UFDC Home  |  Search all Groups  |  Digital Library of the Caribbean  |  dLOC  

Planters' Punch

MISSING IMAGE

Material Information

Title:
Planters' Punch
Physical Description:
Serial
Language:
English
Creator:
Herbert G. deLisser
Publisher:
Planters' Punch
Place of Publication:
Kingston: Jamaica
Publication Date:

Subjects

Subjects / Keywords:
Periodicals   ( lcsh )
Genre:
serial   ( sobekcm )
Spatial Coverage:
Jamaica

Record Information

Source Institution:
National Library of Jamaica ( SOBEK page | external link )
Holding Location:
National Library of Jamaica ( SOBEK page | external link )
Rights Management:
All rights reserved by the source institution.
Resource Identifier:
nlj - P57
System ID:
AA00004645:00006


This item is only available as the following downloads:


Full Text
~':F ~
L-

1


L2.~
S t*....


r ;. : I :. -,i.

~ ~ c '"i

"- ..
, .:.-.- ,,* ...


AP*R


r '9rt


l t 6 i


S PRICE :


..C ONTE NT

gth novel of Haiti, by Joseph HusbAw
i. e celebrated American Novelist. cr-
NOBILITY, a complete Novel, v&irlumMrous,
by Herbert GCae. Liser.
FAIR DAUGHTERSS OF JAMAIA,---two prohuady
S illustrated Beaty Pages.
DRED YEARS AGO A-) TO-DAY-revealing 6
" KingMon of 1625.

-~ -- Y~cr


44


I 1 'G .4.
; -ir-


WINDWARP-iAAD
.. *f.r ". ,,' .'" ; .<**


i.
-, tp
1r


SNUTH

*KitNGSTON


-4 1
/.,


*


* e:t


", "' ,s i ^ "
di

% :' -
A '< :. '
/

/494


S entirely free

frojtkhe

Dust 6 tih
3A---- -
t:
}.,., ,-.


rP Cool

4 1..

''


AINIWClC i Splen pedaimfg Hall overlooking the. F
F a sweepg"^ i*Aoneur. Open on all sice1
"is -Hall is con iseoidm t l in Jamaica. Th e
S Music i stupd l-., .diay morng munig
it ;' C.iae feature.
liai Siundray- Mogg ; Children



~~P ~r
a r
i.; r
"'"` ur
r
'" *': i
,*~..~!


. 4 j ,

-*%. ^


St..-s.


Ktcer S'Ui
saing XR


Is and 5
-~ ~ -',


* N;
*4*4t~


~s.:i
r


", "'


S 1926.,
. 4


:


STHIE


.... ...
:..: d :
::.:.


~'.
'f


A6 -' -..










Hq? < """ '"^" -;.


i DEMERCADO Co.

& 141 Port Royal Street, KINGSTN, JA;AICA.




COMMISON MERCHANTS, .

STEAMSHIP AGENT

AND


EXPORTERS OF

SUGAR, RU
iJ "J ;i _-*.." 'H! l'


:"AND


IS LA PRODUCE
-It~ i-n L... .b ]( ..,? .. : v: .


Our Agencies include -
Jo-N JEFFREY & CO.
Malted Liquors "
BETTYY" CONDENSED MILK
"HOLLANDIA" UNSWEETENED WII
MACONOCHIE BROS., LTD.
:Provisions and Confctionery .
KNIGHT LTD.
S Soan .
GRIEF OS., LTD.,
me
HUMPHRI. LOR & CO. .LT
WELCH GRAP CO.
I. ". I r


LASCEILLES P.O.


. ," ." .. ..
i'OF


:- 3 ::. at.; "


. .

i I
* ... ..,.



"., ...*
F.
On pmodfos Whrf Pemise we an bndlecarg


Best Prices Paid For-
;COFFEE
COCOA -


KI

uONEYr
^'*^^trsa
*I-L~thlFMV


BFES-WAX
SARSAPARILLA, :
ORANGCL? "

S":'I'"' '" AND

We ::p..ialie in roasting CHOICE BLL
MW'NTAIN COFFEE


On onmfiodious WhaWI Premises we can handle cargo
with' q .depatb, and are local representatives of
NJAMES NORIRSE LTD. S.S. CO.
MTAL0IfUfIM MAIL SS. CO.
4WNdMBIAN STEAMSHIP CO.. INC.


We ae.i Wdied touch with every pa
your advantage to -c umecate with us for oc


lles, deMe

14 & 141 Port Royal


"I


JE
6 .*.
'4; -


-.

ku Island by means of our own Pet and T:T ph Offices.
o'or Produce and Best Quality Merch in .e



Sr & Ur., Lti
Street,; a Jaiaica.
: i;' ,, i, !


r~:L~:
~i*4 -
1%b:
NI


S.,

* '4


31,


f I


`~ --""


ir
.IcBili;l.. :
r -~-~;~
;..~.

~e


;'i
b~Ji~i~7-
;e irwcici
r:~:::
''::5


f~E,.,
..
i.


ti i-.:<.


;-~C: ~;
,: ;
:


r' 7111tL


- ---- -


j ,m... ;r


"''''
*`';';"
:r:.::
-:
ilr


I -.

















IHE


which dealste with' kit
n write by MI.,:dJ
IMt iis Jamalea's liex
4l'p know that
And drove f
.anrth a lali
MU,. '"The


HE RING'I.

