ramsingh himself went only once to the
Great House and he said nothing about it or its
master, or Marie's duties there. He said nothing.
Never had he been loquacious; now he seemed as
though he had been stricken dumb-
The night of the second day Marie was at her
post seeing that Arthur's dinner was properly served.
From seven to eight was dinner-time; after the table
was cleared she Drepared to go home, whispering
to Arthur that she hoped to be able, on some good
excuse, to return later for a little while. He shook
his head negatively.
"You had better be careful," he said.
"Tcha!" she laughed. "You seeing ghosts. It is
all right now."
She ran over to her cottage, and cried out her
husband's name. There was no answer. She looked
into the bedroom, thinking he might be asleep. He
was not in it. She went to the door and called loud-
ly. Silence. He might have gone to the coolie vil-
lage, she thought, or perhaps even to some creole
village outside of Morley. He sometimes did. Per-
haps, then, she could slip back to the Great House-
She would wait until certain that the house servants
had gone to their quarters, and then she would go
over for a while. Even if Ramsingh should return
before she got back she would have her usual excuse
about having forgotten something-
Marie knew that this excuse was wearing thin;
yet to-night it would serve very well. Besides,
though she was well aware that Ramsingh was sus-
picious, and more than suspicious, he had deliberate-
ly accepted reinstatement in the Great House, at
a wage which must seem to him magnificent; and
he could be in no doubt as to the reason why he was
being remunerated so handsomely. Then there was
his salary as "time-keeper" or gang boss, and also
Marie's earnings as his help, at the Great House. She
herself laughed at this, for she knew she could have





CLEARY & E100OTT



Recognized as Jamaica's Leading
Exponents of Artistic
Photography


PICTURES FOR:

T. R. Hs., The Duke and Duchess of
Y~ork--The WC;embley and Toronto
Exhibitions.


ORDERS FROM:

H. E. The Governor, Hon. A. S. Jelf,
and other prominent individuals
entitle us to be considered as
such.



WE CAN PLEASE YOU.

STUDIO:
89 KING STREET KINGSTONU.
usessnguaingussigunusarninaugsuanaisanntin essn sumeunun ntin


1931..32


NATH-AN & CO., LTD.

M~ONTE-FG O B.A Y.

The Premier House for Honest Values,


SIPEC'IALISTIS IN


M OTsteds, Serges and

Irish Linen. Suitings*


Wec aim to satisfy our customers by
Supplying them with sterling goods


1010881 POSSIble PTiceS.


Protect your pocket Book by buying:

goods that will give satisfaction from


"Th H0ase with a Reputation to Mlaintain.")




Full Text

PAGE 1

, % AJAMAICAMAGAZINEVOL.II.NO.6.1931-32PRICE:ONESHILLINGPRINCIPALCONTENTS.THECUPANDTHELIP, ByHerbertG.deLisser,-AJamaicaNovel, tellingtheold,oldstoryas it is reenactedinourownlocalconditionsTHEPRINCE AS DANCER,-TheStoryofaninformalnightatConstantSpringHotel.-IllustratedWARSINJAMAICA,-AnentertainingblendofHistoryandHumour.-UlustratenTHETALEOFTHEPICTURES.-ThePastandthePresent,andtheworkoffamousProducers,IllustratedHOWJAMAICAIMPRESSEDME,-ByMissShirleyDerbyshire.-Effectona visitorofa firstlookatJamaica.MONTEGOBAYATBREAKFAST,LUNCHANDWORK.ANorthsideCity'sProgress.-Illustrated. I-IJOW PARAMOUNTDOESIT,-BehindtheScenesofagreatMovingPictureOrganization.-IllustratedTHEHAUNiflNGOFTHEFLAMINGO,-ByDavidSinclair.-AnoldsuperstitionoftheSeaCLUB PaltictLlaTS(}1" A1J)Jlication/i'orJnsfo1',!IC?nuei'shilJ fl'omE.A. HASTIXGs-TILL,Secretmy.Ii.INGSTO.. 'J ..B.'\"".I. BOURNEMOUTHLargestand nest EquippedAquaticSportsClubinWestIlldics. Two SwimmingPools-Inner Pool150 ft.x G5 ft.-OuterPool 185 ft. 100ft.-DivingPlatfol'ms-SpringBoards-BeachGym-nas1um-Trapeze-'VaterHOI'ses-Rafts-RubberfloatsDancingandConcertPavilion Music andDancingDailyby Bournemo.uthRoyal Hungal'ianGypsy Orchestra Cm;d-3Iagazine-Reading andWritingRoom CoolRefreshingDrinks-LightLuncheon-Aftel'lloonTea TeaDansantsandBallsArrangedVerandah and ComfortablyFurnishedAlcovesO,erlookingSixthBestHm'bourill 'VorIel Privilegedand/orTemporary Membership Extendedto \'is1tors to the Club Exclush-ely for se of )Iembers AndtheirAccompaniedGuests

PAGE 2

PLANTER S'PUNCH1931-32ITPAYSTOGIVEUSYOURBUSINESS.BOTHHEREANDABROAD.WeAre:WHARF-OWNERS. IMPOf'TERS OF MEF\CHANDISE FOODSlUFFSETC, EXPORTERS OFALLISLANDPRODUCE COFFEE EXPERTS Be FACTORYOWNERSEarth "Frorrl,the FarCornersoft.heWeBringOurMerchandisetoYou.".TogetherWithOurLondonAffiliationE.A.deDepass&Co.Ltd" vve have World.vvide connectionsW'hichenableustoquoteyou cOrrlpetitive prices,onbothMerchandiseandIslandProduce. MERCADO & Co., Ll.'lD. .. .....STEAMSHIP AGENTSFOR:ROYAL NETHERLANDS STEAMSHIP. CO. JAMES NOURSE Be CO..LTD.... :... flO...' ... ..:i.lCLJ2KTEA': (...'"..... ,..... .. JANIAICA MAD.EBISCUITS.IF YOU WANT THEREe::,TRISCUTTS.'YOU lV1l'ST HAVE, ...."\ARROWROOT 1"DO YOUSTIPULATEJAMAICA-MADE?'> rrHEJAM..-\.ICc\. COMPANY,J .. OF HIGH-GRADE BISCUITS.

PAGE 3

PLANTERS'PUNCHVol.II.No.6.MIXEDBYHERBERTG.DEL1SSER. C.M.G,FortheYear 1931'-1932crhePrince as C[)ancer-Cam.ela Part"aUhi} HltghCecil(Copyl'ight). H.R.H.THE PRI1\CEO:F WALES,EDWARD ALUERT ClIRISTJANGEORGEANDREW DAVID,EarlofChester,DukeofCornwull,Dukeof RothesUJr, EarlofCarrick, Ilnroll ofRenfrew ... LoreloftheIsles, RIHI G.'cnt Stewar(lof Scotlau
PAGE 4

2PLANTERS'PUNCH1931-32ThePrince's chief of staff, SirLionel HaIsley.agl'ee{lacquaint ITis Royal Higlwiththe existing catastrositnation.The Prince8meheel'fully whenSirLionell!tionedthedrugtore,and markpdthat "it mustbtaigooddrug store'" But"he Sil'Lionel HaIsley toldhilwhattheotherfolks ahont hisdancingwitha.g-ilf\'Om a dl'ng store,H.R.H. bCflll1e\-ery much annoyed atthi impertillt'nceandsnobbenMajor Verneyauresusthahehadactuallydecidedt. chflnge hipartnerforthe nex daoce.Bnthedid not. II' would notdo so now.He dan<.cd onceagain with the girl froll the drugstore,a doubtless, a'tomakeitquiteplainthat til .. knew who she was and whatshewas anddidnotcare a 1'a Ilamaniancoinor abontit,sinceshe was alittle lady andanexquisitedancer.Still, hewas inPanamaform a Ily, andso, says Sir Li.ont'l, "besoothedthelacerated fNI ing'ofsocietybydancingtheremainderofthe Heningac cordingtothecalendaroflocalprecedence."InPeruandintheArgentinethePrillC'indulgedinhis fa\"ourlte socialpastimefdancing;meetinginthosecountries, n respeciallyintheArgentine,manya beautifl' senorita.Butone maywell belieye that those fewhoursspentatConstant Spdng Hotel that night(afterso wearisome aprogrammeof speechesandofhandshakes,andwiththe pros, pectofotherequallydrearyfunctionstofol, low shortlyafter)willlingerinHisRo ..al Highness'mindasthebright spot ofhis ex periencesinJamaica.Whenhethinksin i'b futnreofJamaicathepicturethatwill perhap: spring vividly upinhisrecollectionisthe il luminateddanceroomoftheConstantSprin;Hotel,and 'the little ladywhom he selectpd hispartnerfor 011C'brief tropicnight.todancewithher-ODeathandDestruction,ohurricanesandearthquakes! RntMajorYerney saysthatthePrince,after ::tfew "dutydances" with "important'ladies, had turnedwithreliefto"apartnerwho wasslender, graccfnlandskilfuL"And"immediatelytherewer'esignsof afemininedisquietudeintheballroomofthePresidentialPalace;Ulldwhisp el'ing gl'oups were formed."One ofthePrince'sEquerriesenquir'edintothereason.Hedis cm-eredthatadeputationof threeleading' membersofthelocal scciety had berm appoint pC! to cOll\'ey toHisRoyal taff <:eriou, world-dishubingfact tha t the ladywithwhomthePrince wasu[tocing, ,Iudhad d.lnced se\'el'al times, wasanaii',istillit in a(11 ugs'tore. 1Vhethpr it wasfpltthattlHs mightaffectthepriceofdrugs,orthe takinf; ofdrugs. or the fa ilnreof dL'ng PhotobyClea,'y and Elliott,to producetheil'usual('fleet.was notclearlyexpressed;bntthe socialcan"edbJthe Prince's dancingwithayoungladywho workC'll forher lidng in adrugstore,instead ofdancing with ancient lallies ofthe bony 01'the pOl'tl)"type,whose husbandsowned UfUfT:o;t01'('S andcheatedthe customen, thereof, wastel'l'iflc. MISSHOPECAHUSACWHENhe was inPanamaforthefirsttimeanddancedoftenwithaPanamanian girlwhohadcaughthisfancyasa'dancer,some people oftheUpperTenofPanamanian. Amer icanandEnglishsociety-wesuspectit was('hiefly membersoftheAmericanand F.nglish !'ociety inthelittleRepublic-were hOl'l'ifiC'd. Thisgirlwasnotin"society,"andforaPrince, a.young man whowould somedaybe a King,"'Won't youpleasesignyourname iD. thisforme,Sir"she gushed. Major Verneywho wasf;tandingimmediatelybehindthePrince,tellsusthathestaredatherfora few second:;:;. and tlwnlIP:o;poke.")\0'"heanswered, definitely,"I willKOT signyourbook,'"andhe left herstandingthereandsteppeddownamongthechildren.to C'njoy an hou.1' tohimselfheresentsintrusionandhe showshisresentment.MajorVer ney, who haswrittenanadmirablecharacterstudyofHis Royal Highnes,mentionsas anenoueons conceptionofthePrincethe popdar:otory thatheis always amodelofpoliteness "flnd thatinpublicatleasthewouldnotsaybootoa goose." As a matterof fact he tanexpressdispleasure inpublicquickly when he feelsdispleased.OnceinSouthAfricahe was being l'ecei "ed, especially,bysomethousandsof schoolchildren.ThePrinceof 'Vales likeschildrenandthis reception touch I'd him.After the..had sung"GodBless ThePl'ince of "'Tales" a womau-nncloubtedly a societyladyorshewouldnothavebeenas neal' toIT.R.H. as shewas-rusheduptohimandthrustherantographbook before him.RoyalHighness. "Standing bythefountaininthepatioofthehotel,01'framedinone ofthearcheofthelongcolonnade,'thelittle lady mayhavewondered,hoped,wished-one doe:o: notknow.Butpresently-suddenlyitmusthaveseemed-aplcasantvoice was speaking,andsmilingeyesandlipswereasking fat'::t dance.Ifthishadbeenthewild, impossibledreamofhundredsofJamaicagirlswhenitwasknownthatthePrincewascoming here,inthisinstanceatleastthedreamhad come true.Hedancedwithher'again,andagain;againandyetagain;inthe intervals ofthedancinghesatwithherandtalked;he showNl hispreferenceforthisshy,retiringpeti'te dancingpartnerofhiswhowastoonaturalto bC' self-conscious.Thatwastrnlyanhonour auu acomplimenttoacharminglittleladyofJamaica.THATafternoonthePrincewasatpolo, some ofhisgentlemen-in-waitingplayingagainstsomemembersof 'the gar rison.Hehadbeenupall night and nearlyall dayhavinghadperhapsnotmorethan two hours'sleepinthelasttwenty-four'hours.Butatthepolomatchthetraditional charn!. ofHisRoyalHighnessshone'ontasithad done atnootherfunctionexceptthedanceofthenightbe fore.Hesmiledgailyandhappily.At'Ihematchhegreetedwithcheeryfriendlinesshis da'ncingpartnerofbuta few hourspredonsly andirradiatedgoodhumour.Hewas as amantransformed.ForthetruthisthatthePrinceof ""ales doesnotgothroughlifealwayspleasant and smiling,or polite,asthepopularbel jp{has represent'edhim.Heis angry when pl'st ered withtoo mllCh crowding;when he wishesr-rHE islandbuzzedwiththestoryofthisnight'sdancing. Envy ofthefavourite and admiredpartnerofthe Prince sprangintoquickexistencc:that was inevitable. Hundreds of pel's ansmetaphoricallygnashedtheirtecthandtoretheirhair,anddonned sack cloth,andstrewedashesontheir heads, andsatdownupontheground,withalltherailingandimpa'tience ofthePatriarchJob )yhen hefoundhimselfsorcafflicted.Howwasitthat they badnotthoughtofConstantSpring?Surelythey might ha\'eknownthatit was 'to ConstantSpringthattheRoyalbrotherswould go? Whosefaultwasitthatithadnotbeenwhispered'tothemto ap pearatmidnightattheCanstantSpringHotel?SurelyTheirRoyalHighnesses wonld havewishedtomeetthis and thatand'theother person;' "Someonehadblundered."J[andifandif-butthepast was past,thedanceshadbeen danc, ed,thefewbriefhoursofbrightnessandpleasurewereover,andatnineontheforenoonofthedayafterthe dance thePrinceswerebusyreviewingex-soldiers of 'theJamaicaContingent,opening dreary clocktowers,performing fUllc tionsofthesortwhichmakesuchaburdenoflifeandformapartofthepenaltypaidforbeingaRoyalPrince.

PAGE 5

1931-32PLANTERS'PUNCH UhecraZeif The Pictures ADOLPH ZUKOR, Oneofthe leaders oftheJllo\'ingpicture Uldustry.,vhoe-arl.) realizedthe neceiil;sit3' for qunlit.) onthescreen,andwhosehandandsJ>iritare hugel.)" res1)0nsihl('forthel>rogressoftheParamountorganization.FromPansytothePresent-theSilentandtheTalkingFilm--Zukor,LaskY,andtheir work typeofpicturesthatwasselectedforverbalslaughter,whilethebettertypeofpicture(agreatsilentfilmlike"WhiteShadows"forinstance)wasignored.Forexample,Mr.ElmerRicewroteawholebookononeimaginarysilentpicture-playinwhichimaginaryplayhepackedeveryplot,deviceandincidentoccurringintheaveragesilentpicture.Withthatsortofplotallmovingpictureloversareonlytoowellacquainted,especiallyassomeofthetalkieshavenotyetgotawayfromit.ButevenwhenMr.Ricewrotethesilentpictureswerebeingmuchimproved.Letusgobackawhile.InthemovingpictureworlddepictedbyMr.ElmerRice,andcalled"Puerilia,"whichisasynonymfor"puerile,"wehavePansyMalone,"alovelyunspoiltchildofnature."Pansy,itisannounced,isnineteenyearsofageandwhensheisfirstseenbyMr.Riceis"bare-footand dress edinwell-fittingrags."Sheleantdaintilyuponthehandleof arake,which,uponreflection,struckoneasalittleodd,foritwasscarcelytheseasonforhay-making.Herpersoncontradictedthesuggestionthatshehadled alife of arduoustoilandofexposuretotheelements.Shestoodinthefields ofPueriliahatless,yetherskinwassnowyandunblemished.Herhairwaswonderfullydoneup,herfingernailswerebeautifullyshapedandpoiishea;andwhenshe was firstseenitwas,ofcourse,twilight.Twilightandthe weretheperiodsofdaymostadmiredandpatronisedbytheearliermakersofmovingpictures;everynowandthen"Camethedawn,"andalso"Camethegloaming;"andMr.ElmerRicesaysthatonhisfirstvisittoPuerilia,immediatelyafterhehadbecomeacquaintedwith Pansy, henoticedaherdofcowsmakingtheirwayslowly,insinglefile,inthetwilight,alongtheveryridgeofalineofdistanthills;andlaterOilhewastolearnthatcameIs,mules,horses,andother anf malsinvariablyselectedtheridgeofhillsfortheirperambulationsattwilight,theirprogressbeingexplainedbysuchwordsonthescreenas"thelovelyhouroftwilight,whenthesunsinksbehindthewesternhillsandman anu beastreturnhomewardsafteraday'stoil."BUTtoreturntoPansyof .thecOllventionalsilentsentimentalpicture.Sheinvitesthetwostrangerswhohavejustarrivedtoherhumblecottage,andassheplacesherhandsuponthelatchofthedoorherfaceexpandsuntilitblotsoutthecottageitself.Thisis a"closeup"forthepurposeofshowingtears."Itisthemostbeautifulhouseintheworld,"shemurmurswithsimplefeeling;"itishome."Whereuponherfaceshrinkstonormaldimensions,thepartyenters the 110use,andtheadventuresbegin.Naturally, Pansy's motheris a widow.Itwas waysthoughtadvisablethatmostmothersofsimpleyounggirlsbattlingwithlifeshouldbewidows.The fathers madeitaruletodieatconvenientperiods,when tile childrenhadnotyetgrownup,andwhenthe homewas probahlymortgagedtoamanwhowasacheatandascoundreltrustedonlytoo impl:citly byfatherswhoneverseemedtohave ilny sensewhatever.Inevitably,too,thewidows'onlysons were away,andtheirmothersneverheardfromsatiriccritics,theyhadcommencedtowritearticlesandbookswhichwerehavingtheireffectupon theminds ofthemultitude.Someofthemost amusin6 andtelling thesecriticismsappeared,asithappened,justwhenthesilentpictureswere aboUL todisappear.Theywereevidentlywrittenundertile impression thatnoearlychangeimpendedin the movingpictureworld.Then,almostasswiftlyaswepass from onescenetoanotheronthescreen, the talkieswereputacrossthenarrowprosceniumofthepicturetheatreandthecriticswereobligedtoallowthepicturesanotherleaseoflife.THEhitsatthepictureswereamusing,evenifunfairinthatitwastheconventionalisedBUTnowcomes Mr.GeorgeJeanNathan,oneofthebestknownofAmericancritics,andhelaysitdown infiveyearsthemovingJicturewillhavedwindleulndalmostdisappeared,and :hll legitimatestageandstageplaywilloncemorebe all paramount. ::vIr. Nathansaw, '1S manyothersdid,thatthesilentpicturewasapproachingsomethinglikeacrisiswhenthetalk-recordinginstrumentarrivedtogivetothe movingpicturesanotherlease of life.It was believedbymanywhokeenlystudiedthetasteofthepublicthatbutforthesynchronising of soundwithmovementatafortunatemomentthemovingpictureindustrymusthavecollapsedandentirelyhaveperished.BntIthinkthesecritics were wrong.Thattherewas asortofcrisisinthemovingpictnreworldisbeyond question.Butthesilentpictureswouldnothavedisappeared, evenhadthereleen noinstrnmentsjustthenJerfected torecordsoundnd dialogue.ForthereI'ould have beennothingtoputintheirplace,anditisnonsense tothinkofthemillions of urbandwellersgivingupthepicturetheatresaltogether, andequallyabsurdtothinkofthemasbeing satisfied withvisitstothe"legitimate"theatre,atverylongintervals,andatconsiderableexpense. ,'heir appetiteforamusementaswellastheirpocketswouldhaveprotested.Itistrue,however,thattheloversofsimplelove scenesandheroicrescuesanddesperateencounters,therapturousejaculatorsof"0000--",theenthusiasticapplaudersofhair-breadthescapes,,erebecomingwearyofseeingthesame thin,; over and overagain,thesamethingrenderednaueatir.gby repetitionandcloying frcm anexcessof sweetnes.EventhepanegyristsofthepicturesbEgan to showsignsofboredom.AstotheWHENaprolonged"0-000000;breaksforthfromanaudienceinamovingpicturetheatreyouknowatoncethattheheroinehasjustkissedtheherowhohasdevotedthefirstpartofhislifetomisunderstandingherandtheterriblelasttenminutestorescuingherfromtheclutchesofthedesperatevillain.Whenatremendousuproar,atumultuousshoutingandroaring,arisesfromthegallery-thegods inaneruptionofsentiment-yourealise,evenifyouaretwofurlongsawayfromthe theatre, thatthe damnable gangsterhasatthatmomentbeenfoiledbythehandsomepoliceman,whoisprobablyamillionaireindisguise,andthatright,justiceandvirtueareabouttotriumphatlonglast.ThatishowitisinJamaica,andthatishowit is ineveryothercountrywherethemovingpicturehasbe come afeatureofordinarylife.ButonethinksthatinJamaicathedisplayoftheaudience'semotionisalittle ')re vociferousthanin etemperatecountries.Theydonotapplaudorcrate so loudlyinthethea.ofNewYorkandLon.istheydointhetheatresKingston,MontegoBayothertownsofthis 1., .i. Buttheirfeelingisthe .. e.And,anyhow,thereisaysplentyofnoiseevery 're,noiseappropriateto tL" scenesbeingdepictedonthesilverscreenandindicaivc ofthereadyresponseof;hespectatorstotheappealaeingmadetotheiremotions.

PAGE 6

4PLANTER5'PUNCH1931-32JACK OAKIE, THE lIJAXWHO)IA.KES)IILLI0XELACGH them.Thesemothersnowandthenweptoverphoto.:graph., ofthe abS'ent ones;butweallknewthatthe lion wassomewhereinthewide,wideworldand would returnintimetomother;meanwhile thl; manwho has amortgageonthepropertywantsPansybadlY, but Pansydislikesandmistrustshim,perhapsbecausehe twiS'ts hismouthtoonesideinsinisterfashion,orbecauseshelovesthebraveyoungmanwhohasjustenteredherlife,eitherbyleapingwildlyfromanaeroplaneorbydashingsteeplydownthesides of aprecipiceonarestivehorsewhichalwaysbetraysgreatspiritwhenitseesthisgirl.AudnowwithPansyandtheperiodicallyweeping Mrs. Malone,andwiththesinisterevilmortgagee,andthedevotedloverandhisfaithfulfriend,thestageisset.Theonlysonisstillaway.ThemortgageemakesasuddenappearancejustwhenPansyandMammaandthe strangerS' aregoingtoasimplesupper.Andthenafullmoanrises,andalongtheveryridgeofthedistanthillsaherdofdeermarchesslowlyinsinglefile-itwillbetheturnof ihe donkeysnexttime.ADVENTURESfollowfast.Thevillain.ousmortgagee intendS' togetbothPansyandthelandonwhichthecottagestands;butespeciallytheland.Foroilisbeneaththesurfaceofthatsoil,andPansyisarichoilowneralthoughsheknowsitnot.ButtllevillainImowsit;hencehisdeterminationtoemployeitherChineseorItalianthugsoftheunderworldtocapturePansyandsocompelhertomarryhim.And,ofcourse,Pansyiscaptured.Thiscompelsherlovertopursuehercaptors;heselectsatrain for thepurpose,whichtrainproceedstoits deS' tinationbyrapidlyroundinganincrediblenumberofcornersandcurves,alltrainsinsilentpicture-landbeinginthellabitoftravellingexclusivelyroundcurvesandneverinastraightlineforevenasinglemile if theycanhelpitAnd,ofcourse,inthe worhl ()fthesilentpictures,nobodyeverboardedatrainwhileit was standinginastation.Atanyratenobraveloverdidthat.Healwayswaiteduntilitwasgatheringspeedandsweepingrounditsfirstcurve,thenhewoulddashuptoitwithamightyspurt,leapontothesteporclamberupthesideinsomemiraculousmanner,andswinghimselfintoacarthroughawindow,althoughsometimes lle wouldprefertheroof.Andafteratrainaccident01'two,andseveralfightswithChineseoftheunderworldorAmericansof the uPljerworld,withinviewornotof astringofelephantsslowlyproceedingalongtheridgeofdistanthillswhichformtheskylineofthevalleythroughwhichthetrainisrapidlycurving,theloverfinallysucceedsinrecuingPansy,eitherjustassheisabouttomarrythevillaininordertopreventhermotherfrombeingturnedoutofthecottage,orwhensheisputtinghersignaturetosomedeedthatwillalienatethepreciousoil-bearingland.Thentheyoungloversembrace;andafterthatthelostsonandbrothermakesanunexpectedappearance, thuS' causinghismothertoweepmorethanever;andthetwo)youngloversmarchtothealtaramidstthestrainsoftheWeddingMarch;andthistakesplaceinthesweethouroftwilightwhen,inacountrylikeJamaica,themosquitoesemergetomakeaweddingpartymiserable,orwhen,inAmerica,themotorbusesares'eensilhouttedagainstthedistanthorizon,theyhavingchosentheridgeofsomeloftyhillastheshortestandmostconvenientroutetotheirgarage.It couldn't last.Therehadtobesomechanges.Thesechangeswerebeing thought out,andap plied,eventhoughsomanyofthemovingpicturedirectorsweremenwho,witha goodknowledgeI)fthe te.:hnique ofpicturemaking,hadaverylimitedsenseofthearchitectureof a playaI'oftruedramaticappeal.Mostoftheearlierdirectorsseemtohavethoughtthatalmostanysortofplot-andthemorepuerilethebetter-woulddo.Thebiggermenof th';) movingpictureworld,however,realisedin due timethat this ideawasamistake.Itwasthisrealizationof atruersenseoftheneedoftheartisticdevelopmentofthemovingpicturesthathashelpedtomakethesuccessofmenlikeAdolphZukorandJesseLasky,twomenwhoarenowamongthemagnatesofthemovingpictureworld.Suchmenmaynotalwayshavelikedthekindof criticiS'm thatcamefromtheElmerRicesandtheCarlvanVechtens,butatanyratetheyhadthegoodsensetoseethattherewassomethinginit,andtoprofitaccordingly.YEARSagothewriterofthissketchmentionedintheJamaica Gleaner' thatthe LaS'ky pictureswerealmostalwaysofa goodquality,possessedabetterandmoreinterestingplotthantheaveragerunofpicturesshowninthiscountry,andsocouldusuallybedependeduponforentertainment. LaS'ky hadbeenashowman,hadattemptedmakingmoneybygivingmusicalperformances.hadplayedinvaudeville,andhadevendevisedmusicalactsforotherpersonstoperform.ThistrainingandexperiencewereoftheutmostvaluetohimandweretoproveofgreatvaluetoZukoralso,for Lasky's experienceintheshowworldreallymeanttheeducationofhisdramatictechniqueandsense.Therootofthematterwasindubitablyinhim.ConsequentlywhenJesseLaskystruckupapartnershipwithAdolphZukor(afteralreadyhavingbeeuassociatedwithsuchmenasGoldwynandCecil deMille),Zukorbroughttothepartnershipagreat bU5i nessexperienceandaptitude,andLaskyhisunclerstandingofwhatwouldpleasethepublicandyetbe of goodqualityandworth.FromtheveryearliesttimesLaskyhadrealisedthatthestorytobetoldonthescreen-theplotanditsdevelopments-wereofthegreatestimportance.Fineacting,thepersonalityofactors and a(;tresses,countedimmensely-hewaswellawareofthat.Buthewasawarealsothatapuerilestory,andespeciallyaseriesofpuerilestories,couldnot easily beputacrossbyeventhebrighteststarsof the movingpicturefirmamentafterawhile:the beslphot'-'3raphy orthemostlavishadvertisingwouldnotmakeapoorplayworthseeing.ThePansyMalonekind of filmmayhavebeenacceptableenoughwhenanysortofactiononawhitescreenstillaroused curi08ily, admirationandwonder;butwhenthatinitialphasewaspassedadifferentandahigherappealwasclearlyindicated.Laskywasnotonlyoneofthefewmenwho1Inderstoucthis,buthehadthegoodfortunetoknowhowtosatisfytheunexpressedandlargelyinarticulatedesiresofpicturelovers.Zukorgraspedthisfact; Zukor had alS'o beenthinkingonLasky'slines;itwas Zukor whoapproachedLasky,afterseeingsomeofhiswork,andmadethepropositionorpartnershipwhichultimatelyresultedintheParamountPublixCorporationcomingtobirth.Zukorsaw the possibilitiesofbetterfilms;heappreciatedLasky'sabilitytomakesuchfilms.Thecombinationof these two,withother brainS' andpersonalitiesjoiningin,hasbeenproductiveofoneofthegreatestpicturemakinganddistributingorganisations-perhaps the greatest-intheworld.THISAdolphZukorhas had averyromantic and adventurouscareer;whatemergesfroma studY ofthatcareeris aclear-cutimpressionoftenacityof purpoS'e, firmfaithinonc'sself,greatorganisingand financia:l ability.ZukorwasborninHungary,ofJewishparentage.Asa boythelittleHungarianmayhavedreamtdreamsoffuturegreatness;mustindeedhavehadvisionsofariseintheworld,otherwisehewould have remainedamongthecommunruckofEuropeanhumanity.Forone'sdreamsandambitionsaretoaconsiderableextentameasureofone'scapacitytoachieve;whatwewishformoststrongly,andworkandwaitfor,weusuallyachieve.YoungZukorhadhismindfixedonthatwonderfulnewcountryintheWest,thelandofopportunity.InthedaysofhisyouthAmericahadnoreostrictionsonforeignimmigration,andaforeignboymightstillbeginwithbuta fewdollarsinhispocketandriseto beoneofthemoneyprincesof 'ew Yorkor of someotherexpandingAmericancity.AdolphZukorlandedasanimmigrantinNewYork,withaboutfortydollars,andstoodgazingoneeveningofanautumndayatthestrangemetropoliswithitsglowingelectriclights,itsswiftinceS'sant movement,itsclamorousexpressionsofenergy.Hefeltnodoubtinhisheartthathehadcometo make allameandaplaceforhimselfinthisnewworld.Buthewastogofartheranddomorethanhecouidpossiblyimaginethen,howeverhighhisboyishamhitions.ZUKORhadinthebeginningtolearntheEnglishlanguage.Hehadalsotofind a job, foreveninthepenultimatedecade of thenineteenthcenturyfortydollarswouldnotlastforeverinNewYork.Mr.WillIrwinpictureshimtousaswalkingthestreets of Manhattan"agapingyoungrnsticin a strangelycutsuitofold-countryclothes."Inhisperambulationshemusthavefeltthrilledanddepressedbyturns,thrilledbythenovelsightsandexperiences,depressedbytheindifferenceofthemultitudesabouthim,byhisignoranceofthecountry'slanguage,bythatcuriousfeelingofisolationwhichafflictsastrangerinaworldthatisnothisown.Thefirstjobthatheobtainedhedidnotlike.Thenhebecameanerrandboyinarestaurantatfourdollarsaweek.Hedidthechores,hefilled amenialoccupation,hewaslearningalanguageandhewaslearningsomethingaboutNewYork.Hewentintootherlines,hetooktostudyingtheEnglishtonguewithgreatassiduity,choosinggreatmodels.ItissaidthatMilton anll Bunyanappealedtohim,asofcoursetheywould if hewereacquaintedwithOldTestamentliterature.Hereadthenewspapers.Hewentinforsalesmanship.AtnineteenyearsofageheleftNewYorkforChicago and thereembarkediuthefurbusiness.Aftersomeyearsofthis,beingthenapartnerinihefirm ofKahnandCompany,furriers,ZukorreturnedtoNewYorktopushthebusinessthere;inthemeantimeEdisonhadinventedaprocessformakingshadowsthrownuponascreenmoveasmenand thingS' movedinordinarydailylife,fortheseshadowsweretheshadowsofmenandthings.Edisonhim self saidthatitwasbutatoythathe had invented;therewasnocommercialfutureinit.Thushathoughtmanyaninventorinregardtothemiraclehehasbroughttobirlh.Andoftenheisnotevenrememberedasthemanwhomadethemiracle.MR.ZUKOR'Sbiographerinformsusthatintheearlierstagesofthemovingpictures,aboutthirty-fiveorthirty-siXyearsago.andforsomelittletimeafter,AdolphZukorhardlygaveathoughttothepossibilitieS'ofthepicturesasameanstofortune.Theviewthattheremightbe afortune.inthemwaspropoundedtohimandtohispartner,MauriceKahn,byoneMaxGoldstein;thereweremillionsin the pictureshow,MaxGoldsteinsaid,andsoconvincingwashisenthusiasmthatZukorandKahnlenthunthreethousanddollarstobuyapartnershipinacompanythatwasbeingformedtoexploitthepictures,whiletheythemselvesinvestedinthecompany.So,veryfardowninthedown-towndistrictofNewYork,andintheeastsideofthatdistrictZukorembarkeduponthemovingpicturebusiness.Butatfirsthefailed;hewasupagainstotherpeoplewhowerefightingagainsthim.Hefailed,yethedidnotleavehisnewline,didnotfinallyabandontheshowbUS'iness,atanyrateinhis mind. ForZukorknewthaturbanpopulationsloveamusement;that if someamusementcouldbeorganisedandso developedastoretainitspopularity,themanormenbehindsuchamovementcouldnotfailtoarriveatriches.Duringthecomingyearsthis view wastobedemonstratedascorrect.IreadingMr.WillIrwin'slifeofZukor or_ cogniseshowagainandagainthemillionaireoftodaywasOnthevergeofbankruptcy;indeedmanypersonswould have saidatthetimethathe hart completelyfailedevenifhehadnotproclaimedbankruptcy.Butheneverreallyfailed,forhest':lhadyouthandenergyandhopeandfaith, awl ability;andwiththeseassetsnomancanfailHewasalwayslearning;alwaysstudyingthe ofanybusinessintowhichheventured;alwayseducatinghimselfin his enterprises:thedramaticartappealedtohimandhestudiedtheatricalproduction.As Mr.WillIrwinhassowellputit,"He waS' studyingthespokentheatre,withitsbackgroundofthreecenturies,drawingontheaccumulatedexperiencesofitsmanagersinpleasingandalluringthepublic.Andhewasboredatthecarelessyetossifiedmeth

PAGE 7

9-31-32 PLANTERS'PUNCHods of themovingpictureproducers."Hesawthatimprovementwasnecessaryandhesensedthedi rection inwhichtheimprovementmustgo.AndhereandnowI cometoapointupon which-I haveinsistedforverymanyyears.Inspiteofwhatmaybesaidbysomeofthosewhoutteropinionsonmovingpicturesandde clarethattheirfunctionistodosomethingentirelydifferentfromwhatisdoneon"thelegitimatestage,"I contendthatwhilethepicturescanproduceeffects not possibleonthestage,becausethatisboundedbythelimits of fourwalls,andobligedtoproduceitsillusionsamidstsuchrestrictions,thepicturesmustneverthelesshold,likethestage,amirrorup tonature.Inotherwords,theymust prf sentplaysthatareportrayals of humanlife-humanemotion,humanadventure,thecomicandthetragicsides of humanexistence.NOWthestageplay,thetrueauthentic drama, asJesseLaskyperceivedfromthefirst,hasde velopedthroughthecenturiesatechniqueandf'Jrm of constructionwhichthemovingpictureplay Rim plycannotaffordentirelytoignore.ZukarreaIiedthatfactalsowhenhe was studyingtheatrical production.Thatrealisationhasbeen of thefirstimportanceinhissuccess. The movingpictureinitsfirstphases, and up to a couple of yearsago,couldnothavespokendia logue;thesound-recording,sound-synchronisinginstrumenthadyettobeperfected.Buttheplotofa goodstageplay,andsuchwordsofitascouldforminterestingoramusingcaptionsonthescreen,werealwaysfarsuperiortothescenariostheaveragepicturedirectororhishackweresoprone TO grind out, onemanfollowingonthelines of anotheruntil repetitioncreatednausea.Manyscenariowriters feltthattheyhadonlytolifta-plotout ofn hook, put in somewordshereandthere,andtherio was good enough,Manyofthemstill take thatview. Theyarepersonsof notalentforplay writing, theyhaveneitheraknowledge of nor an instinctfor thetechniqueofthedrama,and, ()f coure,anythingliketheproductionof aplaycom pleteandfit for preentingon astageisutterly bp.yond them. Yet thesewerethepeoplewhowere writing thescenarios forthesilentdrama!Forthe1110tpartselecting. Theablerproducersofthemov ingpictureworld, however,wenttothe fortheirplayswhentheycouldgetthem.Theseplaysmighthave to bealteredtosuittheexi gencies of pictureprOduction;butthebasiswastheplaywright'swork,andwheneverthatwasused,whetheritwas aplaybyZangwil!or Somers'et Maugham, or some old classicalwriter,thediffer ence betweenitandthemushoftheordinaryscenario-thePansyMalonestuffandmotif-wasstrikinglyapparent.ZukorandLaskyperceivedthisatavery early date,andthistruthmustnowbecomegeneralandbeacteduponfarmorethanhashithertobeenattempted.Forifitbetruethatthemovingpicturebegantoaffectthelegitimatestageseriouslysometimeago,itisalsotruethatthelegitimatestage,andthestage-play,areinfluencingthemovingpicturetothelatter'sgreatbenefitandthatofthepleasure-lovingmultitudes.Inaword, the movingpicture,inspite of alltheaidsandadjunctsofpicturestars,outdoorsceneryandwonderfulphotography,canneverholditspositionpermanentlywithouttheaidofplaywrightsandofadaptedstageplays,andthisismoreindisputablewithdia-loguespossibleonthescreenthanitwasin tll'3 daysofthesilentpicture.ONEunderstandsto 8""me extenttheviewpointofthosewhopredictthecomparativelyearlycollapseofthetalkingpictures,whenonegraspsthefactthatgoodplaysmustbepresentedonthescreenifthetalkingpictureistosurvive.Thereisnopossibilityofareturntothesilentpicture.Thereisnopossibilityofanycontinuedproductionofsilverscreendramaswithsoundbutnodialogue,orbutverylittledialogue.Screenconvers'ationsmaybeminimised.Thatwillgreatlydependuponthe play, upontheintensity of itsdramaticaction,uponitsinterestingoramusingsituations.Butwiththe ni mostminimisationofthespokenwordtherewillstillhavetobeafairproportionofit,andthatisprovedconclusivelybysuchapictureasCharlieChaplin's-"CityLights".CharlieChaplinwasabletomakeasuccessof"CityLights"becauseofthefamehehadwon,because of hispersonality,becauseoflegendcreatedabouthim-becausehewasCharlieChaplin.Hecouldbringalltheresourcesofanextraordinaryfacialexpressionintoplayinthatproduction,couldaccumulateinpantomimicactionallthepopularappeals of comedyandpath!)s,withhimselfalwaysinthecentreofthestage;couldthereforeachieveagreatsuccessandprovewhatmightbedonebypantomimealone.ButaCharlieChaplin'ssuccessmightbelikenedtotheoneswallowthatdoesnotmakeasummer.Forhowmanysilentpictureswouldbeenduredtoday?HowmanyCharlieChaplinsarethere?Andhowwould alargenumberofevenChaplinpicturesbereceivedtoday?WhatwouldevenMauriceChevalierbewithouthisquaintaccentandhissongs?HowmuchdoesChevaliernotowetohisvoice!ANo'utstandingtheatricalcriticlikeGeorgeJeanNathanseesthedebacle of thewholemovingpictureworldbecauseheknowsthat,amongstothcrthings,thedifficulty ofprocuringgoodplaysforscreenproductionisterrific:playwrightsare bom, notmade,andtheyare not borneveryday.Andtheexigenciesofthemovingpicturemarketdemandaninfinitelygreaternumberorplaysthando th(\ exigenciesofthelegitimatestage.Someofthesupporters of themovingpicturescreenrealisethistoo,hencetheirinsistencethatdialogueispartlydoomed,thatsoundwithbuta fewspokenwordswiIIberetained,butthatthealmostsilentpicturewiIIbethepictureofthefuture.Intheirinnocenceortheirvainhopestheyimaginethataudiences wllI becontenttogobacktosomethinglikePansyMaloneAConstellationoftheParamount PictureStarsandthebadmanandthegoodlover,andthetrainsweeping incessantly roundcurves,andthelostsonreappearing,andtheinfernaloldmother weeping allthetimeandboringustodistraction,an'dwithgeneralembracingsandhappinessattheend of atediousnumberofreels. If itshouldagaincome tn that,thenof asuretyisthemovingpicturedoomed.Butthereisnottheslightestlikelihoodofitsevercomingtothatoncemore.WhatthemovingpicturepeoplewiII be compelledtodointhefuture,arebeingcompelledtodoevennow,istoeliminatemoreofthecustomaryrubbish,andconcentrateupongoodstuff.Thismaymeanfewerplays,buttheencouragementtopotentialdramatistswiII beS'Ogreat,becauseof the increaseddemandforplayspresentingpossibilitiesofpopularity,that t!le supplyof goodandpresentabledramaswiIIcertainlyincrease.Inthat,toalargeextent,liesthehopeofthetalkingpicture.FORsometimepastthestoriesofpopularbookshavebeenutilisedforscreenpurposes,andsometimestheresulthasbeenexcellent,sometimesextremelypoor.This,onefancies,hasbeenduet.othesort of scenariomanufacturedfromthebock,thewayinwhichtheplothasbeenutilisedandtheselectionofthedialoguedone.InfutureitwiII bemenwhoarethemselvesplaywrights,orwhohavedisplayedgreatabilityandtasteinthewritingofscenarios,whowillutilisetheavailablebook-stuffforscreenplays;andsuchscenarios,andstage-playadaptations,andplaysespeciallycomposedforthescreenbytalentedplaywrights,willprovidethematerialuponwhichthemovingpicturedirectorandhisstaffsandphotographerswiIIwork.Andifthestageplaywillalsobecomemore ::lnd morethepictureplay,thusdevelopingthetendencyitdisplayedmanyyearsago(atendencywhichZukorandLaskyperceived),theactorsandactressesofthelegitimatestagewillalsobemoreinthe turesthantheyhavebeenhitherto.Forthatisoneofthechangesrenderedinevitablebytheconnectionofsoundwithshadowmovementsintheserecentyears.Thevoicecountedfornothingwhenthepicturesweresilent.ThevoicewiIIcountformoreastheaudiencesgrowmoresophisticatedandcritical.