MSEPH HUSBAND, author of .I-igh


CHAPTER.I I
gh biirlt i the wOast io the SA
; iathhbad telht of Itksiaeur Slia:. -
jird tIe sva'." Day had ended e J
... Aimte behind .-te towering black
; .:.du Cap, and with trDpi e
~ t:had. Wtlen, a clear traj- :':.
Spt e. Under the dark, i
ligEI In Cap y'ancaise 1
ia, was black aid
ilnt sounds in the I
a ible although tlr, brig
S shore. In .
o.. t. lknht Bush
'a clpd of t.-h at's
It and dt tant; .wth'ht8 a
e hnlwark. and a ~W i,
i his handtti e wath*at1


, Ith
'oalld


RUSH.. BUrH/pO

bd pot drawh i
teath, Wmiddeio:
fe~e.aB l


i...- .... }i li4 Ade


of the second
ed. hera that se i
ma "peaiated umder,',
be gwnt that we
Iprtm- Wine' Indian
,:;


Sthe end Him Datt ther eandl
tMibib viatse v Lh wiirath 5wlU nst the pi.
.lst: n %Bush, and cllrbed the, e.l .
l f -:Ad-.f .l "Luke!"he cai ~ci ..
5 h itiriew..' Altb-:. From the forecast a
t..f.iifgo was At. ed and came toward: blaii
that seemed almost aninalR l.
S''Th long. black' by the soft paf-fat of his barte
EdMn."': iaIth sudden "Thfe boat. I am going:shkAre." '
ipanfonrway.aid ran The igan swung over the bulwark and
hie.abin. It waH a bimsjef td the chains. Then he reappeared, a
p.,aten.l A he',y r, j.gi l- hand. and drew the b6 t. forward to
$ait'tl h i*oedw*o.k ,,gangway Bush seated himself in,:thb.aternsbeetsi
nea~i ertaiis were" "11Hggett!" he called. ':.:;
.: A man's head app "a ove L
.. a on looked down, p nto ht
I going to the
iretiun i two hours. You
ra it.. anythin sga pens '
he :head i64Aed viplemnfip
S...... e e.bobblg.,th his neck.

OT. ver hiis shoulder Bush watched ti
Z C ilth 1.t0OU emotion that ga
s h ~ hlalha InArf har.' Ti


Th (mall that "15 I
Swa dub to her. t'thhs evagq ;

,T It. agatnet the la.n

"Two hI -e, Luke. ""a: ,.
iJ-ig oa bi.t 1 tr, oat.' 'IYno


ba T1 reial to :16iieao

having bseet Ftn b'
island In .1804, a.
:.oel-b .., a .. .-+.hotllt-.

i thi of his per-,. .
g ears the negroi;'
him like a slai'...
ig was dark, and ex
,moon the town was pract ,
But only three a lg.n ..
Water-front there was a.ello
candles thvozi
and the persiattenf-
tar Indicate. se
i. i de laRep
From the
room si ia near-by
le a group of .o clustered,
their black.'. iattteped noses .
th he strange ;d.-JrUiance of
.h red eaol$and white twoiq
in CasuallRy, ~onsieur SazntI
Sa was relieverg.; "
amnhan; m;i sur; to detain hm.: :
160 tons.
t o Le Cap, a cog ct
b white Ike- &btbe house of Lerg"
. "i t, dontbl- residents, his ward, a..
g in the a Of appealing beaty and
0e0e and g impress on his,ima
from. .l owed, his thonalb.iIi
d 0ha hours they dF
a rbeall a t14.0 a


toad to the rulief
P-hifch they had IDo
iW ba-y and the plala e v1
hbe remembered I i
iw ol tfi l cie had
eon her bOr'I' liquid rt Pri
e trazge. story -t -lM t. -


,.. :,
.. ... :: :,


.- :. ..,. a
, ,, ',
;: .r + .. L


rP;P
*;
"

:: ~:
I c;
i,.
r :~~






di;

;I
E
ri.
i



Kr-


CIo
















*.M w as ..nes again hard face
by the excuse ths4 ', again to see Monsieur and ,", -hi l "A great a ma
Samatan, what I true nor necessary. HI and a ...dog, ,would t
glanced at t is too early to present hbli. agree, Mo
self at thp,; ademoiselle Goutier's gu Bushb e amis. I re
He teen crowding tables to that I cannot. And it
side .. At one of the small tables sat his curious awl" his way be-
ner ey wore the white linen of th. teen chairs ani
pla aid exhibited flashing jewels on ji For five minutesf. h at an an
.. angle
and glittering gold fobs and c -..a wall trying to br4 the ughts
W .eethed in his brain. r t.ll.
"Ah. Monsieur Bush!" The elder topie night. The wor bright
S: spied him approaching and sprang t t to illumined by a light only
extend a welcome. "And the LI arried Across the dirt road als, crumbs
? you here? Ah, it is indeed:o od:.' Monsieur ed by flames. were half, by vines
le Cahibaine." b vines
le Capitaine. : Through the massive Ir e of a
Monsieur le Capitaine a solemnly p'..was a courtyard, and beyond other
Sixth his black acquaintat avely received s a an blackened beneath their of
Ptn introduction to the he tipped back wls.q":'""~i Even the wall in whose an
hki. chair and lit o' a smile began to .m rks of fire and violence.
'ftch the corner was, hole town, he recollected. A
Sw. ltied he In lrerlant troI
.., ORTUN le smiled on you, Monsieur r now in udI L tro-
E means that the King recog- .et re s... houses, of filth and bar-
Knr baric t of black citizens ruled by
:nies ~."fa loyal subject." He waved a sum- a l,
meons aiter. "A bottle of French wine and
9 6 commanded. .'
::.And Fortune has not deserted you, MonsieurR II
," Egalite answered. "There is much money to
had by those who carry desired merchandise past A CROSS the t ruined mansion
the guard of the English ships." He raised his glass where but a dosi' had lived Pau-
t. Bush and drank the clear yellow wine. "The King line, sister bof Napoleon wits atw.G- .-
will make this fair country rich again. Great works tain-General Le Clerc, who -thousand
jre in progress. But it will be wealth for the black troops had come to restore the nce But
.0men." He gave Bush a quick glance from small red the yellow ever and the black sold -patBrtuot
-eyes. "There will be no more ,white rule here; no U:S. MoxmAOl v. MYERS: virtually annihilated the picked troops leon,
holding of lands by the white men." so : uAesr seen Mrs. Haracep.ly"a an- and theh battered remnant of the army besiet
Bush nodded gravely. "Perhaps. Monsieur fumed.' Pal)haedtertainiuga .epofanisasi Can ad finally surrendered to the English fleet 1fn
ligallte," he said, "this millennium of which you e i. 6 lti seems all the m tthe harbour. All the tragic- history of the
soP eems all th Silas. oofuredti
speak will make difficult trading business as I Sef at r*Je;iraeA:4 ;th is bone. of Jlf seemed pictured in these moonlit ruins: the ea
would wish to establish here; perhaps you have in' le~,4s tiS ,t her social t is days.; a of. Spanish rule in the years following Colmn.
mind to have your own ships and your own mer- ly, .pt ....fgx ien eilelently, dol. .. .b.; .the era of the French,,.t era of vast plantsa-
T. chants. r shohshed "emutdo:k .,othe bawvy .ad finding In that at god deal .. t. s and stone villas among the.jSl .,*; and then
The negro shook his head. "We must do bst- the uprisings of the negroes and. th6.i*?=apedtiten
a with you, in your ta." He raised a great black:" *'? i': ~i om on a large sdsie of neces- '-of) the French and English to subdue *Zi e
Ittte .rith fleeingltt in the..ne. There e to be slaves. And in the recent years these waaed
; .i` e iTe triend-bit that s .q:tiat home, a h. lady of names new to history, the slave who led thM t..t:
w w ft that is. at home .g5 ay.. o
all" the'i .t.ti bi' t"eetthem and put' th entirely Dessalinea, the negro Emperor who followedi4g,
"His MXiJesty 18 w i?" Bu changed the topic at .the e k A s u al greethi( g f.'avr re- and .now Henri Christophe, the King.
abruptly. ga .deda4a: ite: be:i.W &iitg as that .6A stress In the peace of the night he recalled the stories_
"Ah, yes, and the great fortress of La Perrilrae! 'at e 'ia.w......i".... of peop R': ; he had so often heard of that terrible year or 17
From the harbour you can see it on the mountalr.i-4 i l or loolsh~::n the .l 'es of anto Domingo, rio.w. ssinal:.
top. In all the world there is no place more secure si...ething ho aa :.reittital.lU s had made dee~ite the
from an enemy. It is a monument to the genius of the'tt welcome: m h : a. $ .lM .. Le
the King." sh it is -
US tTSI lifted his glass. "To the King, Christophe!" thts Mr s ide e athom


DJ The three glasses met above the table.
"And how are Monsieur Mangan and his ward?"'
The smile still lurked in the corners of Buah's :.
'atitb, but now a singular intensity seemed to VpaA s -
acforss l yes, a fleeting expression, a thought mo re
serioutaxIj p.anthan he cared to disclose. The sugges- .l
tion, howe;:, o.a. deeper significance to the simple ,
question did lbit ~~lageth er escape the negro a~i, -he
hesitated, as ift embarrassmente, for the an~iEr.
"My good frfedUClMc*sieur Loup"-he noddet.to.,
his companion across-e'ti:able--"can tell you i. 'i:iia
recent news of your frienil. I ha: e myself not S M ::.:'
Monsieur Mangan for several meets, and Madei ~lt-'.
selle Virginie. It is months since have seen her ao.:i :.
great beauty."
"Monsieur Mangan is well." Monsteir Loup took ..i.1
'.the conversation. "He is much occuiptd with the.:
StrA the King has placed on his 'Itoldeo.i:S
It Mademoiselle is betrothed to captain i'

Tihe1:'t d in Bush's hand clinked .on.
sharply on t:s mouth set suddenly, a thin .. :
straight Line above jaw. "And who may be
Captain Nicholad?"r' 'ttly
The broad chest f .Lonp expanded and nd
a smile disclosed his tet and fleshy a n
gume. "Captain Nichol fj: tmaeh educa- rh
tion, Monsieur Bush; for trei he enjoy- peo
ed the best advantages of that on.
Here he Is an honoured officer at .tsi' .body- For
. gWard of the King. He is rich, for :a h;
on him much land-" He 0 in to
I inti tanue, but something more 'j" :t tha
son
", g!" ..'Bush spoke as if the words a. ris
i r nolnnr? Ah nui" r ".:'":.;':i::


iher bottle o this most
p.rriedly broke in. "It
ptan Bush comes to
the French words
fr..om a glass.
uinmy dear Captain,.
say, definitely ar
S a much wealth
Kin,&, .alliance between tt


i


ing wine.q
seldom th
He babbled a
t:. g from his
SOf course y
at this perhaps
but Monsieur:
urity from the


at i ii



s persona.
thous




mnds and.acquain
ia are tired. and a'
....u of Jamaica


tlstreaed\a
reunioli t..
idually 'tijs is
resourewtih'ought
f bight be. A* AW as
sent at last
our ot" itertaning
Party given at Weml
her husband and hers
Sonly Jamaica but the B
presented by a large a'
i t was disftintively a
o.over by a Jamaica
pr,, esented the best-ri
italty and what: is .it
l|f something for Jlik~p