PAGE 8

6PLANTERS'PUNCH1931-32RICHARD ARLE::",A:FLYING STAROF STARTLI::"G EXPLOITSTHEREwasmuchtalkaboutenunciation,pronunciationandvoicetrainingwhenfirstsingingandconversationaccompaniedtheflittingshadowsonthescreen.A goodmany of thepictureactorsandactressesfoundthemselves faced with ofoccupation;several of thempossessedfinephotographicfaces,excellentfigures-andwhatElinorGlynhasclassifiedas"It."Buttherumourwasthatthese"Its" had-the voicesofmacaws,01somethingtothateffect,as Ii lawyermight put it.Some of themhurriedovertoEnglandtolearnhowtospeak, others spedto voicetrainersintheUnitedStates,perhapstodiscoverthatliftingthelarynxwouldnotbeaseffectiveasliftingtheface.Schoolsofelocutionbeganto beestablished;actorsandactressesatHollywood, an(1 especiallythelatter,busie.dthemselveswithlessonsinvoicemodulationandintheuttering of simpleEnglishsounds.Butinthemeantimethetalkingpictureshadtohavemimes, the conversations' of thescreenhadto becarriedon,and,so, nomatter what thevoicessoundedlike,they hart tobereproduced.A dozencompaniesweremakingtalkingpictures.Somewereproducingoverfifty ayear.Howcouldthesesuspendoperationsuntiltheproudbeauty,andtheheroicwarrior,andespeciallythesonofthemillionaireeducatedatYaleorHavard,hadlearnttoexpressthemselvesintolerablydecenttones?Theconsequenceweknow.Wehaveheardsometerrificaccentsemanatingfromthefiguresonthesilverscreensincetalkingpictureswereinvented.Someproducershaveapparently,inasortofdesperation,decidedthatanysortofvoicemustdo: "we cannotwait."Butthebestoftheproducersknowthatacomparisonbetweenthevoicesonthescreenandthevoicesonthestagewillalwaysbemade,andthatinscreenenunciationandtonetheremustbeimprovement,especiallyas,atbest,thereproducinginstrument,givestothefinestvoicesamarkedlymechanicaleffect.Thevulgarvoicewillalwayshaveitsplaceonthescreen-thereisplenty of scopefOrit-butaudiences,growingevermorecritical,willrevoltagainstmuchofwhatnowpassesforspeakingonthesilverscreen.Andasthestagedoes representgoodvocaleffects,aswellasa goodmannerandappearanceonthewhole,asthelegitimatestagedoesprovidestillthebesthistrionictrainingobtainable,itisfromthestagethatthescreenwilldrawalargernumberofitsstarsinthefuturethanitdoeseveninthepresent.BUTonehearsitsaidthatthestageisdying,thata few yearshencetherewillbelittleofthelegitimatestage left, thisbeingtheexaggerationofthosewhoseethesituationfromaview ;Joint dlawetricallyoppositetothat of Mr.GeorgeJeanNathan.Isthatreallytbeprospect?WehearinEnglandthatthetheatredoesnotpay,butwhenoneremembersthecrowdsthatthrongtoseea successfulplayinEngland;remembersalsothelongrun of suchplays,andhowoftenitisdifficulttoobtainatheatreinLondon,oneissuspicious of thesepessimisticforecasts.AstotbeUnitedStates,Mr.GeorgeJeanNathanhaspointedout,andproved,thatatthopresenttime the Americantheatl'eis In averyhealthyeconomiccondition."Cons'ider,"hewroteinJuly,1931,"thislastseason.Largersumsofmoneyweremadeonplaysandshowsthaninseveralseasonspast."andwemustrememberthat1931hasbeenthe peak yearofthedepressionintheUnitedStates. "More andmore,"Mr.athaawrites,"theAmericantheatreislifting itself out of theemotionalchildhoodinwhichithad hep!1 placidlyrockingitselfforyears,andis enterin>; uponanadultcourse."ItisindeedthisdevelopmentandtriumphofthetheatrethathascausedMr.athantobelievethatthetalkingpictureisdoomedwithinthenextfiveyears.Buttheprimarysuccessesofthetalkingpictm'ehaveledtheadheremsofthepicturestosay (whether theybelieveitornot)thatitisthelegitimatetheatrethatis doomed.Thatisnonsense:thetheat.reis not duomed.Menandwomenwillalwayswis'h to heal'thelivingvoice,andnottorestcontentonlywiththemechanisedvoice;theywillalwayswishtoseethelivingactresses,theactorsinthefleshandintheirhabitastheyliveupontbestage:theshadowalonewillnotbesatisfying.Thetruthsimplyisthat.boththetheatreandthetalkingpictureswill tinuetoappealtotheplay-lovingcrowd,for hasaplaceofitsowntofillintheemotionallife of civilization.Andsincebothofthemdealwithhumanlifeandemotions,bothmustuselivingagentsfortherepresentationoflife.Andtbetheatre,becauseitisvividandliving,withagreattechniqueandgreattraditions,willalwayscompelthemovingpicturetoutilisethebestandfinest ofitsimpersonators of humancharacter,sincethesewillbethebesttobefoundanywhere.IThasalreadybeenmentionedthatthemotionpictureshaveamuchwidermediumofrepresentationandexpressionthanthestage.Hereisone of itsgreatadvantages.Andbecausethe film3 of thesamepicturecanbemultiplied,sothatapicturethatisbeingexhibitedinNewYorkmaybesimultaneouslyseeninKingston,London,Chicagc,Montrealand fifty otherplaces,andfiveyearshenceaswellastoday,itfollowsfromthissort of massmechanicalproductionthatthecostofgoingtothepicturesmustalwaysbeconsiderablylessthanthecost ofpatronis ingthe legitimate theatre.Astageplay 13 notproducedin half adezentheatresatonce;foronethingitbecomesassociatedwith
PAGE 9

931-32 PLANTERS'PUNCH7A DelightfulMixtureOfFactAndHumour CJ3ellilJeren tsWarsInJamaica,And CTheONFJ fanciesthat if inDecember,1831,somestrangerhadaskedanyprominentJamaicanwheretheGreatWarwasthenraging-assumingthatanygeneralEuropeanwarwasthenin pr<' gresshe wouldinstantlyhavebeeninformedthatthescene ofitwasSt.James,thatTrelawnywasalsothreatened,andthattherestofJamaicawasInahighlydisturbedcondition.Ifthe stranger, endoftheyear,andtherewasastirandathreateningmovementintheneighbouringparishoLTrelawny. And inSt.Elizabeth,Portland,St.Ann,St. ThomH:5 andelsewherestrikesofslavesbegan,and,withthat,amovementoftroops,ofmilitiatroopsespecially,andthepublicationofmilitarydespatches,proclamations,andallthatsortofthing.And,especia!ly,theemergenceofgenerals.inmilitaryterms,andofcoursethosegentlemenwho felt themselvessafeforthemomentbegantowalk about withamilitaryswagger.Theenemymusthedefeated.Thetroopsmustadvancein coluruni:l. Theartillerymustbemassed.HowdidNapoleondefeattheAustriansatWagram?HowdidWeilingtonbreaktheFrenchatWaterloo?Thesame ,actics mustbeemployedinSt.James.Wecan l\iAROO:SSINAMBUSH INTHEPARISHOFTRELAWNYIN ONE OFTHE '\IAROO:oi WARS.THEYARE AWAITING THEAPPROACHOF GOVERNMENT TROOPSratherpuzzled,hadthenenquiredwhoweretheene my and theirleaders,hewouldpromptlyhavebeen informedthattheenemyweredesperatehordesof rebellious slavesandthattheirinstigatorsandsecretcommandersbadgraduatedintheMilitaryAcademy of the localBaptistChurch,wereEnglishmenandministers whohaddevotedtheirlivestofomentingrebellion amongtheslaves.Ifthestrangerhadaskedstill whowere thedefendersoftheKing'speace:nthecolony, hewouldhavebeenoverwhelmedwith names;hewouldhavebeentoldthattheCom manderin-Chief wasoneSirWilloughbyCotton,a regularArmyOfficer,butthattherewerealsoahost ofothcr Generals,veteranswhohadneverbeen on a fieldof battlebefore.Theyweremilitiacommander.He wouldhavelearntsomeoftheirnames; I Cox, Major-GeneralMarshal,Major-Gene'ral Major-GeneralRobertson,andsoforth. was prolific 'ingenerals.Everyparishhadits militia,anditwouldseemthateverymilitiabadits general. Tosaynothingofinnumerable colonels and captains, allinnocentoftheelementsofthe military art.In December, 1831,quitesuddenly,areportwentabout amongtheslavesthattheKingofEnglandhad rlecreedthattheyshouldallbe free. Itwas further statedthattheslave-ownerswerepreventingthe King's orders frombecomingeffective.Theslaves were loyal,especiallyInanymatteraffectingthem elves. TheyarguedthatsincetheKinghadset t1:emfree-andtheybelievedimplicitlyinthepowerofMonarchy-itwasbutrightand prnper thatthey should seetoitthattheKing'sdecree shoultl be respected.TheKingwasbeingdefiedIttherefore behovedhisfaithfullegrosubjectsthey nad begun tothinkofthemselvesastheKing's showthatnonecoulddefyhimwithImpunity. Besides, whowantedtoremaina Sotherc was a slaverisinginSt.Jamestowardsthe THE numerouslocalMajor-Generalsgirdedontheirswords,mountedtheirhorses,andcalledouttheirmen.Thesemenwerewhiteandcoloured,withpracticallynotrainingordiscipline,buttheywereopposedonlytorebelslaveswhohadstillless.Andthemilitiaaswellastheregularsoldierywerefairlywellarmed,whilethe slaves hadbutfew guns betweenthem,andbutlittleammunition.Still, tbey weretheeliemy.Theslaves,ofcourse,didnotregardthemselvesastheenemy.TheyteokitthattheyandtheyonlyweretheKing'smen (an worner.)sincetheywerefightingtomaintaintheinviolabilityofHisMajesty'sorders.Theyreallybelievedthatthatfreedomwhichwassoontobetheirshadbeendetermineduponalreadyandwasbeingillegallywithheldfromthem;butthatbeliefof their:; didnotmakethemastersanythemorepacificorlenient.Themastersobjectedtoanyabolition,andtheywouldhavefoughttheKinghimselfhad tlwy possessedpowerenough.Nowtheywouldfight thE' rebelliousslaves.Thatwasnecessarytoo,for all'eady someoftheestateworksinSt. Jamesbut not thefactoriesortheGreatHouses-weregoingupinflames.Itdoesnotseemthatthe rebelE"wanten todestroyallthevaluableproperty.Probablytheyhadanotionthatsuchpropertywouldafterwardsfalltothem,ortheymayhavefeltthattheywouldstillhavetoworkontheestatesfor wage., andsoshouldnotdestroythemeansoftheirownlivelihood.Whatevertheirreason,theydidnot dest:ro;r asmuchastheymighthavedone.ALLtheislandwasastirandanxiousandafraid. TilE' Christmashadcorneanditwashardly over beforetherewerethousandsproclaimingwaronearthandIll-willtomen.'TheMajor-GeneralshastenedtoputtheirservicesattheGovernor'sdisposal;therealsoldier,SirWilloughbyCotton,hastenedtoSt.James.Everybodynowbegantotalk almost hearsomemilitiaMajor-Generalpractisingto himself thecommand,"Up,guards,andatthem!" Meantime thenewspaperswerenotidle.Thatweek lyjournal,TheSt.JagoGazette,wroteon January 7, 18;{2, that"wehaveeveryhope,fromwhathas already been done,thatwhenSirWil'loughbyCottontakesthefield, a fewdayswillrestorepeacetothecount:y."SirWilloughbywastakingthefield!Tothatpractisedsoldieritmusthaveseemed'moreliketakingtothegulliesandthehills.It was agreatwar.ItwasthebiggestthinginthecountrysincethelastwarwiththeMaroons.Weread of oneencounterbetweentheopposingarmieginSt.James,thataftera fierceattackonthepartof the rebelsonemilitia-manwaskilled:that was theonlycasualitysufferedbythe Government's forcesonthatoccasion.Wewonderhowithappened.Theenemy,however,weredrivenbackinconfusion,soitwasagloriousvictory.Thewar,indeed,didnot endure forlong.Theenemywereeverywheredefeated.Theenemyreturnedtowork.OnlytheestatesinSt.Jamessufferedmuchdamage.Never theless onefearsthatthegentlemenofJamaicaeverywileres'uffered atremendousfright.THEREwereanynumberofproclamationsofcourse.EveryMajor-Generalissuedone,andsomeGeneralshadmorethanonetotheircredit.Thelanguagewasdecisiveeven if thegrammarwasshaky;ofallthesespiritedutterancesoneperhapslikesbestthatcomposedbyMajor-GeneralRobertson.ThatherowasincommandofSt.Elizabeth, where nothinghadhappenedasyet.ButhefearedthattheexampleofSt.Jamesmightbeinfectious,andhewastakingnochances.Herewasa fine opportunityforwords,butwordswithaverypracticalmeaning."Ifanyfirestakeplaceon the properties,"he p\'rH:laimed, "Icommandthateverynegrohousebeburntdown,andalltheirhogsandpoultry

PAGE 10

8PLANTERS'PUNCH 1931-3Z killed, if anyhornedcattlebelongingtothem, they aretobekilledfortheuseofthetroops;also theli' provisiongroundsdestroyed."TheMajor-Generalmadeitveryclearthatthehornedcattlewould be eatenbyhistroops;butwhatwastobecomeofthe 31air. hogsandpoultry?Presumably,thesewould disapPEar. Thetroopswerebuthuman.Apigora fowlmighteasilybeconcealed.Alittledishonestyiscreditableinamilitia-man.Letusnotenquiretoocloselyintothefateoftherebels'pigsandpoultry.TherewasnorebellioninSt.Elizabeth,butonefanciesthatmanypigsandpoultrydiedsuddenlyandwereneverseenagain.OnecanimaginetheGovern ment'::: forcesmaintainingorderintheparishesbythesimpleexpedientofproclamationsandpettylarceny.Whynot?All'sfairinloveandwar,andmilitia-menhadgoodappetites.Itisalsoveryconsolingtoreadofhowmanypersonswereshot for fightingfortheirfreedom.Thedeathlistwasquiteasatisfactoryone,butthecasualtiesdidnotmainlyoccurinthefield.Theyweretheresult of summaryexecutions.Therebelswereeitherexecutedwhencaptured,orweretriedbeforeaproperlyprejudicedtribunalandshortlydespatchedout of thisworld.Theyweregiventhefreedomofheaven.TheyweretoodrmgerousforJamaica.BU'I'whohadputitintothemindsofthe slaves thattheKinghadwilledandcommandedthatslavervshouldceaseinJamaicaattheendof1831'!Thepiantersknew,thenewspapersknew, everyb0dyinterested inthemaintenanceofslaveryknew.Itwas tbe Englishmissionaries,andespeciallytheBaptistmissionaries,amostdangerousand b100dthirst\' body of persons,menwithnoregardfor mor'tlity, moralitybeingthemaintaining of the;'ight of somementoholdnumbersof their fellow-creaturesperpetuallyinbondage.TheCorn wallCmtTie'l', whichdidnothaveasingleslave amonb itssubs'cribers,norasinglemissionary amon;; its expressedthehope"Thatthe coWbloorle(l wretches,whohaveinstigatedoursemibarbarouspeasantrytorebellionandincendiarism," woulol. notescapedetection;thatindeed,itcontended,shouldbequiteimpossible,sinceeverybody knew whotheywereandwhattheyhaddone.The Cow'iel' furtherhopedthat"theexampleswhichwillbemadeofthew,will,wetrut,ensuretothos'e of uswhoseonly stake isinJamaica,futureprotectionforQUI'livesandproperty."The C01t7'ie1' didnotsay what theexamplesshouldbe:butonesuspectsithadinmindaseriesoffloggingstobe followed by a painful hanging.Threemissionarieswereactually arrestHl andmarched off togaol;theRev.WilliamKnibbwaschiefamongthem.Thegentlemenonthe n:)J"thside werequitepersuadedthatan ins-ur rection,whichdidnot s-pread beyond tbeconfines of asingleparish,andwhichwasquicklysuppressed,musthavebeenplannedandputintoexecutionbyeducatedEnglishmenwhoseconnectionwiththeBaptistChurchwasasufficientproofofhighmHitary gifts, diabolicaltreachery,anda cravingforbloodshed.Buttheydidn'thangthemissionaries.Thetimeforthatsortofthingwasgone.Andthoughthenewspapersoftheperiodimplored that onlymenwithalicenseshouldbepermittedtopreachanywhereintheisland-whichwouldhavemeant,andwasintendedtomean,thatthereligiousinstruction of theslavesshouldceaseforthwith-suchstrongdecisivemeasureswereuottaken.TheyletthearrestedmissionariesgoIreeafter a while:thesehadaverypowerful backing iuEngland.Andtheystoppedexecutingrebels,fortheveryexcellentreasonthat,whileslaverystill exist ed, a liveslavewasofvalue,whileadeadslave-hemighthavea soul,thoughthatwasextremelydoubtful-wasofnovaluetoanyoneonearthorany wher3else.And soendedthelastslaverebellioninJamaica.DuringitscontinuanceSirWilloughbyCotton"tookthefield"andMajor-GeneralRobertsontookthe pigs. II wQr:Sltar110us. IN these daysonethinksoftheMaroonsas havin;; beenaraceofdoughtywarriors,notunliketheancientScotchHighlanders,secureintheirmountainfastnesses,defiant of thelowlandenemy,periodically making raidsupontheestatesinthevalleysbelow,perpetuallyacauseofterrortotheGovernmentandto the Englishinhabitants of Jamaica.T)someextenttheywereallthis:unquestionablytheyhadtobewatcheddowntotheendoftheeighteenthcentury,whenthose of themthatrosein rebf':lion forthelasttime,inTrelawnyand St James,weredefeatedanddeported,firsttoHalifax,inCanada,andthentoWestAfrica.ButwhoweretheMaroons?Thenucleusof that bodyofpeoplewasformedinthefirstinstancebyNegroeswhohadbeenslavestotheSpanishmastersofJamaica.WhentheSpaniardshadperforcetoleavetheislandandfleetoCubatheygavefreedomtotheirslaves;andastheSpaniardshopedtoreturntoJamaica,theseliberatedslavesremainedastherepresentativesoftheSpanishowners of theislandwiththeintentionofharassingtheEnglish.Inaword,theseSpanishNegroesweretocontinuethe IVat' againsttheinvaders,andtheirimmediaterewa!'dwastheirliberty.TogivetheMaroonstheirdue,theygladly ful filled obligations,BetweenthemandtheirSpanishmasterstherehadbeenagooddealofreal Upintothemountains,therefore,whichtheyknewverywell,wenttheblackmenwho regard ed EnglishexactlyasdidtheSpaniards. The Englishweretheenemy.Andwarmustbemadeupon an enemy.NATURALLY,theEnglishsentexpeditionsagainsttheseSpanishMaroonsbutcouldnot sub dueorexterminatethem.TheMaroonsontheirpartslaughteredeverywhitemanorwomanthatventured tr: settleatanydistancefromthecoast;itissaidthattheybutcheredeverywhitepersonwhocamewithinstrikingdistanceofthem,withoutdistinction of ageorsex.Nowandthentheymade treatie:> withtheGovernment,whichtreatiestheybroke :1.!' soonas'itwasconvenient.AJamaicanhistorianstatesthat,withinhalfacenturyafterthecapture of thecolonybytheEnglishforces, upwards offony-fourActswerepassedbytheHouseof Assemblyagainstthe Maroon!>, andnearlyaquarterof amillionsterlingexpendedoneffortsfortheirsuppression.Theyconstitutedarealandaterribledanger.TherewaS' also anotherdanger.SlavesfrcllIthe English plantations,importedfromAfrica, would. often 1'un awayandjointheMaroons.Thustheranksofthelattergrewinnumbers.Thenin1730the war-bur;.! wassoundedandtheMaroons(whobyonemeansandanotherhadmanagedtoprocure gum, ammunitionandcutlasses)brokeintoabigwar and sweptdownupontheEnglishsettlements.This ",as the first greatMaroon '''.'ar. 'j!Ie wardraggedonforseveralyears;theEnglishplantersandtheirsubordinatesmusthavefeltthat they wereconductingavastcampaign against aterribleenemy.TheMaroonsprobablyrejoicedin beliefihattheyweresettingallEnglandatdefiance, though theyknewnothingaboutEngland.But,ofcourse,bythistheSpaniardswerenearlyforgottenandU'Joneexpectedtheirreturn.Thiswasa MaroC'll war, Il!ough theMaroonsconldhardlyhavehoperltodrivetheEnglishout of thecountry.Whattlley probably didhopeforwassomesortofformal !'ecognitlun asanindependentgroup of people,and that endwaseventuallyachieved.Atreatyofpeace be t.weenEnglishandMaroonswasatlastdecided upou in1738.Landwasgrantedtothemindifferent parts of t!:le country,notablyinSt.MaryandTrelawuy, andboth GovernmentandMaroonswereglad ofthese arrangements,forbothweresickandtiredofthe struggle. BUTtherewastobenononsenseaboutthetreatyiJetweentheMaroonsandtheEnglishin Thethingwastobedoneingoodformandstyle.inproperlanguage,withaflourishanda how. TheMarocI'. leaderwasoneCaptainCudjoe.whosenarneisstillrememberedandmentionedinJamaica.Thehead c:f theIslandwasGovernorTrelawny. Hisagent indealingwiththe,MaroonswasDr.Russell;andinthiswisetheArticles of Pacificationbegan:-"InthenameofGod,Amen. ,Vhereas CaptainCud.it'e.CaptainAccompong, .Captailf Johnny, Cav tainCuffee,CaptainQuaco,andseveralother Ne groes,theirdependentsandadherents,havebecninastateofwarandhostility,forseveral year., past,againstourSovereignLordandKing,andtheinhabitantsofthisisland;andwhereaspeace ann friendshipamongmankind,andthepreventing ofdfusion ofblood,isagreeabletoGod,consonanttoreason,anddesiredbyGodandman"(andsoonandsoforth)itwasenactedthat"allthosewithCaptainCudjoeshouldbeinaperfectstateo( freedom andshouldliveinamityandfriendshipan:!peacewiththeGovernment,andtheGoverlimentwiththem,"thattheyshouldundertaketoputdownrebellionsintheisland,thatthey Sh0u'(1 workwiththeGovernmentforcesforthat pUl'rose, andthatifthecountryshouldbe invadert by P.lIY foreignenemy,they(ortheirsuccessors)Shouldassistinrepellingtheenemywiththeirutmostforce, etc.AstoanyslavesthatmightrunawaytotheMaroonsinthefuture,theyweretobehandedback immediately tothechiefmagistrateofthenearestparish,andrunawayslavesshouldbehunteddownand dt];vered upbytheMaroons-therewasareward attacl'ed tothis.Butinthecaseofslaveswhohadfled to theMaroonsuptotwoyearS'previoustothesigning of thetreaty,theycouldremainas Mar0011s if they wished;but if theydesiredtoreturntotheir maste!'s andownerstheywerepromisedfullpardonandamnestyforwhatwaspassed,thoughoneisafraidthatsuchpardonandamnestywouldhavesubsequentlytakentheformofaterrificthrasning,laid en inprivate.Onedoubts if any of theS'e Tnnawayslavesoftwoyears'freedomavailedthemselvesoftheprofferedclemencyoftheirformerowners,There i!.' aJamaicaproverbwhichsays:"Manfoolonetime,nofool;manfooltwotime,damnfool."Thewriterisnotsurethathehasgotthewords ab solutelyright.Buthehasrenderedthesenseoftheproverbadmirably.WHATonelikesaboutthewordingoftheagree betweenCaptainCudjoeandtheGovernmentisitsdevoutreferencetothedesirabilityofpeace :Jlld friendshipamongmankind,andits gmve statementthatthepreventingoftheeffusionofbloodisag,eeabletoGod,consonanttoreasonand'desireclbyeverygoodman.Onelikestoreadthehumbleandholyobservationsofearlyeighteenthcentury 5'lave-cwners onthemindofGod,andonthedesiresofgoodmen.Ofcourseitisindisputablethatthey frequ'Ontly interpretedthemindofGo-dashaVingnoobjectionwhatevertoone'sfloggingaslaveto chopping off anarmoralimb,anearoranose,by W:ly ofpunishment,ortoworkingaslavetillheperished-foroftenitwascheapertoimportnewslavesthantopreserveasworkersthosewhoweregrowingweak.Thereis, too,intheMuseumoftheInstituteofJamaicaanoldirongibbetcontainingthebenes of afemale,andEdwardLonghassuggestedtcusthatitwasconsideredagreeabletoGod.consonanttoreason,anddesiredbyeverygoodman,thataladythusconfinedshouldbepermittedtoperishslowlyofstarvation, if indeedherexecutionersdidnotalsolight a slowfirebeneaththegibbet .,0 thatsheshouldnotsufferfromthecoldofatropicalclimate.Grantedthatpersonsthustreatedwereprobablyregardedasdesperatecriminals,thatleadersofaninsurrection,obeah-menorwomenwhohadpoisonedmanypersonsonanestate,andothersofthatkind,wouldbestarvedorburned to death.Still,thereweremorehumaneforms of executionavailable,andthepointisthatthosewhodidthesta:'vingandtheburningseemedtohavebelievedthat1heyweredoingsomethingfOrtheprotectioncfreligion,somethingpleasingtothemind oftheAlmighty, anddecidedlyathingwhichallgoodmenwoulddesire.Theyregardedthemselvesasthebestofmenandtheywerecertaintheyknewthemindof God.HOW didtheseMaroonsappeartoothers,andwhat waiZ tbeirmethodoffighting?Theyaredescribedasbcldinappearance,swiftandindependelitinmovement,athleticintheirhabits.Conscious()ftheirfrEedominacountrywherethemajority ofthemen oftheirracewereinservitude,theymovedaboutwithabearingwhichataglancedistinguishedthemfromslaves. v'-cre theycourageous?BryanEdwards almus: deniesit.Othersdenyitalso;mostprobably,whentbeMaroonswereatpeace,andestablishedonthe la:)dafter thetreatyof1738,whichthey observed until1795,theywerespokenof(inprivat.o) ratlH'1 contemptuouslybytheownersofestatesandotherrepresentativesofthedominantclassesoftnecountry. When afewMaroonswerearound,itis proballip thattheywerecourteouslytreated.Itwasa cac;'-aof "beforeDawg.itis Mr.Dawg,butbehind Dwa's itisonlyDwag,"andsometimes"COmnll)Jldawg"atthat.BryanEdwardsthinksthatthe Maro{)!;s wereterriblycruel,'eventotheirwives andchildrilJl. anditisrelatedbyEdwardsthataMaroonhadactuallybeenseentosizeone of hischildreT!bya leg,whirlhimaroundtwoorthreetimes,thendash hif' brainsoutagainstarock.Thiswassaidtohavebeendoneina fit of temper,butitmayhavebeen done in a fit of jnsanity. Besides,theMaroonscouldhardlyhave made thedashingoutoftheirchildren'sbrainsasortofregularpastime,otherwisetherewouldsoonhaveceasedtobeanyMaroons,Theremusthavebeensomecruelwretches amonbst them,butthattheywereasatribeguilty of an ab normalindulgenceincrueltyamongstthemselvesduringtimes of peacethereis noevidence.Ontheotherhandit is unquestionablethattheywereruthlessandbloo(1yfighters.IT isevensaidthatonatleastoneoccasion the Maroonsroastedanddevouredtheheartandentrailsof afugitiveshotdead,BryanEdwards says so;healsoaffirmedthattheMaroonshadno;licesense of smell,thathehimselfhadseenthem eat somerottenbeefwhichhadbeenoriginallysaltedinIreland-itreallydoesnotseemtomatterwherethebeefwassalted-thatthisbeefwaspreferred because it wag putrid,andthathehadseenMaroonsdrinknewrumfreshfromthestillinpreferenceto s'ome winewhichheofferedtothem. He didnotthinkmuchoftheirfighting.Heassertedthattheyusedtolurkinthewoods,andambuslJorrushatanunsuspectingenemy.An,! once,whentheMaroonswerehelpingtheEnglishtoputdownarebellionofCoromantyneslaves(in1760),notaMaroonwastobefoundwhenthebattlebetweenthesoldiersandtherebelswasproceeding.EdwardsaffirmsthatthecommanderoftheEnglishtroopsforsometimesuspectedthattheMaroonsthemselveswerehisassailants;itwasdiscovered,however,that,"immediatelyontheattack,the whole body of themhadthrownthemselvesflatontheground,andcontinuedinthatpositionuntiltherebelsretreated,withoutfiringorreceiving '1 shot."Wasthiscowardice?Orwasitonlyaplantolet the English bear thebruntofthebattlc?DURINGthissameyearof1760theMaroonswereaccusedofhavingbroughtintheearsofanum,bel' of rebelswhomtheysaidtheyhadengagedand. defeatp.d. It was afterwardsdiscoveredthattheyhad