^Myers well are agrei t
h*tdamental qaulitUeii go
iil kindliness oa dispoeit
p nds consta*it press
.bers. In a nd'aildof s
"iae who woqtjl father
i@rng, who 1pihrftn h hi
g.le' disatetjalf..AS_.
trivial a gall 4
may be intli
tot heard It


Ud ..ple do
-e.to pieees:.
eionast the
stands.


no
tful-
two
ting

the
bley
elf:.

snm-
ia-.
ady

in


ghthome with him
0"at Jamaica. What had
ween Gouter and Leroy
rga" .'t. d tile latter to assume charge; q
infant child, Bush had never known. S
some reason by the blacks, Mangan had r 'man%'
years following the revolt held a singular
He was rich; he was a man of education'
man, some said a renegade-member of a,.
and he was a friend of Christophe, the .i.
That he and his wife had faithfully
through her girlhood and r I ..H...."
thing that Mangan's great :
.one could deny. Then, whi':M
ginie had been sent.pi dy a :
France. And she ld .l, d
the household Qt i;r


U'


d. a bridge toaau i.w )awn i
intrigue of the.::.... -
hat As h.e s ". .s w44. .
ood- horror .of -.'i to him.
ion The 'ad com with 4S.
aion .b ...N w w ohe was thijlp:,,
Pite imendous diomiulag
say Cbomplete -belpleS:.
e .iyes and her seal
.. him. A new.
ity, swept over'
ghe street, he can.
dee was wallimp
-moonlight. Tlhe
n. turning share
e grade upw
Morae. Its ru
ered reuse that
its acrid a5
the iway and

gateposts of e
to the grounds tn, t
re was black white t.
vth drive direct h he
S.barely see es, was..
story buldra :
S were drapefat
L.",


.. .:.....-t w-'
f-


*I


,''~*h




:'S." &
T:-..


PLANTE RS'


PUN.C.-: ,


i -Virginie appeared from an inner room.
had remembered her beauty and her gen-
Sstood for a moment confused and
e walked toward him, her hands-4l-
I tended to greet him. She was.dress-
H h bare neck and shoulders around
lace shawl hung with.:lngintg touch,
her breast a single po.,ittti :wass caught
ad clasp.
it is you!" she exclait~ .:. "How can I tell
glad I am to see yqou?"' : a voice was low
sessBed a bell-like .iflgty that gave distinct.
her words. She spoke.in. English with a fa.nut
accent that was altogether delightful.
oh caught her hands and met the frank gaze
great dark eyes. 'Her lips were very red and
-spoke. h.l. saaull even teeth glittered with in-
whitelisti;.. 'hen a self-consciousness came
im, and; e"pulled at his square jaw with his
|L:t ner.J gesture that betrayed his momentary
rasiisiit. She was lovely, a glorious creature;
jila~kseen her in her perfect girlhood, but now
a woman, and in the depths of her eyes he
understanding, a realization of something of
lem of the life which in her had reached the
bloom
MS:not for one of the Society of Friends to pay
46vpliments to the gentler sex," be-laughed.
i.wst of his lips as he spoke; "but having so
ed myself, by force of circumstances, from
I will not hesitate to Crave your pardon for
rdness, which can be blamed to nothing but

V"To me" I did not think you awkward. But if
.were, in some way, why do you blame it on me?"
He saw a glimmer of laughter in her eyes.
iMademoiselle, will you make it harder for me,
hble Quaker captain of a trading brig? Must I
why?"
*.ihalf-seated himself on the table behind him
Omight the better watch her as he spoke.
Tquire it." she replied.
it is because I am overwhelmed to find
ayou are. In this sad country It Is indeed a
t blooms beneath the roof of Leroy Mangan."
itthis Society of Friends that has taught you
es of the King's court?"
h felt the topic was leading him beyond his
PCome," he said. "Can we not sit and talk
le? I would like to learn of all that has hap-
.:.ou since we last met. These have been
although few."
koned with a slight gesture and they
.room to a doorway that opened on the
d the house. In the soft light of the
a that burned in a candelabrum within
globe on the table he saw at his side
oothness of her bare shoulders, the fine
.lender neck and the curves of her
and fell beneath the crimson blossom
Emotion seized him. He dared not
a; he dared not mention again the
; he felt the cords of hirneck tense


tra on a garden seat in the moon-
deas of a vague sentiment that sur-
t*0tient young and fragrant as the
FIliLg on the still night air. Had
elf-tialysJs he would have recog-
he.had fallen irrevocably in love
-eyed girl beside him, that the
last two years were to-night
Reality. Alone in a world
ad her delicate memory
-atlimentalize about the
v-beautiful woman. But
-lght touched the white
he had dreamed in
had paced the nar-
white shoulders
'Quick glances in
'%Woman to whom
nent visitors.
the first time


e. in the
r t..
something


silent
Ihe bur
p.1I am.
will. The
.h. rhand f
to his lifii
G'ome way can
*er."
Esotmnd behind
l r grated a
:h ered acro
ifeet