PAGE 11

1931-32PLANTERS'PUNCH 9 THEREwerenowsometwenty-onepersonslivingintherunaways'town,whichitsfounders named"WeDOn'tSend,YouDon'tCome." wereninemen,eightwomenandfourchildren.Todealwiththemanexpeditionofwhitemen, aCC0111 paniedbyconfidentialnegroslavesandbaggage CRr riel'S,wasfittedout.OneaccountassertS'thattherewere"twenty-fourarmedwhitesandconfidential slaveR;' andtenbaggagecarriers,andtheotherac counts givemoreorlessthesamenumbers.At the yery thebandits,astherunawayswerenowdescrihed(thoughtheyhadneverattackedandrob bedanybody),wereoutnumbered:intheattacking party', too,therewerenowomen.Andtwenty-fourofthepunitivepartywerewellarmed.Whether,beforesettingouttochastisehan:ditryDIdtomaintaingoodprinciplesofconduct,theexperlitionindulgedinprayerwearenottold.Moreprobablyitimbibedrumpunch.Butitmarched valif:u,]y forth,stronginthesenseofnumbers and of arighteouscause,andaftersometimeit r:ama toanarrowpassinthemountains,which,it bad (OontinuedonPage 22) seemedalmostinhumanthatpeoplewhoweregiven thattheyreallyneededshouldwishtofly from itall.Most,however,couldnotescape;andthe oe,'asional runawayslavehadtobeverycareful;therewasnocityofrefugetowhichhecouldgo.Ifmany slaves escapedatanyonetime,theyknewthattheywouldbepromptlyhunteddownandbroughtback,orshot.TheirmastersandtheMaroonssawtothat. 1 'evertheless,nowandthenaslavewouldflee.Sometimes,tiredofhisfreedomandloneliness,andfindingithardtoobtainsustenance,hewouldreturnto hi'.! ownerafterawhile,beproperlyflogged, per hapsotherwisepunishedalso,andthenputtoworkagain.Therewereevenslaveswhoranawayperi cdica:iy; theywentonholiday.Itwasdifficulttoknowwhattodowiththesewhenslaverywasnearingitsend;for,somefiftyyearspriortothe end oftheslaverysystem,itbecameillegaltocutoffa m'ln's armorlegforpersistentandunauthorisrldepartures.Itmusthavebeenfeltbysomeoftheownersthattheabolitionofthisformofpunishmentwaspuresentimentalityandshowedthateverybodywasgettingtoosoft.Inaword,thecountrywas going tothedevil.Thetimemightcomewhenfloggingitselfwouldbeprohibited.Then,indeed,thecountry'sdegenerationwouldbecomplete.Itwasasadfuturetowhichmanygentlemenlookedforward.InOctober,1824,then,whileplantersdiscussedtheprevalentreportsofaprobableemancipationwithindignationandhorror,andwithassertionsaboutitsbeingmorallywrongfromtheviewpointoftheinterestsoftheslavesthemselves,arumourwentaboutTrelawnythat,milesawayintheinterioroftheparish.inalittlevalleysurroundedbyhighhillsandinaccessiblesavethroughnarrowdefileswhichcouldeasilybedefended,anumberofrunawayslaveshadmadeasettlementwheretheylivedinfreedom,cultivatingtheland,drawingfromita goodliving,andleavingthetownsandestatesoftheparishseverelyalone.Thisrepublicansocietyconsistedofpersonswhohadstolentheirfreedom:unquestionablytheywererogues,rebels,vagabonds,andabadexample.Shootingpartiesweresentoutagainstthem;threeoftherunawayswereshotandtheir heads broughttothetownofFalmouth,wheretheywereexposedasawarningtoallslaveswickedlydissatisfiedwiththeblessingsofaservilelife.Therestofthegroupescaped,retiredstillfartherinto,themountainfastnessesofTrelawny,andforsometimenothingmorewasheardaboutthem.Itwashopedthattheyweredead.Thenagainbegantherumours,theI'eports.Perhapsoneortwooftherunawayshadbeenseen.Theywerenowcultivatingmoreland,theyweregrowingaquantityofvegetables,andinordertosupplementtheirfoodresourcestheywouldexchangesomeoftheirgroundprovisionsforsaltandherringswithoneortwoslaveswhocamesecretlytothemtoeffectthisbarter.Theydidnotencourageotherstojointhem;theyknewthatifothersdidsotherewouldbeasearchandadiscovery,andtheslaveswhoknewoftheirexistencewereawareofthisalso.Butperhapsoneofthelattertalked,ormaybeabook-keeperdiscoveredsomething;whatactuallyhappeneddoesnotmatter.Areportspread,itgrew,itbecameaconviction.Andthewordwentforthamongtheoverseersandbook-keepers,thechiefemployeesoftheestates,thatjusticeandrightmustbemaintained,whichnoblesentimentwasexpressedinthedeerminationtohunttherunawaysdown.may!Javebeenmanypersonwhofeltthathalfadozenofthemwouldbesufficienttoreducethesedefaultingslavestoabjectsubmission.Buttheydidnot e::]Jress theirfeelinginaction.Thatmighthaveseemedvain-glorious.Andifdiscretionisthebetterpart of valour,itmayalsohavebeenconsideredbythe 6'entlemen ofTrelawnythatmodestywas quite nine-tenthsofit.There was already,intheyear1824,plentyoftalkaboutacomingemancipationoftheslaves. The latterbadheardthistalkandrejoicedinit;theownersofslavesandtheiremployeeswereconvincedthatwhatemancipationmeantwasruin,thedelivering or thecountryovertothesavages,andtheultimate Ruffering ofthe.savagesthemselves.They ar guedthattheslaveswereperfectlyhappyandcon tented, werewelllookedafter,notworkedtoohanl,andhadnotacareintheworld.Slaveswere1Iotobligedtoworryaboutwhattheyshouldeat,for they were tocultivateplotsoftheirmaster'slandforfood,andwhatpartoftheproducethey did not u::e themselvestheycoulddisposeoffortheirownprofit.Itistruethatsometimestherecamedroughtsandthenpeoplediedofhunger;butdeathwas lh<, commonportionofallhumanityandwhyshouldaslaveexpecttoliveforever?Theslave.then, tJad notasaruletofearstarvation;hewasmade towork topreventhims,elffromstarving.As for hi,; clothing,whyneedhethinkaboutthatwhenhe WOI'' solittle?Inthosedaysnoonearguedabout"thesimplelife,"and"backtonature,"buttheslave populr.t)on livedthesimplelifeandwasveryclose tonature.Asingleosnaburggarmentforthewomen, a pairoftrousersandasackofthesame materifll forthemen,and,behold,bothsexes werc clothed.Thefashionsdidnotchange.There w'!re nonightgowns.Yousleptinyourdayclothesoryou slept withoutthem.Inthewarmweatherthelatterprocedurewasfrequentlyadopted. A'3 forhousing,therewerethehutswhichthe slave'S themselveswereputtobuild,orlong rOW.3 o[smallrocms,called 'JarrackS'. Thesekeptouttherain,andalso thE: freshair.Whatmorecouldmendpsire?That,anyhow,iswhatthemastel'sasked, and thebondsmendidnotanswer.Theywere supposed tobehappyandcontented.Itwasnot wise for any ofthemtoexpressdiscontentorindicateunhappines'S.BUTsomeofthesepeoplewouldnowand then runaway. This wasdistressingtotheplanters,whocouldnotunderstandsuchingratitude.It GARDINER, DISCI;SSIXG OFPEACE WITHCAPTAIXCUDJOI" OFTHE 1.38 III !xtl'rntinatingilll1l'i!{UtHtlUUY9.THERE'S nothinglikecourage.Nothingliketho brayery whichenablesmento facefearful odds. But :t may tend tomakeamanconceited,sothatis probably why when, in October1824,itwasreported amon/; theplantersofTrelawnythatahandfulof runawu.y slaves weresituatedsomewhereinthemountainsofthatparish,itwasdecidedthat they shoulu beattackedwithadequatenumbers. THEMaroonswerewonttocovertheirbodieswithcreepersandlightbranches ofplants.Thusdisguised,itwas impossibleuntilyoucameveryneartodistinguishthemfromshrubsandlow trees:andwhenyoucamenearenoughto makethediscovery,youprobablyhadnotthetimeto make it.Theyfoughtwith longguns,muzzle-loading,ofcourse,andheavycutlasses.Theyusuallyworeashortpairofpantsandnothingelse, thoughsomeofthemaffected aroughsack evenwhenfighting.Theycarriedtheirammunitioninahornslungtotheirsideandovertheir left shoulderbyaleathernthong;theywereadeptsatseekingtbeprotectionandconcealmentof every tree,everydepressionintheground or rock availab1'e.Thishabitoftheirsitwaswhichcausedsomeobserv ers to believethattheywerecowards.But one seems tohaveheardoftheBoersof SouthAfricadoingsomethingofthesort, whilethoseontheoppositesidewhodidnotadoptsimilartacticshardlyeverlived longenoughtobewailtheirrecklessbravery.Aftertheirlastdefeatin1796theMaroonsneverrose ;;gain: therebelsweredeported,theotherswoull notriskasimilarfate. Ontheoccasionofthe Morant Bayuprisingin1865theycamedownatthe call oftheGovernment,burnedeverypeasanthou e withinreach,weresaidtohavetakena gaod many of thehandsomerpeasantgirlsuptotheSt.MaryandPortlandMaroontowns-butperhapsthcgirls had noobjection-andreceivedthethanksof the GovernmentandtheHouS'e ofAssembly.Asfortheir ownlastrebellionin1795,itisinterestingtolearnthattheHouseofAssemblyfeltandstatedthatbutfol'thebloodhoundsimportedtohuntthemdown,"therebels couldnothavebeeninduced to surrenderfromtheiralmostinaccessible fastnessE'fi." Dogs, then,mightreallyhavebeenS'aidin1795-96tohave won the war.Wearenotinformedthat they demanuedanythingintheformofawarindemnity.cut th(,se earsoffthebodiesofinsurgentslavesal readyslaininbattlebytheregulartroops.Thisparticularactdoesnot.however,onreflection,indicate cowardice somuchasasoundbusinessinstinct.Ofcou .. setheMaroonslied,butwhendidtheyeverset themselvesupasexamplarsofthetruth?Therewas a rewardofferedforeachpairofears,theseearstobeproofthattherebelshadbeenkilled.Ifthetroops, wHh theirbaggagefollowers(who,ofcourse,wereslaves),hadbeensosillyastoleaveeach deat! rebelinpossessionofhisears,theycould hardlycomplain attheenterpriseoftheMaroons.Besides,toleaveenemycorpsesontheground,to bedealtwith bythetropicalsunlight,wasahighlyunsalJitaryand evencriminalthingtodo:forevenin those daysitwasknownthatdecomposingbodiesspreaddisease. So While,beyondquestion,theMaroonswhoassistedtheGovernmentin1760toputdowna Coro mantyuE' rebellionwereguiltyof adeception,tbeparty oftheotherpartwasguiltyofstupidity ann negligence,andthereforemustberegardedascontributingtotheMaroons'exhibitionof a lack of financialvirtue.Tousea com mon saying,therewerefaultsonbothsides.ButiftheseMaroonswereascow ardlyasBryanEdwardssuggested,throwingthemselvesonthegroundwhenthere was firing,notshootingagunatan enemyexceptfrombehindatree, and sobeingonthewholerathercontemptible (oemen,onewonderswhytherewassomuchconsternationthroughoutJamaica whentheyagainaroseinrebellionin1795.ThisuprisingwasthelastMar oonWarofJamaica;andindeeditseem ed that,intheview oftheGovernmentandofthedominantcasteinJamaicaatthatperiod,itwastheGreatWarofalltime. TheEarlofBalcarreswasGovernor,and he showedtheutmostdeterminationto "savethecountry."GeneralWalpolewas incommandofthetroops.MosquitoIndianswithbloodhoundsfromNicaraguawere speciallybroughtovertopursuetbeMaroons.Theislandquakedinapprebension,estateswereattackedbytherebelliousmountaineers,nooneknewwhen someseeminglyverdantfieldmightresolve itselfintofierceyelling warrior'S intentuponruthlessblood.Forthatwaswhathappenedagainandagain.

PAGE 12

10PLANTERS'PUNCH1931-32TheCupandTheLipA Jamaica Novelinwhich skilfully drawn characters are set offbythe conditions characteristicofthe island TJJEIRlUGJL"ESSESTUEPRI:-ICEO:F WALES A:-IDrRIXCE GEORGEINGOLF ATTIRE ON THECONSTA.J..... T SPRI:-IG GOLFLINKSgenerallygiveriseMrs.Beaversham.thatyouwant tv clinedtobeverycriticalbehindone'sback.Mr.Pembertonwasgrowingatrifle stiff inthe legs, thoughheflatteredhimselfthathewasstillremarkablyyouthful-looking.Hewouldnot,therefore,flingthoselegsabout,orattempttogetmoreoutofthemthanwasnormallyinthemnow:tolookyouth,fulandto beyouthfularenotexactlythesamething.Yethecoulddance,andheverygallantly of feredhisarmtohishostessandledherintothe AtthatmomenthemorethaneverbelievedthattheLordhadhimunderHiscare. For thetunebeingplayedwasthatofanold-fashioneuwaltz,andtheoldwaltzwasadancewhichMr.Pembertoncouldmanageperfectly. He Gopyl'ightbyClearyan(l Elliott. wasjusttheninthatstateofmildexaltationwhichleadsmanyasuccessfulmantofeelandtobelievethatProvidencespendsmostofitstimein look ingaftersuchasthey.Presentlythere was amildconfusionamongthedancers.Onecouplehadcollidedwithanother,andthisollehadbouncedintoIVIr.Pembel'tonandMrs.Beaversham,thuscausingthema.slightbutverymomentaryinconvenience.Mrs.Beaversham secretly feltthatitwashighimpertinenceforanyordinarypersontocollidewithher,suchabeingcouldnotpossiblyhavethatnecessaryreverenceforwealthandpositionwithoutwhichthefoundations of theworldcouldnotbeaidtobesecure.As forir. Pemberton,he only turnedhisheadtoseewhoitwasthathadputahastyelbowintohisribs.hebeingpreparedtoforgiveandforget, if theoffenderwereaprettygirl.Andthistimeitwas.Shewasindeedverypretty,andbeforeshewaswhirled off shehadflungathim,everso brightly, aquick"sorry!"whichmadehim wish thatshewouldhithimagain,evenharderthistime.Whataface!-how wa" ithehadnevernoticedit before': Thenherememberedthathelivedinthecountry,and[orthefirsttime for yearshequestionedthewisdomofburyinghimselffarawayfromhisurball fellow-crea;;ures.wno woulddoubtless te delightedattheopportunityofsharinghissocietyinthemetropolis.Attheend of thedance,Mr.PembertonledMrs.Beavershambacktothesouthernverandah,wheretheyfoundtworocking-chairsandsatdown. Mr.Pemberton'seyesrovedrestlesslyoverthefacesofthedancersasthesestreamedout of theballroom;hewaslookingforthefacehehadseenbuta fewminutesbeforeandwhicbhadinterestedhimkeenly.Asgoodluck,hisownparticularluck,wouldhaveit,she wa'! walkingoutthroughoneofthe UPPE>r doors;whatwasstillmorefortunate.shewastraversingthewholelengthofthe pas5'age betweentheballroomandthesouthernlawn,andthiswouldshortlybringherwithinacoupleoffeetofhim.But,ofcourse,heonlysawherwhenshecameverynear,andshegavenoglanceinhisdirection.Againhewasstruckwithherappearance.Hehadanotherquickimpres "ion'of laugbingbrown eyes, bobbed,light-brownhair,whichgleamedsoftandsilkenintheelectriclight,straight,slendernose,andaprovokingpair of lips.Thenshehadpassedwithherpartner,ayoungmanwhomhedidnutknow.Hethoughthehadneverbeforeseenquitesoattractiveagirl."Doyouknowwhothatis?"heaskedMrs.Beaversham,indicatingwhomhemeantbyaslightmovement of hisheadandeyes. Mrs.Beavershamhadnoticed bow hiseyeshadbeenfixedonthegirl,henceshehadnodifficultyinguessingwhomhemeant.Sheliftedhereyebrows."Idon'tknowher"(shestressedtbe word "know")."butIhaveseenherandIbaveheardthathernameisLudford.Shehasbeenoutherenowfora fewmonths."UEnglish ?" "Yes;orsoI believe. Ihaveneverasked.Youseeminterested,Alfred.""She was theonewhobounced.intousdurIngthelastdance.""Butevenabouncedoesnottosomuchcuriosity,"laughed"Iamalmostinclinedtothinkdancewithher.""Well,whyshouldn'tI?Only Idon'tknowher,andasyoudon'teither,youcan'tIntroduceme, Isuppose?"HewaswonderingwbetheragreatladylikeMrs.Beavershamneedwaltforanintroductlenfranklyfondofcocktails,herhusband,her friend,;, herlife,theworld,andallthatthereinwas.Shewasaprettylittlesoul,shelovedgaiety,andeverybodywasglad of hercompany.Mr.Hepworth,aUI)ther of theguests,wasamanofaboutforty,Wll()hadinheritedmoneyandhadhad the good sens!! tokeepit;MissMaylandwas,strictlyspeaking,Dr.Mayland;shehadtakenhermedicaldegreeinEdinburghsometimebeforebuthadneverpractised and probablyneverwould.Shetoohadmeans ofher own.Butshelikedstudy,andshebelievedthatawomanshouldhaveanobjectinlife,thoughshe tlid notseemtohaveexactlydiscoveredwhatherobjectshouldbe.Shenowdevotedherselftophilanthropicwork,andfoundmuchamusementinstudyingthecharactersofthepeopleshemet.CaptainandMrs.Trevourwerethetwootherguests.TheCaptainwasattachedtothegarrison, andwas notedchieflyforasilentbutinalienable devo tiontowhisky.His wife, aratherfadedperSall,wasdistinguishedmainlyforanaptitudeforagreeingwitheverybody'sopinions.Thedinnerover,thepartystrolledinthedirectionofthehotel'sballroomwheredancing was al ready inprogress,Everymemberofthe party danced,evenMr.Pemberton.Buthewasratherpreciseinhismovements,nothavingacquiredanyproficiencyinthenewmeasures;hewasjustsixty,andheknewthatamanofhisage, "'ho wasalsoamemberof the Governor'sPrivyCouncil,mustendeavourtocombinedignitywithfun if he was tocommandtherespectofthelowerorders,and of hisown class,whowerein-universallyvotedtobe"sonice"bythosewhoknewthem.Mr.Smith-Parsley'sfather'snamehad been originallySmith;Smithandnothingmore.Butintheeffluxionoftimeithaddevelopedintoa doublebarrelledname,Parsleybeingaddedbytheoldermallbecausehelikedtbesoundof it.andthoughtit was somewhatmoreimposingthanplainSmith.YouugSmith-Parsleywasasolicitor,areallycleverlawyer,andpopularlyconsideredasthebrightestand be>::tof alltheyoungersolicitorsinthecolony.He was onlythirty-five,butalreadywasmakingahandsomeincome.His wife wasamerry,calCUlatinglittlewoman.CHAPTERONEByHERBERTG.DELISSER,WHENMr.PembertongotdowntotheMyrtleBankHotel,hefeltthat,sofar,theday had beenamosts'atisfactoryone,Hehadcome over toKingstonthenightbeforeandhadputupattheConstantSpringHotel.Hehadlunched,witha fewotherpersons,atKing'sHouse,andthenhadformedoneofthepartytakenbyHisExcellencySirArthurandLadyMugsleytotheKnutsfordParkraces.Ordinarilyhedidnotcaremuchforracing;but h'J wouldnothavemissedthisparticularmeetforanything;hehadknownbeforehandexactlywhatwouldhappen.TheGovernorandhisguestshadarrivedaftertherunningofthefirstrace;as they enteredtheenclosedgroundsthesemi-militarybandhadburstintotheNationalAnthemandeveryone had stoodtoattention,themendoffingtheirhats.Alleyeshadbeenturned upon thegubernatorialparty,andtheyhadnotfailedtoseethat.Mr.Pembertonwasamemberofit.Thatwassomethingtolivefor;nomancouldaccounthislifewasted,whoattimes,wasabletosavoursuchperfectsocialtriumphs.HewasearlyattheMyrtleBank,buthishostandhostesswerealreadyonthespotandwaitingforhim.Ml'.Beavershamwasa Sh01't,thinpersonwithagreyingmoustache,a foxy ex pression,andanairofgeneralpleasantnessthathadluredmanyamanintoabusinessdealchieflyprofitabletoMr.Beavershamhimself.Hiswifewastali.well-featured,undeniablygood-looking.Thearrogancewithwhichshecarriedherselfcontrastedsharplywiththeingratiatingmannerofherhusband;butshedidnotdeemitnecessarytoendeavourtoplacateordinarymortals.Shewasnotinbusiness,andthesocialmustbekeptdistinctfromthebusinesssphereofactivity."Youarethefirstto come,Alfred,"shesaid,assheshookhandswith l\1r. Pemberton."Oneortwoofthe others maybelate;somepeople, you know, havenoideaofpunctuality.""Itithecourtesyofkings,"sair[ Mr.Beaversham,astheyallwalked to wardsthelobby.HeintendedaCOI1lplimenttoMr.Pemberton,who,asamemberoftheGovernor'sPrivyCoun cil,mightfeelthathewasconnected,howeverdistantly,withhisSovereign."YonwerewiththeGovernorandLadyMugsleyattheracesto-day?"askedMrs.Beaversham,whoofcoursealreadyknewthathehadbeen. Hel'familyhadnotgonetotheraces.TheyhadhalfexpectedaninvitationtoaccompanySirArthur and LadyMugsley;tbathavingfailedtoarrive,theybaddecidednottopatroniseKnutsfordthismonth.Ittakesalittletimetolivedownadisappointment."Yes,"repliedMr.Pembertoncasually,butpleas'edthattbematterhadbeenmentioned.Otherpersons,surely,mustalsobetalkingaboutit."WhereisHazel?"heinquired,alludingtoMrs.Beaversbam'sdaughter."She'llbedowninamoment;shepromised in callforMissMayland,whosecarisatthegarageforrepairs.Ah,herearetheSmith-Parsleys."Mrs.Beavershamwent off togreettbeseotherguests,whileMr.Pembertoncheckedhishatin the coat-room,thenwenttositatatableindicated Oy Mr.Beaversbam,whichhadbeenreservedfortheservingoftbeBeavershams'cock-tails.Hefelthappierthanever.Aftertheotherguestshadarrivedandthecocktailshadbeendiscussed,thepartywentintodill neroInthemeantimetheyhadallreferredto Mr.Pemberton'spresenceattheracesthat afternocn, though,inthecaseofalessermanwbomtheyhadbeenobligedtomeetatdinner,theycertainlywouldhaveignoredthecircumstancealtogether,holdingthattheGovernorhadmadeasocialmistakeimperillingalltheprinciplesofsoundpublicadministration.Thereweresevenguestsaltogether,andMr. and MJls.BeavershamandtheirdaughterHazel.TheSmith-Parsleyswerethere,ayoungcouplewhowereautho,'ot "THE,YllITE WITCHOF ROSEH.d.LL,""REVEKGE," ETC.

PAGE 13

PLANTERS'PUNCH11"Iagree,"assentedMr.Pemberton."Ifyoumixwitheverybody,youwillloseyourownposition.fhavetoldArthur'0manyatime.Butthis M;5S Ludfordlooksanicegirl,andif she isanartist,thatmakesawholelotofdifference."Thenfortunewasagainmostkindto Mr.Pemberton.Mr.Beavershamcamealongtoseehowhiswifewasgettingon.Hehimselfdancedbutrarely,andatpublicdanceshemadeitaruletodancefirstwithhiswife.HewascertainthatthisprocedurewaS'dulyobservedandcommentedupon,andmadehisdancingasortofhighritualaswellasagreatandgloriousexample.Henowcametosuggest t() his'wifethatthisritualshouldbeproceededwith.And,inwardly,Mr.PembertonthankedGod. Mrs.Beavershamroseandwentawaywith her husband. Mr.Pembertonalsogotupwithalacrityandmadebiswayouttothelawn.HestrolleddownthePalmAvenueofthehotel,nowilluminatedbvmany-colouredlamps.Thelawnwaspartlyin light. partlyinshadow,andgroupsweredottedaboutit,sippingdrinks,laughingandtalking,whilefromtheballroomcamethesoundofamerryairtowhich a massofcouplesmovedswiftly.Mr.Pembertoncontinuedhiswalkuntilhecametowherethelongfrondsofthecoconutpalmswerestirringinthebreeze.Heascendedthe ::'hort esplanadethatoverlookedtheseabath;beY(JI1dweretheshimmeringwatersoftheharbourofKingston;overheadwasahalf-moonthatmaderadiantthetropicscene.Hewasinamoodtoberomantic. He hadhadahappyday,haddinedwell,hadinbibedjustsufficientchampagnetogivehimthatfeelingofexhilarationinwhichonecouldappreciatethebeautiesofnature,providedthatonehadanexcellentcigartosmokeandcouldlookforwardtomeetingpresentlyanuncommonlyattractivegirl. It wastruehewassixty,buthefeltquiteyouthfuljustnow.Twentyyearsago he wouldhavethoughtofhimselfasbeinganoldandalmostdecrepitmanatsixty,butitwaswonderfulhow,ashehaddrawnnearertothatage,hehaddiscoveredthatitdidnetmeanoldageatall.Hehadaltered his scaleofvaluesinsofarasagewasconcerned.Ateightyhewouldbe old,butthatwastwenty yearE1 away.Hewasnow,strictIyspeaking,onlymiddle-aged.Hehadenjoyedhislifehitherto;heintendedtoenjoyittotheend;hewasabachelor;hewouldremainabachelor.Butlifemightbe reud eredmoreinterestingtoabachelorby quaintanceshipandfriendshipwithlovelyladies,andhehadknownafewofthese, ill theverybestsociety,andithadbeen ple., santtoentertainandtobeentertained by them,andtheyhadalwaysbeennice to' himalthoughtheymusthaves'eenlongagothathewasnotamarryingman.Asarule,hehadnotsoughthisfriendsamongstanyexceptthebestpeople,thoughhehadnoticedthatsomeo.fthosewhowerenot tile bestto-daybecamesoto-morrow,andthatitmightbehazardoustoprophesyinsocietywhowouldneverbeamongstthebest. He, however,hadusuallywaitedtobequitesure;butnowhefeltthathecouldsafelyfollowtheadvicehehimselfhadgiventoMrs.Beaversham:hecouldrelax.HewantedtomeetMissLudford;quiteuddenly'shehadinterestedhim.Clearly,shewasnotyetinthehigherranksofsociety,butsheclaimedtobeanartist,andMr.Pembertonhadheardthatartistsels'ewheresometimesroseveryhighindeedsocially.Ifelsewhere,whynot here? And,indeed,whatdid'itmatteranyhow?Forthefirsttimeinhislifehewasconscious'of'acontemptforhard-and-fastsocialdivisions'anddistinctions,andhefeltproudofthatfeeling.He wa::; risingtonewheightsofmentalandmoralsuperiority.Meantimehemustfindhisnephewatthecloseofthisdance.owwasthe getintroducecitoMissLudford.Themusicceased,thecrowdwaspouring(lUeemorefromoutoftheballroom.Mr.Pembertonlefttheesplanadeandslowlytookhiswayupthe illtl minatedPalmAvenue,downwhichflowed astreamofchatteringpeople,eagerforthecoolnightwimlandtheglamourofthetropicalnight.Hereachedtheentranceto.thehotel'slobby;standingtherehesawhisnephewandtwoothel'youngmenwithhim.Hemovedtowardsthem,wonderingwhathadbecomeofthegirl."Well,Arthur,"washisgreeting,"howareyou?Ididn'tknowIshouldmeetyouhereto-night." He noddedtotheothermenashespoke.Heknew them bothslightly,butdidnotremembertheirnames."Onlymadeupmymindatthelastmoment te; come,"saidArthur."IranuptoKingstonto-dayandwasofhalf a mindtogobacktoPortlandtonight.ButIthoughtI'dstayover.Wonanythingatthe races?" "AfewshillingS'.Asyouknow,Ineverbetheavily."AnyobserverwouldhavenoticedthatMr.Pemberton'snephewresembledhimgenerally;yetthereofthenextdance,andthedancersbeganhurryinginfromthelawnandthelobby.Theyflocked in'.o thelongverandahontheirwaytotheballroom, amI Mr.Pemberton'seyeseagerlyscannedthefacesfortheonethathadattractedhim.Hemighteasilymissher,heknew,fortherewereotherentrancestotheverandahbesidesthewesterndoor.He Irept glancinginmorethanonedirection,therefore, and itwaswhenheturnedhisheadwestwardagain that hesawher,andanexclamationofsurprisealmostburstfromhislips.Fornowshewaswithanewpartner,and this wasnootherthanhisnephewArthur.Theyoungmanwasnoddingtohimgailyashepassed,and the girlwasalsolookinginhisdirection.Arthurcalledoutacheerygreetingto Mrs.Beaversham,whoreturneditwitha bowjustatriflecold.Thenthecoupledisappearedintotheballroom,andMr.Pemberton,whohadhalfthoughtofaskingMrs. i3eaver shamifshewoulddancewithhimagain,decidedthatitwouldbenicer if theysatoutthis dance. Thiswayhewouldthequickergetridofbor."It'ssohotinthatroomthatIdon'tfeelIoughttoaskyoutodancethisonewithme,Arabella",he said,; "besides,youaresointerestingaconversationalistthatitis'alwaysapleasuretohavealongtall,withyou.DidyouseewhoArthurwaswith ?" "Yes,andIcan'tsayIquiteapproved.""Butifthegirlisanartistandsellsobjectsofart,youknow."Idon'tseewhatdifferencethatmakes.Shehasotherthingsinhershop,andwhowouldbuyartisticobjectsinJamaicafromsomebodywedon'tknow'!Whenwewantthesethings,wegotoEnglandtogetthem,orwegetacatalogueandselectwhatsuitsus,andsendforthem.ItistrueArthurisyoung.butwhynotmixwithpeopleofyourown class?It neverdoes tohavetwoorthreesetsoffriends.""Iammoredemocraticthanyou,"laughed }dr. Pemberton,whojustthenfeltthathewasalmOSt asocialist,soexpansivehad his creedofequalitysuddenlybecome.HewishedthatBeavershamwouidputinanappearance.Itwasunreasonablefor Ben. vershamtoleavehimalonewithhiswifeforsolongatime."Well,whateveryoudo,don'teverintroducemetothatgirlifyoushouldgettoknowher,Alfred.Oranyofus.""IIright,mydear;Iwillrespectyourwis'hes.But,really,youaremuchtoostrict;youshouldrelaxalittle.""Ihave an unmarrieddaughter.Youare n. bachelorandhaveonlyyournephew.Amancanknowpeoplethatitis,bestthatawomanshouldnot.And if youoncebegintomixwitheverybody-"n.R.n. lltIXCE GEORGEEDWARD ALEXAXDER R.G.,G.C.V.O., llEUTE]\'ANT R.N., BORSDECKUBER 20, ]002. THEPRINCE JUS BROTHER, 'J'REP.RI:"iCJ'OJ!' WALES,TOJAJUAICA INFEBRUARY 1031 toa muchyoungerwomanbeforeaddressingher.Hewasaware tha: thereputedpossessionofmuch wealth confers ononesocialrightsandprivilegestowhichthepoorersortcanneverdareaspire."OfcourseIcouldnot",answeredMrs.Beaver with finality."IhavenowiS'lltomeetthe lady atany time,and th'lt iswhyIdon'tknowher.""What'sagainst her?" askedMr.Pembertoncon fidentially.Heknewthattherewasmuchtobesaidagainstnearlyeverybody,butthatnooneeverseemedto suffer fromaninsinuatedscandal.Andthesugge tion ofscandalalwaysgavea spice toconversation.Ithelped to mal_e lifeworthliving."I know ofnothingagainsther.Onlywemoveinquite differen tspheres,Alfred:thatisall." The voiceindicatedthatthatwasmorethanenough.Mr. Pembertonthoroughlyunderstoodherpointofview."Isee,"hesaid."I am toldshecameouttoJamaicatoopen sume sortofshop," Mrs.Beavershamadded, as thoughthat explainedeverything.Mrs.Beaversham'sgrandfatherhadbeena grocerin a smallway;consequentlyshealwaysspokewith somethinglikecontemptofcommerce.That was onewayoflivingdowntheho"rible pa t.Mr.Pembertonhadtoadmitto himself that, though hefelthewasoneofthemostliberalmindedmenalive,there was some thing wrongaboutthesocialstatusof anyonewho had to keep a shop. Astore obviously. different. Astorewascomparatively or positively alargeplacewhereaconiderableassortmentof goodswasstocked; it representedcapitalonafairly larg'.l scale. A shopwassomethingsmall.Theowner of a storemightbeadmittedtohavea right to socialrecognition,theproprietorofa shop was nobody.Andladies'rarelykept a shop unlesstheyhadcomedowninthe world.Eveniftheywereladies,theyseemedbytheirmethodofearninga liveli hoed to havesurrenderedtheirsocialrights.Hewasstillinterestedintheprettystrangerwhohadjustpassed;yethewasnowcon scious of feelinglessdesiretomeetherthan he had feltonlya fewminutesbefore.Hewould not,heconfessedtohimself,liketobeseendancinginapublichotelwith a female shopkeeper.Appearanceshadto be maintained. Mrs. Beaversham was inaconversationalmood.She wasusuallyinthatmoodwhen there wasanybodytobediscussed,a pedigree traced, astatussettled.Shewasa critic,onthe acidside;she was convincedthatshe owedittoherclass,andespeciallytoherself,thatthetruthabouteveryoneshouldbeknown;intheinterestsoftruthitself she toldit-whenitreferredtoanyone else.Herwholetruthwasalwaysomething morethanthetruth,forshead mitted noqualifyingcircumstances;shewould mention one'sfaultswithsimplesev erity. but wouldnottroubletosayanythingabout one'svirtuesatthesametime.Thusher word-pictureswereallinprimarycol ours; there wasnoshadinganywhere.See ingnowthatMr.Pembertonwas somewhat curious about this girl,andrealisingthein convenience toherofpersonsinhercircleassociating withpersonsnotinthatcircle, she feltthatheoughttobewarnedintime.Hemight meettheyoungwomanlaterandmight actuallywanttointroducehertotheBeaver hams. Suchthingshadhappenedbefore.Ithad notalwaysbeen poso'ible topreventcalami tie Still, oneshouldtryto;thatwasadutvnottobeignored. "Very little isreallyknownabouther,"shecon tinued."hecameoutthisyear,butwhatpartofEngland she came from,whoherparents are. whatshe didinEngland, whoshewas,andwhosheis, nobody here knows. Sheisn'tanybody,you see,or we hould haveheardsomethingdefiniteabouther.""That's so,"admittedMr.Pemberton;"shewouldhave brought letters,orshewouldhavewell,she would havegottoknowpeoplelikeyouin some way or other." "Quiteso.We wouldhavetakenherup,forImu.t admitthatshe looksquitepresentable.Butshe hadn't been hereanytimebeforesheopenedthisshopofhers.That'sevidentlywhats'hecameouttor.""What does she sell?" askedMr.Pemberton, thoug-h his interest wasrapidlywaningnow. Mrs. Beaver ham had almost killedit."CurioS'anclthings ofthatsoft;artobjects,she caUs them. I believe shesayssheisanartist,butthatisprobably only talk." "Objectsofart?"exclaimed Mr.Pemberton;"butthatis not the samethingas shop-keeping,Arabella;It I altogether adifferentthing."Hefeltelatedatleamingthatthisgirlwas one towhomthemys terIous appellation ofartistmightbeapplied.That word could cover amultitudeofthingsoffered fnr sale. Here was, asitwere, anewanglefromwhichshemightbeapproached.Justthen the orchestrastruckuptheopeningbars

PAGE 14

12PLANTE R-S' PUNCH1931-32weremarkeddifferences.Mr.Pembertonwasotmiddleheight,dapper,clean-shaven,withhair grey ingatthetemples,noseslightlyaquiline,andkeengreyeyes.Hehadastrongchinand finn mouth;hecarriedhimselfasoneveryconsciousofhisimportanceintheschemeofthingslocal. Youfeltthathewascarefulnevertoforgethimself.Arthur,ontheotherhand,wastall,somewhatloose ly-built,withblueeyes,brownhair,andstraightnose.Hehadanintelligentforehead,apleasantexpression;hisfacegaveyouanimpressionof good nature.Atbottom,youwouldhave concludE'd,his unclewasadeterminedman,Arthurmoreagreeable,moreloveable,whilestrength and
PAGE 15