you


I


A GREAT ORGANIZER


litrvToa lTOB I. CTTrE
With the death of Mr. Andrew \V. PreEton, Mr.
Victor M. Cutter became President of the United
Fruit Company. It is a position to which Mr. Cutter
must hive looked forward with legitimate ambition.
setting himself with characteristic energy and thor-
oughness to become qualified for its onerous duties
and responsibilities. Mr. Cutter is of the younger or
second generation of the men who have made the
United Fruit Company famous in the United States
and Caribbean regions: and like many of this sec-
ond generation of industrial captains he is a college
graduate; he belongs to the ranks of those whose in-
tellectual foundations were laid in a scholastic at-
mosphere before they went out into the world to
make their fortune,
Certainly, his college training and experience
did not detrimentally affect Mr. Cutter's mental capa-
city or paralyse his energy. As a young man In the
banana fields of Costa Rica, and afterwards in a more
responsible position in Jamaica, he displayed mark-
ed ability and developed a character showing the capa-
city expected in those who win to the command and
the direction of considerable enterprises.
When he became. one of the Vice-Presidents of
the United Fruit Company, and was placed in charge
of its tropical division, there were many who saw in
him Mr. Preston's fattite successor as President of
the United Fruit Company; and it may be doubted
if he would have remained with the Company had
he eventually failed to obtain that position. He
would probably have regarded his passing over as
indicating lack of confidence in him, and he is of the
type of mAn who can only do his best and be con-
tent when he feels that he has the implicit confidence
of those whom he serves.
When Mr. Cutter was about to leave Dartmouth
College the Acting Secretary of that Institution sent
a letter to Mr. Andrew W. Preston, then President
or the United Frnt Company, recommending Mr. Cut-
ter to that gentleman's attention. Amongst other
things that letter said:
"He is an istMual mani in that, in speaking of
his charactertsfticW, no reservations have to be made.
I should like to call your attention to the following
characteristics:
"He is an eipeptional student, having been grad-
uated from the college with honours.
"He is an indefatigable worker, putting all his
energy into whatever he undertakes. He is a man of
absolute integrity and of unlimited trustwotthineis.
"He is a man of resource, having earned his
way through college."
Mr. Preston decided to give a trial to a young
man about whom a-nyone could write so well as this,
and young Cutter..was cent to the swampB and banana
felds of Costa Ieit.ato fail or make good according
to his capacity. The fact that to-day he sits in the
chair so long ala. h-onoWtlably occupied by Mr. An-
drew Preston is 6`iBcient ein6tientary on the truth
of what had been writte.,of htib at the end of his
college career, and on his .zieleped character.


iji it. fragrance. "I shall.never forget. I. too, am alone.
Ithe But there is a way,:an. I shall find it."
s It Leroy Mangan stood, a black shadow, in the dbor-
ss the a .
"Qu'k. "Virginle!" he called
It is my guai:. "I am here, uncle." They had risen from thbMflr
forget what ere already am the terrace. "Who do :.-yir4
seeking It is Captain Bush of Philadelphtia ;i:t-
louth seeking heri since we last saw-him!" ..
tls cheek t1um ena* igan bowed stiffly. He was a tall, lean man


i


- .tr.:tjt&*hv.


''aJ


k~eh 4


C)


with I. V face beneath his long gif .:bair. The
mouth was .e striking feature, a smallIuth with
a loose, thi'u lower lip. His black cli' were
severe and '~i eed by ornament except :..tl e
throat, where a- e emerald in a heavy fold setting
gleamed like aFi .Skagainst the whiteness of eit
Hluted stock.
John Bush recalledINBWatsilsater face, but now, in
the light of his recent fi~ort rtion, it assumed an
evil aspect that he had not :py'ioN" y attached to it.
He remembered Manganga; iot !i :,.or lean, as an
auateie, iold man of faultless: t.l-iisi tesy.
In the awkward pause Virgtiie' -SiW1 situation
:..developing; with an apparently .uniCOielT A move-
;',lent she put her hand on Mangan's shoulder:,
'. :My we not invite the captain to stay fth us
a b.:6 iilonger? He had hoped to find you. I am- are
*he'tWt:have interesting news of the war and :ot

#.0E 4c .took a step to the side of the doorway.
"I rB ta.itd, "that the hour is so late. Captain
Bush reaptb4z alat conditions at Le Cap are far from
desirable fbor;~th, who walk its streets after sunset.
I am sure h: Ilili 'his ship a more desirable plaice
in which to slnpi'iei evenings."
A Hare of hbit :.ig ed in Bush's cheeks; he felt
his neck tighten aiM~:.haefds tremble with anget'.
For a flalhing secondfhii: i ple was to strike the
expressionless face that cant4rded him. But
all lie did was to bow and. tM 'd from his
steady blue eyes one penetrating l the eyes
orf Mangan Itf he had expected them .-i p before
that look of disgust and hate he was mistakes The
imperturbable lace wa- mansklike. For the saice-of
the girl whose delicate hand rested on this creature's
arm he resisted his impuicef.
Mademoiselle," he said slowly, with the quaint
drawl of his people. "I shall accept the advice of
Monsieur Mangan. It is perhaps best that so pleas.
ant an evening should not last too long."
As he turned to cross the room their eyes for a
passing moment met, and in that quick glance Bush
read her.appeal of entreaty and fear. It was the look
of a hunted creature, a look that haunted him far
into the future.

CHAPTER III

OHN BUSH went ashore the following morning '
shortly after sunrise, but even at that early hour
the heat was beginning to quiver over the marshes
south of the town and the air In the streets wa h1ot
and lifeless. A.:M ke rowed himn.. fear# tb.iw lte
had noticed with?'intrest thliva "e11 it ure tht .
capped one of the high peakl.'rd -a mountain range
that lifted Its serrate wall beyond the flat sweep of
the plain, perhaps thirty miles away. It was the
great fortress of the King of which Egalite had spok-
en, a tremendous stronghold perched on the peak
of a mountain three thousand feet above the sur-
rounding valleys.
In the strong morning light the town of Le Cap
disclosed its squalor and desolation. Everywhere
ruined stone walls, smoked and scorched, recalled
the one-time splendour of the French city. The
Hotel de la Rdpublique was deserted and the dark low
room was cool and odorous of last night's hospitality.
Bush took a seat by the door and a few minutes later
Monsieur Samatan crossed the threshold. The mer-
chant was a tall. well-built mulatto with regular fea-
tures and straight black hair. His even teeth of glit-
tering whiteness emphasized the frequent smile that
hovered beneath his waxed mustaches, and a small
goatee gave to his fine thin face an air of distinction.
Monsieur Samatan was perhaps fifty years old, a
man of culture,.of4-nmmense power in the community,
due to his wealth, and the high regard which was
everywhere accorded him. He wore a striped blue
and whits put of fine linen, and as he sat down
across the table from Bush he removed the .hotf'
straw hat which almost concealed his feot, Z
its voluminous drooping brim. For an ftE idia-
cussed the negotiation of the Lu-4mIq -Sld, ar-
riving at terms mutually auEs".tted It with
pale rum and water. .
Five days later Jo : again found himself
in the HOtel de-la Ae. During those five
d'ys he had laboure .fiiii tlessly, and not only was
the Lucy's cargo :j:iilfein the ample warehouse of
Monsieur SamatWlbt-talready a small part of the
coffee he had-uii"ehii~efl was between the decks.
SIn these: f. iitBy days Bush had not again seen
VirginIe oCftleQ;'but the thought of her was never
Inng from his mind. Time did not heal the smart of
MonajlWt rii gan's discourtesy. He had restrain i'
hi it t :evening when Mangan had shown h .littt"
the o4or, with the realization that only evil; eoi
emte from violence and that Virginle's happl.quierBd
'afety .would be jeopardized by an op~fji~ be-
tweei himself and her guardian. ...
ft was seven in the evening ..*w liieft the
warehouse of Monsieur Samatan .wit. fA intention
of going immediately on board tftli which was
pcehorpen no more than hI.alf .floan the land-
ing. But as he turned down: i--Akg straight street
that ran parallel with tm lfr front he saw black
rioudrs niled hieh eeaiPat .' distant mountain and
the flicker of lightnii:.rned him that within per-..-
(Conti ,ed on Page 14.)

....


_~li---IIYL..I~ ~.... ~LI-!?~'~


V


' '*' *.". *


"55;




-.vs


I( r; And nature .wmnr
S Her noblesa wlmt
Her 'prenicehad
An then she mad


STh Fair D ughter of
5 ..:., ."."..-? ;' --- .: ... ... .," ,


kIw
'* IK!-----
Y m"niChrw ;


MISS MAJOnIE IIONIIIALL


# -f"Plantertjr'unch" con- its 8suoni4estaritas; Cuba with its 'Mi, its
'T lHa. pot'ures ofipnamll group latest ~raii5'i .Paris, its profusion of:- 'as,
f0 Ue seleid from the its studied endaEi4 to be the centre of ple e,
g been elsen as re- aiety and b b"M.4W the Caribbean countries.
EE/S How could JaMalWtt ate with Costa Rica, how
S~ ieisl grace ands.ty. wih Cuba? That i i the unspoken question of
* ."'gi ..there ore ten there might eaity g v b en Jamaicans. But men. the North, Americans and
or forty; names and faces nglisb, take quite. s* lw Tw; 'heY see the
forty; a d facs ##n:to beauty of the Jamai.cwi ; "thgey preelve their
.nd as one rapidly reviews the field f .i. grace and style. They ay hee gh a coun-
with a pang of regret that. ompeUi WW try never renowned for wealtoM.m exqutlid .And
of spare made it imperative to excl-de .Fs .." oa same of them have been to Rica an4ve
s' many who have so excellent a right to h PbiW 'flatted Cuba's world-renowned a
amongst the finest. and fairest daugnekrs Tlc
maia. ongsr tihe pst1. i fyatres aasg !.sl .,:,e(V a.::Amaica girl, or the girl loniget in Ja-
.. :.. ...;;. ':'":';i: "'i&- t bes, has a manner all her own. a trifle
The people of J'maica" have often Wi' i mj' oons, her languor being born of th ad of
scented as peasant.: eely, the womes.~i' :t necessity for slow and even movement: mem
torially hisw.astly hben women of, fi rather to be eating than energetically pushin:her
r~~toiy 7bnw.&F*..tly HJj= t W hpol. life; she is bright but not strenuoust;
classes. iic es trdging it domwt:,% stt've. ta:whmn there. is reason for activity, but
4keto e so : .i7:-j:great lads of ever pere rtsA* .. mrom 'the earliest days it was said
ti. k a;e. : laughing 4imsels wasRki g CI th ot her ht'h;~ i 'e pssion was dancing, and to this
':,F re~l^i ifi f g servant girls sayiga moment it i la itb e that ishe will sometimes
4y iaft "fte. Aan0amtm is greatmen'C- iMia hvie dance from A1:.Wi aale, n.wibe.,ready at
been .Sewi'a ad again, and the 9ats fdef 'who sundown to beit.4 gaint; B6utt.i fntiwe.ahve
has .erw been ~ io Jamaica may wetf. be l sed changed and she 'at :iS 4 with them. : 0 longer
for f .tha thke colony has no .. eir.tw a does she loll in- bt i a3 .: .:to rest and recuperate
to sw, canbbast of no daughters to. comp e wit n for the real business of tb*:*'iit a continuous mov-
nng to seductive rmuskg.' 3A*.'I4iAthek twentieth cen-
those of northern 6untries. The pictorit repre- ituy, even in Jamaaemu list twenti c
t ,* ** ury even in Jamalcl *WIli' it of that. A
sentation .of i Jm a life in the past hat f tew there may be who d a. ', et the hours
largely in. 4 dirWeton of burlesque. The othe wing their way unheeded; the i.thee must
side of the piture. has hardly ever been seen. work at some occupation. And 't t sl
"'Planters': Punch" in the future will emphasize it, that they will dance night after nh not
till sunrise, and wake betimes the next to
Other p1itres of fair ladies wtill appear fro undertake their daily tasks. Thus they may well
time to .i.e :. Planters' Punch." There wl be evoke admiration, and not merely for their eels.
other Beasft Pages. But we may claim. to have There is the sterling stuff of sound womanhood in the
begun vu.e d, d we are proud of our selection. Jamaica maiden.
H' : "best people" are not necessarily the richest:


it








..f.