1931-32PLANTERS'PUNCHI, 0) ByMISSSHIRLEYDERBYSHIREImpressedMeyampiandcho-cho,whilewehavenofishinEnglandwhosenamecanbecomparedwiththatofsnook.Itissopleasant,too,thewayinwhichyoucan take allyourmealsoutofdoors-everywhereIstayed,thereseemedtobe avistaofseaandlandwhichwasaspoeticasthemeal fpread beforeme.AtPortAntonio,thekling-klings,theirblackfeathersshininginthesun, used tocallsweetlytooneanotherandthenjumpontotheverandah,demandingcrumbswithalltheimpudentassuranceof success.Thegardenslopeddowntotheseaandoccasionallyboatspassedout of theharbourwithaloudhootoffarewell,anditwasallverypeacefulandpleasant.AtMontegoBaytherewasthesea,andagainatKingston,andwhenyoutookyourmealsoutofdoorsyoudidn'thavetoglancecontinuallyattheskyforthefirstappearanceofrain clouds. Youknewyouwouldseeeitherabrilliantsunor aq uallybrilliantstars.IonlyknowofoneLondonfamilyboldenoughtotakeitsmealsoutofdoorsduringthesummer.Throughseveralyearsof fftmiliarity, ithasnowceasedto beanobjectofsurreptitiouscuriosityfor the neighbours,butthecatsstillsitinserriedrowsalongthewallsandstarewithalltheirmight.Theopen-airlifeinJamaicaissomethingsodifferentfromanythingthatweareaccustomedtoinEngland.Thebathingis <;.dmittedly amongstthefinestintheworld,althoughittakesthevisitoralittletimetoridhimselfofthefearsengenderedbytheawesomestorieshehasbeentoldofsharksandbarracootas.EveninLondonwetrytosunbathenow,becausethedoctorssayitisso goodforus.butitisaptto be asootybusiness,notto becomparedwithsun-bathinginJamaica.Nowondertheobjectoflifeis togetasbrownaspossible,whentheacquirementof amahoganycomplexionissuchapleasantundertaking.Anditisalessoninconcentrationtowatchfervidsun-bathersturningthemselvesroundmethodically,atstatedintervals,toensureanall-overbrownnessofevencolouring.Whypeopledon'tgetsunstrokeinJamaicaisoneofthemysteriesofnaturethatcannotbelogicallyexplained.Butthefactthattheydon'tlendspointtotheratherstartlingtheorypropoundedbymychambermaid,whowasatreasurenevertobeforgotten.SheelucidatedtheideathatEnglandwashotterthanJamaica.Withsomereason,Ithink,IsaidthatIhardlythoughtthis could be so."Why,yes,"wasthereply,"inEnglandpeopledieoftheheat,inJamaicayouneverhearofsuchathing."Beforesuchirrefutableevidence,argumentmeltedwithinme.SOtheJamaicandayswentby,eachoneaddingitsimpressiontothestorealreadygarnered.Outofallthememories,someemergemor-eclearlythanothersanditisnotalwaysthebigthingsthatremainsodefinite-ImayforgottheexactcontoursofsometropicalvalleybutIwillneverforgettheexvression of thechickenwhowastryingtocrossaswollenriveronthewayto MooreTown.Eventhecarfounditdifficulttopassthrough.Howmuchmoreterrifying,then,forthechicken,'whocountedonthehelpofsteppingstonesandfound,whentoolate,thattheYhadbeensubmerged.Thereitstoodinmid-stream,itsneckstretchedforwardtenseandstrainedasitgazedlonginglyattheoppositebankandthen,withadespairingsquaWk, flappeditswingsinalasthopelesseffortandflewcrazilytosafety.Therewas,too,thewasherwoman,atermagantifevertherewasone. Ishouldhatetohaveentrustedmyclothestoherononeofherbadmornjugs,theywould,Iamsure,have poundedtoshreds.Wehadpresumedtotakeaphotographofher,againstthebackgroundofsomepicturesquefalls,atthefootofwhichshewasdoingherwashing.Butthephotographnevercame ()lit, asithappened;itresultedinasmurredstreak whieh represented,inreality,thewasherwomanhurlingherselftowardsus.avengefulfuryscreamingmaledictions.Itwasjustaswellwecouldn'tunderstandwhatshewassaying,otherwisewemighthaveblushedforweel{s.Butourhastydeparturedidnotplacateher.Nextday,passingthesamewaterfall,thereshewasagainandnotonlydidsherecognizeus,butshecalledout,withenormousvigour,justa few oftberemarkswhich,intheheatofyesterday'sencounter,shehadnot found timetosay.ButshewastheonlycrosspersonImetinthewholeofJamaica,acountrywhereeveryoneis so friendlythatthevisitorisalmostoverwhelmedwithkindness.Smallwonder,therefore,thattheWestIndiesarebecomingsopopular.SinceIhavebeenbackinEngland,Ihaveheardagainandagainofpeoplewhohaveeitherbeenouttothosedelectableislandsorareplanningtogonextyear.TheWestIndiancruiseisbecomingevenmorepopularthanthel\I[edit,erranean one,andpeoplewhohavebeentothe'WestIndies,andparticularlytoJamaica,canfeelnosurpriseatthisdevelopment.Jamaicawillalwaysrepresenttothemanislandwherethenaturalbeautiesofitssceneryareonlyrivalledbythenaturalkindlinessofitspeople.How jamaicaBaytoMontegoBay.isanexperiencewhichnovisitorshouldbeallowedtomiss.ThewholeofJamaicanhistoryseemstounrollits-elfbeforeyou,prefacedbythelongstraightroad,aglory of logwoodblossom,whichleadstoSpanishTown.ThereissomethingverysadaboutSpanishTown,withitsold,shabby,jalousiedhousesgroupedaboutthebrokenmagnificenceofKing'sHouse.King'sHouse,ruinedbyfirebutstillfrontedbytheelegantdignityofclassicpillars,seemssymbolical of thecontrastbetweenSpanishTownasitusedtobeandSpanishTownasitnowis.Itisinevitablethatthecentresofprogressshouldchange.MontegoBaylooksforwardtoaprosperousfuture,butinadmiringitsmodernityonecanstillspareasighofregretfortheforgotten,lonelydignityofGeorgianFalmouth.WhenonegazesacrossRunawayBay, and inthemind'seyeseesthat desp"rate littleboatwithitscrewofbeatenSpaniardssettingouton their perilousjourneytoCuba,itisstillpossibletolookwithsadnessupontheremnantsofthefine oldhouseswhicharefallinginto irn,parable decay.ONElearnsmanythingsinJamaica.Howtoeatanorangeproperly,foronething.Itis,afterall,animportantquestionwhichhasforyearsworriedthecompilersofetiquettebooks.Whywehavenever,inEngland,thoughtofpeelingthefruitandspearingitwitha l'ork, Idon'tknow.Itis,afterall.verymuchontheprincipleofa toffeeapple.andplentyofthem are eateninEngland,inallconscienCe. IamanxiouslywaitinganopportunitytoprovewhetherEnglishcattleareasintelligentasJamaicanones. Onmorethanone occa'3ion, whenour car suddenlybecamesubmergedinaherdofcattleandIhadreallygiveneverythingupforlost,apathwasmiraculouslyclearedforusbythestrongermindedmembersofthepartyleaningboldlyfromthewindowandshoutingfirmly,"Side!"WhydoJamaicancattleobeythisordersopromptlyandsodocilely?Notoncedidtheyshowanysignsof defiance,evenontheoccasionwhenthepresenceof aredhatinthe ear mighthavebeenregardedasjustifiableprovocation.No,theysimplymovedquietlytoonesideandallowedustodepartinpeace.Ifshouting"side"willhaveanyeffect onEnglishcattle,motoringtlno'JghDevonshirelaneswilllosemuchofitsterrors.TheendlesspageantryoftheroadsisoneoftheunforgettablefeaturesofJamaica.InEngland,certainly,theroadsareneveremptybutthesamenessof acontinualstreamofmotortraffictendsto be monotonous.ThetrafficinJamaicais of anin finitevarietyandeventhemotortraffic ismoreexcitingthanitisinEngland.Thereisalwaysa delightfuluncertaintyastowhichsideoftheroadanothercarwilltakeatacurveandthealmostinevitablepresenc'e ofprecipiceslendsaspiceofexcitementtoeventheshortestdrives.Thoselongprocessions nativemenandwomen,walkingtomar l:et inthemorningand back homeagainintheevening,remaininmymemoryasoneofthemostcharacteristicfeaturesofanislandwhichisfullofcharacter.Theirtirelessness (:"annot helpbutbe impressive.Theyswingalongformiles,fullofvigour.carryingheavyburdensontheirheads,andwhenonepassesyoucanonlymarvelattheperfectbalancewhichallowsthemtoswingroundsounconcernedlytostareatyou.Andthenthehundredsofpatientdonkeys,donkeysdrawingcarts,donkeysladenwithpaniers,andtheequallynumerousmuleswho, I am told,allrejoiceinthenameofAliceandneverfinditmuddlingtosharesouniversalacognomen.Alsotherearethepigs:mor,esquealingpigsithasneverbeenmylottosee. YounevermeetsuchsmallonesinEngland,itwasagreattemptationtoadoptoneasapetandtiehimupwithaneckletofpinkribbon.Butthesmallestpigsgrowintolargeporkersinthefullnessoftimeandsucha pet,therefore,wouldbeboundtoleadtodisillusionment.Butthelittleblackpigsscamperingalong the Jamaicanhighways,tosaynothingofthegoatsand kids whomonopolisethebanks,remainasoneofthepleasantdiversionsof acountrywheremongoo&erunacrosslikerabbitsdoinEngland.WHENIembarkonanyofthesesubjects,inresponsetomyfriends'requeststo"tellthemaboutJamaica",I findmyselfbeingledonandon;itisdifficult tomarshalintoordersnchakaleidoscopicrichnessofimpressions.Onesubjectopensupanotheranditisimpossibletocometoanendofthem.ThepoetryofJamaicanfood,forinstance;ourtraditionalSundaydishofroastbeef and Yorkshirepuddingis weH matchedbyyourtraditionaldishof cod-fishinackee,wehavenofruitsosucculentasthe purple andwhitelusciousness of thestarapple,noranydelicacythatcanoutrivalthesavouryflavourofblackcrab. The centre-pieceoffruit,cooledwithcrackedice.whichgracestheJamaicanbreakfasttable,ispoorlysubstitutedbytoastandmarmalade,ourpotatoessounddullwhencomparedwiththoseexoticequivalents,"I/ l' 'VilofindsthequestioJl, "What is Jamaica Like" a hardoneto answer I MISS SHIRLEYDERBYSHIRETHERE issomethingverycompellingabouta legendthatwillpersuadeawholeboat-loadof people toriseatanincrediblyearlyhourtoseea sunrise. Ihardlyknow how itcameaboutthatweacceptedthefactthatweshouldgetourfirstglimpseofJamaicainthedawn-light.Fewof ushadbeenout totheWestIndiesbefore,butgradually,asthedays slippedbyandtheever-increasingwarmthof tbesunpersuadedusto forget thecoldfogginesswhichhadbeenourvaledictionfromEngland,webegan totalkaboutthe day ofarrival."Ofcourse",wesaidtoeachother,"wemustgetupv-eryearlyonFriday,theysaythatsunriseoverJamaicaisa sIght not to bemissed".Fridaymorningcameandwedrankhurriedcupsofteainourdarkcabins,rushedthroughthelastbits ofpackingandwentupOildeckwithallpossiblespeed.Theskywasstillgrey,theseacolourless,themountainsofthemainlandstoodoutdarkandsombre.Nocolouranywhereandtheonlysoundthatofthelittlewavesslappingawayfromthesideoftheboat.Thensuddenly,withoutanywarning,theskybecametingedwithpink.Thepinknesswarmed to roseandthentogold;itspread,coveringtheskywithitsglory;lowdownonthehorizonwhere the colourwasrichest,appearedtheenflameddisc ofthesun.Theseatookonbewilderinglybeautifultintsofturquoiseandblue,themiststhatwreathedaboutthemountaintopsflushedinthereflection ofthesky,thegreentreesstirredinthefreshmorningairandthelittlecurvedbeachesshonebrilliantly wllite. 'Wedrewa deepbreath.Wehadseen tbesunriseoverJamaicaandknewthat,onceagain,traditionhadnotplayedus f-alse. 'Whatexcitement,afterthat,tonotethedifferentfeatures whichassuredusthatwereallyhadcometoa tropicalislandofthe'WestIndies.AllourjumbledimpressionsoftheSpanishmain,ofpiratesand ships oftreasure,ofdaringbattlesbylandandsea, of DrakeandRaleigh al'd NelsonandMorganand ahundredotherworthies,alltheseseemedfocussed, asitwere,bythesightofourfirstpalmtree. Andthisparticularpalmtreestandswellinview of arrivingtourists.Itisallbyitself,some wherepastthePalisadoes,andgrowingtherebytheedge of theseaitseemsto offer anofficialandautbentic welcome tovisitorsfromcolderandlesscoiourful climes. Nosoonerhadwepassedthepalmtreethanwesawourfirstnatives,bobbingaboutintbe sea intheirfraillookingboats,providingabrilliant spot of eolour withtheirgayclothes.Then. for the firsttimeinfourteendaysourenginesstopped,the doctor came on board.Wemovedoncemore,sail ing overthesunken of oldPortRoyal.Howmany of uswonderedif.inthatquietmorningair,we mi?;ht nothearthebellspealingfromthesteepleofthatfamoussubmergedchurch?Yettherewas,afterall, notimetolistentoghostlyChimes,wewere moving quickly uptothewharfandinafewmomentshad accomplis:led thefirstofour am bitions. We hadsetfootin Jamaica. SINCE I been inEngland,somanypeoplehave sald to me, Tell me.whatisJamaicalike?"and eachtimethequestionhasseemedmoredifficult to answer. 1<'or youcannotposs'iblydescribethewhole ofJamaicainasinglesentence."Isitveryhot?" I have been asked,andassoonasIhavesaidyes, I have remember-edthecoolbreezesthatblowdownfro111 the mountains' upConstantSpringway. "Of cour eitis averytropicalcountry,isn'tit?"I have also been asked,andmyinstinctive ac quiescencehasbeenhalted1,yamemoryof Mon eague. CouldanythingbemoreEnglishlookingthanthatrollingcountry,withitsspreadingmeadowsand shady clumps oftrees?Eventhegreystonewall of England there. and thesoftwhitemiststhatcome up intheevening,blottingoutthepanorama of thehills. Only inEnglandwedon'thavethefirefliesdartingbrilliantlythroughthedarkness.nordolizards perch themselvesuponbegonia leavE'S andlisten,withaknowinglook. toall0111'conversations.Thatdriveto MoneagueandonpastRunaway

PAGE 16

14PLANTERS'PUNCH1931-32How ParamountCJ)oes It } TheEditor BehindtheScenesofoneoftheWorld'sGreatestMovingPictureServicesANDOFFICESINBROADWAY,NEWPRESENTLYwepushedthroughasilentswingingdoorandstoodatthefart.herendofanarchedcorridorscintillatingwithlight,paintedingleamingcolours,andadornedoneithersidewithpictures.Theparquetfloorwassmoothtothefeet;thiswasagallery sl.lch asonefinds InsomepalacesconstructedintheFranceoftheMonarchy."PeacockAlley,"Mr.Nathanmurmured;"thepatronsofour shows comeheretopromenadesometimes.Youcanimaginetheirpleasure.Manyofthemliveinratherdrabsurroundings,andtobeabletoenjoysomethinglikethisappealstothem.Theyappreciateit."InthecorridorsandhallsoftheOperaHouseofParisoneseesagainandagainthouslands ofpersonsofordinarypositionpromenadingwithanappearanceofpride,alookofpersonalpossession.Thebeautyandthegrandeurofpalatialsurroundingsaretheirs for thepriceofanoperaticket:theyarenotexcluded.,andsoarenotmaddenedwithangerandenvy.InthegreatpicturetheatresorpicturepalacesofNewYorkagreatand successi."UI attemptisnowmadetodelightandsatisfythesensuousinstinctsofordinaryhumanity:onepaystoenterashowplacetoenjoyanentertainmentwhichmightlastforacoupleofhours;inadditiononemaymoveamidstthelightandcolourofgorgeousgal.leriesorreposeinloungesprovidedwithInxuriouscouchesandchairs.Thusthelittletypistmaybe '1 princessforanhour.Foranhour,ifshewill, she mayenjoytheluxuryofpalaces.SomeoneopenedadoorinthisPeacock Alley; theredistinctlycame,fromthetheatrebelow, acrashoforchestralmusic.Thedoorclosedagain,andoncemoreitwassilence.Wewentstilllower,to '1 loungewhere,inthewinter,Iunderstand,cupsofhotcoffeeareservedgratistothosewhowishforsuchrefreshment.Wedescendedyetfarther,tothegroundflooroftheParamountBuilding,tothatpartofitwhichformsthevestibuleoftheParamountTheatreofNewYork.Andthistoowasa placeof beauty.inaveryshortspaceoftime,andnowoccupies ahighlyimportantpositionintheParamountorganisation.Heisabrisk,sharp,veryenergeticman,isapparentlyuptohiseyesinbusinessandkeenonpushingtheinterestsofhisbusiness.WetalkedforalittlewhileaboutJamaica,andIfancythathecouldalsohavetalkedaboutJapanhadIknownanythingregardingthemovingpicturebusinesS'inthatcountry.Hehasdonesometravellinginhistime,fortheParamountpeoplemakeittheirpolicytobecomepersonallyacquaintedwiththeterritorieswherearesituatedtheatreswhichtheysupplywithpicturesorwhichtheyown.PresentlyMr.Seidelmanwishedmeagood day, andI res'UmedmyconversationwithMr.Nathan.Heexpressedawishtoshowmeoverthebuilding,andespeciallyoverthetheatre.AndwouldIvisittheotherParamounttheatresinNewYorkandBrooklyn?Hewouldsendtomyhotelapassforthatpurpose;hewouldalsobepleasedtoknowwhenIcouldgoto see theParamountStudioinLongIsland,theretowitnessthemakingofatalkingpicture. He wouldsend,someonetotakemetothisstudio,theywouldbedelightedifIandmyparty(whichconsistedofoneladyonly)wouldlunchatthestudio:Imightalsomeetanystarwhowasworkingatthetime.Everythingwouldbearrangedinadayorso.Inthemeantimewemightvisitthetheatrebelow,usingthestepsinsteadofelevators,sothataswedescendedwemightbeabletotakeinsomeofthefeaturesoftheParamounthomeinNewYork.Iagreedandwebegantheexploration.MR.SEIDELMANhadbegunatthebottominthemovingpicturebusiness,learntmuchaboutitouts'ide,theskiesgrayandgloomy, abiteofwinteralmostalwaysintheatmosphere,andperhaps a smallfireburningintheroom.StillI,asatropicalperson,appreciatedimmenselythelargerofficesofNewYork.InthiS'particularoneIfeltparticularlyathome.Wetalkedaboutthepictures,theappreciationof inJamaica,theirholdupontheAmericanpublic:Ilikedthisquiet,well-dre.ssedmanwiththeculturedvoice:it was apleasuretomeethim.HetoldmehewouldverymuchlikemetomeetMr.Seidelman,whowasthechiefinchargeoftheCorporation'sdepartmentwhichhandledthewholeofthedistributionofpicturestodifferentpartsoftheworld.HetookupthetelephonereceiY-er:"Mr.Nathancalling,"he svJd. SoMr.Nathan"called,"andpresentlyMr. Seidelman,whoseemedtoinhabitastillhigherregion ill thisNewYorkskyscraper, responqed tothecallbyappearingonthescene.AndthenIdiscoveredthatIhadmethiminJamaieabefore.thatinNewYork,duringthesummer,thedaysaresometimesstiflinglyhot,whiletheheightofthebuildingsretardafreeingress and circulationoftheair.InLondon,ontheotherhand,veryfewreallyhotdaysareknown;awholesummermaypasswithoutanythinglikewarmthastheyknowitinAmerica.SoitisactuallyacomforttositinasmallofficeinLondon,withtheraindrizzlingTHEPARAlIlOUNTPICTURECOMPANY'STHEATREYORKMR.J B.Nathanis, Iunderstand,theChief As sistanttoMr.JosephSeidelman,whoisheadoftheforeigndepartmentoftheParamountPublixCorporation.Hesatbehindalargedesk,onwhichafewpaperswerearrangedinorderlyfashion,inalargeroomwithcomfortablechairsandwellcarpeted,theensemblegivingoneaninstant impressionofspaciousnessandcomfort.TheytellyouinNe"wYorkthatspaceissopreciousandtheareaofManhattanIslandsolimited,thatbuildingsmustsoarintotheskiesandrentalssoarevenhigher.YettheAmericansprovidecomfortableoffices,intheirnewerstructuresatanyrate,farmorethanisdoneinourownLondonforinstance.Itmightseemasthoughtherewaslessroomfor sortofthinginLODdon,butIthinktherealreasonis TIMES Squarewasclamorouswithnoises,withthetootingof innumerabletaxi-horns,theimpactof a thousandfeetupontheconcretesidewalks,themurmurofamyriadvoices.Itwasasummer'sdayinNewYork,theblueskiesshowingbeyondthesummitsofskyscrapers.withBroadwayatitsliveliest.The shops andofficeswerebeginningalreadytodisgorgetheirarmiesofworkerswhowouldsoonbethrongingtherestaurantsandeating-housesthereaboutsfortheirdiurnalluncheon.ThebuildingoftheNewYorkTimesroseslenderandgraceful,likeasortofarrowheadofstoneprojectedintotheSquare,thenimmobilisedforever.To my rightasIfacedthisbuildingtoweredthehugebulkoftheParamountPictureCorporation'sgreatstructure,thebiggestinthiscentreofmagnificentedifices, amammothamongststonemonsters.'Butamammothamongmonsters'builtonaparticulararchi"tecturalplan,and-withnothingoftheuglinessofmere size withoutdesign,ofmerebulkdivorcedfromthedreamsandthefashioningofartists.WhenMr.Audley askedmetocallontheParamountPicturepeopleinNewYork,andmentionedtometheirofficesinBroadway,I ex pectedto findthiscompanyoccupyinga floorortwoinaBroadwayskyscraper.Ithadnotdawneduponmethat they ownedthisgreatbuilding,had erected itforthemselves,andthatwithinitswallswerenotonlytheCompany'sbusinessofficesbutalsothefamousParamountPictureTheatreofNewYork,oneofthetheatresspokenof,writtenabout,andpatronisedbymillionsfromallovertheUnitedStates.Onthisbrightsummerafternoon,then,IenteredahallcommunicatingwiththeelevatorsandthestairwayleadingupwardstothebusinessdepartmentsoftheParamountPictureCompany.Igavethenameof Mr.Nathantotheelevatorboywhospedmeswiftlytosomefloorhighupabove,(Ithinkitwastheeleventhfloor)andthereIfounda messengerinacorridor,discussingwithtwofellowattenrlantsbehindacounterinanalcovesometopicoftheday:itmayhavebeentheology,butdidnotexactlysoundso.HecarriedmycardintoMr.J.B.Nathan,Iinthemeantimesittingin a' paddedcouch-seatintheanteroomwatchingpeople,mainlyyoungwomenwithabusylookontheirfaces,passtoandfro.RathermorespaceherethanyouwouldfindinanEnglishcorridor,certainlymoremovement;butthentheAmericansaregiventomov-ingaboutmuchmorethantheEnglish,thoughI donotthinkthattheyaccomplishmore.Soonthemessengercamebacktome:"Mr.Nathanwillbegladto See you." ImurmuredsomethingabOl;t 01 myselfbeingpreparedtobegladtoseeMr.Nathan;for,iftherewaS'tobeanyjoyinthismeeting,IwasnotdisposedtoallowittobemonopolisedbyanynativeofNewYork.

PAGE 17

-1931-32PLA.NTERS'PUNCH15 MAURICE(CHEVALIER, Anexoticatarofthe Tl....kies. and trt"nlendonsl)-I>oJ)uJur withthe ladiesDIWl'RIClf, AGREAT Ei\10TJONAJ. ACTRESSwereaccompaniedbytheorchestra;forinthegreattheatresofthebigAmericancitiesonedoesnothearmechanicalmusic.Thiswasmassproductionofamusementwithavengeance,butthepictureswereonlyapartoftheamusement.Ifranklycon fess,however,thatitwasthepicturesthatIappreciatedmost,andIbelievedthatitwasthepicturestheaudiencecaredmostfor. I donotthinkthatvaudevilleandtherendering popularmusic would drawbythemselveshalfthecrowdwhichthepicturesattract,whilethepictures,ifofgoodqualityandappeal,couldcertaiulydowithouttheseaccessories.ITisdifficulttoinstituteareasonablecomparisonbetweenaewYorkpicturetheatreand,say,thePalace Picture TheatreofKingston.Here,withourbrilliantperpetualsunshineandouropen-airtheatrewecouldhardlyhaveday-timeperformances,thoughwedo have matineesattheCrossRoadsMovies.Herewebuildlightstructures,with,mainlytheskyforroof,andourmusicisthemechanicalreproductionofanorchestralperformanceinNewYorkorHollywood.Neverthelesswetoo,inouropen-airmovingpicturetheatres,cangiveaglamorousimpressionofgorgeousness.Naturehelpsus.Indeed.naturedoesthetrickforus.Thebreezesthatfanourcheeksarebreezesfromthenorthernhills, .he littlelamps of goldaboveourheadsarethe star,> ofheaven.Awave of happinessseemstosweepthroughourpicturetheatre;itisanemanationofthepeople'sjoyousspirits,anexpressionoftheirbubblinghilarity,thewellingupineachoneof afeelingofcontentment.Theemotions of eachofthemaffectthewhole,themusic,thoughof ameehaniseddescription,isusuallyexcellentevenifsometimesalittletooloud,theaudibilityofthevoicesonthescreenisusuallygood.Wearenotinabackwaterinsofarasthepicturesareconcerned.SothatwhenIfoundmyself,onmyfirstvisit tv theParamountTheatreofManhattan,thinkingofthePalaceTheatreinJamaica,Iwaspeculiarlycontented,althoughIknewthatnotindreamscouldwehavehereastructure of stoneandmarbleandplushandgilt,withscoresoflivingdancerstoperforminitandwithahugeorchestratorenderthenecessarymusic.EvenapartfromthefinancialoutJay,theconditionsherewouldmakesuchastructurewithitsaccessoriesunnecessary.AndImaintainthatthepeopleherewouldwearyofthevaudevilleandthefunnysketchesandwhat-notasaregularpartofthedailyprogramme.Itisthepicturestheyprefer.Itisdramawithsomerealrelationtolife.dramawhichisanillustrationoracriticismoflife,thattheyinstinctivelycrave for. Allthroughtheagesmenandwomenhavehankeredafterplays,comicortragic,portrayingsomeaspectofhumanlife.Wegetthesenowbymeansofmechanicalreproduction,Tiffany;andMr.MoraishastoldmethateverytendaysanEnglishpicturecomes tohim,forwhichtheJamaicadirectorsmadespecialarrangements.TheParamountPublixCorporationisconnectedwithnofewerthantwot.housandtheatresallovertheworld.yetitdoesnotholdasingleshareintheJamaicatheatres. Thp. JamaicaPalaceAmusement CompallY isnotonlyaJamaicainstitution,buteveryshareisheldinJamaicabyresidentsofthiscountry.ThearrangementsmadewiththeParamountpeo ple,bywhich .has beensecuredalargenumberofthebestpicturesproducedintheUnitedStates,havebeeninstrumentalinkeepingusintouchwiththelatestdevelopmentsin ing-pictureproduction.THEdayafterthisinterview,IvisitedthegreatParamountTheatre.Thethermometerstoodatsomethinglike88degreesintheshadeandwhenthetaxiinwhichIrodestoppedina trafficblockfortwominutes,IfeltasthoughIwereinan airless cubicle,withmyheadthrobbingasifaveinwerelikelytoburst.TheheathaddescendeduponNewYork,aheatwavebeginningsomewhereinthemiddlewesthadswepteastward,andIwhohadtravellednorthtoescapeourtropicalsummerwas.experiencingsomethingmuchworse.ButwhenIgottotheParamountTheatreandha(lpassedthroughthebigswingingdoorsintothegorgeousvestibule,andthroughtheinnerdoorsintotheauditcrium.Isuddenlyfoundmyselfin a genialspringtemperature,witha deliciouscoolnessbathingmybody,andthedarkenedinteriorrestfultomyeyesafterthegarishnessandglareoftheheatedstreetsoutside.InNewYork,asinLondon,themovingpicturetheatresareartificial-lywarmedinthewinterandcooledinsummer.Insideofoneofthemyoucanescapethediscomfortsofthecrowdedthoroughfares anll forsometwoorthreehoursenjoyinthesummer,nightorday, apleasantatmospherewhilewitnessingaphoto-playoravaudevilleperformance.TheinteriorofthesegreatewYorkpicturetheatres-theParamount,Hoxy,andthe passeseasilyinarchitectureanddecorationtheinteriorofthe"legitimate"theatre.Acriticwhobe.lievesinverydelicateshades ane] tonesmaysaythatthes'epicturepalacesreveltoomuchincolour,appealtoostronglytothecruderemetionalappreciationofthecrowd.But,afterall,thatmightalsobesaidofthedecorativeeffects ofsomeoftil egreatestofFrenchpalaces,withtheirpaintedroofsandmuralembellis'hments,theirmarblecolumnsandhighlypolishedparquetfloors. Iahlmyselfaloverofquieteffects,yetICOI1fesstohavingnoaversiontothe lIe corativeschemeoftheParamouutTheatre,andIknowthatitbringsafeelingofjoyandexhilarationtothemillionswhomakenopretenceto ahighlyaestheticeducation,butwho passionatelytoenjoythemselves.WHATstrikesthestrangeralso is theextraordinarilylengthy pro grammepresentedatthesetheatres.Thechiefpictureexhibited,the featur2 pictureofseveralreels,isbutoneitemofthatprogramme;there i3 usuallya two-reelcomicpieceasweil,and,ofcourse,thereisthepicturenewsoftheworld,orpictorialnewsbulletin.Yetthesearebutabouttwothirdsoftheprogramme.IntheRoxyTheatre,forinstance,Isawthemorespectacularpartsof"Aida"renderedonthestagebyliVing actor,> clothedinthecustomaryoperaticgarmentsofdiversecoloursandsingingtotheaccompanimentofanorchestrawhichmusthavecontainedbetweenthirtyandfortyinstruments.IntheParamountTheatreonthisdayofwhichIwritetherewasquiteaslargeanorchestra;therewere humorOl;.> dialoguesbywellknownartistes,andvaudevilledancing,and amusing sketches.Yougot,that ii!> tosay,somethinglikewhatyougetintheordinaryMusicHall.Therewasalsoaperformanceonthe great organbyanorganistwithaconsiderable reo putation,andwhenthemovingpicturescametobeshown,themovementsofthe shadow!' onthescreenYo can imagine foryourselfthethrillofthemultitudes whoselivesarecomparativelyhard,when they stepwithinanentrancehalllikethis.'fhey feel, liketheircompatriots of asomewhatbet ter financial position feelwhentheyentertheOperaHouseofParisandfindthemselvesinsurroundingsthatonce werethedelight of ahaughtynristocray."Tell mesomethingaboutthistheatre,"I Raid toMr.Nathan, as we pacedthemos'aic floor."Itaccommodatesabout5,600 people,"he,1Ilswered, "anditis opentothepublicfromaboutoneo'clock in the day,withcontinuous performances, until elevenatnight.""Itmust have costanimmensesumof money to build," I said."Itdid," he repliedwithasmile,andtoldmethe amount."Doyou care to goinsidenow,"he asked, "orwould you prefer toretnrn?"I told my genial ciceronethatIwouldprobablyreturn to the thelltre onthefollowingday,andwoulll al0visit the otberParamounttheatresinNewYork,and some otherpicturepalaces,notParamount,alse.with the object of seeing formyselftheattractionwhich these places exercisedontheNewYorkpopulation. "In lhe meantime," Icontinued."Ihavenoticedthatyousupply toJamaicaotherpicturesbesidestho'eyou make yourselves." "Of course," said Mr.Nathan;"Paramount makes helween sixty and seventy :;;ictures ayear,andinJamaica you change the plays sooftenthatourownwould nothehalf enough. buytheextrapictureswe need anddistributethemtothe theatres withwhich we are connected;butinourowntheatresof 'ew York, BrooklynandLongIslandweofcourseshow our own films exclusively." Aamatter of facttheJamaicatheatresaresupplied throughParamountPublixwithpicturesmadeby Warner Bros., TheFirst MetroGoldwyn. Fox,'niveral Pictures,Pathe,R.K.O.,Colombia and Fromtheroofdependedglowingelectroliers;in concesagainstthewallsgleamedmanyelectriclamps;supportingtheroofrosemarblecolumnsveined and colouredlike porphyry, whilefacing 'ehe great doors,throughwhichcomeandgothepicturelovers,thereweptupwardstothehigherstorey,with a circularcurve,twoflightsofmarblestairs.Anentrance, Ithought,suchasapalacemighthave, somethingmoreelaboratethanImyselfhadseeninany palaceinEnglandorontheContinent of Europe, saveVersailles.Itwassomethingtooglittering perhaps for apalace,whichafter all isalsoa home; there washeretoogreatanelaborationof splendour.Butonepurposeofitisanemotionalappealtothosewholiveinsurroundingslackinginbrilliancy:itwasdemocratisedsplendourlavishlyelaborated.

PAGE 18

16PLANTERS'PUNCH1931-3Zonsuchavastscalethatalltheworldmayseethem,andthoughmanyoftheplaysarepoorthereisasteadyimprovEmentdiscernible.ItheforenoonfollowingmyvisittotheParamountoffices, ayoungfellowcalledattheRooseveltformeandmyparty;hewastakingustothestudioatLongIslandwhereParamount makes someofitstalkingpictures.Thiswasnearlyanhour'srideaway,trafficblocksincluded.Thisstudio,whichIhaveseendescribedas "The Paramount Famous LaskyCorporation'sStudioatAstoria,LongIsland,"isabigbuildingcoveringalargearea,butapparentlynotmorethanthreestorieshigh.Admissiontoitisnoteasilyachieved;strangersunaccompanied by oneoftheParamountofficials, Iaminformed,nevergetbeyondtheporteratthedoor,andwhen you havepassedthroughthatfirstdoorthereisstillsomeotherfunctionarytodemandyourcredentials.Forheretimeis noiseatthewrongmomentmaymeanseriousloss;toomanyoutsidersonthespotwouldcreateanunwelcomediversion.So aspecialofficialofthe com!.Jany, alreadyinformedofourimpendingarrival.appearsintheentrancehallandtakesusunderhiswing.Heleadsusthrough a narrowwayintothestudio."Andwhenyouhearabellclang,"hesays,"pleasestandstillandbe very silent,forthatmeansthattheyare"shooting"asceneupstairs,andanynoisewemakebelowmaybeheardabove."Atthatverymomentagongclangedrapidly,andweallstoodfrozenlikesoldiersatattention.Nooneevenwhisperedaword.Notexactlyunderstandingwhatitwasallabout,Iendeavouredtoabstain ]'rom breathingbutfoundthatfartooinconvenient.Pre spntly thegongclangedoutagainandourguiderelaxedintoactivityandsaidthatwecouldgoalongnowandseethingsuntilanother"shot"wasbeingtaken.Imayexplaintothosewhodonotunderstandmovingpictureterminologythat a 'shot'inAmericadoesnotmeanadrink,asitdoesinJamaica,whereweshootprettyoftenandwithquitesatisfactoryeffect.Whenatamovingpicturestudiotheyaretakingpartsofa picture theyaresaidto "shooting"it.ButhadInotknownthisbeforehand,andhadbeensuddenlytoldinthestudiothattheyweregoingto"shoot,"Tshouldhaveshotlikelightningoutoftheinfernalplaee,sinceIampossessedoftheimmovableideathatshootingis a dan gErous processandlikelyto be 'Illpleasanttomiddleagedliterarypeople.IT isoutofthequestionthatIshouldsuccessfullyconveytomyreaderswhatamovingpicturestudioislike.Tomeitlookedmorelikeajunkshopthananythingelse. Ihadtowalkcarefullytoavoidstumblingovercansofliquidpaint,walkingtooheavilyuponslipperysheetsofquarter-inch1ron,collidingwithvastmovableelectriclampsofwhat.seemedtobe amillioncandlepower,andbruisingmynoseonbedsteadsorbureauxwhichwereshortlytoformpartof asuiteforamagnificentbedroominwhichsomebeautifulPrincessofFilmodiawouldreoceivethenewsofthedefeatofhervaliant troopR ledsogloriouslybyFieldMarshalRunaway.Ineversawsuchapeculiarmedleyofobjectsinmylife.OnlythepenofaBalzaccoulddescribeit."Youseethatcornerthere,"askedourguide,"withthosecouchesandchairs,andthepicturesagainstthewall?"Thecornerindicatedformedalargerightangle,thefloorofwhichhadbeencoveredbyacarpetnowrolledtooneside.Someofthemuraldecorationshadalreadybeenremoved,someofthefurniturehadbeenthrustaside.Theplace,suchasitwas,lookeddrabanddirty.But-"Wetookascenethere,adrawingroomscene,notlongago,"saidourguide."Ithinkitwasasceneinapalace,whichwilllookquitewonderfulwhenthefilmhaspassedthroughallitsprocesses.""Andtheexteriorofthepalace,"Iasked,"eauyoumakethatheretoo?""Oh,easily,ifnecessary.Orifthereistobealargegardeninfrontofitandmovementinthe gar den,wemaybuilditatthestudioinHollywood,intheopenair,orwemaytakeanactualbuildingsomewhereinthecountry,"HowdoyoureproducetheinteriorandtheexteriorofaplaceliketheOperaHouseinParis?"Ienquired."IhaveseenmanypicturesoftheOperaHouseonthescreen,withpeoplemovingupanddownthegreatstairways,andwalkingalongthesplendidcorridors,anditseemedtomethatyouhadtheParisOperaHousereproducedtoperfpction.Ontheotherhand,itmustcostalotofmoneytocollect crowdsintheOperaHouseitself,aswellastosendyouractorsthere.""Wecananddoreproduceanyhistoricalbuildingthatweneedinourstud;.os,"wastheanswerIreceived."Whatwedo,"eontinuedmyinstructor,"istotakeanumberof"stills"ofthebuildingbothoutsideandinside.Thesephotographsarefaithfulandperfectrepresentations of thebuildingsandfromthemw,ecanreconstruct,onanyscalewelike,anypartofanactuallyexistingbuilding."*"BUTyourscenesof ashiplabouringinaheavysea,"said1."Iknow,ofcourse,thatyoucannotpossiblyphotographtheexteriorofagreatlinerwiththewavesdashingoverherdecksinanactualstorm;foryouandyourpreciouscamerawouldalsobeinimminentdangerofsinking.ButI donotseehowyou dothetrick:perhapsbecauseIamnotareaderofthemovingpicturejournals."Myfriendsmiled."Atoyshipon a smaIJsheetofwater,withwavesartificiallystirredintobillows,canbephotographed,"he said, "andthatphotographcanbemagnifiedtoanysize,elike.Thentherushingofpeopleupgangwaysandcompanionladdersandaboutthedecks,represents,asyoumayhavenoticed,onlyasmallsectionofashipatanytime.Thatisalsoastudioscene. After thedifferentscenesrequired(orashipwreckaretakentheyarejoinedtogether,grouped,edited,andproducedastheplan of thedirectorrequires.""Isee;yougetthenecessaryillusionbyaplannedandcompletedcombination.Thatunityinvariety,whichisoneoftherequirementsofart(obtainedinthisinstancebymechanicalmeans)is-"andIwasjustbeginningtoenjoymyselfbygivingalearnedlecturetomovingieturepeople,explaining, so tospeak,theirownprocessestothem,andnodoubtexplainingthoseprocessesquitewrongly,whenthatmiserablegongupstairsclangedoutagainandcutshortmyrhetoricalpronouncementforever.Againwestoodsilentforaspaceoffiveorsixminutes,andagaintheclangoroussignalrangouttheintimationthatordinaryworkandtalkmightnowproceedasusual.Ihadnoticedthatthemomentthegongsoundedalltheworkmen,thecarpentersandothers,onthisgroundfloor ofthestudio,had,likeourselves,ceasedtomoveorspeak."Welose :'l lotoftime,which,ofcourse,meansmoney,byhavingtostopworkwhensometalkingsceneisbeingshot,"saidourguide,whenthesignalwasgiventhattheremightbenoiseoncemore."Wemayhavetopauseseveraltimesduringanhour.Butwehavebuiltabigcompartmentwheresomeofthe carpentersean workallthetimemakingthethingsrequired for thescenes,forwhenthosedoorsareshutnosoundcanescapefromwithin."Wouldyoucareto goupstairsnowandsee sceneshot?"Upnarrowstepswhichnotwopersonswalkingabreastcouldpossiblynegotiate,weclimbedtotheupperstory.Someworkerswerepullingaprisonapart;thatistosay,theywereremovingthebarswhichranforadistanceoffortyfeet,andwhichstoodbeforeaperturesrepresentingprisoncells.Whenyouseethatprisonsceneonthescreenyouwillimaginethatthosecellsstretchalongforacoupleofhundredsofyards;suchwillbetheillusion creaJted. Butasamatteroffactthegreatesteconomyintheutilisation,of andmaterial(andofcourse,time)hasbeenpractised.Themovingpicturepeopledonotgotoprison-(someofthem,however,dogo). 'Vhen theywanttotakeaprisonscene,theymakeit.Buttheymaygiveyouanexteriorphotographofanactualprison;suchphotographstheycantakewiththeircameraatanytime.Theirinteriors,thoughfait.hfulrepresentationsofexistingconditions,havetobemadebythemselves."Hereweare,"saidourguide,andweenteredasortof room. Ifoundmyselfwedgedbetweenanarrowwoodenframeofsomesortandabigstandcrownedbyanimmenseelectriclamp.IwasstandingOnsomesbeetsofmetalwhichrattledwhenImoved,andthegroundaboutmewaslitterpdwithallkindsof scraps andrubbish. The]1'wing picturedirector was sittingbehindthe cam"ras onwhatseemedtobeanoldsoapbox,andayoungmovingpietureactress,withlipsand eyebrows heavilypainted.waspercheduponthebackof a chair.Anumberofjacketlesspersonswerestandingorleaningabout.andtomyrightwasanoblongstripofpavement,lookinglikeconcreteslabscementedtogether.Behindthatstripofstudiopavement rose apolishedsurfacesomeninefeethigh,lookingliketheouterwallof abuilding."Whatisthat?"Ienquired."ThisisasceneshowingCharlesRugglesatacornerinFifthAvenue,"Iwastold. -.vants togotoprisontoescapegangsterswhoareafterhim;hehasdoneeverythingpossibletoinvitearrest,butthepolicehaveignoredhimsofar.owheisgoingtobegatastandinFifthAvenue,knowingthatthatis atrictly forbiddenandinthehopethathewillgotoprisonatlast.Heisdisguisedasablindmantoputthegangstersoffthe "cent, andisbeingledbythatlittledogwhichyouseehimholdingbyaleash.""SothatisFifthA,ienue!"Iexclaimed."Ishouldbeverypleasedindeedtocomehere,ifyouwillletme,whenyouaregi-/ingarepresentationofHeaven.Thatwouldbe Butnowthegongclangedoutoncemore,awhistlesoundedloudandshrill,severalvoicessharplyshouted"Silence!"Adeathlikesilencefelluponthescene,andthenthevoice ofthedirectorgavetheemphaticorder-"Speed!"ABOVEthelittlestripofstudiopavementhadbeenerectedtremendouslypowerfulelectriclamps,allpouringtheirintenseraysuponthepavement,andtheglareofotherlampswasdirectedtowardstheartificialouterwallfromdifferentan gles.Thiswastheartificiallightwhichhasenabledmovingpicturedirectorstodispensewiththeactualraysofthesuninmaking ;Jictures. Thenappeared Mr. CharlesRuggleswithhisattendantandhislittleblind-man'sdog. Mr.Rugglespresentlysteppedontothepavement,whichwasliftedaboutsixinchesabovethefloorofthestUdio,andpreparedhimselftobeledbyhisdog.Butthelittlebeastdidnotwanttoleadanybody,andespeciallynotMr.Ruggles.Insteadofgoingforwardit.turnedatrightanglestowardstheedgeofthepavement.Thensomeoneontheoppositesidebeckonedtoitsilentlyanditobeyedthesignal.Thecelebratedhumorousactor,nowblindforpicturepurposes,shuffledhis fewsteps along,histoolwasplacedforhimbyhisassistant,andheseatedhimselfto beg.Butthescenehadnotbeensatisfactorilytaken.Thedirectorgavethewordthatitmustbe d'Jne all oVcr Thereforeagainthesameprocess or walkingandof beingledcommenced,as soon asthegonghadclanged,thepeoplehadcried"silence,"andthedirectorhadshouted"speed!"Thistime,afterasteportwo,thedogranbackwards,andforonebriefsecondtheblindmanwasleadingthedogandnotthedogtheblindman.Thishaltedtheproceedings,andagainthetediousactingcommenced.Meantime,thewoodenthingatmybackwasboringintomyspine,thuscreatinginmybodytheutmostdiscomfort,whiletheelectriclampstructureinfront W:lS obscuringfrommyviewthefaceofaverywellmade-upyoungactresswhostoodsomewhereinthemiddledistance,totheleft.ThuswhatwiththepaininmybackandthepartialobliterationofmyVision, IwasbeginningtowishthatMr.Ruggleswoulddieandthatthedogweredead,andthatIhadrestrainedmycuriositytowitnessthemakingofatalkingpicture.However,afterabouthalfa dozentrials,thethingwasdonetosatisfaction,andthenIgatheredthatitwastobedoneoncemoreforfurthersatisfaction.AsImovedawaywiththerestofthecrowdtowardsthelunch-room,Iconcludedthatseeingatalkingpicturemadewouldbedestructivet.otheenjoymentof aplayinthecaseofthemajorityofpicture-lovers.Thereissuchathingasknowingtoomuchaboutsomethings."Whereignoranceisbliss,'tisfollytobewise,"saidthepoetGray,andheknewwhathewastalkingabout.Theillusionofthescreeniswhatthepicture-goerswant,nottherealityofthestudiowithitswearisomerepetitions,itsartificialreproductions,itsperspiring,anxious,harassed,a.lI1noyeddirectors,andaninfernalfiend III woodborlngintoyourback,whileanotherthinginmetalpreventsyourseeingalmosttheoneobjectintheroomthatyouwishtolookupon.THElunch-roomofthisLongIslandStudiowascrowded.ThelunchisprovidedbytheCorporation,thefood isplain,wellcooked,andplentiful.A goodlunchtherewouldnotcostyoumorethanseventy-five cents, butthereisnothingluxuriousaboutit.Thestarathundredsofdollarsa week. lune-hes alongwiththeordinarysuperata few dollarsa week,andthereisalsoalunchcounterwhere youmaygetyoursandwichesorahelpingofsomethingatastillcheaperrate.Inthisroomeverybodylaughsandchatsatease,isanimatedandrelaxed;withinanhourthefeedingisoverandbacktowork goeseveryone.Andthough you maysmokeinthislunch-room,notacigarettemustbe puffedinanyotherpartofthestudio'sinterior,unlessofcourseduringtheactingofasceneifsmokingis a featureofit.Theyvigilantlyguardagainstfiresinthesestudios.Theyknowwhata firewouldmeantothem.AfterlunchIwentbacktothecity.Ihadhadaninterestingexperience.Ihadseenthemakingofmovingpicturesbefore,butthemakingofa talkie,itseemsto me,involvesafargreaterdegreeofminutescene-taking,whilevoicereproductionhas adder1.ne\\" difficulties tothework.Forthetechniqueofthetalkiesisdifferentsomewhatfromthetechniqueofthesilentpictures.Theintroductionof thespoku wordhas made adifferencewhichwillbemoremark.edastimegoes on. =--

PAGE 19

19313PLAN T ERS'PUNCH17anee,assuredme,thatMr.Fletcherhad heenin duringthemorningbuthadleftabout half anhourbefore."Forbreakfast?"Ienquiredsweetly. looked puzzled,thenreplied:"No,Idon'tthinkso,"asifthatsettledthequestion."ButwhenwillMr.Fletcherbeback?"Shewasnotcertain,butsheexpectedthatitwouldbebeforelunch.IgatheredthatMr.Fletcheralwayswentbacktotheofficebeforelunch,andAFTERIhaddiscoveredthat :\11'. Kerr-Jarrettwouldbeatbreakfastateleveno'clock,orsoon el', andprobablylater,Isetouttomeetsome other gentlemenwhomIthoughtIwould see thatday.IdrovetoMr.WalterFletcher'Soffice. A yOHn:; lady,clothedincoolwhite.andlookingcalminspiteoftheheatoftheforenoenandmysuddenappear-hismind.Ithereforeproposedthatheshouldcom .. andhaveteawithme,andIe\-en offeredthatteamaybedescribedasbreakfastintheinterestofconsistency.ByH.G.D. cMontesoCJ3aYatCJ3reakfast Lunchand Work ANORTHSIDECITY'SPROGRESSWEareaUacquaintedwiththatpeculiarsensation ofsmallnessfeltwhenwecallatahouse,send in cards,andareinformedby aplausiblebut obviouslyuntruthfulmaidthat"Nooneisafhome." Weendeavourtoassumeanexpressionof credence,andeven tothemaidwepretendthatwe '///17'/;Jf, ./I'/I'JI'{':11:1'11'1/1'('IO.Tt:GO-BAY;t_'/,/'./'1//lr.1,J.nl.\J('.\/'11,"f,'11/1/;'//'11h,(!t.__ __ lLJ,USTRATJOXSHOWl:SGJW::-iT'EGO BAYAS IT APPEAREDABOUTA CEl"TURYAGO 5, dg lS11'.1.mISk,)1releo dy d;rklisnyrseeain ,an lad of6:ie, utelewthe, of kCIu-k helieve she isspeakingthetruth.Weretirewithnonchalance or dignity,butfeelinglike foolS', and we determine toberevengeduponthosepersonswho,to save themselves alittleinconvenience,arenotathomeatthe time ofourcalling.Somewhatsimilarwasthiswriter'sexperiencewhen, one day illJune Ial>t, betweenthehoursof nine and ten illthemorning,hebeganhispregrammeoftelephoningorcallingupon sume ofthepersonalities of Montego Bay.FirstofallherangupMr.Kerr-Jarrett. AmaidrepliedthatMr.KerrJarretthad goneoutridingroundhisproperty,anl[ateleven o'clock he would beatbreakfast.Thusferthe next couple ofhoursMr.Kerr-Jarrett waS' dis po edof.ButIrememberedthat,on apreviousoccasionwhenIwas in .10ntego Bay, Mr.Kerr-Jarrettwasatbreakfastatnine o'clock.Onanotheroccasion,whenIcalledatCatherine Hallaboutmidday,Mr.KerrJarretthad just finishedhisbreakfast.Ithereforeconcluded that arationalsurveyofthesituationwould bring everyimpartialpersontotheviewthatMr.KerrJarrettspentthehoursof.sayroughly,seven to twelve, consumingbreakfast.Themanseemed to have an insatiableappetiteforbreakfast:so to speak, he livedathisbreakfast-table. Conse quently, when alittlelaterinthedayIreceivedall urgent telephone messageaskingmeto withMr.Kerr-JarrettassoonasIcould,thefirstquestionthatIasked onthetelephonewas whether he was stillatbreakfast.Thiswasaboutoneo'clock in the afternoon.Theanswerwas"no";butI gatheredthathe wasjustthencontemplatingtea:teaatthe moment occupied aprominentpositionill MR. WALTERFLETCHER,ONEOF BAY'S )JE:S then,presumably,lefttheofficeforlunch,andthatasureandcertaintimetocomeacrosshimwouldbeimmediatelybeforelunch.Satisfiedthattherewasapossibilityofmeeting Mr. Fletcherthatday,ItrekkedofftoseeMr.EdmundHart.Mr.Hart'seldestson,Mr.AllanHart.tall,urbaneandlookingasthoughnoearthquake,hurricane,plague,pestilence,famineorsuddendeathcouldeverdisturbhisequanimity,greetedme witlI quietcourtesybutregrettedtosaythathisfatherwasnotin.Wouldhebeinthatday?Washe near orfar?Mr.AllanHartwavedhisarmslowly,symbolicallyindicatingaradiusoftenthousandmires.IgatheredfromhissubsequentexplanationthatMr.EdmundHarthadgoneouttodosomevaluationwork,tovaluesomepropertyorsomeperson,andwasnotlikelytoterminatehislaboursthatday.Igatheredthathemightbeanywherevaluing. thathewascertainlysomewhereintheworld.Ibegantowonderifanyonecouldeverpossibly sel) thepeopleofMontegoBayatanytimethatonemightreallywanttoseethem.Ilooked through thedoorsofMr.Hart'sstore.Yes.thereweresomefolktobeseeninthestreetsofMontegoBay;plentyofpeopleinfact.This Wi;S encouraging.Imadeupmymind:Iwoulddroproundtoseethememberfortheparish,Mr.PhilipLightbody;undoubtedlyhewouldbeinhiseditorialofficeandwritingsomethingabouttheWhiteSandsofMontegoBay.IfoundmywaytoMr.Lightbody'soffice.IaskedtobeadmittedtothePresence.Oneofhisemployeesshookherhead. "He hasnot come downtowork,"shesaid."He'maybeher.eintheafternoon.Ithinkheissleeping."

PAGE 20

18PLANTERS'PUNCH1931-32 TIEW OF POWERS1'A1'10:,\ ST. JA)IE' LTD.. :lIOXTEGOHAYDIYIlOX. SHOW IXG 200B. n. P. :llIR3LEES,BECliERTOX'"DAY4,CYLIXDER,4,('yeLl-; DIESEL r:'\IT reallybeenlookingaftersomeimportantmattersinthetownwhenI firs-t calledtoseehim,andMr.EdmundHarthadactuallyfacedtheperilsof floodedroadsinordertoaccomplishhisvaluation.And60forth. There wasnonewhocouldnotgivea goodaccountofhimself."YOIlsee,"saidoneman,"we work in Monteg()Bay.Weriseearlyandwetoillate."IgatheredfromthisgentlemanthattheyproposedtomakeMontegoBaya model forKingstonandeverytownoftheislandtofollow. I harlethemgoahead.ButIcancertainlysayfor peoplethatthey arc reallyonthejob of iml11'Oving theirlittlecity. They havebeenonthatjobforsometime;and they a rp goingto succeed,THEfirstnightIwasinMontegoBay this yearIdrovethroughtheelectrically lighted streetstothemovingpicturetheatre,andonthefollowingnightIgazeddownfromaheightuponthosesame streets, notingwithpleasure,asIhaddoneona previow; occasion,theilluminationbelow. Mymindwentbacktosometenyearspreviously,beforethe Hen riquesBrothershadinauguratedelectriclightinginMontegoBay.Howdarkanddullseemedthetownatthattime,withbutthefaintgleamfromkerosinelampsemergingfrom half closedwindows,with only oneortwoofthemainthoroughfareslighted thesurrounding darkness beingrendereddenserjnconsequence.Irememberedhowtherewasthen no picturetheatre,onlyatinyClubHouse,noBathingCiubwithanythinglikeadequateaccommodation.MontegoBaywasacountrytownstickingto the ancientways,orsoitseemed.Andthosewayswereveryancient.ButevenwhileMontegoBayseemedstatic,itwasmovingtowardsimprovement. ItS' awakeninghadreallybegun. My mindwentbackfurther.IrememberedthetownasIhad passed tbroughitinearlyboyhQod-.Atnineo'clockatnightitwaspitch-darkanddead:thecurfewsoundedearlyintheheartsandheadsofthepopulation,ifnotintheirears;therewasnothingtodoafterdusk.Asyoudrovethroughthestreetsatabouteighto'clockatnight,witha few starveling dogs yappingatyourhorses'hcels,youmightglimpsea fewfiguresmovingfurtivelyabout;butthepeopleasawholehadalreadyretired,andperhapsevenatthatearlyhourmostofthetownwasasleep.Gobackstillfurther.Gobackahundred yean;.The topographyoftheMontegoBayofthattimeisshowninthefirstillustrationofthisarticle.TheBayitselfwasasitisto-day,butaSCOreofsailingshipswerelyingatanchorinit,waitingnodoubtforcargoesofsugarandrum. The townclusteredalongtherightcurveoftheshore,withricketywoodenpiersjuttingalittledistanceoutintothewater,withthebusinessoffices,thestores,theshops,theresidencesmainlyof wood,withafewlargehousesperchedonthesummitsofsurroundiughills,thesebeingthehomesofsugarmagnatesand of considerablemerchants.ButwhileinthepicturetheMontegoBayof acenturyagolooksnotunlike the MontegoBayofto-day,therewerereallylargedifferences.Evenintheillustrationthesedifferencesareindicated..LTD., MOXTEGO ButMr.Fletcherknewwellwhathewasabout.HeinsistedthatIshouldseetheBathingHouse.HealsowantedtoshowmethechartoftheproposedPier.ButhereIwasunalterablyfirm. IassuredhimthatIhadnotimetostudycharts;Isworethattherewas sicknessinthehome. That didthetrick,andnowIbegantowonderwhetherotherMontegonianswouldsweepdownuponmeandcarrymeawaytoshowmethecemetery,orthenewestdevelopmentsinPanamaDisease. They werebestirringthemselvesnowwith tremendom: effect.Theywere seriously gettingawake.Inowfound,indeed,thatIhadtoapologisetothetown.Mr.Kerr-Jarretthadviolentlyrepudiatectonthepreviousafternoonmysuggestionthathedidnothingbutbreakfast.Hepointedouttome that inthemorningofthedayIhadrunghimuphehadrisenbetweenfiveandsixbytheclock and goneouttoinspecthisplantations.Itistruehehadreturnedhomeforbreakfast(aprocedure hefirmlydefended)butafterthathehadgoneintothetowntos'eesomepeople,andintheafternoonduringtherainstormhewasatameetingof the BuildingSociety.Thenhehadcometoseemetodiscussthepotenttopicofrumanditsrelationtogeneralwell-being,andthatdiscussionhadoccupiedatleastacoupleofhours.Mr.Fletcher,too,had"eaULDyouinformme,"Ienquiredwithscrupu-louspoliteness,"whethereverybodyintowneitherbreakfastsorsleepsorgoesonjourneysbeforetheafternoon,andspendsthewholeoftheforeuoondoingthat?"AgainIseemedtohavepuzzled the' natives;againMontegoBaymusthavefeltthatthiswasastrangecreaturearrivedfromKingston.Buttheladyansweredmepatiently."Mr.Lightbody,"shesaid,"wasawayinKingstonyesterdaytoattendanimportantconference.Hecameinlatelastnightorearlythismorning;soheisnotyetintheoffice to-day.""Ah,"Isaid."Yes, Iunderstand.Itis a conferenceabouttheNewConstitution.ortheOldDevelopmentCommittee,orsomethingofthat sort. Verywell,pleasegivethe edltor mycomplimentsands'aythatIcalleduponhim."Andnow, Ithought,IwillgotoseeMr.Eldemire.I was goinginthecartowardsMI'.Eldemire'sestablishment,whenhappilymychauffeurcaughtsightofthatgentlemantravellingrapidlyinthe op positedirection. "That isMr.Eldemire,"heexclaimed, ane! i!u mediatelyI ros-e tothesituation."Pursuehim,"Ipanted."Followhim if y,m breakeveryspeedlimitinthistown,where body s'eems toknowIhavearrivedandeverybodyisdoinghisbesttoavoidme. The secretisoutnow,"Icontinued."ItisascientificimpossibilitythateverybodywhomIwanttoseeshouldnot hI? perceptibletothenakedeye."SowetoreafterMr.Eldemire,passed his car,blockedtheway,andsi"gnalledtohimtostop. The poormanmayatfirsthavefeltthatthiswasacaseofahold-upbyamotorbandit.However,hestoppedhiscar,jumpedout,and we hadaconversationinadrizzle.IhadnowbeeninthetownsincetheafternoonbeforeandhadmetonlypeoplefromKingston,withtheexceptionof !\II'. Eldemire.Ifeltthatitwasabouttimetogobacktomyhotel,theretowaitfortheappearanceofMr.Kerr-Jarrett.Rainnowbegantofallintorrents,andinanhourortwothegullythroughthetownbecameatorrent. The populaceassembledoneitherbankofthistorrenttoshoutencouragementtotherushingwatersandtosuggesttomotor-cardriversthattheyshouldmakeanefforttocrossandbedrowned.Ifellasleepwiththeirdistantshoutsstillringinginmyears. Then fouro'clockcameand"EnterMr.Kerr-Jarrett."Wetalkeduntilsixandthenwentouttogether.Icalleditaday.THEnextdayallthecitizensseemedto beattheirofficesbydaybreak.ImetMr.EdmundHarl,whopreachedoptimismtome. That wasstrange,forIhadalwaystakenhimtobe apessimist.IsawMr.Fletcher,whocollaredmewitha firmand mas terfulgrasp,draggedmeoverthelandsiteoftheproposedrailwayanddeep-seapier,andthen took metotheBathingClubtoseewhatabeautiful place itwas. MyworkinMontegoBayhadreallybeen finkhed theafternoonbefore;thisinspectionofthetown'samenitieswassupposedto be apleasure.ButasitwasrainingcatsanddogsandIhadleftmyumbrellaatthehotel,Ibecamegravelydoubtful of thepleasure. .. .\M:)lo",rA.'COl\lPRESSORAl\DIK THEICE PLAXT;' ST. JA:llESl;TILITffin.-\yDI'\"ISI0X

PAGE 21

_.1931-32PLANTERS'PUNCH19 OFFICl':AXDPOWERSTATIOXRUILDUWS, ST. JA:\IES UTILITIESLTD., )IOY!'.EGORAY DIVISION,SITUATED ONjUARKET STREETTHE MontegoBayofthepresenttimeis, like Kingston, aplaceofsmallyards,atownwiththe housesattachedtooneanotherandrunningin blocks.OnthelevelsectionofMontegoBaytherearenolonger widespacesamidstwhichthebuildingsstand, with treesandgardensaboutthem.In1831almosteverywhereweretheselargeopen spaces,thesespaciousfruityieldinggardensamidst whichtheresidencesstood;andevenin the restrictedbusinesssectionofthetowntherewerebackyardsinwhichtreeswouldgrowspontaneously,and hereandthereintheunpavedthoroughfaresgrass sprouted freely.Thougheventhendignifieubythe name of a town,MontegoBaywasreally a big village.Itboastednobuildingscamparahie with those to befoundinFalmouth,theedifices of which,withalltheirruin,stillremindusofthedays when itwas believedthatFalmouthwouldpre sently rivalKingston,thechiefportandempOrillll1 of the island. MontegoBayindeedseemsto haye slumbered longandpeacefullyunti[sometwentyyears ago, whenitsuddenlywokeandbegantotakeitsfutureseriously.Butitiswithinthelasttenyearsthatithasmade most appreciableprogress;andthatprogress wassignalisedbytheflashing of the electriclightonitsstreets,bytheilluminatingwiththeelectriclightofitshomesanditsstoresand its hotels;itwasasthoughtheinjunction,fiat therebelight-hadamentalaswellas a material significance,sincemen awake inthebrightnessandslumberinthedark.Aseverybody inJamaicaalreadyknows,it waEo theHenriquesBrotherswhofirstestablished:mefficient electriclightingsysteminMontego Bay. Inaddition, theyimprovedtheice-makingfacilitiesoftbe town.ThentheHenriquesBrotherswereboughtoutbytheJamaicaPublicServiceCompany, with itslarge capital resources,itsintimacywiththelat.est developments intheutilisationofelectricity,andItsstimulatingpolicy ofpushingtheutilisation of electricity in everypartoftheisland.Prior totheHenriquesBros.goingdown to Montego Bay(in1897to beprecise),anattempthadbeen made byanAmericanengineertolightitwithelectricity.Butalthoughaplantwasinstalled,the whole systemwassounsatisfactory and evensodangerousthattbeGovernmentsteppedinand had operationssuspendedindefinitely.When the Public Service CompanytookovertheHenriquesplant,itdidsobyformingaspecialsubsidiaryin stitution called"TheSt.JamesUtilities,Limited,"which now operatesinMontegoBay,andto-day the town boasts of atwentyfourhouradayelectriclightand power supplyquiteasgood,thoughnaturallynotas large, asthatofthemetropolis.The power plan t consistsoftwogeneratorsof tbe GeneralElectricCompany ofEnglandmanufacture. Tlllll'e is, alsoan ,i.ce.plf,lnt op,eratedbr a :jO horse-power synchronousmot01' wIiicl1'providesalltheice necessary forthetownandsurroundingdis tricts. The dem:md forthiscommodityhas been growingsorapidlythatitisproposedtoincreasetheoutputbytheinstallationofanot.herunit.AllthestreetsofMontegoBayarenowlightedbyelectricityundercontractwiththeParochi?lBoard.Theprivateplantshaveallbeenabandoned,andthehotels;residences,churchesandpublicbuildingstaketheirsupplyfromthecompany'smains.Thebakeries,aeratedwaterfactories,picturepalaceandallotherutilisersofpowerinthetownalsouseelectricity.MontegoBayhasactuallymovedmorequicklythanKingstondidinitspas'sagefromdarknesstolight.INJamaicaourhistoryinthematterof lighting hasbeenoneofveryslowprogress;somethingquitedifferentfromthatofCentralAmerica,forexample,01'Cuba.What?stonishest.betravellerinCentralAmericaisthelavishusemadethereof elec t.ricity.UptorecentlyCentralAmerican towns wereburiedindarknessaftersunset.Inalltbehouseskeroseneoilwastheonlyilluminant.Thencameelectriclighting,andinstreetswhei-e grass stillgrowsluxuriantlyelect.riclampsshedabluishwhiteglareuponthescene,andinshackssuch as eventheJamaicapeasantryarelearningtodiscardelectricbulbshavedisplacedthetinkerosenelamps.Thetransitionhascomesuddenly,abruptly.Itis IlOW electricityeverywhere.ButinJamaicaonlyKingstonandLowerSt.Andrew,PortAntonio,MontegoBay,SpanishTawilandBlackRiverarelightedwithelectricity;inPortAntoniotheUnitedFruitCompanylongoperated an electriclightplant,maiulyforits' own businesspurposes,butalsosupplyinghouseholderswithelectriccurrentforlighting.ThisplanthasnowbeentakenoverbythePublicServiceCompany.ButinthematteroftbegeneralutilisationofelectricityMontegoBay,whichbegantouseelectric lighting onlyafterPortAntonio,BlackRiverandSpanish Town hadbeendoingsoforsometime,stands 3e candtoKingstonnow.Thisisanindicationof the spiritofMontegoBay;itwishestobebright;itlooksforwardtothefuture.Andwhileitbuysa largp. quantityoficedailytheSt.JamesUtilities,Limited.alsosuppliesfrigidairesoperatedbyelectricitytothehotelsandtomanyofthelargerresidence:,in 'and aroundthetown.Thuscoolnessandlight,andfacilitiesforpreservingfoodfordays,are avail ablethroughtheSt.JamesUtilities,Limited, and ifMontegoBayeverinstitutedatramway thoughthatdoesnotseemlikelyatpresent-itwouldbethesameinstitutionthatwouldprovidethisconvenience.MONTEGOBay is growingandwillcontinueto grow.Itmayseemasmallthing,butthenewClubHouse,withitsgolfandtennisgrounds,thatwasinprocessofconstructionwhenIvisitedthetownthisyear,isindicativeoftheforward-lookingattitudeof its leadingpeople.WhenMr. KIl1T Jarrettinsistedupontakingmethroughrainanflslushtoseethisbuilding,Ihadnoparticularwishtogo.ButwhenIgottothespotandsawthelargestructurethatwasbeingerected,witha floorspacefordancingwhichshouldbeabletoaccommodatesometwohundredcouples,withasituationfromwhichonecouldgazedownonthedark o-reen ofluxuriantbananafields,thelightergreenofbcane,theclusteredtownbeyond,theharbourofsilverwaterpaintedinshadesofcrimsonandpurplebythe.glObedsunsinkingamidstdark,angry douds, IrealIsedatoncethatthisplaceofsportandrecreationwasbeingbuiltforthefuture as wellasforthepresentandrepresentedtheambitionofthecitizensofthisnorthsidecitytoputMontegoBaymoredefinitelyuponthemapthanithadbeenbefore.I thisalsowhen,onthefollowingday,IwentWIth Mr.FletchertovisitthenewhomeoftheMontegoBayBat.hingClub.ThisbuildingwasalreadycompletedwhenIwasinMontegoBayin1930.ButIdidnottroubletogothroughitthen.ThisyearIwascertainlypleas'edtoseeit. The illustrationsinthis sketoh givenoadequateideaoftheap-to-dateandspaciousarrangementsm'adeforthecomfortofClubmembers and visitors.Downstairsarealargenumber .of cubicles,eachprovidedwiththenecessarybenchandrackforthehangingofclothes;inaddition,there is acommunalroomofampledime.nsionswherethemenwhodondt par" ticularlycraveforaspecialdressingroommaydressandundress.;andthereare'also.thefreshwater' s'llOwers; andeverythingiskeptinacleanand at tractivecondition.Upstairsisthereceptionhall,'whichisalso ; ballroomcapableofaccommodatingsomething'likethreehundredcouples. .On,tJ;te .sea;wardside of thjsbayroom, opentotherefreshingbreezesofthesea.commandingaviewof'those glorious sunsets. foJ: whichthebay.ofthe town isfamous,andlookingdownuponthecrystalwater!ofthe,bathingbeach,isaverandahwhere'scoresofpeoplemay.sit enjoyrefreshments,and parti,<:jpate in' mentofconversationamidst'exhilarating ingsengenderedbyairand sl,ya!?-d sea...Theyhavedoneremarka.blywellinthebuildingofthisnewBathingClubhouse, better thanIeyerthoughttheywouldhavedonewhentheyweretalkingaboutit.Ibelievetheyaregoingtodoremarkablywellalsowiththeirprojectedpier,thebigcommercialventurefromwhichsomuchishopedinMontegoBayandthroughoutthe 'parish of SL James.WHENMontegoBaymadeupits mind toget a deepwaterpier,itwentaboutthe busines"li withenergy.ThelateHon.W.CokeKerrtookupt.hoproject;anditmaytrulybesaidthathe dilld workingforit.Mr.WalterFletchernextattackedtheproposition.Hewor.kedhardtoconciliate the opponentsofthescheme,butitmustbesaidforMontegoBaythattheoppositionwasnotto a deepwater'pier,butastowhereitshouldbe constructed andthroughwhatpartofthetownshouldthe lines connectingthepierwiththeGovernmentRailway

PAGE 22

20PLANTERS'PUNCH1931-32"683Ineveryhome"Ovaltine"shouldbethedailybeverageforeverymemberofthefamily.Itisthecheapestinpriceandthemosteconomicalinuseofallformsofconcentratednourishment.Childrenprefer"Ovaltine"toplainmilkbecauseofitsdelightfulflavour.Theagedfind"Ovaltine"avaluableadditiontotheirdietary,particularlywherethedigestivepowersareimpaired.Inadultyears"Ovaltine"isequallynecessary.Itrebuildsbrain,nerveandbody,rechargesthenervoussystemwithrichreservesofhealthandenergy,andstrengthens the bodytoresistwinterailments.ThisperfectfoodbeveragesuppliestherichnourishmentextractedfromNature'sbestfoods-purefreshmilk,barleymaltandeggsfromourownandselectedfarm,s.Itcontainsinaconcentratedandcorrectlybalancedformallthefoodelementsessentialtohealth.HEALTHand vi talitvare maintained from childhood to old age if deli cious"Ovaltine"takes the place of ordinary beverages, OVflLTINE............. TONICFOOD BEVEl\AGE Builds-upBrain.Nerveand Body Soldbyall Chemistsand Store3. thousandsofthem,too,whohaveneverlefttheisland.ButintheirownchieftownofMontegoBaytheycannowseesomethingofthegreatworldpicturised,andonecannotdoubtthataspanoramasoftownsandcitiesinEuropeandontheAmericancontinentpassagain aUlI againbeforetheireyes,theywillincreasinglycontrastwhattheythusseewiththeirownsurroundingsandbemovedtomprovethosesurroundingswhereimprovementsaredesirable.Thenorthsidetown,oncesosomnolent,alwayscharminginitsownway,willshineoutinJamaica,notonlyasoursecondcitybutasacityofpeculiarattractions.Thoseattractionsareindeedapartofitsheritage;ctherwisehowarewetoaccountfortheloveexhibitedforitbysomanypeoplefromdifferentpartsofjamaicaanddistantcountries?Itsattractionswillbeincreased,notdestroyed,byitsmaterialprogress.Foritwillneverloseitscharmofbeingpartofanolderorder of thingswhilebeingalsoapartofthenewerorderwhichdevelopseveryday.MONTEGOBaypossessesonemovingpicturetheatrenow;itwillhavemorethanonein 'Lhe daystocome.Thetimewas,notlongago,whenithadnone.ThenanenterprisingAmerican,Mr.Emery,builtthepresenttheatre,andthepeopleofMontegoBaywereabletoseethesilentmovingpictureswithouthavingtotravelallthewaytoKingston.Thetalkingpicturecameintovogue,andthisyear(1931)theMontegoBaytheatrewaswiredfortalkingpictures.Thistheatrehas-aseatingcapacity of someninehundred,thepicturesthatareshownintheKingstontheatresareshownthere also: theyarethesa.methatarethrownuponthescreeninLondonorNewYork.TherearestillpeopleinSt.James,hundredsofthem,whohaveneverbeentoKingstonThereareTHEREisnothingsodepressingtothespirits as darkness.ThelureofthegreatcityofEuropeorofAmericaisthenight-brightnessofitsstreets,theilluminationwhichinspiresitsinhabitantstomovementandgaiety,dispellingmelancholyandbrooding.TherearethousandsinKingstonwhostillrememberthegloomthatusedtosettleoverthecitywhennightfel!andbutafewquiveringgasjetsfaintlyguidedthepedestrianhereandthere.ThesecancontrastthatsituationwiththebrightnessofsuchathoroughfareastheVictoriaAvenueofto-day,withitsgailylightedshops,itsilluminatedpicturetheatres,itsflashingadvertisingsigns;theycancontrast,too,thepresentbeautyandbrightnessofourCentralParkanditssurroundingswiththedeadnessanddullnessofitsomeyearsago.Kingstonislightedwithgasandwithelectricity;thebuildingsareinstalledwithelectricity,thepubliclampsburngas.MontegoBaypossessesanup-to-dateandperfectlyadequateelectricplant, J,11d whenthedeep'eapierisbuiltitwillblazewithelectriclight,andthenewhotelswillshineoutWithelectriclight,andsoontherewillbe nohouseof any pretensionsinthetownbutwillenjoyelectriclighting.Thusthevisitor,cominginhishundredsandhisthousandstoMontegoBay,willlookoutuponatown,orpromenadestreets,notshroudedin darknes!':, butcheeredandilluminedwithlight.noadditionalprotectionexceptasubstantialstructureandadequateinsurance.Thepierwillthereforebeadequatelyinsured. If itisdamaged,theInsuranceCompanywillfindthemoneyforitsrepair.Butthenorthwesternsideoftheisland is notasfrequentlystruckbyhurricanesasisthesouth-easternpartofit:notoftendoes'St. James experienceagreatcycloue.Andthoughthepier'sshedmightbedamagedbywind,thereisnoreas'onwhatevertoexpectthatthepieritselfwouldsufferauyinjury.Woodenpileswillnotbeusedintheconstructionwork,butironscrewpiles01'cylinders.Itwillbe averysubstantialstructure.Thispiermustundoubtedlyhastenthedevelopmentofthenorthwesternportionoftheisland:itwillbringmorebusinesstoMontegoBay,andsoaidmateriallyinthattown'sexpansion.Already,thewoodenbuildingsinthebusinesscentreof MontegoBayaregivingplace to stonestructuresof respectablesizeandneatappearance;thisprocess of desirablechangewillbehastened.Thebusiuesssectionofthetownwillgrow,residenceswill mc,e towardswhereverthereislandavailableforbuilding;asamatteroffactMontegoBaywillin 'Lhe futureexpandintwodirections:towardsLuceaanr1towardsFalmouth.ThehotelsofMontegoBayhaveincreasedandbeenenlargedduringthelastfewyears. The touristseasonlastsforonlyaboutthreemonths,yettheseestablishmentscateringforvisitorshaveinthepastdoneremarkablywellandwilldostillbetterinthefuture.Morehotelswillspringup.Therearefourattractionsforthetourists:oneisthebathing,thenextisthequaintold-worldcombinationofcountryandtownwhichMontegoBaypresentsandwillretainfordecades,thethirdisthesociabilityofthevisitorsandotherswhichmanifestsitselfsoquicklyinMontegoBay,thefourthisthebrightness of thelittletownafterthesunhassunkinablazeofcolourbelowtherimofthesea. AXVIEWO}' TIlEDOCTOR'S CAVEBA1'.1IlXG CLUB DAXClXG FLOOR AXDPAVILIOX belaid.MontegoBaywatooanxiousforthepiertoriskafailuretosecureit;cons'equently,atthebeginningof1930,theSt.JamesParochialBoardgrantedpermissionfortherailwaylinestorunalongcertainstreets,while the LegislativeCouncilshowedeverydesiretofacilitatethepassingof aPrivateBillgrantingtothepeopleconnectedwiththepropositionthenecessaryconcessionsandrights.OntheseconddayI was lastinthetownIwentwithMr.Fletcherover the groundalongwhichtheconnectingrailwaylineswouldpass,andfromhis wuart premisesIlookedalongtheroutewhichthepierwonldfollowfromtheshoretothedeepwater.Allthiswasnothingnewtome;asamatteroffactIhadoupreviousoccasionssurveyedthepierquestionofMontegoBayfromdifferentanglesandpointsofview.Mr.VernonHenriqueshadtakenmeaboutthefore-shoreofMontegoBaytoshowmewheredeep-seapiersmightbebuilt,eitherprotectedbyartificialorbynaturalbreakwaters.ButIlikedtogoaboutwithMr.Fletcher,forIappreciatedhisenthusiasm:ifIaskedquestionssuggestinghesitation01'doubts,itwastodrawforthemphaticexplanationsfromhim.Ididnotneedtobeconvertedtotheproject.Iwasoneofthefirstconverted.MONTEGOBaywillremembertheeffortsof :\011'. CokeKerrtoobtainforitadeep-waterpier,butthepieritself,whenaccomplished,will bemainlyidentifiedwithMr.WalterFletcher.Foritishisschemethathasbeenadopted.WalterFletcherwasbornatBlackburn,Lancashire,andtothisdayonedetectstracesoftheLancashirewayof spllak inginhisvoice.Heisashrewd,capable,quiet,energeticman.HecameouttoMr.ThomasSharpin1902asaplanter'sassistant;notlongafter thi hejoinedtheUnitedFruitCcmpanyasa bookl,eeper, andinaverylittlewhilehewaspromotedtobeoverseerofoneoftheCompany'sJamaicafarm.SuchrapidpromotionwasanindicationofyoungFletcher'scapacity,andmorewastofollow.HewassubsequentlytransferredbytheUnitedFruitCom IJanytoPortland,totakecharge of their inthatparish;thenhewassenttoCostaRicaasSuperintendentofoneoftheCompany'sDivisionsthere.Heremaineda fe w years inCostaRica;then,afterservingthenitedFrnitforsomeelevenyearsinall,heseveredhisconnectionwith andreturnedto'Jamaicatoenterbusinessonhisownaecount.Hehadambition.Hehadlongsincemadeup hia mindthathewouldnotallhislifebeanemployee,howeverwellsalariedandtreated.Lancashireisshrewdandsaving,thereforeitisnotsurprisingthatMr.Fletcher,onhisreturntoJamaicafromCostaRica,wasabletotakeoverLatiumestateinSt.JamesfromMr.JohnC.Farqu!larson,andthentopurchasewharfpremisesinMontegoBay,thusbecomingatonceaproducerandahandlerofproduce.Helaterondisposedofhisinterestinthebananapropertyhehadacquiredanddevotedhisattentiontodevelopinghiswharfandproducebusiness.HebecameassociatedwithGrace,Limited.ontheirfirstcomingtoJamaica,soldouthisMontegoBaybusinesstothemin1917,butretainedthemanagement;andwhenGrace,Limited,becameGrace,Kennedy,Limited,Mr.Fletcherbecameashareholderintheneworganisation,retainedthemanagementoftheMontegoBayendofit,subsequentlypurchasedthatbranchofGrace,KennedyandCompany,andagainbeganbusinessofhisownunderthenameofFletcherandCompany,Ltd.,ofwhichto-dayheistheManagingDirector.Andnowheisdevotinghimselftothedeep-waterpierprojectof Momego Bay.THEpier,whencompleted,willbelinkedupwiththeJamaicaGovernmentRailwaysystem,andthiswillenablefruitbroughtoverbytheRailwayfromManchester,St.ElizabethandSt.Jamestobecarriedtotheship'ssidewithoutthedoublehandlingandthelighteragewhichatpresentarethecostlyandsomewhatinconvenientmethO,dsthathavetobeemployed.Whenanortheris'blowing,thelightersinMontegoBayares'ometimesnotabletogoouttothewaitingships.Thisoccasionsdelay.Andhowevercarefulthehandlersmaybe, youcannotpassbananasfromatrain-cartotheground,fromthegroundtoalighter,andfrom'alightertoaship'sholdwithout.damaging some ofthem.The pier willeliminatethisinconvenience.Itwill beabout1,220feetlong,thefirst300feetpassingovershallowwater.Thissectionwillbe fifty feet wide,therestofitwillbe 110feetwide.Thiswidersectionwillbeprovidedwithashed680feetlongby56feetwide,theshedtobe asteelframewithheavygalvanisedil'onsheetingoverthesides,andwithroofandslidingdoorsofthesamematerial.Theengineersaresatisfiedthatthecurveofthelandtotherightasyoulook'fromthe Fletcher'::; Wharfoutintothebayisampleprotectionagainsttheordinarywindsandnorthersthatvisitthebay.Againstpossiblehurricane'destructiontherecanbe