-k.I


1 they may belong to families that are poor or of
moderate means, as well as wealthy. But by their
manners and appearance you shall know them; by the
'dotward but unconscious expression of breding. are
they to be recognized. Some of the girls of Jamaica,
the girls "in society." may be the daughters of men
with Incomes of thousands of pounds a year. Others
may be the daughters of men with salaries computed
only by hundreds. But no line can be drawn betwqrw
thia batr~f nd -thn h n nwl~n .


tose etter-offu anuu tuose nULot sou weu-o;,. ith s-
role of wealth is not applied here thba..i.OS4 be
ridicutous.t II this, respect at "iat ilth l true
:dmmomaasq; bIlt: ip : ww :l dl 'i ",Jm ic a ae a..fe..
eracy.
on of aris-
by standards un-
insistent on refine-
i Wealthy or of but mod-.
erats,'ui& : enflefolk of Jamaica have a feel-
ing of personal worth, and it is among the girls that
we see its finest expression. In some it is, perbhait,
a little too dominant. There is a suggestion of arro-
gance in these; but of the majority this is d-i *
There may be vanity In all. But who would.
beauty for being somewhat vain? ..*


S N T E R S' PUNC-H
^''iiiii~~~~~iii. .<.. .. iil i~ i i ^ -i-'''* *


'.44
e~:..."
,.Li;:?"""


1925-26


"V O couldn't d,.a prettier or better dressed a.-
It: tcto girls 'anywhere," said an..lAmrica
vtitor' t .. iShaiCI, after witnessing a big .dai e
at thi f-iiglea Cab., .Others have altd te ma m
thing: agMi a.."'aB i when they have. seen thi
J AP~nadB eliw u's anbe in all their glowr at m.l e
ball at the MyrUtle Bankr2tel or other social centre at
the colony's life. .. ...
Npnmerous. and MvDntti sincere are the mp.i
meats tahus i ow iipp.:th women of a- u ea;s:
.thbir taste" .fIi"4s ^g.1s extolled; their fgra : t
foirmm an attnct iveuiu olt feature win Ates
.ttica. ti.. vIteir f. .:t other lands. Yet,
rael avqr ? Btae l^tmag Wsrf tborth
her womEs or6sr' Se.t upon their
Rounal; adnitid, .^ St :beenmodes;
might *:rpa"W 7evanin.
Am000oi t the CiMllit countries Cs9ta Rica it is
wnhic is .:a :. ...tand of fair pamen. Con-
tan ~ a heat~*s~ti pretty girls i: that little
repzblie;l he ~Altioh Costa *ihas claim-
ed for iittt,:t.* as.lsarrded to it liit a mur-
mir. .rsd: Cafikib is:,ltaelf upon the dressing of
:.* .' .- l!- **!: '.** 'S ii **


m ......~


s~Hlrchv




K>qP~~


P L A N TI S'


ica: Characteristics
i. : ; ..... ..::


.. f however, and other circumstaoie play
part in Jamaica Society. Thi.:. sa really
into many societies, but thire are no unpass-
rriers between these;.. te .harriers indeed
palpable and easily creaile.With but ordin-
.Sy' means you cannot hfi*l:.. a :.host of friends.
You cAnnot afford to .Sit host of friends.
You must confine yournMfil:-. tairy limited circle,
having but a bowing .-"paqpte aeship with others of
much the same UWoi mEl of different financial
Status. Thus tlhaiiChE into existence what is
known as or even cliques, though
ii the. word a s:5ash and unjust when used
iln ie .A clique suggests a hard and
:::'exeiou3lV: '. of men and women, a rigid
::"and. .- sectarianism. That is not very
to lea, it is not the rule; there is enough
Siand good sense to temper the snobbish-
is inevitable where class distinctions
long established and exist. In a country
a few hundred persons are absolutely the social
rdt and crown of things, those not of this enchanted
circle simply do not count-in the opinion of those
Swho are within the circle. But in a eaall country,
where the fortunes of men are Ctntitually changing,
Sand where you must meet one another in some rela-
. tionship at some time, Sik eeelaslveness is out of
i te question. Small o::O'c ial instead of one big
.Society, is a neeXesgiit Q '6 aed by circumstances. All
I- these small soci tii :twI be regarded as forming
-ethe Jaupatl o igild when the younger female
:Stgather together at some great
w'i'alll.... .take a spectacle upon which one
7": .'.."in-e pleasure, a spectacle of youth
bPg htness, of alluring witchery and

is a softness about the appearance of the
.C of the Jamaica better classes which perhaps
: I*.1ld not be there did she pass more strenuous days
I1 physical exercises. It is the softness of the balmy
airs and golden warmth of the West Indian spring.
t is not that she neglects health-giving pastimes:
'.;here is always tennis. In the country there are
orse-riding, swimming at the seaside, other recrea-
t .L But compare the long stride of the English
rl, or the quick decisive step of the American girl,
:*tl. the slow sinuous movement of the Jamaica gil,
m- the difference leaps to the mind. It is a differ-
ene gendered by .climate, which in the long run
tMaeo..~haracteristics.
d the Jamaica girl spoke with a de-
wasl... broad, flat, unpleasant to
e ..btter educated classes it is
tere is a Jamaica accent.
it, but strangers
however, or
with those
from a Ir imodifyT this
iadcent: what *linated:
.it: is, on the .wns, it
Andl
is 'natural. And yMll
5flt,.their laugh*
le is in them, ti a
-Mall p o etube-.
*nwit~ *e satliesetinos at
~ T~P~Ian Sa~ .A ~~s