PAGE 23

1931-32SHELETHIMDO,Werent '1' HEmost important,andin fact the only serious, objection anyone has ever found withRumas a stimulating beverage isthatunfortunatelycertain inferior types ofRumleaveanunpleasant after-effect of smell....s,LABE L'J NOODOUROFRUM.leyLEAVESaTHATRUMChTHEGood OldJamaicaRumhowever does no such thing....yetalthoughitis acknowledged the world over to be the most ideal combination of refreshment and nourishment, its charms have onmanyoccasions been disregarded on account of the erroneous ideathatRum....all Rum....is afflicted with,an odour none too pleasant. AllRumisNOT....andinanycase there is no necessity whatever totakeanychances, therewasa problem oncebutthathas been satis factorily solvedbyCharley's((White Label" ....Good Old Jamaica. with all the good there is inRum....andnone of the odour."WHITEforit 62-64 KingStreet,Kingston. Superblyblendccl by((geniusfrom the["crypickojJamaicCL's callesugar(l nclextra-m atu reel fOl'many long ycal'sWldcr the mostfa["ourablc condi tions,itis 110 1rondcl' that Cllal'ley's"TT'hiteLabel," ulliquein itsCJ'traordillal'y lJu/'ity (lnd mellou; IICSSso1'0pidlY becolI/ ilifftlle1["01'ld's most populal' Rum.,. Blendedill Jamaicaby CHARLEY

PAGE 24

22PLANTERS'PUNCH1931-32Builton amostcommandingsiteonthehillsofSt.Ann,1,216feetabovesealevel,ithasanidealclimatewitnthethermometerveryseldom going above80 deeTees intheshadeandanaveragenighttemperatureof65degrees.MONEAGUE rContinllCclfrom Page12)"Lovely,Arthur;andIenjoyedmyselfsomuch,thankstoyou.""Nonsense,you would enjoyyourselfanywhere,butIamgladIcameoverforthedance.Whowouldhavethoughtyou'dhavemetmyuncle!Andhe was takenwithyou;he spoi'i. tomeaboutyouafterwards.Itwasgreat!""Whatdidhesay?"sheaskedeagerry."Oh,thatyouare a verynicegirl,andthat he waspleasedtohavemetyou.HewantedtoknowhowIhadcometoknowyou.""Whatdidyoutellhim?""ItoldhimthatafriendhadintroducedmetoyouattheMyrtleBankthreemonthsago,andthatwehadbeenfriendlysince.Heseemedquitepleased.Iwasn'tsurewhether,whenheknew.Arthurstoppedshort,asifindoubthowtocontinue."Yes?"sheprompted."Well,whatImeanisthattheseoldsters 'lre verypeculiar,andasIamhisonlynear relatiY<, Iwonderedwhathewouldsaywhenhelearnthowveryfriendlyweare.""Whyshouldhesayanythingabout th'1.t, Arthur?There'snothingwrongwithme,surely!""Ofcoursenot,Gladys;youknowIdon'tmeanthat." His voicewasreproachful."WhatImeanis.well,hangitall,Iamveryfondofyou,youknow;Ihavetoldyouso.""Yes;butdon'ttellmesoagainhere,andinaloudtoneofvoice,"shesmiled."Thegirlsoutsidecanhearquiteeasily,andIdon'twantpeopletobesayingthatyoungmencomehereduringbusinesshourstomakelovetome.Soyouarerelieved,areyou,thatyouruncle has nopersonalorsocialobjectionstome?""Hecouldn'thaveany,"repliedArthurstoutly:"butIcertainlyampleasedthathelikesYOll allll thinksalotofyou.Itmakesthings easier.:' Shedidnotaskhimwhatthingshadbeenmadeeasier;sheknew.Arthurhadshownforsometimenowthathewasgoneonher;hecametoKingstontoseeherwheneverhecould;hewasalwayssingingherpraises,payinghercompliments;buthe had hardlyeverspokenofhisuncle.Sheknewthatthatwasbecausehefearedthatwhile"theoldman,"ashecalledMr.Pemberton,wouldhavenothingto say againstamerefriendshipbetweenhimandher,itwouldprobablybeverydifferentifArthurhintedatamuch closerrelati.ollshi.\l.Arthm' hadneverproposedtoher,thoughhehadmadeplentyoflove.Hehadshrunkfromsuchamomentousstep.Hethoughtshecouldneverguesswhatwaspassinginhismind,butshereadhimlikeabook;as,however, Wi1!; .he did not love him.shesufferednoemotionalmisery,nomalady of passionordepression;evenherselfesteemwasnotmuchwounded,forshebelievedinherselfandfeltcertainthatthepeople nvho lookeddownuponhernow,be cause theysaidshewasnobody,wouldbeverypleasedtoknowherlateron.Shehadagreat,aprefoundfaithinherfuture.Herself-confidencewassuperb;butforthatshewouldnothavecometothiscountry,alone,tomakealiving,andaplaceinsocietyforherself.evertheless,shewasthrilledtohearArthur say thathisunclethoughthighlyofher,andthatthusthingsweremadeeasier.Shelookedathimnowwit.hmorethoughtful,apprai::lingeyesthaneverbefore.Heassumedagreaterconsequenceinher minu.She mightnotlovehim,buttherewereotherworthwhilethingsinlifebesideslove.Position,forinstance."IamgoingtosuggesttoUncleAlfredthatheshouldinviteyoudowntoMapletonforaweek-end,"resumedArthur,"whenhehassomegueststhere.Iwanthimtoknowyoubetter,Glad;IwanthimtothinkasmuchofyouasIdo.""Thatwillbeagreatdeal,won'tit,Arthur'?"shelaughed."Awhaleofanamount,"heprotested "Butaren'tyougoingtoaskmeto sit down?""10,mydearboy,notnow.Thesethingsarenoticedandtalkedabout,andthereisanyamountoftalkinginJamaica.WhatabouttheLiguaneaCluhthisafternoon?Areyougoingup?""Well,yesterdayIthoughtIshouldhavetogobacktoPortlandto-day;UncleArthurdoesn't like metostayawayfromthe vroperty toolong,youknow.ButIguessI C:ln remainoverfora few hour:; longer,andthengobackto-night.""Itmustberatherhamperingtohavetothinkwhatsomebodyelsemayfeelandsayabout one':; movements,"observedGladysthoughtfully."However,Ishallseeyouthisafternoon?" uYes." "Good.Well,then,runawaynow. Ihaveasketchtofinish." "Oh,youartists,"hegrumbled,"foreverthinkingofyourwork."Shesmiled,shewasgratifiedthatArthurtookherartisticpretensionsseriously.Shenoddedto himgailv ashewent 'Jut.Then shebegantomakemarksonthesketchingpaper. rContinuecl Page 24) TheCupandTheLipNoVisitor toJamaica should without sponding timeatthis Hot.l.HOTEL Therewerelour childrenalso.Butit was notconsideredthatthesewereverydangerous.Still, of course,younevercouldtell.IT was hopedthataforce of 270menwouldbe more thanequaltooneoflessthantwentymenandwomen,and so intheeventitproved.Onefeelsgladtobeabletorelatethattheattackingarmy,showingtheutmostbraverywhenitfoundthattherewasnothingtobefeared,gainedacompleteIandsmashingvictory.Asthearmyenteredthetownitwasfiredupon,butnoonewashurt.The rebels' fire was returned,andtwoofthemfellmortally woundbd. Arebelwomanwasseenonahillside.Withadmirablepresenceofmindsomeshotswerefired :l ther,butwithnoeffect.Thiswasunfortunate,buttherewasstillhopethatthewomen would be s1:.Lin lateron. Acouple of hundredmencan,withpersistence,do alotofdamagetoeightwomen,particillarlyifthelattercannothandleguns.Thebattlewas Goon over.Thearmywasnowin ofthecity.Aftergatheringwhatspoilswero :lvailable intheformoffood,itdecidedthatIheplaceshouldbesackedandburnt:alwaysaplaceshouldbesacl,edandburnt in Jamaicaaftera fighLTherewassomethingaboutthisproced.urethat rE'minded thevictoriousforcesofancient war fare :J.Dd redoubtableheroism. Thr) provisionfieldsweredugup,thesurroundingsweremadeawaste.Justicewasdone, righLwasreestablished,amovementthathadbeendangerous, hl.'ing confinedtothecultivationofprovisions,hadnowbeenputdownwithanironhand.Unhappily,someoftherunawayswerestillrun ningaway,andtheColonelcommanding the attackingarmyrighteouslyconcludedthatthecountrycouldneverfeelsafeandbeatpeaceuntilthesewereallcapturedordestroyed.SotheMaroonsandothersweresentouttopursuethefugitives, WllO weretobebroughtinaliveordead.TheleaderoftheMaroonsreportedthatthehuntedrebelsorbandits-theybecameanythingaccord in!; tothewillofthosewhospokeaboutthem-had got wind f'f hismovements,sohewasnotabletodotheexecutionheplanned.Thiswasdisappointing; yet there was alwayshope.Andinthemeantimetherewasthispresentvictory.Itdemonstratedonceagainthat,nomatterhowboldandvillainouswerethernnawayslaves,withtheirevildispositiontokeepto themsf-Ives,andtheircrueleffortstocultivate yams and b,manas, andnomatterhowsmalltheirnumbers,theyc(luldalwayslookforwardtobeingcrushedbylargearmiesofdevoted'menvowedtotheirdestruction and proudtofeelthat,solong as theyCall Id runawayintime,therewasnothingtobe feared from rebels.TableRecreationsFo?' Ratesetc.,applytoBENC. OLIPHANT, Proprietor, P.O., JAMAICA, B.'N.r.Good Sportsand Easily (rom Kingston by caror trarn. WarsinJamaica,andTheBelligerents (Continuedfr0111 Page 9) learnt,ledtothelairofthedesperatecharacters wh'J spentmostoftheirtimeingrowingyams.\Withgrimheroismtheavengersmarched rOT' ward.Theypausedatabouteleveno'clockfor "s(' condbreakfast",thenontheypressedoncemore,breathmgbraveryandthefumesofJamaicarum.Fornearlyanhourtheyclimbedupamountain'sside,thenentereda defileleadingdownwarrtssuddenly shotsrangout, for therebel-runawayballdits,IT.endaringenoughtogrowbananasfortheirownsustenance,hadsomeguns,andwiththese they hadaudaciouslyfiredontheattackingparty.Threemenofthatpartyfell,twoofthemfatallywoundeu.Thesetwowerewhitemen,theotherwasblack.'l'he wasterrible,theexecutionwrought waH devastating,yetdidnottheattackerslose thp-ir presenceofmind.Somethingswiftandeffectivehadtobedone:theygraspedthatnecessityat once. Andtheydidthewise,thestrategic,themasterlything.Throwingwildlyfromtheirhandssomefifteenguns,andcastingawayalsotheirammunition(foreverybitofweightisanimpedimenttothe legs whenrunning),thewarriorsoftheexpeditioJlturnedtheirbacksuponthefoeandfled.Thisthey calletl. aretreat.Itwasremarkableforthedespatchwithwhichitwaseffected.TheyreturnedtoFalmouth.Theirshadbeena priva:;.:! militarymovement,withoutwarrant fmlll Governmentormagistrates,undertakenpurelyinthe interE'Gt oflaw,order,andthesuppressionof evildoing.Itwasnowrecognisedthatthematterwasfartoo serious aonetobelefttoprivate enterprls2, eventhoughtheprivatepersonsengagedexcelled :n running.SotheverynextdayafterthestrategicretreatameetingofmagistrateswasheldinFalmouth,anda mess'agewassenttotheleaderoftheAccompongMaroons,biddinghimhastenwith his contingentofwarriorstoaiddislodgetheformidableenemyinpossessionofthetownof "We Don'tSend,YouDon'tCome."AndtotheTrelawnyMilitia the wordofcommandwentforth,causingsixcompanies of thisredoubtableforcetomusteratDromillyEstate.So,inthemorningofNovember1, 1824,abodyofarmedmen,MilitiaandMaroons,numberingwiththeirbaggagecarriersandpioneers270souls,movedtowardsthecitadeloftherunawayrebels.Thesemnsteredninemenandeight womp-I:.

PAGE 25

-1931-32 PLANTERS'PTlNCH'23TOTHOSEWHOLOVEBEAUTIFULFURNITUREIHAVE been struck for a long timebythe lack in Jamaica ofanyservice similar tothatperformed in London for people desiring beauti ful homesbutnothaving the time or, perhaps, the necessary equipment to search themselves for the lovely pieces of furniture whichsoen hance thebeautyof a luxurious home.INLondon I havehadconsiderable experience of furnishinganinterior decorationandhave been responsible for planning the decoration of the homes of English gentlepeople, Here, in .. Jamaica, there are around the country many exquisite pieces of workmanship in the fine old mahoganythat,in substanceandworkmanship,issoinfinitely superiortomodern productions. There are few people who have time and inclina tion to search for these pieces,yetthere are many who would appreciate being able tobuyata reasonable price some of these exquisite old materials.IHAVE accordingly decided to apply to Ja maica the knowledgeandexperience I have gained in London,andto open here a business which shall have as its object the supplying of genuine oldJamaicamahogany to those who appreciate beautiful things.THEREare three classes of people to whom I expect toappeal-thosewhoalreadyhave beautifully furnished homesandwhoarealways looking foranextra piece to fit into their present scheme of decoration; the newly married wishing to furnish their home with the solidand the beautiful in preference to the flimsyandthe ephemeral;andto newcomers to the Island who wish to have in their homes the Island'sbestproductions. Collectors also will often find a valuable piece which their own researches mightnothave discovered.IHAVE now several fine mahogany diningtables, wardrobes, sideboards,anddressing tables"which I shall behappyto show inquirers.Ifyou need a special piece to complete your home, please tell me your requirements and. I will have a search made for the particular article you desire. MANTON, "LYNTON,"KINGSWAY,HALFWAYTREE,JAMAICA.TELEPHONE6016.

PAGE 27

1931-32PLANTERS'PUNCH 25 AffordstheundermentionedfacilitiestoitsDepositors:-1--BETHRIFTY!TheGovernmentSavingsBank 01 JamaicaknownasFreePostage,whencorrespondingwiththeBankII\1.I"0DRBANK"friends,youknow.FromSaturdaytoMondaymorning.Howwillthatdo?""Itwillbelovely."ThiswasthefirsttimethatMr.PembertonhadeveraskedtheSmith-ParsleysovertoMapleton,and such aninvitationseemedtoindicatedevelopmentsofapromisingcharacter.AlreadyMrs.Smith-Parsleybegantowonderhowmuchthehalf,say,ofMr.Pemberton'sannuallegalworkmightbeworth.Butifsheknew nothmg aboutperspective,andcaredlessaboutartistS',shohadacutelittlemindandwaswellawarethat invitationwasparticularlyforMissLudlord. She hadbeenaskedonlybecauseshehappenedto be onthespotatthismoment.Shehadabrain-wave.SheturnedtoGladys-"Perhapsyouwillletustakeyouover,MissLudford?Ourcarcanholdfourpeoplequitecom fortably." "I shonldlovetogowithYOU,"Gladyswarmlyassuredher,andspokeasshefelt.Forhowmuchbetterthatwouldbethangoingalone.Indeed,itwasnoteasytoseehowshecouldwellgobyherself,eventoahouseparty.Butnowa1l difficultieshadvanished.IfshehadbeeninclinedtoresentMrs.Smith-Parsley'sintrusionalittlewhilebeforeshewasheartilygladofitnow;itwasreallypro:videntiaJ.Notapenny.And,markyou, Idon'tthinkitisworthfiftypounds."EvenMrs.Smith-Parsleywasimpressed.This,undoubtedly,wasanartistandnotmerelya saleswoman.Allartistsweresupposedtobeabitpeculiar,eccentric,stupidinpracticalaffairs;andsurelyitwaseccentricity,nottosaystupidity,torefuseahundredpoundsandtakefiltyinstead.ThismustbetheartistictemperamentofwhichMrs.SmithParsleyhadheard.Unquestionablyitwassomethingastonishingandeventohedeplored.AsforMr.Pemberton,hewasdelighted.He was abouttopatroniseart,topleaseMissLudlord,andtoestablishfriendlyrelationshipswithher,atexactlythefigurehehadoriginallyhadinmind.Andhehaddiscoveredthatshewasnotmercenary,thatshe l11HI asoulabovemoney;alldthisdiscoveryhad bep-u madeinthepresence01awitnesswhowould testify toit,andwhowouldbeabletosaywhatshouldprovethatMissLudlordwasaveritableartist,oneofthosestrangecreatureswholivedforwhat waf;, calledart,andwhosooftendiedgloriouslyofstarvation,whilethegrowersofbananasorthedealersinsugarwaxedwealthy,wereclothedinpurpleandfinelinen(ortheirmodernequivalent),and fared sumptuouslyeveryday. :\'11'. Pembertonfeltuplifted;whocouldrefusetoadmitthisadmirable artist intI)society,thehighestandthebestsociety?Andhehadbeenindirectlyinstrumentalinestablishingherclaimtosuchloftyrecognition."Ifyouwillhavemypicturedoneupforme,"heannounced,"Iwilltakeit.AndIwillgiveyou'achequeatonce. I feelthatIamaveryluckyman.Nowyoumustpromisemethatsomeday,early,whenIhavea house party,youwillcomedowntoMapletontoseeithangingonmydrawing-roomwa1l." "Oh, Mr.Pemberton,youarerea1lytookind!"exclaimedGladys,flushingwithpleasure."ThekindnesswillbeonyourpartifyoUcome;'herepliedgallantly;andnowMrs.Smith-Parsley,seeinghowthelandlay,determinedtodo astrokeofbusinessforthelegalfirmofSmith-ParsleyandOxford,whilealsoadvancingherselfsocially.bypleasing Mr. Pemberton."Andyoumustcomeandsee me, too, Mis:; Ludford,"sheurged;"weoughttoknowmore of oneanother. Of course,Ishouldhavecalledonyou long ago,butIhaven'treallybeenwell,youknow.Iwillremedymyomission,however;Ishallcome toseeyouoneafternoonthisveryweek.Youliveat?"Gladysmentionedheraddress. "VerY' good. Youwillseemeshortly.Youarereallymarvellous.youknow,marvellous;suchperspective.Ineversawanythinglikeit.""Youaresimplytookind,"murmuredGladys,whothoughtthatthisindeedmustbeherDayofDays,somanymiracleswerehappeningallatonce."AndyouwillcometoMapleton,won'tyou?"askedMr.Pemberton;"IhopeMrs.Smith-Parslevwillcometoo-perhapsonSaturday,"headded, thethoughtflewthroughhisheadthathemightaswellhaveoneofhisperiodicalsocialreunionsina fewdays'time."Delighted,"saidMrs.Smith-Parsley;"yOU aTe askingRuperttoo,aren'tyou?"Rupertwasherhusband'schristianname."Naturally.Youwilltellhim?Justafewold withoutsomesortofpretensiontobeapurchaser. Mrs. Smith-Parsleynowhadthefeelingthatshewascaught. Couldsheescapefromthisplace,sheaskedherself,withoutbeingvictimised?Happily,Mr.Pembertonseemedrelievedthatshe wouldnottakeadvantageofhisgenerosityinofferingto leave toherMissLudford'sgreatwork01art. "I shouldliketobuythat 'icture," hesaidtoGladys,"ifyouwillletmehaveiI"Oil,butitisonlya copy, Mr.Pemberton,"Gladysanswered.Asshespokeshewasrapidlycalculatinghowmuchshemightreasonablyaskforit.Shewouldneverpretendthatshehaddonemorethan copytheoriginal;shewouldrunnofoolishrisk.Prudencewaspartofhercharacter.Butifanyonewantedthethingshehaddone,why t)f courseshewouldsellit.Businesswasbusiness.Theactualworkshehadperlormedonitmightbevaluedatfivepounds,ifcomputedintermsoftime,thoughshewe1lknewthatallartistswould suy thathertimehadbeenutterlywasted.Ifsheaskedtenpounds,thatwouldmeana profit.Itwasn'tmuch,butitwassomething.Mr.Pemberton, howeVer, seemedkeenonthepicture;hewaspraisingit to her lace.Itwouldneverdo forhertodepreciateits value.Thismighthetheheginningofanexcel lentreputationamongtheuppercirclesofJamaica,whowouldjudgeartisticobjectsalmostentirelybytheir price. "A copy, MissLudford,"saidMr.Pembertonearnestly,rememberingthathewasalocalPrivyCouncillor and therefore,presumably,ajudgeofmostthingsearthly, "a copymaybebetterthantheorigi.nal.Idon'tpretendtobeanyauthority,butit seems tomethatthisbeautifulpaintinghasagreatdealofsoulinit,realsoul.Whatdoyouthink,Mrs. Smith-Parsley?" Mrs.Smith-Parsleyatoncerecognisedasuperabundanceofsoulinthepicture;shefe1lbackafOOtorsoandgazedatitecstatically.Nowthatshe was notto bewangledintobuyingit,shecouldaffordtobecomeanenthusiasticartconnoisseur."Verywell,"saidMr.Pemberton,withthatde finiteairhealwaysassumedwhensigningacontractforbananasoragreeingwiththeGovernorin Priv)' Council,"willyoutakefiftypoundsforit,MissLudlord?""Oh, Icouldn'tthinkofthat,Mr.Pemberton,"cried Gladys,genuinelyastonishedatthesumof fered.ButMr.Pembertonmisunderstoodher.Heimaginedshethoughttheamountofferedtoolittle,andstraightwayhehadafunnyfeelingsomewhereinhis inside.Forthoughhepossessedplentyof money, hewascareful;thoughhewaswillingtopurchase apicturehehadnoearthlyusefor,heneverlikedtospendmuchonanythingofnoobviousmaterialvalue.Yethewouldnotlookstingynowforthelifeofhim."Pleasesaywhatyouwilltake," he said,withaveryfineair."Ahundred?Iamnojudgeofthevalueofsuchthings,exceptthatI knowthatthisoneisheautifuL"Gladysrealisedthathewantedtodosomethingthat wouldmakehimshineinhereyes.Hedid 'lot reallywantthedaub.He-hewantedhergoodopin ton; he,thegreatMr.Pemberton!Shemadeuphermindinstantly;herquickintelligencedeterminedher course ofaction. "I willtakethefiftypoundsyouhave offered," sllesaid,"butnotapennymore.Security,basedongovernmentguarantee.ExemptionfromStampDutyonWithdrawals.Interestattherateof3%compoundedhalf-yearly.anofitsTheoperationatanyofBranches,accountopenedatHeadOfficeoraBranch.5.4.3.2.Innine cases outoften,thisisabusinessman'sEarningCapacityProtectedbyLifeInsuranceWriteforparticulars of Policies:CONFEDERATIONLIFE ASSOCIATION GREATESTASSETandcaneasilybeMotorInsuranceEffecta substantial savingIncostofInsuring your carsbyplacing your Insur ancewithTHEARMY, NAn&. GENERALASSURANCEASSOCIATION,LIMITED.].B.KILBURN, ATTORNEY. J.B.KILBURN,DistrictManager.MAURICEMAIR,CanvassingAgent.CORONATIONBUlLDlNG,KINGSTON.Thereare103BranchesthroughouttheIsland, at which Deposits andWith.drawalsmayBemade.

PAGE 28

26PLANTERS'PUNCH1931-32 (R,ayalOhmtel Dated1839).PASSENGER A1\'DFREIGHT SERVICES TheUnitedKingdomandContinentandBrazilandtheRiverPlate.WestCoastfNorthAmerica(via Psnama Canal).MAILSTEAMCOMPANYTHEROYALPACKET Tours deLuxe:DuringWintermonthsfromSouthamptontoJamaica,andother beautiful spotsinthoCaribbeanby hrge, luxuriouspassen ger liners.PleasureCruisesfromtheUnitedKingdomtoNorway,Mediterranean,etc.RegularFrequentFreightService:BetweenJamaica,UnitedKingdomandContinent,andfromJamaicatoorthPacificCoastPorts.RegularCoastwiseFreightService:BetweenKingstonandOutports of JamaicabytheMotorships"ARNO"and"ARUN"every7days.toppedbyhangingplumes of greatgreenleaves,halfthelength of thetreesthemselves.Infront of thecottageranapathwhicha small motorcarconldnegotiate,andbeyondthispath,andparalleltoit,intheshadow of anotherforest of bananaswhichspreadoutintheoppositedirection,flowed a darl, gleamingstream.Thescenesuggestedseclusion.Arthurfelt that hemustinterveneinthisquarrelbetweenman alldwife alittlefurther if peace was to beestablished,andhadbetterincludethewomaninhisconciliatoryconversation."Well,Mrs.Ramsingh,IamsureyouandyourhusbandhavenorealreasontobeangrywithSampson,"heremarkedinafriendlytone,addressingherdirectly."Sampsontoldmeaboutthequarrelonly a few minutesago,andheassuredmethathehadonlybeenpolitetoyouastohisnearestneighbonr.Thereisnoharminthat,Maharajah;you,whowereborninJamaica,likeyour wife, knowthatevery bodyhereispolitetooneanother,andthatcivilitytoaman'swifedoesn'tmeanathingintheworld.However,Sampsonsaysthathewillnoteven biel Mrs. Ramsingh goodmorninginthefuture,asyoumightobject.Andhewillonlyspeaktoyouwhenhehasto.BothyouandhehavetoworktogetheronMapleton,youknow,anditwillneverdoforyoutothreatenhim.Youmustkeepthepeace.""Sahib,"repliedtheIudianslowly,"Igomyownwayan'mindmyownbusiness;butnomanmustinterferewithmywife.Sheismine,andIwon'thaveit.""Iamyourwife,butnotyourslave,"putin tho womansharply."Andyououghttobeashame of yourselftothinkIwouldcarryonwithanordinarybrownman.Whatyouthinkofme?""Youareto carryon withnoman,whetherbrownoranythingelse,orordinaryoranythingelse,"retortedherhusbandheavily."Youcan leave thattotheblackandthebrownpeople,an'thew-"hewasgoingtoadd"thewhitepeople,"butcheckedhimselfindeferencetoArthur'spres'ence. "If I fine you doing it-.""Youtalklikeafool!"rappedoutthegirl,steppingoutintotheopengardenandshaking witll anger."Youalwaysthreateningme,an'Iwon'tstandit.ThisisJamaica,notIndia,an'Idon'tknownothingaboutIndia,andIamnotthere. If youeverbeatme, Iwillleaveyou,butIwillmarkyoufirst.Don'tthinkyoucan do whatyoulikewithme!"Herhus'bandwheeledaboutto face ller, movedtoevengreaterangel'byherflauntingdefianceofhim;butArthurintervenedsharply."Haven'tItoldyou,Ramsingh,thatSampsondenieshaVing had anyintention of takinglibertieswithyour HehasonlybeenonMapletonfortwoweeks,andhereyouare,already,tryingtohaveafeudwithhim! If youcontillueyouwillhavetogo; .lVIr. Pembertonwillseetothat.Youarenotlikelyto beaswell off outside of Mr.Pemberton'semploymentasyouarenow."TheEastIndianknewthatwell.Hewasa "time-keeper,"ontheproperty,thehead of the banu ofEastIndianswhoworkedonMapleton.HewasagoodWOIker,intelligent.active,thoughofsour,broodingdisposition.ButSampsonwasa goodmanalso,andSampsonhadbeenhorrifiedwhenRamsinghhadthreatenedtodoterriblethingstohim if pressedinanger,hereyesgleamedassheflashedthemfromherhusbandtothesquireonhis horse. Arthur,beyondhisfirstsalutation,hadnotaddressedbel';hisbusinesswaswiththemanhehadjokinglycalledMaharajah.ButthegirlwasnotdisposerJ.tobesilentorignored.Shebrokeout:"There'snothing for himtothreatenabout,Sa hip. Heisfoolish.HethinksSampsonwanttocarryonwithme,as if Iwouldpermitsucha thin;;! AndhethreatentobeatSampsonandme. If hetouch me--" she left thesentenceunfinished,buttherewasmenaceinhertone.Shewouldnotbebeatenwithoutindulginginsllmeunpleasantform of retaliation.Shewasframedinthedoorway of thehouse,abuilding of threeroomsallinarowandmuchsuperiorto the sort of placesinhabitedbyEastIndiansworkingonaplantation.Akitchengardenwaslaidouttotherightand leftof it,acarefullyfendedgarden,withlettuces,tomatoes,radishes,cabbagesandothervegetablesgrowinginneatbeds;infront of thehouse itself cratonsandplumbagohadbeenplantedanda few rosetrees.Nootherplacewaswithinafurlong of thisone.Behinditstretchedavastbackground of bananatrees.abackground of trunksrisingsometwelvefeetfromthegroundand"Well,thatissettled,"saidMr.Pemberton,pleasedwiththeladies,himself,andalltheworld."WeshallseeyouonSunday."Thenheleft,accompaniedbyMrs.SmithParsley.CHAPTERTHREE"NOW,"saidArthur,"thiswillneverdo,youknow.Maharajah;you can't threatentobeatanybodyonthisproperty.Youwillsoonbegettingintlltrouble if youdo."He said thispleasantly,laughingly,andtheshort,thinEastIndianheaddressednoddedhishead.HewasnotangrywithMr.Norrisforremonstratingwithhim;itwasdonesopleasantly.Besides,11'.Norrisalwaystreatedhim so verywellandwasthemaster.TotheEastIndianArthurwasasort of god.Arthur'seyestravelledfromthegloomyface of themantothatofhiswife,whostoodjustoutside of themaindoorofthelittlehouseinwhichshelived.ShetoowasEastIndian,tall,slender,very ;>retty, withthethinnose,black,smooth,glisteninghairandfineeyeswhichthebetter-favouredwomenofherracepossessandshowtosuchadvantagewhenyoung.Herfull,poutinglipswerenowcom-

PAGE 29

1931-32PLANTERS'PUNCH27 9 11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111.1 j1III 11111111111111111111111 ..-::: Re-AndCOMPANYCOMPANY.MANTON & HARTR.BRAHAMHARRISR.A.FIGUEROAGORDONS.ANDERSON & HARTUNIONASSURANCELIMITED.INSURANCELIMITED.INSURANCEGovernment > CORRESPONDENTSCOMMERCIALCOMPANYFireandAccidentInsurance.IMPERIALLIFEASSURANCECOMPANYOFCANADA.OFMONTREAL,CANADA.. ..'\..GENTS LIMITEDQUEENSLANDCALEDONIANROYALSECURITIESCORPORATIONOffer Municipal Industrial High-Grade Bonds at muneratlve RatesofInterest.BRANCHMANAGERSTRAVELLINGREPRESENTATIVES (Conlinnca onPage29).hecontinuedtobepolitetohiswife.RamsinghhadsaidthatiftheyhadbeeninIndia,there would have beensomepersondeadalready,becauseofwhathadoccurred,butasamatteroffactnothingofimportancehadoccurred.Sampsonhadbeenbadlyfrightened,forheregardedallEastIndiansasterrible people,jealoustothevergeofmadness,readytouseknifeandmacheteindefen () ofthefamilyhonour.Hehadnottheslightest to provoke any fightwithRamsinghoranyother"coolie"ashecontemptuouslydescribedtheman;hehadmerelythoughttheymightbehaveasordinarypeopledid.HewasdonewithRamsinghandhiswife.ButtheEastIndianwasapparentlymistrustfulofhis thoughproudofherbeautyandappearance.HiswarningthreathadbeenforherevenmorethanforSampson;hewasnowwarningheragain."Allright,then,Sahih,"hereplied,thenglancedatthegirlasifto ask whyshewaslingeringthere tohearanymoreoftheconversation.Hislookplainlyindicatedhisthoughtthatsheshouldnowretireintothehouse.Sheinterpreteditcor rectly,butmerelytossedherheadandcontinuedstandingwhereshe was. Shewasdressedinwhitelawntrimmedwithredaboutthe neck andsleeves,andoverthebackofherheadwasthrowna filmyscarfofred,whichframedandsetoutthebeautyofherface.Strungonherbarearmsweresomebraceletsofbeautifullyworkedsilver;inher ears silverpendantshung.Buther nosehadnotbeenpiercedfornoserings,aswerethose ofmostotheroftheEastIndiangirlsabout.Thisaccentuatedherdifferencefromthem.Sheworeshoesofasomewhatdelicatemake,withstockingsofartificialsilk.NotanotherEastIndianwomanonthepropertyworeshoesexceptonveryspecialoccasions,notanotherwasgarbedlikeher;andhercarriage,herpose,herlookre vealedhowhighlyshethoughtofherself.Likeherhusband,shehadbeenbornintheisland.Herfatherhadcomeoverinhisyouthasanindenturedimmigrant,hadlongsinceservedhistermofyears,hadworkedhard,saved,acquiredsomeproperty,andhadsenthislittledaughtertoa SChoolwhereshehadbeentrainedmuchlikethedaughtersofthebetter-classnativefarmers.HerparentshadbeenChristianised.ShehadgrownupaChristian,but oneIndiancustomthefatherhadinsistedupon:she hadbeenmarriedtoRamsinghbeforesheleftschool,marriedatfourteen,thoughitwasnotuntilshe wassixteenthatshehadbeen sent tolivewithherhusband.Hewastwenty-fouratthetimeofthismarriage,anadvancedageforanEastIndianmarriedman.Butthefactisthathewasa widow er whenhemarriedthisgirl;hisfirstwifehaddied twoyearsbefore.Theyhadnowbeenmarriedforthreeyears.The secondweddinghadbeenarrangedbetweenhimandMarie'sfather-MariewaS'theChristianname ofhiswife.Shehadseenverylittleofhimbeforehermarriage,hadhadnothingto dowiththechoosing ofhim.Andthis,thoughshewasstillin fluenced byIndiancustomsandideas,shesecretly re senterl. Shewasreallytheproductof twocultures,conflictingculture.Shehadmade'somefriendsamongthegirlsattheschoolsshehadattender)and had imbibedsomethingoftheirwayofthinking ann feeling. Butherhnsband,thoughhetoo had never beenoutsideofJamaica,wasalmost [IS much oftheEastinhisideasas his grandfatherhad been.Heheldstronglythatanywoman,especial ly ofa class abovetheordinaryworkers,should sep.k "eclusion andliveforherhusbandonly. This'viewoftheproperpositionofwomenwasbuttressedandreinforced by anaturallysourandjealous disposi tion,andbyacomprehensiveknowledgeofthe la-x moralityprevailingeverywhere.Heknewhecouldnot insistupon his wifegoing'aboutveiled,buthewished he could.Heknewthatfemalehonouramongtheworkingclasseswasnothighlyregardeclina land ofeasysexualrelationships,andhewasfiercelyapprehensivelestanyoneshould thin}{ thatinhis householdtherecouldbeanylaxity.He har! his secretpride.Hewasof ahighcaste,theseconr)ofthe fourgreatcastesofIndia,andthereforeheldhimself to be ofconsequenceamonghisownpeople.ButMarie'sfatherwasstillalive.and Mariewus wellawarethatsomedayshewouldbe inde pendent ofherhusbandinthematterofmoney.Herfather was devotedtoher;therewasnootherchild.Herhusbandhaddoneverywell,had a goer! situation,earnedhighwages,buthewasnotinherclass financially,and Jamaica wasnotIndia. She wouldnotbesubservienttohim,andsheregardedl1is-threatswithscorn.Thedayhelaidhandsuponher,shewouldleavehimasshehadsaid;shewould gobacktoherfather."Iwantyout(lcomewithmeto OldDingle[arm,Ramsingh,"saidArthur,partlybecausehe wish edthemantoaccompanyhim,partlybecausehethoughtitwonld be akindlyacttopreventallY bittercontinuanceofthequarrelbetweenhim ap.d his wife."Getyourhorse." Andthen.asluckwouldhaveit,just as Ra!l1iugh wasturningto gotowherehishorsewaskept,the brown man,Sampson,theimmediatethoughin nocent cause oftheexistingmaritaldiscontents,redeup.

PAGE 30

28PLANTER S'PUNCH1931-32.."..".,"..".."".."......,"""" "".,.."-----yourthoughtswill naturallyturnto \( B. Myers, Manager. MotorCar&Supplies(1923)Ltd.Whenyou thinkofAutomobiles,orofanythingappertainingtotheirmaintenance, ,.1 ,,

PAGE 31

1931-32 ---= PLANTERS'PUNCH29 scnOOL BOOKS,REWARDBOOKS, NOVELS, TOURIS'rS'BOOKS,VIEWPOSTCARDS, STA'l'IONER);',TEX:SISA:SD FANCYGOODS,SCHOOLAPPLIANCES.Havingfinishedhiswork,Artlnu'wentuptothehouseforawash. Then heandMr.Pembertonsatonasort of balconyoverlookingtheeasternexpanse of Mapletonandslowlysippedthecocktailswhichamaidhadbronghtthem.Lunchwouldbeservedpresently. "The housewillbefulllateron,"remarkedMr.Pemberton. "The Beavershamsarecoming,andDr.Crossleyandhiswife.fromPortland,andthetwoReamster girls andtheirbrother;andsomeotilerpeople. Ihopethey'llhaveanicetime;butyou willseetothat,Arthur.""I'lldomybest, sir," saidArthur."Youalwaysdo,myboy; youarethoroughly de pendable.Iwonderhowsome of myfriendswilltakeMiss Ludford.""Idon'tseewhytheyshouldnot !;ke her," Arthurprotested."You do, Ithiuk,andyouareasgood ajudgeofaladyas'anybodyel einthiscOlln try.""Ihopeso;Ithinkso.Butthere's Arabella Beaversham;shedoesn'tknowthatyour yOllllA friendiscoming,andsheaskedmeparticularlynevertobringthemtogether. The truthisI forgotherinjunction,orIdon'tthinkI'dhave asked theBeavershamsthistime.Itcan'tbehelpednow,however.Peculiarlystuck-upsomepeopleare,aren't.they?""Andwhoarethey?"askedArthurwarmly;"whathavetheygottobestuck-upabout?" If youcaninviteanyonetoyourhouse,Iamcertainthat any bodyelse ('an' dothesanie.Yourexamplecanalwaysbe safely followed."theremustbenomorewordswithSampson,oroutyougo."RamsinghwascowedbyArthur'smanner; he knew,too,thatMr.Pembertonmightacts'everely if provoked,althoughhepreferredtohumourgoedworkers.Andhe himself likedthisnewarrangement;itwouldtakehiswifeawayfromthe vicinityof theobnoxiouS'Sampson,thoughitmeanttheahal1donment of the kitchen gardenhehadmadeandsocarefullycnltivated. Morley wastheplantatiut1whichMr.orris maIl agedforhisuncle,whileatthesametimeoccasionallythrowinganeyeoverMapletonandDenhurst.Morleywasmilesaway,actuallyinanotherparish,Portland.Ramsinghbow edhisacquiescence,castasullenglanceat hiswife toseehowshetookthis comJllg change,observec]onlyscorninhercountenance,androdeoff with Arthur.ItwasSaturday.GuestswereexpectedatMapletonthis afternoon fortheweek-end;theywoulllstayovertillMondaymorning.Arthurhaddriveninearlythismorning;hisunclehadaskedhimtorideoverpart of MapletonontheSaturdayfore noon,andtosuggestwhathethoughtshouldbe done withoneortwo of themorebackward banallJ. farmers.HeknewthatMr.Pembertonwould not objecttohistakingRamsinghtoMorleyandputtingsomeoneelseinhisplaceonMapleton. The visitorswouldarrivebeforetea-time,sohehadhoursbeforehim.'WhenhepartedfromRamsingh,hegavethelatteranotherwarning. Ramsingh promisedthattherewouldbenofurther'trouble.andmeantit.JamaicaPRINTERS. ANDManager.Kingston,GILLIES,ST ATION ERS,R. 'W. BOOKSELLERS,TheCupandTheLip (Contin1lecl 11'07"Page 27') Sampsonhadguess'edwhereMr.Norris andwanted totalktohimonsomebusinesshe hall forgotten tomentionearlier.Hehadnotpausedtoreflectthathewouldbegoingintoamsingh'ster ritory.Further,heingguiltless ofany ontheIndian's wife, andhaving maLle uphismindnoteventospeaktoherinthefuture,ithadnotoccurred tohimthatRamsinghmightresenthis ap pcarance onthescenejustthen.BnttheEastIndian,ahouttoleavethe precincU; ofhis place,sawinthesuddenadvent of 1:iampsoll.who was a well s'et-up,notbadlookingbrownman or aboutthirtyyears of age, a sinisteroccurrence.HestolJpedinhistracks,utteredashortgrowl, and turned a facedarkwithhatetowardsthenew-com er, Hisrightarmwasjerkedupwardswith hand tlenched,iteemedasthoughhe woulLl springuponSamlJson. Had thelatterbeenonfoot,thismighthavehaplJened.Sampsonsawthelook,thegesture,audhastilyplacedhimselfonthefartherside of Arthur and theyoungEastIndian,Marieemitteda provokinglittlelaugh.Thequarrelwasbynomeansover;Arthur "aw that nowquiteclearly. Therewas dangerintheair:Ramsinghmeanttrouble. Then thesolutiullflashedthroughhismind.Hesawawayantof the difficulty. Sampson tookcarenottocastsomuchas a glanceatMarie;hediscussedwhathe had to withMr.Norris,thenrodequicklybackalong the wayhe had come.Arthurnow turned toRamsingl:and aid peremptorily:"Getyourhorse;IwantYOII,Ithought Ihadtoldyou so.Whatareyouwaitingfor?"AndtheEa'tIndian,realisingthathewasneglectingorders, went tomounthisanimaLHemutteredsomethingtohiswifeashepassedclose toher;s'hemadenorejoinder.Whenhe laine backmounted-amatteroffiveminutes-Arthur spoke. "Iwantyou.Rumsingh,"--therewasnofriendly"Maharajah"now-"tomoveovertoMorleyassoonasyoucan. There is a cottagethere,likethis;evenb:ggerasamatteroffact;andyoucanhavethegroundarounditforagarden.Youmustbeprepared to assoon as youcan:earlynextweek,ifpossible. Yoncanborrowoneofthe truck"[)r a day.MeantimeIwon'thaveany quarrellin<.; amongmyuncle'semployees.Iwilltellhim later aboutthisarrangement,andhewillapprove. And Obtain yonr supplies ofOxoCubes, illtins,from Cecil B.FaceyLtd.,168HarbourSf., Kingston,Jamaica. i !8!i! iI ., i i i Ii, j i i0 -, i0 -, ,I! Brown'sTownBenefitBuildingSociety,. IiIA BROWN'STOWN.ST.ANN.! i ESTABLISHED1893INCORPORATED1899 IiI I ASSETS,330 17 3 It RESERVE FUND,07381 I I i I INVESTMENTSreceived on SubscriptIOnshares, iI Paidupshares,andDeposits. Ii Liberaladvancesmadeonapprovedsecurities. II Ij Terms tel investorsandborrowersequal tothei I i bestinJamaica. Ii Businessaccepted in allpartsofthe Island.J I Prospectusandfullparticulars g-iven upon appliI cationto I IG.OWENGOVER,I I (Secretary) t .: .,I.................-.c..-.(_..-.._ .. -.._.__I.:..DISSOI-,VEA'r CUBESIN II BEEFOxogives the flavour of beef to veget.able dishes and makes them morewholesome-be-,sides saving work for the cook.WithOxo as a basis for your soups, gravies, stews and curries, ,you. ca achieve that rich appetising flavour which is themarkofthe chef.MakesGoodCookingBetterAsure -Foundation

PAGE 32

PLANTERS'PUNCH1931-32 _I :DoCR thefinest \'ie\\-s ofthisuni(JlIc "Cod:pitCounh-y." Innoother wayen II \'i('ws of the CockpitCountry be ollin incd. \ jlnJticlIlal'ly fine dew isafford ed of )fontego Bay,acrosstheBogue l:;;lnndR.)Iolltl'g-o Bay-Doctor'sCave-one ofthelilH'Rt coralbathingbeachesinthewOIld.'Yondcrfulsun and .ca bathing r('commendecl bySirHerbcrt B
PAGE 33

-. 1931-32PLANTE R" S'.PUNCH31FIVESEATERHILLMAN t.=:=;:;=====WIZARD-ir -ISNIPEFIVESEATERTOURERBeBritishbuyBritishandtradewithinCOMMERh30-40CWT.teEmpireICHASSIS rn I \SWYER BRITISHMOTORCARCO.LTD111HARBOURSTREET,KINGSTONJAMAICATELEPHONENo.3111SERVICESTATION159HARBOURSTREETTELEPHONENo.3188CABLES:lINBERTKINGSTONCODES ABC 5fhAND6th EDIlIONSlIEBERSANDBENTLEYS

PAGE 34

:.'":>::1'931-32SRVlC'v "... BehindeveryDunlop ,product isj ri" themosthighlyorganisedservice intheworld..As J;)epositaires for tj;le DunlopRubberCo.Ltd.weare, able toextendtocustomersthefulladvantageofthis service. PLANTER S' PUN CHTheDUNLOPRANGE includes PneumaticTyres,TubesandAccessories;GolfBalls,TennisBalls,Racketsandgeneralsportsgoods.Depositaires :BritishRubberAgencies Ltd.IIIHarbourStreet ,ii" .WhenyoubuyaDunlopproductyou of anarticleofthefinest madeinEnglandby experti' craftsmenwhotakea pride in producing onlythebest." 32 Printedill England.. KINGSTONJAMAICA Ref. 786fA,P.f9/31.

PAGE 35

:)..1. PLANTERS'PUNCH 1931-3Z and"Laughter,"intobigones,byhergreatperformance.Sheisveryversatile--notonly anddancingwell,butsingingwell.Thislittle l'tar hashadahardtimeinpictures.Shehadmanyfilmtestsbeforeshewasgivena jobinthemovies,beingturneddownsixteentimes because the producer:; thoughtherfacewastooround!To-dayNancy'sface is stillround,yetsheisoneofthegreatest b0x officedraws,andhasbeenselectedbyJohnMurrayAnderson,thegreat showman, asoneofthe ten loveliestwomeninHollywood.Nancyhasa goodsenseofhumour.Irecentlyreadthefollowing: "A temperamentaldirectorandancy(not untemper!l. mentalherself)werehavinga 'cometo'overa detaU inascene.Suddenlytheiratedirectoryelled,'Nextto-(namingaveryunreasonablestar)you're the mostinfuriatingwomanIhaveeverworkedwith.''Howdareyou,'giggledNancy.'AfterI'vespent t:le bestyearsofmycareerearningthereputation of themostinfuriatingwomaninpictures-yougivemethesecondbilling!'"ONE of themostsuccessfuloftheoldsilentstan;isBebeDaniels.Shehasblossomedforthintoanexcellentcharacteractresswitha good speaking andsingingvoice.Duringthepastfewyearsshehasbeengivenagreatdealofpublicity,though slH' isoneofthefewactressesaboutwhomnotabreath of scandalhasbeenheard.Hermarriageto B'!n Lyon-andstrange,asitmayseem,hel:first-waspopular,andherweddingwas'oneofthemostsper'tacularthathasevertakenplaceinthemoviecolony.Shehasbeengrowingsteadilymorebeautiful,andalittlewhileback,wasconsideredone c;f theloveliestbrunettesinAmerica.ButBebe has shockedthemall.Shehasfollowedthenew andbecomeaplatinumblonde!Andnowshebidswelltobecomeone of theloveliestblondes'in. foviedom.In"ReachingfortheMoon,"with Doug lasFairbanksandthatpicturestealer,ClaudeAllister,shesurpassedherself:sheshowedhowversatile she canbe,playingthepartofanirresponsible,flllllovingebullientandslightlydomineeringperson.Hervoice,thoughdistinctlyAmerican,is good, aUIl canbeveryemotional.Whentalkingpictures came intovogue,hercontractwithParamounthad just expired,sosheslippedquietlyawayanddid what shehadalwayswishedtodo-developedhersingingvoice.Whatanassetthisistoanalreadyacceptedstar,whoisbeautiful,andextremelypopular,canwell beimagined.Hersingingscreentest wailse goodthatRKOimmediatelysignedherupforalongtermcontract.Herfirstpicturewiththemwas"RioRita,"astupendouslylavishpictureintechnicolourwhichransuccessfullyformonthsinall the largecitiesoftheworld.DYNAMICactingisallverywell,butwhenitisoverdoneitbecomesboring.One doesnot care toseeanactordivingoverthehackof a bed,vaultingdownthestairs,jumpingthroughwindows,whenthereareperfectlygooddoorsforhimtowalkthrough,andslidingdownropesinquickrotation,asifhewasperforminginacircusratherthanin a picturethatissupposedtodepictsomeform of Americaneverydaylife.Itischildish.Therearebutfewactorswhointroducethiskindofthingintotheirpictures,for if notwell anelcleverlycarriedoutitisahorriblefailure.Ofcourse,itdepenllsverymuchonthepicture.StoriesbyAlexandreDumas,andHugoanda fewothersofthesame type, lendthemselvestothisspectacularform of acti?1:;, ashasbeensuccessfullydemonstratedbyDouglasFairbanks.Butin"ReachingfortheMoon" Ithinkheoverdidit.Haditallbeenhumorousashisactionswereafterdrinkingthesnappycocktail,itwouldhavebeen good.Theresultwas, Claude Allisternearlystolethehonoursfromhim. !VII' Allisterisoneofthecleverestcomediansinfilms to-day.Healwayscharacterizessomeform of Europeanaristocracyintheneatestway-neveroveracting.Twoother"dynamic"actorsareJohnBarrymoreandFrederickMarsh.'Whiletheformer-whoisamember of afamousdramaticfamily-hasalwaysbeenafamousactor,thelatterhasincreasedhisIlopularitya hundrtld percentsincetheadvent talkingpictures.Heastonis'hedthepublicbyhisexcellentperformancein"TheRoyalFamilyonBroadway,"withInaClaireandMaryBrian,a pic turewhichissupposedtobe aburlesqueontheBarrymorefamily.Hehasa goodspeaking VOiCI\ actingability,style,andindividuality,andthesecoupledwithgoodlooksareboundtomakehimsuccessful-provided,ofcourse.hisproducersdo uot casthim'inmediocreandunsuitableparts.Hisperformancein"TheRoyalFamilyonBroadway" ant! "HonouramongLovers"(inwhichhewashappilycastwithClaudetteColbert)hasgainedforhim hun dredsofnewfansinJamaica.Hispicturesare
PAGE 36

PLANTER S'PUNCH35BARCLAYSBANK(DOMINION, COLONIAL AND OVERSEAS). FOUMERLY THE COLONIAL BANKIncorporatedhyRoyalCharter1836.Re-incorporatedbyActofParliament 1925.\Vith whichareamalgamatedTHE NATIONAL BANKOFSOUTH AFRICA, LTD. AND THE ANGLO EGYPTIAN BANK, LTD.AuthorisedCapital,000,000SubscribedCapital,975,500.CapitalPaidup,975,500ReserveFund,650,000."Deposits" 31/3/31,473,499 HEADOFFICE: 54 LombardStreet,London, RC. 3.LONDONOFFICE(ColonialBankSection.)29GracechurchStreetE.C.3. MANCHESTER OFFICE,LIVERPOOL Oli'FICE, HAMBURGOFFICE.21YorkStreet. 25 CastleStreet.AdoJphsplatzIV. J. EW YORKAGE CY.44BeaverStreet.CANADIANAGENTS-BARCLAYSBANK(CANADA)MONTREAL&TORONTOandTHEBANKOFMONTREAL.AllBranches.BRANCHESINTHEWESTINDIES-Antigll:t,Barbados, Dominica, Grenada, St. Kitts, St. Lucia,t.Vincent, Trinidad.BRANCHESINJAMAICA-Kingston,Annotto Bay, Falmouth, Lucea, Montego Bay, Morant Bay, Port Antonio,PortMaria, Savanna-la-mar,t.Ann'Bay.BRANCHESINBRITISHGUIANA-Demerara,Berbice. INTHE VVEST INDIESFOR TH/: BANK OF MONTREAL.Over 400 Branches throughoutBritish West AErica,EgyptalJd the SlIdan, Transvnal, Rhodesin,Cnpe Province, Natal, Orange Free State, Swnziland, PortugueseEast Africa, South-West Africil,Nyasalanc1, Kenya Colony, Malta, Gibraltar, Palestine and Mauritius.WORLD-WIDEBANKINGSERVICEFORTRAVELANDTRADE. :RUSTEE DEPARTMENT-HEADOFFICE-LONDON. THE OFFICEOFEXECUTOR Al'ID TRUSTEE.REGINALDV.BUTT,P.E.N.MORTIMER, Asst. Manager.ManagerJamaica Branches. I IL--------------.:

PAGE 37

36PLANTER S'PUNCH1931-32I Ii] **30 .. 34PortRoyalStreet, Kingston Jamaica. Agt;nc::it;sV euveMarieBrizard & LiqueursGaelicOldWhiskyGooderham & .WhiskyetClt,etCltFor 10GOLDMEDALSOLDRUMSASPECIALITY I

PAGE 38

931-32PLANTERS'PUNCH37YOUOWE 11" 'ro FAMILYtoprovidethemwith a Home-a realHome-on' willownoutrightandneverhavetomovefromunlesstheysellit.LADLORD!personswere.Generallyspeaking,shewasafraidof nobody.SheaddressedGladys. "Youknow,MissLudford,"shesaiddistinctly,"Ihavelongbeenwantingtomeetyou. Ihaveheardaboutyou;andthoughIdon'tunderstandanythingaboutart,IamgladyouhavecometoJamaicatodosomethingtoencourageit.Wereallymustseemoreofoneanother."ThiswasMiss Mayland'smethodofeasingthesituationforGladys. Mrs. Smith-Parsley,sittingnotfaraway,overheardtheremark.Sheleantslightlyforwardinherchairandsaid:"Thereis atreatlorallofusinstore,thoughIhaveenjoyeditalready.Oneof MissLudford'spicturesishere,andMr.Pembertonisgoingtoshowittousthisafternoon.""Indeed?"saidMrs.Beaversham,butfelt,nevertheless,slightlyinterested.ShewonderedhowthepicturehadgottoMapleton."Indeedandindeed,Arabella,"criedMr.Pemberton,andthenshewasawarethatthatgentlemanhadquietlycomeupbehindher."Youaregoingtosee arealworkofartbyacharmingartist. If youareallfinishedteawemightgoandlookatit no,v."The:;' hadfinishedtea.Theywereallgenuinelyintriguedaboutthisworkofart.Wasitpossible,UJTUALBUILDINGSOCIETYgreaterportionofthetobuildorbuy;thenBE YOunO'V THE VICTOIUA vvillprovidethemoneyyouneedyoudotherest..twocubesofsugaroronlyone,Clara?"sheaskedDr.Mayland,"Inevercanremember.""Inevertakesugar,"repliedMiss Mayland. "Thatistrue;so foolishofmetoforget."ShehadpouredoutteaforGladys,butneglectedtoaskherwhethershetooksugarormilk.Still,Gladyswouldnotbediscouraged.Ihaveheardsomuchaboutyou, Mrs.Beaversham,"sheobserved;"everybodytalksaboutMr.Beaversham,too;heisawonderfulman.""Thanks,"saidMrs.Beavershambriefly."WhenIfirstsawyourdaughter-itwasattheConstantSpringHotel-Iknewwhoshewasimmediately,thoughyouwerenotwithheratthetime;sheisstrikinglylikeyou.""Sotheysay,"remarkedMrs.Beaversham."Arthur,willyouhavesomemoretea?""No,thanks,"answeredArthur;asamatter of facthedidnotwantanythingfromthisunpleasantwoman.Hesawherattitudeandknewitsreason.SodidMissMayland.Thelatterglanced,with amusementinhereyes.atGladys.Shewasacleveryoungwoman,goodlookingherself,andwithplentyofbrains and akinddisposition.Andshehadcourage.She.vasnotafraidofMrs.Beaversham,assomanyotherTheCupandTheLip(Continued 11'0111, Page30).for flowersatanytimeoftheyear.The gardeners wereEastIndians,apeopleparticularlycleverathorticulture.Therestoftheservantswereblackorbrownmenandwomen,thehousekeeperherselfbeinga coloured:womanwhomanagedthedomesticswithgreatefficiency.Labourischeapinthetropics,anditwassaidthatlVIr.Pembertonnettedtenthousandayearfromhispropertiesevenwhenpriceswerelow.Hecouldaffordtopayforabundantservice.Helikedtoentertain.Itwasadistinctionaswellasapleasuretobeinvitedtooneofhishouseparties.Hedidyouwell;thefoodwasofthebest.thewinewasgood,andhetookcaretolethisguestsenjoythemselvesastheypleased.Hedidnotworrythemwithready-madeplanswhichhadtobecarriedout.Themaleguestsweretakenchargeofby self andArthurastheyarrived,the lallies wereshowntotheirseveralroomsbylVII's.Prince, the housekeeper.Themenwereaskedifthey weulC: haveawhisky-and-sodaaftertheirlongdrive,thentheywentupstairstowashthedustofftheirhandsandfaces.Presentlyallofthem,menandwomen,cametroopingdowntotea,andthosewhodidnotalreadyknowoneanotherwereintroduced.Gladyswastheonlyrealoutsiderpresent.Shefeltalittlepeculiar,atrifleoutof ease,atthisexhibition of herunfamiliaritywithsomanypersonsoftheuppersocialworld.ButshehadcomewiththeSmithParsleys,andthatwassomething.She was dressedinaskirtofwhiteEnglishspunsilk,withbroadpleating.Herbodicewasquiteplain,white,withaVneck.Thesleevesofthisbodicewereshort,andoveritsheworealight-greencoateewithpockets.Thebodicewasfastenedatthetopwithabeautifulgoldbrooch.Altogether,herattirewasveryeffective,andsheknewit.Sheknewhowtodress.Theguestsweregroupedaroundthreeorfoursmallteatables,andithappenedthatGladysfoundherseHseatedneartolVII's.Beaversham,whoregardedthisproximityasanimpartinence.lVII's.Beavershamwasscandalised.ItwasallverywellforlVIr.Pembertontodancewiththisgirl,butto invite hertoahouse-party-whatwashappeningtotheworld!Andshe,Mrs.Beaversham,hadwarnedhimthatshedidnotwishtomeetlVIissLudford.Couldhehaveforgotten,orhadhedeliberatelyignoredherwish?Gladyssensed-almostanybodywouldhavedoneso-that ;vII's. Beavershamwasautagonistic. She hadnoticedalsothatlVIr.Beavershamhadbeencold. while MissBeavershamhadbeenalmostrudeinthecasualmannerinwhichshehadbowedwhenintroduced.ButGladyswasayoungwomanout to makeherwayintheworld,andshealwaysendeavouredtobreakdownbarrierswhentheseroseinherpath.Thiswasacaseforanothersuchendeavour."Youhaveaverylovelydaughter, 1\lrs. Beaversham," she said,asthatladyseriouslypoured ted. intofourorfive cups. "Thanks," saidMrs.Beaversham."DoyoutakeAUDITORS.Kingston,Jamaica, B.V\T.I. OFFICE:No.6DUKE STREET,LOANS aregrantedattherateof perannumforInterestonamountsnotexceedingtwothirdsofthevalueofFreeholdProperty.PROFITSaredivisibleamong Members. SHAREScost2/6permontheach.THEVALUEOFEACH SHARE onmaturityattheendof10years,isO.O.ofwhichyouwillhavepaid O.O.only.BONUS,ORSECONDPROFIT,isaddedYEARBYYEARandwaspaidattherateof6s. lastyear.SOLICITORS.MESSRS.HARVEY&BOURKE,53618.5.PermanentGuaranteeFundrepresentedbyLiquidAssetsat30thNovember1930H.A.L.SIMPSON,ESQ.O.B.E.,J.P.NOELB.LIVINGSTON,ESQ.H.MACAULAYORRETT,ESQ..J.P.COLONELAH.PINNOCK,V.D.,J.P.THEHON.A. E. Da::lOSTA,M.B.;; .. .. J.P.SAMUEL.ESQ.DIRECTORS.,3723.O.W.BOWMAN,ESQ., CharteredAccountantV.ST.CLAIRDORAN,ESQ.TotalAssetsat30thNovember,1930SECRETARY.Receiptsfor1929SIDNEYC.McCUTCHIN, ESQ., M.B.E.,J.P.,582O.II.T.N.AGUILAR.ESQ..J.P.,ChairmanM.M.ALEXANDER,ESQ ..J.P.,teputy Chlirman V. E.MANTON,ESQ.,LL.B.H.E.BOLTONESQ., J.P. THEHON.LEONARDDeCORDOVA,M.L.C,J.P. L. V.D.o 0:0,-0-.-.-000-,------'-'--'-'-1 IDoctor'sCaveBathingI J Club I I II WHITE SANDS BEACH II MONTEGO BAY. iIi i THEFINESTSEAandSUN-BATHINGI I INTHEWORLD. !I I VisitorstotheIsland II arewelcomed II and I, admittedtomembership. I' 0 Comfortable,Clean.Sanitary,Dressing i0, Cubicles, Ii LargeSpaciousPa.vllion. ii PayMontegoBayaVisitandenjoy iI theSeaandSun-Bathing i i under I I themostidealconditions II atthe .iI I Doctor's Cave BathingClub, III WALTERFLETCHER II Hon.Sec.&Treas.I ........

PAGE 39

19.31-32 PLANTERS'PUNCHgentlemanhadnotbeenaltogetherasuccess;Mr.Beavershamhadbeencalledupontomakea large: yearlyallowancetotheyoungcouple than hehadcontemplated.Thehusbandhadd'eclinedtowork,sayingtohimself,nodoubt,that,asdeathistheend of life,hesawnoreasonwhylifeshouldbealllabour.Lifewithhimmeantnolabour;hehadnotintendedthatitshouldmeananythinglikeitwhenhemarriedEthelBeaversham.Herfatherwas williul; tomakethemanallowance;allthattheyounghusbandaskedwasthatthatallowanceshouldbemuchlargerthanwasoriginallydecided'on.Hedidnotconsiderthisunreasonable.Hewasthecousinofabaronet.Surelythatshouldcountforsomethingintheschemeofthings.Mrs.Beavershamhadthatexperiencevividlyinmind.So, if ayoungadmiralorgeneralshouldnotbepossible,whynotArthur?That was thethoughtthatflashedthroughhermindasshegazedatherstylishdaughteracrossthetennislawnthisafternoon.Shewouldmakeuphermindlateron,Thegamewassoonover,thoughitwasnot yet sixo'clock.Thepartyseparateditselfintolittlegroupsaccordingtoaffinity;dinnerwasateightandtherewasmorethananhouravailableforpastimesorconversationbeforeitwouldbetimetochange.Mr.Pemberton,withhiseyesnowopelledbyMrs.Beaversham,observedthatArthurselectedGladysashiscompanionforawalk,andsaw the111 strollinthedirectionoftheriverasthoughtheywouldbeapartfromeveryone.HewascOl!sciuus of indignationatthis.Heregisteredaresolvetogivehisnephewahintthatheshouldnotlethimselfbeentangledintoanyunderstandingwith laoy. "Weshould'inviteArthurtoCriptonmorethanwehavedonelately,"saidMrs.Beavershamthateveningtoherhusband,whentheyweredressiugfordinner,"Helivesaloneillthecountry,andifhisfriendsdou'tdrawhimouthewillbedoingS)lllethingridiculoussomeday.""WhatIhave lleen thinkingmyself,"returneclMr.Beaversham."Itwouldbeapityifsudlapromisingyoungfellowweretogoastray.""Heisgoingastraynow,"assertedthe ife."Haven'tyounoticedit?""Yes;andIheardwhatyousaidtoPemberton.Thatwomanisonlyanadventuress;weoughttoprotectArthur.""'Wearegoingto,"saidMrs.Beaversham,withtheairofoneabouttoresorttoacrusadeforsomehighandholyobject;andMr.Beaversham rapidlyconjuringupavisionofbroadandprosperousbananaplantations,thepropertyofMr.Pemberton,feltlikeamodernSt.Georgeaboutto res('\1t') amaleUnafromthecoilsofadesigning whosenamewasLudforel.Hewasmightily relie"t'd bywhathis wife hadsaidanddonethatafternoon.Hecouldreadhermind.SheseemedabouttodesertdefinitelytheArmyandtheNavyandtoacceptanordinarycivilianasoneworthyofadmittanceintoherfamily.Thatcivilianwouldbewell-offandwasofverygoodfamily.Unitedwithbaronets.ortheircousins,hewouldstandsecondtononeintheland.Theonlyobstacleinthewayofthisrighteous plaa wassomethingwhichdescribeditselfasArt,butwhichsurelycouldbebrushedout of existence.Mr.Beavershamdeterminedtotakeahandinthis worK ofbrushingartisticobstaclesoutoftheway."Ithink,"hesaid,ashetiedhisdinnertie,"weoughttogiveadinnerpartyshortly.Weshouldinviteeverybodythatishere,withoneexceptionofcourse.Thatwouldshowquiteplainlywhatwe thinli: ofher.""Itwouldstinghertothequick,"smiledMrs,Beaversham."Ithinkthatindealingwitha womanlikeherweshouldnothesitate.""SendouttheinvitationsauTuesday,"advisedMr.Beaversham."ButIwillmentionthepartythiseveningandinviteeverybodybywordofmouth,inherpresence,"saidMrs.Beaversham."1willaskeachofthemcasually,butleaveherout.""ThatmightunnecessarilyannoyArthur,"hel'husbandremindedher;"woulditbewise?""Heisn'tengagedtoher,ishe?Ifhewere we shoulddrophimaltogether.Perhapsheisn'tevenyetverymuchinlovewithher.Weshallbedoinghimakindne'stolethimseejustwhatthebestpeoplethinkofher.Besides,IamsureAlfredwill begratefultous."Mr.Beavershamsawthepointofthemanoeuvreandwassatisfied.Theybothwentdowntodinnelwiththefeelingthatsomethinghadbeen arrangeLl tokeepsocietypureandundefiled,andtosavefrommatrimonialdestructionafoolishbutpotentiallywealthyyoungman.CRAPTERFIVEMORLEYwasinastateofconfusion. So:nething untowardwastakingplace.Soonanauthenticfactemerged:thebigMysorebullhadescaped.Thisnews,spreadingrapidly,createdasmuchconsternation :IS wouldthereportthatalionhadbeenletloose.TheMysore,arecentimportation,hadprovedevenmoreobstreperousandsavagethanmost of hiskind;hehadabsolutelyrefusedtoyieldtothe d3eyond thehillisavalleyOURprogressinlifeislikeajourneythroughamountainouscountry-aseriesofhillsandvalleys.Todaywemaystandonthehilltopofsuccess,butjustaheadlies a vaHeyofuncertainty.'Lifeinsuranceis asafeguardduringbusinessdepressionsaswell asinboomperiodsbothofwhichareequally Carrylifeinsuranceinorderthatamplefundsmaybeprovidedtoguaranteeanindependentoldageplusprotectionforyourdependents.Eslablished1,887THEMANUFACTURERSLIFEINSURANCE COMPANYrHEADOFFICE" TORONTO. CANADAC.LESLIE ROBISOK....)Ianager forJamaica,116 Tower St.,Kgn. T.E.LEVYSpecialAgent,Black RiYer J.A. FISZI Agent-KingstonV.G.SASSOdo do L. A.ROSSdo do A.TIE EEdo doC.L.DAVISdo do)

PAGE 40

39PLANTERS'PUNCH1931-32treatmentusuallyappliedtobullsbythenativecattlemen;andthesmallboysofnotmorethantenortwelveyearsof age,whohadbeenusedtoherdingcattleandmanagingthemwithasupremeindifferencetohornsorhooves,werepuzzledbythebehaviourofthisbeast.Theseboyscouldnotunderstandwhythebullshowedeverydispositiontogorethemwhentheyappearedwithinstrikingdistance of him,andtheold'ermenshooktheirheadspropheticallyandprognosticatedthatnogoodcouldcomeofananimalwhichexhibitedsoobnoxiousadisposition.Theytreatedhimrespectfully,prudencecompelling,buttheyhadnolikingforhim.AsfortheMysore,hehatedthemall,eventheEastIndians,whosecomplexionandmethodsremindedhimofmenhehad left behindhiminIndia.Andnowhewasloose.Thiswasn'tanybody'sfault;itwasduetohistakingitintohishead ,=arly thatmorningtoleapoverthelowstonewallthatboundedtheareaofhispasture.Mysoresaregoodjumpers,andthisonewasachampioninhisway,Hehadnotonanypreviousoccasionexhibited this particularaccomplishment,otherwiseprecautionsmighthavebeentakenagainstanyattemptonhisparttogetaway.Butataboutdawnthisday,moveddoubtlessbyadesireforfreedomandindependence,andperhapswishingtoshowthatstonewalls,donotaprisonmakeforMysoresofhisdescription,hehadvaultedintotheopenandstoodfree,fearlessandferocious,lookingaboutforsomethingtodothatshouldnotbe of averypacificcharacter.Findingnothing,hesetoffinsearchofadventure.ItwasjustthenthattheyoungEnglishbookkeeperatMorley,whohadnotbeenintheislandformuchlongerthanthebUll,happenedtopasshisway.TheyoungEnglishbookkeeper,Robinsonbyname,hadnobookstokeepbutwasresponsib.lefortheobservanceoflawandorderonMorleywhileengagedinlearningthemysteriesofbananacultivation.Hesawthebullandrealisedthathehadnorighttobewherehewas. The bullalsoperceived'thebookkeeperandconceivedtheideathathetoohadnorightto bewherehewas.Withsuchasharp(j'ifference ofopinionprevailing,aclashanda con flictmightberegardedascertain;inthisinstanceitwasthebullthattooktheinitiative.Heloweredhismassiveheadwithitsterriblespreadinghornsandbellowed;possiblythatbellowwasintendedasawarning.Mr.Robinsonregardeditasachallenge;inanycaseheknewthathewouldbeblamedifthebullcommittedanydamage,andthatitwashisduty,asthemostresponsiblepersonpresent,toseethatthebullwasdriven back tohispen.Hewasaplnckyyouthoftwenty-two,apublicschool boy,andthoughhehadheardinageneralwayfromtheNegroandEastIndiancattlementhatthisbullwasnotasotherbullswere,butof avileandnastytemper,hewassatisfiedthatitwouldyieldtofirmbutconsideratehandlingadministeredfromafairlyprudentdistance.Heratherdistrustedthereportsoftheworkers,thinkingthemexaggerated,andhehadforthenativesandtheirpeculiaremotionalismallthedisdainof anewcomerimpatientofcustomsandtraditionsWhich,heheld,should'beswiftlychangedtothegeneraladvantage. 'This bUll,hefelt,couldbemanagedbyanyreallyintelligentperson.Therefore,pickingup astonethatlayathand,hethrewitintheMysore'sdirectioil,utteringashedid so aloudshouttofrightentheanimalbackintohispenn. Th'3 onlyresultwasafurtherbellowfromthebullandastrangemovementofhisforelegs,asthoughthemostinterestingproblempresentingitselftohismindatthemomentwaswhetherhecoulddigabigholeinthegroundwithhishooveswithinthenextfewminutes.TheyoungEnglIshman,recognisingthatnonoticehadbeentakenofhisstoneandhisshont,nowfiredupwithdetermination.Waterloohadbeenwonontheplayingfields ofEton,andayoungsterwhohadbeena finecricketerandsprinteronthe (ContinuecL onPage 42) THETEXASCO.,(CARIBBEAN)LTD. .:.l (I __ (J_(I __ II __ .:. !iI 'iII TIETENQUEE,Ltd.,I i!i 53,551 WESTSTREET, !i !i CommissionAgents !i !i AND !. II Manufacturers'Representatives !I,'i i IMPORTERSOF:!I INewfoundlandCodfish, !i Herring&Salmon. i i Super Seghundi&Burma! .I S.Q. Rices. ",i ." Baking,Mediumand Shop Ii 'i Flours. !, I ISoyaBeanOil. !i Lard Compound. !. Ii Currants, Strawpaper. ,'i BakingPowder, Soaps. !!Ii /CY-KOL. ', !!MeadowBrandCondensed i, Milk. 'i! KOTOWine. !I JUV/GORPure Grape Juice.I ,fi Holsten PilsenerGerman! Beer. i Chinese Silks and General ,,'i DryGoods, etc. i !I EXPORTERSOF:!i i General/sland Produce.! i Cocoa, Coffee, Pimento,! i AnnattoSeed, Ginger. i Kolanuts, Sarsaparilla, Hides i i i(fVet Salted),etc. !I! i !i YourEnquiries Solicited. I PHONENO.2911.! i !I I__(I_ll_, haswill2836.I"""""'"",,,',, ,,! iii!!!.WAREHOUSE""IIiifiilli""IIi!lHii",ii, """I,! 13PORTROYALSTREET,KINGSTON. IThe NewTEXACO MOTOROILnoequal-itIStheonlymotoroilthatgIvecompleteprotectiontoallmOVIngparts.I J 3 =1 PHONES-OFFICE254IICHECKthevitalqualitiesyouexpectillamotoroilandyouwillfindthemInthe ""'e:;W T e:;xae:o.TRY IT TO-DAY! LISTEN! 1""'""""Iii!'''''''''''''''''''''''' ",,,WJIWIillI!IllllillOW""" !

PAGE 41

PLANTERS'PUNCH40SOLEAOENTS-J. WRAY&NEPHEW,LTD.

PAGE 42

t1PLANTERS'PUNCHTheChoice 01 theConnoisseur!\ FINEST SCOTCH OFCREATAGEaboDewar &1 OISTILLERS. TV:::''''O!r, pEEsoW' ScotchWhiskywhichseemstohavecapturedthesunshineofthebarley....thetangofthepeat smol{.e ..themellownessofgreatage.. Whisliy withafragrantbou agraciousmellowness,andagenialflavourthatwarmstheheart-suchis DEWAR'S, arareoldScotch Whisl{.y. iteLabel"AgedinthewoodandbottledinScotland,theunvaryingqualityofDewar'sleavesnothingtohedesired.SOLEAGENTS-J.WRAY&NEPHEW,LTD',

PAGE 43

1931-3PLANTERS'PUNCH42MANUFACTURERS' REPRESENTATIVESKingston,Jamaica,B.W.I.=.1111111111111111111111111111111111111111111111111111111111111111111rll.!::------ALEXANDERDOLPHY-YoungRobinsonfullyrealisedthathemust pre vent,ifatallpossible,thatMysorefromeffectinganyfurtherdamage.Hewasinchargeofthesituationnowevenmorethanhewasbefore;hecouldneverpleadignoranceafterhavingbeentreedbythebull:hewassurroundedbyacloudofwitnesses.Thedistancetoearthfromthebranchonwhichhewasperchedwasnotgreat;hepromptlyjumpeddown,landingsafelyonhisfeet,andwithquick,agonisedmovementsproceededtoexterminateasmanyantsashecouldreachwithoutundueexposure.Thenhecalledtosomeoftheyoungfolk and badethemaccompanyhiminhistrackingofthebull;twoothershedespatchedtosummonsomeofthecattleboys.Thetrackingofthebullwasnotdifficult;hewasmakingnoefforttoconcealhismovements.ButwhileRobinsoncouldeasilykeeptheMysoreinsight,hedidnotknowwhatelsetodojustthen.Hisproblem,indeed,wasmainlytokeephimselfoutofsightoftheMysore,forhewasnowinaforestofbananas,andthebananatreeissomethingwhichnoonecanClImb.Itdidnottakealongtimenowforthescenetobecomeananimatedoneofexcitedhumanbeings.Thetwolittleboyshadshoutedastheyranthatamadbullwasengagedingoringandotherwise (Continuecl onPage 46) SUPPLIERSMERCHANTS-BeIMPORTERSCOMMISSIONoftheseblackantsnowbeganascientificinvestigationofRobinson,andforonewildanddesperatemomenthewondered whl1ther itwouldnotbewisertoleaptotheearthandmakeanotherrunforit, than toremainoutoftheMysore'sreachandendurethetormentsoftheants.Itwasthenthata voicecametohisear,a voicefromtheothersideofagullywhichranthroughthissectionoftheproperty,dividingitintwo.Thevoicewasthatofanoldblackman,who,standingsafeonthefartherbankofthegulley,advisedtheyoungmasternottoattempttocomedown."Bullbad,massa,"cametheunnecessaryassurance;"an'thoughIknowantsbitesy'u,itbettertoperishbytheantdanbydebull."Robinsonthoughtbitterlythatifhehadtoperish,aquickdeathwouldbepreferable;buttheoldman,afterhavingthussetforthhisviewsuponachoiceofdeaths,atoncebecamepractical."Holdon,massa,tillIgetsomeofdesechildrenheretostoneoff debull,"heshouted,thendisappeared.Inaminuteortwohehadcomeinto view againwithwhatappearedtobemembersofhisfamily,girlsandboys,and'these,safeenoughfromthebull,butnearenoughtoreachhim,beganwithstonesandshoutstoendeavourtoscarehimaway.owthebullknewthatRobinsonwasabove.andhisparticularquarreljustthenwaswithRobinson.Buthehatedallhumanbeings,andsomeofthesewereinsultingandannoyinghim.HeforgotRobinsonaltogether.Hemadearushtowardstheurchinswhowerefiingingstonesandrudecriesathim.Hefoundhecouldnotcomeatthem;hecouldnotleapthatwidegully,hecouldnotclimbdownonesteepsideofitandthenclamberuptheother;hecouldonlybellowhisdefiancewhilethestonesshoweredonhisheadandside.Onestone,hittinghimsharplyneartheeye,determinedhistactics.Hewithdrewoutofthereachofthemissiles,thenstood, formidable, waitingforsomeonetocomewithinhisreach.Thegroupoftatteredboysandgirlsnowchangedtheirplan;theyscrambleddownintothegullyandscrambleduptheothersideofit,thisbringingthemnearertotheMysore.Fromthisnewpointofvantagetheyagainbegantohurlthingsathim,andhe,believingthattheLordhaddeliveredthemuntohishorns,charged'swiftlyintheirdirection,onlytoseethemdisappearmysteriouslyfromsight.They had simplyslippeddownthegully'sside,withtheirheadsbelowthelevel ofthebank,knowingthatnobullcouldcomeatthemthere.Whentheyappearedagain,itwasalittlefurtheraway,andoncemorethehailofmissilesbegan.Againtherewasarushofthebulltowardsthem,andagaintheywerenowheretobe seen.Thisdisgustedtheanimal;hecameofgoodfightingstockandhefeltnothingbutcontemptfor two-leggedcreatureswhowouldnotcomeintotheopenandfightlikebulls.Withonelastdefiantbellowheturnedawayandattacked'acoupleofbananatreesinthevicinity,easilyknockingthemoverwithonesweepingmovementofhishead.Thisdidsomethingtoassurehimthatdestructionwasstillwithinthepossibilities of themorning,andnowhetrottedofftodiscoverwhattheworldmightholdforabullwhowasnotinclinedtobetrampleduponbyany TheCupandTheLip(Continued .q-om Page39)playing fields of awell-knownEnglishpublicschoolmustsurelybeabletotriumphoveranddominateany bull.Hepickedupanotherstone,andthistimehehurleditstraightattheMysore,advancingatthesametimewithafirmandconqueringde meanour,whichprogresswasbroughttoasuddenhaltasthebull,withonelastterrificbellow,chargedmadlyathim.Therewasnomisunderstandingthebull'sintentions.Hemeantbusiness,andbusinessof adistinclyhomicidal type.Thatyoungman,inaninstant,feltstrangeandlonelyandfarfromhome,alone,allall aloneinatropicland,withaninfuriatedbullbearingdownuponhim.WaterloomayhavebeenIvonontheplayingfield'sofEton,butmanyawarhas beensuccessfullyterminatedonlythroughstrategicretreatseffectedinthenickoftime.Thislookedlikeoneofthoseoccasionswhenaretreatwashighlyadvisable,was,indeed,imperative.Thebookkeeperturned,and,asthebullsurgedforward,he spedwithlightninglikeagilitytowardsthenearest tree.Heheardthethunderofthebull'shoovesonthehardgroundasthebrutedashedforward,heimaginedthatalreadyhewasbeingliftedintotheair bythosehorrifichorns.Thetreetowhicha healthyinstincthaddirectedhisfiyingfeetseemedvastdistancesaway,andhisstartledmindwonderedifhecouldreachthatholyandloftysanctuaryin time.Butanactive,athleticEnglishyouth,whohas won areputationforswiftness,maybeatevenaninsolentandman-contemptuousbull;andso youne; Robinson,almostwithoutknowingit,foundhimselfbestridingthelowestbranchof asubstantialtreewithinthreesecondsoftheMysore'sarrivalatthefoot ofthatplaceofrefuge;andthoughthecreaturepromptlydealtthetree'strunkaviciousbutt,theeffect oftheimpactmerelycausedhimtorecoilinamazement,whilethetreestoodstockstill,notevenshaken bytheblow.Herethenwerethetwoprotagonistsinthislit tledrama,theoneabove,theotherbelow,andforabriefspaceoftimeeachtookasurveyofthesituation.Robinsonfoundthathishandswerepainfulandbleeding.Thiswasatreecoveredwiththorns,longstoutsharpthornsthathadhithertoeffectuallypreventedanyonefromascendingit-"amakkatree"thenativescalledit.Andtodescend,itseemedthathewouldhavetorunthegamutofthosethornsoncemore!Descent,however,wasnottheimmediateproblem;solongasthebullremainedbelow there would benodescent.Butwhatadded'to the horrorofthesituationwastheappearanceofgreatnumbers or aparticularlyviciousblackantwhich livedonthetree,andwhichwasnowcurioustomakethefurtheracquaintanceofthisstrangebeingwhohadintrudedhimselfsosuddenlyanddisturbedtheeventenorofanestablishedform iniferoushomelife.TheblackantofJamaicais not poisonous,putitsbiteisextraordinarilypainful. Anditsabilitytopenetratetoalmostanypartofthehumanpersonseemsproofofgreatpersistenceand or ahighorderofintelligence.A fewhundredDISPENSING CHEMISTS AND DRUGGISTS.0/Experience."WINES STOCK?FEED YearsCABLE ADDRESS -.. ALlCK"JAMAICA. ""E Specialty.aPERFUMERYFRENCH== i PRESCRIPTIONSCAREFULLYandACCURATELYDISPENSED. i KINKEADLIMITED-DealersInPureDrugs,PatentMedicines9Cologne,Confectionery,Teas, etc.,etc. .. -AmericanIcedSodaDrinks20KING STREET,ofFineFlavoredSyrupsandKINGSTON,JAV1AICA,IceCream.(Opposite BankofNova:5cotia.) m.111I111I11I1I11lI;::

PAGE 44

43P LAN TERS'PUNCH1931-32 COheHauntinsQ/ the Flaminso ANOLD SUPERSTITIONOFTHE SEA'IN 1921thePortugueseGovernmentboughtsomeBritishblood-stockhorses,and we-theofficerS' oftheFlamingo,oftheX--Line-wereverypleasedaboutit.ForthepasttwelvemonthswehadbeendoingtheWesternOceanrun-AntwerptoNewYork,NewYorktoAntwerp-untilithadbecomemonotonousand,indeed,somewhattantalIzing,forouronlyviewofEnglandhadbeenthroughapairofbinoculars.Thuswewerehighlyelatedwhen"Sparks',"thewirelessoperator,receivedaMarconigramtotheeffectthatweweretoproceedfromAntwerptoHullinordertoembarksomehorsesforLisbon.ButEnglandwassufferingfromaboutofmist,rainandfrostduringourstay,whichrather spoiled ourpleasure,andinslliteofourpreviousanticipationswewerenotaltogethersorrywhenwewere once moreatsea.InduecoursewereachedLisbon.Themateandthe engineerhadbeentherebefore,buttotherestofusLisbonwasnewground,andwewereverygladtohavearunround.Shore-leaveforusofficerswasrenderedpossiblethroughatechnicalhitch,connectedwiththelandingofthehorses,whichdelayedour depatture, butitwasdeemedinadvisabletoallowthementoland,astheywereratheramixedlot,andhadanyofthemgotintotroubleashoreweshouldhavebeencompelledtosailshort-handed.Intheusualcourseofevents,mostoftheofficerswouldhaveremained'onboard,andtheadventurehererelatedwouldthereforehavebeenrenderedpracticallyimpossible.Thesecond engineer, however,.hadextractedfromanorange-vendorthen,ewsofalocalbull-fight,andthencewemadeourway,leavingbehindontheFlamingoonlythechiefengineerandthemate,bothofwhomwerefullyoccupiedwiththeirvariousduties.Themajorityoftheofficershad-been'rovingtheseasthroughouttheWar,anditwasstillafavouriteamusementofourstoattachatargettothesternrailforthepurposeofpistolpractice.Mostofususedautomatics,butSmith,thethirdengineer,wasanexception.Attheoutbreak of hostilitieshe haa joinedtheArmy,wanderinginandoutofvariousunitsuntilhefinishedupascaptainintheIraqregion.Smith'sonevicewashisinordinateprideinhisServicerevolvei',whichheconsideredfarsuperiortoourmodest"Brownings."Seamenasaclassareinvariablysuperstitious,butSmithyhadoverthrownmostofhissea-loreinfavourofsundryArmybeliefs;anditwasthroughthisthatthetroublestarted.AftertheFlamingoresumedhervoyagetheAzoreshadbarelydroppedbelowthehorizonwhenthethirdengineer,asusual,beganboastingabouttherangeofhisrevolver.Atthatmomentadeck-handdrewourattentiontoan albatrosS' hoveringoverhead.Smithygrinnedatus,and,sightingonthe ].ird of W-(Jlr.'m withoutstretchedarmcried:"Nowwatch!"Roarsofdissentcamefromallsides,butitwastoolate;Smithyhadfired!Apartfromafewfeathersthatcameflutteringdown,thebirdcontinueditsflightapparentlyunhurt.Nevertheless,thestoryofthedarkdeedspreadthroughouttheship,andinspiteofhispopularitySmithreceivedmanyblacklooks.Indeed,soseriouslywastheincidentregardedthataspiritofuneasinessbecameapparentamongthemenwhostoodabout talking inundertonesandcastingfurtiveglancesinourdirection.Thethirdengineer,however,remainedcomplete lyunmoved,maintainingthattheColeridgelegendhadbeenoverworked;itwastimesuchan'absurdbeliefdiedanaturaldeath.Thesecondactinthedramaoccurredsometimeduringthenight-offstage,sotospeak,forweknewnothingaboutitatthetime.Atbreakfastthefollowingmorningwewereratherastonishedtoseeourusuallyplacidstewardrushpastthemess-roomdoor.Fromthefleetingglanceweobtainedofhisperturbedcountenance,wegatheredthatsomethingorotherhadgoneseriouslywrong.A fewminuteslater,whenhescurriedalongagain,Smithycalledout:-"Introuble,Steward?"Thestewardpaused."Trouble!"heechoed,inanangryvoice."Thepantryhasbeenlooted.To-day'sdinnergone!"SmithyandI lookedatoneanother;then,almost as' amatterofcourse,wesaid:"Thefiremen?""Theymusthavethekeys,then,"repliedtheworriedsteward."Thelockhastn'tbeentamperedwith.Comeandsee!"Althoughboththethirdengineerandmyselfhadsuggestedthatligh.t-fingeredmembersofthe"blacksquad"mightberesponsibleforthetheft,neitherofusreallybelievedit,for.theFlam,ingowasa goodshipforfood.FreshstoresonaliberalscalehadbeenprovidedbothinAntwerpandNewYork,andforthistripthestewardhadalsoob.tainedextrasuppliesinHull.We followedtheexcitedfellow tothepantry."There;lookatthat!"hecried."Notevenadirtyfinger-mark!"Hewascorrect.Therewerenotracesofaforcedentry,butwhoeverthe raiderS' were,theyhadbehavedratherwantonly.InsideIthepantryfoodlayscatteredinconfusion,eggsandsalad-dressingformedastickypool onthefloor,and, gerierally speaking,itlookedasthoughtheplacehadbeenusedforthesettingof aknock-aboutfilm.Afterim'llectingthemess,someinstinctmovedmeto'gazeupward,andmyeyesremainedsolemnlyfixed.Thethirdengineerandthestewardalsolookedaloft."Well,I'mjiggered!"gaspedSmithy.Abovethedoorwasaventilationspace,coveredwithmetallicgauze,aboutthreefeetwideandeightinchesdeep.Thisgauzehadbeen torn awayfromthebottomnails,andfromtheraggedendsofthe mec:h dangledfoursausages!"Well,thatsolvesthemystery,"observed Emithy. "Indeeditdoesn't!"snappedthesteward."Couldyou,oranyoneelse,squeezethroughthatgap?It'smybelief,sir,thattheship'shaunted!No goodever 'Tis Cltnstmas again.Let'shonourtheday A.rld putall nurtroublesandwO'/TiesaWII1/, Feastandbe rnern.J! Aboveall.don'tfailTopledgeFa.tke?' Christmas inYounger'sScotchAle.WhatputsZipinChristmasCheer-WelcomingthegladNewYear? dlin:.HAHBOUHST., KINGSTON."MONK BHAN))"KIl\G OF ALESMILK STOUTPAL EAr,EEXTHA STOUT R.MOUDECAJ, By the way, don't (orget to put some Younger's StrongDISTRIBUTOR

PAGE 45

1931-32PLANTERS'PUNCH"'i,,, JJ!!TI"IJIiI'CtmI IIi,ii,Ii''',.!.,,''.'! ".f ,,,""'!III',,"ii'!IIIi1ii",,",,,",ii',""ii'"'ill'"!IIiThe,IIi,111111,I,m'"" Doctor's Cave Hotel
PAGE 46

PLANTERS'PUNCH1931-32::::lllllllllllllllllllllllllltlllllllllllllllllllllllll:Illil!1111111111111111111111111111111111111111111111111lllllllllllflllllllllllllllllllllllll;; .----Buyersof everyDescription of-----, there.I1IIi"""",,,"'"""""",;,-J Honey,Fustic theGlobe 9:>BA'RRYRTREET.,,," .1,,,IIiii,"Ii'ilii""!"'."iii"iili",lili"",!i'" 134Y. FOllntainrefresh yourself"What tvas it?"Idemanded."Hasn'thetoldyou?"inquiredthesecondengineer."Well,itwasamonkey!Thebeastwas just dis-appearingoverthebackofthecoalwhenSmithyfiredatit.Itmusthavebeenaluckyshot,withonlythetrimmer'sflaretohelphim."Merchants.i"Ii'iiii""!!!!','ProduceRUM MERCHA;NDISE .""", ATTHE Dealersin:Kingston, AGENTS FOR.rn Cocoa,Pimento,Log,"'ood, andtoeverypartofGeneralWhenIslandPlazaSodadonot fOigettoobtain your Grocery SuppliesItis the most convenient place to shop. Coffee,Cocoanuts, LUMBERPAINTS Il':CLUDING: E'xportersAnd PLAZACOMPANY. MORRISMOTORSLtd.CARS&TRUCKSR.EHRENSTEIN&CO.Ltd., ,j,iIrh'ih"!iili!liilliiiii"iiii"'''''''''",,"liWiiiiiiiiiiiiiIiih'lJII!!!IljIl'I""u'lIIi!ii.... h,iii,"",iiiiIiii'"''llii1iiiiihiiiiiiiiih"iii!""i1i1!iiiii""iiilliiiiiiiiiiiiiiiiiiiiiiiiiiiii!iiiiiiiiii"iiiiiiiiifiiiiiiiii"'''''""",iiillii"i!iii'''''''Wii''i"LookhereSmithy,"Isaid,"ifyoudon'ttellmerightawaywhatyouhavekilledyouwon'tneedthatgunanymore."Hegrinnedatmemockingly,andindespairrturnedtothesecondengineer,whohadjustcomeoutofthebunker.confrontedwiththeill vi:;ible youspeedilygetsomethingborderingonpanic.UnderlyingouruneasinessconcerningtheiII-luckbelievedtoattachtomeddlingwithalbatrosses,severalofuscherishedafaintsuspicionthatsomebodyonboardwasplayingapracticaljoke---andmostofthesuspicionfelluponSmithy.ItwastruethathewasondutywhenBlairlosthisglassesandspokedowntheengine-roomtube,butanactivemanwouldhavehadtime.tocreepuptothebridge,scarethemate,andbebackathispostbeforetheofficercalledhimtothetube.Thoseofuswhosus'PectedSmithypointedout,moreover,thatallthemysteriousincidentshadhappenedduringhiswatch,inthedeadhoursofthenight.Wetalkedmattersoververyseriously,andfinallytoldSmithyourthoughts,buthisresentmentsatisfiedusthatheknewnomorethanourselves.Ashetoldus,itwasscarcelyconceivablethathewouldriskignominiousdischargeforthesakeofasilly urag." Thereuponwewentintogeneralcommitteeanddecidedthatsomehoworotlierthemysterythatoverhungtheshipmustbesolved.Everybody'snerveswereonedge,andweknew,thatthecrewweretalkingallsortsofnonsenseintheirquarters.Inconsequence,thenightwatcheswerebecomingarealordeal,fornomancaredtowalktwopacesalonewithoutcastingafurtiveglanceoverhisshoulder.Astheresultofourdeliberationsweofficersarrangedtomaintainaspecialvigil.WhenIcameoffdutyat mirtnight Iwastokeepontheprowlforthenexttwohourswiththethirdmate;thesecondengineerwoulddothehoursbetweentwoandfoura.m.withthemate.Thethirdmatekepttothedeck,whileI patrolledtheengine-roomalleywayandbelow-decks,butnothinguntowardhappened.Itistruethatoneofthecoal-trimmerswhomIencounteredonthestoke-holdfiddley,declaredthathehadheardasoundlikethewhimperingofababyinthestarboardbunker,butafterexploring it withtheaidofallelectrictorchIdecidedthathewassufferingfromatouchofimagination,andtoldhimsoprettyfor cibly. Ihadbeeninbedaboutanhouraftermyspellofsentry-gowhenIsuddenlyawoke.InstantlyIbrokeoutina coldsweat,forIwascertainthattherewassomethinglyingonthecoverlet!Fearfully1stretchedoutmyarm-andmyfingerstouchedahairybody!AlmostbeforeIrealizeditthethinghadgone,andwhileIwasgropingwildlyfortheelectriclightswitchIheardapatteroffeet,followedbyaterrifichullabaloointhealleyway.I floodedtheroomwithlightandstaredeagerlyround,butthecabinwasempty.ThenIrantothedoor,andlookingout,perceivedtheCaptainapproaching,hisfaceredwithrage."Didyouseeit?"hedemanded."Nosir"Ianswered."I'veseennothing.Therewas inmybunkwhenI woke,butbeforeIcouldswitchonthelightithadgone. Iwaitedforasecond,expectantly,andthen,astheCaptainmadenoreply,Iadded:"Whatwasit?"TheCaptainglaredatme."Idon'tknow!" hn barked,andstampedoff. Amomentlaterthesecondengineercame alon!l:. cursinghisluckatmissingtheThing,whateveritwas,andupbraidingmefornotbeingquickerwiththelight.AtbreakfasttimewelearnedthattheCaptainhadawakenedduringthenightand,sensingthatthere was somethinglyingonhisbed,hadcautiquslyreachedforthelight-switch.Beforehecouldtouchit,however,therehadbeenascufflingsound anll the"something"leaptaway.Thinkinghehadhearditmakeforthealleyway,theCaptainhastenedinpursuit,butsawnothing.Wewereallwarnednottomentionthematterinthehearingofanyofthecrew,butwesoondiscoveredthattheywerealreadyinpossessionof the facts,andoneandallsworethattheywould"jnmptheship"atNewYork.Wekepttothearrangementsmadethepreviousnightasregardsaspecialwatch,andoncemorethethirdmateandIspentafruitlesstwohours.JustasIhadgotintomypyjamas-attwo-fifteena.m.IheardasoundwhichItooktobetheburstingofawater-guageinthestokehold,andgrinnedunsympatheticallyasIvisualisedthethirdengineercursingwhilehefittedanewglass. Mymerriment.however,wascutshortbythesec'ondengineerpokinghisheadoutoftheengine-roomdoor,shontedexcitedly:"Comeon,Fourth!IbelievetheThirdhasgotit!"Therewasnoneedtoaskwhat"it"was,so, hastily donningapairofshoes, Irusheddown the engine-roomladderandthroughintothestokehold,whereImetSmithyjustemergingfromthestarboardbunker."Youcan'tbeatanArmyrevolver,oldchap,"hesaid,airily."Bulletwentastrueasadie.""Whatdidyouhit?"Iasked,inbewilderment."Ihitthemystery,"heansweredexasperatingly."Youcan'tbeataServicegun.I'velaidour'ghost,' so youcangobacktoyourbunkandsleepsound,aidman.We'llgointodetailsinthemorning."

PAGE 47

1931-32PLANTERS'PUNCH"No!Notaluckyshot,"objectedSmithy."ItwasaquickeyeandajollygoodServicerevolver."Asitwasmywatchfromeighttotwelve, Iwasunabletoleavetheengine-roominordertohelpinthesearchforthemysteriousmonkey.Theweather,moreover,wasdecidedlyboisterous,sothatmytimewasfullyoccupiedinwatchingtheenginesandkeepingthebilgesinworkingorder.Iwasinthemidstofcleaninga bilgeboxwhenoneofthefiremen camEl rushingthroughtome."Quick,Mister!"hecried."Stowaways!"WiththatIabandonedmyjobandhurried intu thestokehold.ThereIbeheldthethirdengineerwitha deau monkeyinonehand;theothergrippedthecoatcollarofaverywoebegonespecimenofhumanity,whilethesecondengineerhadafirmholdoftwomorestrangers.Goingbacktotheengine-room,Ipassedthenewsuptothebridge.Whenthesorry-lookingtriohadbeenhandedovertotheCaptain,SmithycamedowntorelievemewhileIhadalookatthestowaways'hidingplace.Thebunkerinwhichtheyhadsecretedthemselveshadnotbeentoucheduntilearlythatmorning,whenthechief-engineerhadgivenordersforittobe opened.Rightatthebackofthe coal, directlyundertheventilator,therewasasortofpit,linedwithboards.Atthebottomofthis"dug-out"wefoundsundryscrapsof foodandthesecondengineer'smissingcurtains.Fromthedeck-ventilatorawirehungdown.This,wefound,hads'ervedasaladderforthemonkeywhenhewentforthonhismaraudingexpeditions;theboatswainsaidthatonseveraloccasionshehadtorenewthecanvasscreenoftheventilator.Thestowaways,itseemed,werePortuguesewhohadboardedthe atLisbonduringourabsence.Welearnedunofficially,afteraPortuguesecoal-trimmerhaddesertedtheshipatNewYork,thathehadplannedthewholeaffairwhenhejoinedtheshipatHull.RelyinguponbeinggrantedshoreleaveatLisbon,hehadpreparedthe"dug-out"inthecoalforhisfriends,towhomhehadwritteniuadvance.Althoughhedidn'tgets'hore-Ieave,hetookadvantageofthefactthatpracticallyalltheofficerswenttothebull-fightinordertosmugglehisfriendsonboardanddownintothebunker.Thenextdifficultythatarosewastheproblemofobtainingfood,andoneofthenewarrivalshitonthebrightideaofutilizinghishalf-trainedmonkey.'Theanimal,however,provedinsufficientlyexperiencedinthedutiesof"scrounging,"andplayed a few"monkeytricks"ofitsown;otherwiseitisquiteThe Cup and The Lip(Continuecl trom Page 42) maltreatingMassaRobinson,andeverybodywithinhearing,onlearningthedirection of theiut.erestingspectaclethusadvertised,hadrushedofftoseehowMassaRobinsonwasst.andingtheordeal,with, of course,everyintention ofIE;nding arescuinghand.Some of these,appearingdirectlyinthepathofthebull,founditadvisabletoflyfortheirlives,thegloom of thebananaforestgreatlyfavouringthem.Twocattlemen,scornfullycursingthebull,ranboldlytoward'shim,onlytofindthatheinhisturnrushedstillmoreboldlytowardsthem,thuscompellingawildmovementontheirpartindiagonaldirections.Thebullnowseemedmoreresolveduponscaringpeopleoutofhiswaythanoninflictinganyactualpersonalinjury.Thebananatrees impededhismovements;hischargeswerecarriedtonocompletion;whenhisantagonistshadputsomespacebetweenhimandthem,hepausedandresumedhisprogress.Hedidnotknowexactlywherehewasgoing,butheseemeddeterminedtogetthere.Hewastakingalinethatledt.oRamsingh'scottage.Arthurhadhithertoheardnothing of allthisnoise.TheGreatHouseof Morley,inwhichhelived.wassomedistanceawayfromthespotwhereyoungRobinsonhadencounteredtheMysore,andthismorninghewaspreparingtoridewithSampsonover !l. partof Morley,toinspectapatchofbananasaffectedwith"PanamaDisease".SampsonwasinaresponsiblepositionatMapleton,whereitwasimportantthat"PanamaDisease"shouldnotbreakout,andArthurwantedSampson'shelp.ThebrownmanhaddrivenoverinaFord,neitherhenorArthur, of course,givingathoughttoRamsingh,whoseremovalfromMapletonhadt.akenplacethreeweeksbefore.probablethatthe"ghost"oft.he Framingowouln haveremainedanunsolvedmystery.TheAmericanGovernment,ofcourse,wouldnotallowthestowawaystoland,andaccordinglywewerecompelledtot.akethemback,workingascattle-men,onthereturntriptoAntwerp,whencetheywereputinatrain for Lisbon.The"albatrosslegend"diedanaturaldeathaftertheshootingofthe'monkeyandt.he disc'overy ofthestowaways,andthecrew,withtheexception of thePortuguesetrimmeraforesaid,forgottheirpreviousintention of "jumping"theshipinNewYork.Andsoendedthehaunting Of the TheywereridingtowardsRamsingh'scottageataboutthesametimethattheMysore,feelingmuchbuckedupwithhavingscatteredsomanyenemiesin awilddisarray,emergedintotheopengroundthatfrontedthecoolievillageofMorley.Andthen,frommanydirections,camepeopleandmorepeople:thosewhohadfirstheardofthesestrangeandunusualevents,andthosewhohadfled,andthosewhoweresuddenlyapprisedofthem.Itwasanarenawithagreensettingofbananatreesonthreesid'es,and,onthefourth,thevillage witl1 itshutsanditsonewoodencottageofsuperiordescription.Thebullpausedashecametotheedgeofthisarena,hisheadcarriedhighandproud, hi.3 mightyhornsstandingoutsharpandcruel,his eyed alightwiththeflameofbattle.Hesaw,tohi'3right,twohorsemen;hesaw,allabout,scoresofblackandhronzedandbrownpeoplegesticulatingandshouting;and,asfatewouldhaveit,hesawRamsingh,whohadl1urriedintotheopenonhearingthesoundofthisextraord'inarytumult.Ramsingh,inhiscapacityof"timekeeper,"ormaninchargeofagangofworkers,hadbeenscandalisedbywhatseemedtobealackofdiscipline;heimagineda fight.Injustonesecondherealisenthat,forhim,itwasgoingtobea flight.Forhewasclothedinasimplepairoftrousersandascarletshirt;whichflamingscarletlookedverypicturesqueOlloccasionsamidstthedarkgreenofthebananas.Butbullshaveadeep-rootedantipathytored;andourMysorewasnoexceptiontotherule. He perceivedinRamsingh'sbrilliantappareladeliberateinjuryandinsult,andhewasnomoreabletopreventhimselffromhurlinghisvastbulktowardsthatflaunting,incarnadineinsolencethanashellcanstopitselffromflashingout of arcannon'smouthwhentheexpellingleverispulled.Itwasallina flashoftheeye--theterror-strickenEastIndianturningtoflee,thebulldashing forward intentupongoringthepoorwretchtodeath,andArthur's swift, instinctivespurringofhishorsetowardstheinfuriatedbrute.Arthurhadtakeninthesituationataglance;hewouldstrikethebull on theheadwithhisheavyridingcropandsodiverthisattention;theanimalwouldchargehim,buthishorsecouldeasilyoutdistancethebull,and,besides,thecowboysaboutcouldbetrustedto capltir.:l t.hecreature.But.Arthurwasnotrained'bull-fighter;hemiscalculatedtherushofthebullandthespeedofhishorse.HedidgetinbetweenRamsinghandthe M'ysore, butonlytofeelthehorsehe alm)stliftedoffthegroundastheMysore'shornsrippedintoitsside,andthenhorseandhewere flung heavilytotheearth.MARTIN,HarbourStreetKingston. E.Me76Never Before aCarinThis PriceClassWithsoMany QualityFeatures. CHRYSLER THE FloatingJ)owe;.. GIVES THE CHRYSLER"THE SMOOTHNESS AN EIGHT""".rHEECOl"OMY OFAFOUR"InadditiontoFLOATING PO'VER theNewChryslerPlymouthCombinesalloftheseADVANCEOFEATUUES.FREE isthetalkoftheIndustryandadistinctoontributortoeconomy.EASY SHIFTTRANS'1ISSION-which eliminatesallgearclashingand makes theshiftfrom High toSecondeasyandnoiseless.56nORSEPO"VER-Uevelopedwithnoinoreaseoverpreviouspistondisplacement.SAFETY-Contributed by ChryslerPlymouthHydraulic Bralies andSafetysteelUodies. DOUBLEDROP FnAME-Provides morebeautifulLinesand lower, safercentreofgravitywithoutLossof Iload Clearance.

PAGE 48

47PLANTER S'PUNCH1931-32Andnowitwaspandemonium.TheNegroworkersshriekedtheirconsternation,thelessdemonstrativeEastIndianscriedoutalso;a dozenblackmenrushedforward,twowithupraisedmachetes,buttheMysorehadalreadydrawnbackforanotherblow,anditseemedthatArthurcouldnotpossiblyescape.ThenitwasthatthebrownmanSampsonprovedagaintheresourcefulnesswhichhadmadehimsovaluableaservant.Hetoohadspurredhishorsetowardsthebull,accompanyingArthur,andthemomentthecatastropheoccurredhegraspedwhathadtobedonetopreventadreadfultragedy.Inaninstanthehadtornfromhisbacktheblue-blackjackethewore,and',sharplypullingupatthebull's side whenthecreaturewaspreparingtodrivehishornsintothestrugglingmass before him,heflung tha darkclothoverhishead,thuscompletely blinding himfora second'ortwo.Startledbythissudden,inexplicableeclipse,theMysoregavewaytopanic.Heforgoteverythingsaveacompellingdesiretoridhimselfoftheblacknessthathaddescend'eduponhim,Heswerved;forgetfulofmanand'horseontheground,hedashedaway,scatteringthepeopleinhispath;inatricehewasthrustingthroughthebananas,hisheadquitefreefromthejacket,whichhehadtossedoffasheswerved,buthissuddenfrightpersisting.Ithadbeentouchand'go,butthemomentaryblindingofthebullhad saved thesituation.YoungRobinson,shoutingtosomeofthecowmento followhim, Gtart edoffagaininpursuitoftheanimal,andSampsondismountedandhurried'toseewhetherMr.Norriswashurt.Hewasnot.Arthurwasanexcellenthorseman,hehadmanagedtoswinghislegfreeandupwardswhenhishorsewentcrashingtotheground,andthoughhehadinevitablyfallenwithit,theearthaboutherewasspongy,hencehehadsustaineda few slightbruisesonly.Butthehorsewasbadlygored;itwasclearthatthemostmercifulthingtodowastoshootit.Arthur,however,hadbeenshaken;soSampsoninsisteduponhisgoingintothenearesthouseforaglass of liquor,ifprocurable,andtoseeifanyseriousinjurieshadbeeninflictedonhim.Sampson,whogenuinelyfearedRamsingh,becausehebelievedtheEastIndiantobecapableofterriblethings,didnotbecauseofthishesitatetoleadArthurintothe best cottageoftheneighbourhood,whichhappenedtobeRamsingh'shouse.ButRamsingh,himselfwasprofuseinhissolicitationsthattheSahibshouldenterandmakehimselfcomfortable,andheshowednoobjectionwhatevertoSampson.Ramsinghwasonlytoowellawarehownarrowlyhehadjustescapeddeath."There'snothingthematterwithme,"ArthurassuredSampson;"I'llbeallrightina fewminutes.Hasanyonegone alter thebull?"AvoiceinformedhimthatyoungRobinsonhad."Ihopehe'llbecareful.MyunclewouldbemadifanythinghappenedtothatMysore;itcostalot of money.Youhadbetter get agunandshootmypoorhorse,Sampson;tryandkillhimwithoneshot.""I'llsenduptothehouseforagun,"saidSampson;butRamsinghannouncedthathepossessedagunwhichhethoughtwoulddoquitewell. Sam,, songlancedathimasifsayingtohimselfthataliEastIndianwhocouldthreatenotherssobitterlyand'whoalsohadagunmustbeevenmoredangel"ousthanhehadthought.Buthetookthegunandsoonthehorsewasoutofitsagony.Someofthelabourerswereorderedtotakeawaythecarcaseandburyit.CHAPTERSIXSAHIB,younothurt?"Arthurnoticedfor the firsttimethatMarieRamsinghwasintheroom :md lookingathiman xio'.:sly;hesmiledanacknowledgmentofherpresence,and,foranswer,roseoutoftheeasychairinwhichhehadbeendepositedandshookhimself."Yousee?"hesaid."ThankGod,Sahib,"said'Ramsingh."Ifitwasn'tfor you,whatwouldhavehappenedtome?""Andifithadn'tbeenforMr.SampsonImightbenowinawarmerplacethanJamaica,"saidArthurlightly.HewasratherembarrassedatthisdirectreferencetohissavingoftheEastIndian'slife."Mr.Sampsonwasgreat,"admittedRamsingh,turningtoSampson.Hewasascordialnowashisdispositionpermitted."Well,weshallhavetogoaboutourbusiness,Sampson,"saidArthur,"andthenweshallgobacktotheGreatHouseandeatwhatcannedthingsthatfoolgirlcan give us.SorryIwon'tbeabletoofferyouadecentlunchtoday.""Ihearyourcookleaveyou,Sahib,"remarkedMarieRamsinghasArthurpreparedtoleave."No;sheisonlysick;itismybutlerwhohasleft:gonetoKingston,asallofthemliketodo. So IaminaholetillIgetanewbutlerandmycookgetsbetter.""Sahib,"brokeinRamsinghdiffidently,"ifyouwillexcusetheliberty,Marieisa good'cook-""Surelyyouarenotofferingmeherservices!"laughedtheyoungman."FancyyourwifethecookattheGreatHouse!""WhatIwasgoingtosay,Sahib,wasthatifyouwouldsocondescend,Mariecouldcooksomelunchforyouhere,andyoucouldeatitwhenyouridingbackthisway, if youdidn'tmind.Shecando anicecurryandotherthings."ArthurgraspedthatRamsinghwishedtomakesomesortofreturn,toshowhisgratitude,forhavingbeensavedfromthebUll, and hedidnotwanttohurttheEastIndian'sfeelingsbyrefusinghishospitality."ButitisnotIalone,"hepointedout;thereis onPage50)MillionsIIIIHaveproclaimedita perfect food richInfood value. ...-.PleaseremembertogiveusaVisitwhenever youareinthe'city.KEEP fiDrink forHealth!Breakfa,stKINGSTON.141HARBOURSTREET,AGENTS.T.GEDDESGRANT,LTD.,COCOAFRY'S People,.I UPKEEP \ DOWNVEE[)OLTheultimate costofMotorOilisfoundinthe Repair Bill Goods Better BetterStore'''ForBetterFor A r,;

PAGE 50

49PLANTER S'PUNCHGOLOFINAAND 1931-32 CIGARSLATROPICALJAMAICAAREQUALITY' Their QualityinWorkmanship and their Fine AromaareW amous.OBTAINABLEINLONDON FRO.V1 TheArmy&Navy Co-operative Society, Ltd.,105Victoria St., Westminster, S.'V.1.TheWestIndian Produce Association, Ltd.14Creechurch Lane,E.c.2.TheColonna Tobacco Company,14Creechurch Lane, E.C.2.Herbert Merchant, Ltd.,25Denmark St., W.C.2.and many other leading TobacconistsMANUFACTUREDBYKINGSTON..JAMAICA,B.W.I.

PAGE 51

1931-32 --", PLANTERS'PUNCH 50 TheCupandTheLipEstimates&Termsfornewroof,orreplacingold ':.oofs withtiles,givenfreeonrequest.Hardware&MotorCarSuppliesGarage,Storage&RepairsALSOManufacturersofConcreteRoofTiles,BuildingBlocks,Pottery,DrainPipes,Balustrades,etc. (Continuedtrom Page 47) alsoMr.Sampson,andtwoarealargeorder,Maharajah.""Mr.Sampsonwillbeverywelcome,"saidRamsingh;"butitwasfor youtoinvitehim,Sahib."AremarkwhichshowedthatRamsinghappreciatedthewidesocialdifferencebetweenhisemployerandhisemployer'sassistant."Verywell,then,weacceIlt,"saidArthurheartily. ""W,e shallbebackaboutoneo'clock,"andMariesmiledbrightlytoshowhowpleasedshewasthatherhusband'shospitalitywouldbeaccepted."WhydotheycallyouSahib,Mr.Norris?"askedSampsonastbeyrodeaway,anewhorsehavingbeenbroughtforArthur."Thecooliesheredon'tusethatexpressionasarule.""Theyaremanycutsabovetheordinarycoolies,Sampson,so IsupposetheyliketousewordsthatareIndian,""Youdon'tsupposethatRamsinghwilltakethisopportunityofpoisoningme, doyou?"asked SamIl sonjestingly."IneverimaginedthatI should'everenterhishouse,andIneverwantedto.""Hehasprobablygotoverhisstupid'jealousybythis,"said'Arthur."Perhapsitisnaturalfor ? maninhispositiontobeveryjealous.Hiswifeiscertainlyveryprettyandhasniceways.""Likeacat,"observedSamllson."Sheissoftandsleekandlovely,butshe can spitandsnarlanduseherclaws, Ihavenodoubt.Theyareadangerouspair.""Youranalysisandvehemence shaw an lxtra ordinaryinterestinthelady,Sampson,"teasedArthur."Youprotesttoomuch.""Godkeepmeoutoftheirway!"exclaimedSampsonearnestly,butaftertheforenoon'sworkwasoverandtheygotbacktoRamsingh'scottage,hestealthilywatchedthegirlasshewentaboutherIlreparationsatthetable.Andhenoticedthat hiH simileofacatwasre