gaily. And why.1i. olin t*,.es i l*ly passes and
the responsibilities iof .matfr*.l;sme apace?
... ..' ;.. .. ..
D DMIRATId:R, are
1 the birthrt t
of Eve, and tflirl nUU i
of them. They a!4i ri Sth.. t "
or America; iit 11'they ate niore f
is not, as In adi uriig Cuba or Panama itr
ing of the m~j ~i:at her window to listueto0 t.he:,
serenade of a :iOieJover, or to exchange a wae'.
two with him t.flime watchful parent hovers ii
the background; iilb; like a spectre at a teast.
Here Is no pri .ltdil a publicc to the music of a
band, the girl 11: tpfgether, the men by themselves,
each sex moving I~:adatind round in an opposite
direction, always:tfailt.ile.aiother but exchanging
never a word. fAet .ian'e en and women meet and
mingle freely, go bitthiiigst Bournemouth Bath-de-
lightful place of:: MRD----and dancing at Myrtle
Bank Hotel or.at oe fthke clubs for men and women;
they go together :to ie. ,tl picture shows, motor
long distances to':outry plrbes, and often and often
with never a li.eh n '"The time for that is past,"
said a lady cauvtUly n.ot long ago, phd it would
seem so. Theresar:till parents who think that where
their daughters, are there: also should they be, but
these are steadily t:emnlng a species extinct. They
belong to the rank$ of those who, not so long ago.
shuddered at the tl~oght that their daughters might
go out to work. Bt the daughters have gone out to
work; they fill po ltion becoming to them and which
they have digniped by their competence and refine-
ment. And girls bo .can meet men daily and take no
harm, who can il l their own with the sterner sex
and win their re~spet, who lose nothing that is finely
and sweetly feialine by embarking, however tem-
porarily, on a career of independence and usefulness-
such girls need not have guardian angels at their
side every hoar'Sf the time they give to pleasure:
they already have such guardian angels within them.
THE Italians. of the fifteenth century, the Italians
of the Reilsanuce, held that beauty was one
of the supreme virtues, perhaps the supreme virtue.
That was a purely :paga belief. But it expressed a
feeling permanent i. the hearts of all men; beauty
will win its way w:fe. the appeal of other qualities,
moral or mental, wil be slow and difficult. And
beauty has always sought to adorn itself appropriate-
ly, and mei have wilsly tolled so that their women-
folk may be clotled in the splendours of the rainbow
and draw homage,: fre dazzled eyes. But Jamaica
is a country o& which a::ammon has not smiled in-
dulgently; so it her tdigtters dress so as to earn the
laudation of many who" see them, that is not because
they spend lavlRbiag.asEclothes but because of their
taste and the akllf t61 i local dressmakers. Because,
also, and .prinflpally, they. themselves carry off so
finely what the iqw i:..
So let Cliba -lieot of its jewelled senoritas and
Costa Rics and. Other c'm tries plume themselves up-
on their pretty wanea:: Jamaica may rest content.
Pride of i.laee ib&ei iSi to none, for she too may
say,; Wifk "a"te' aoltelfable satisfaction, as she
points to i te as~itPs and beauty, "these are
my dauphtern.s:ii .'"
.. : I'


..... *-... B J WLKOTWOItB-A
* .o.. -


-' 1925--26


MISS SYDNEY HRANB SMITH
-.'


MISS WINIFrM TABUOT-MAIS


MISS DORIS


GUNTER


uxg tllil fT:it L .0os OBNlSOlt






A
NT, E R S'
6'11'1_i



DY A 6,; Ou A N, ID


KING TRA PR14AnON91"f
ver happen d to
TOat e e
George Bernard ShIM
T.-A
.-A
great humouriet 0
SW,,-re ad&jassed to
L SUaw! But, instead, the

to' true.. Ty7e all think SO.
'for anotber.,Perlxups it
d at.,'this enUirel
which was, however, quite'
r t Of Rnother great 0a
:i0f_ January, 1907, wouald dO
atim half frantic.
Yet it Si stro-
pule$ tilat An the
pas ':long years
angein the
on. has started
a elf ir has done
-with accomplialled
0 now
en
plete 4ixture alteration
Imagined; what is Wi4,
r all copi" generations and it qer-",
enough for the existing. generation;, go
them can beanything different?, Thus tb4
6n that existed'before January 1907 1WOUX '
have continued down to the present, 4ay hod
th e not come, an the 14th ct that moutha rogr UkR,,,
that of a thowopLd' charlots driv4u fun Keed p3ong a
-r.9eky roao) A, -toar immediately.-falltiwed. tw, suct a
Vlent 46AVUIsfll)n Of the eart&tjbj,
ed likPrf a %haken, puee of.eard TA40'wjnd then
AkpFsed, the d" 'j
't of #Qr TisiAg to 100 TF."S AGO
lom,",oimque canopy py",4,t; qn it Wag
41 it e u ha ft fi of "d no- jt- dkajUBaekUn. There areAo y .' UrrY4
er loped 4%j#0 0*'4*De#i&n au& i3treet in Kin
$ton which pop-,
Never had'sna whP ,#PKrWiqn, Wn rail' i,44kUoriops life. pot the memories of those tw&"
known before. And Jrov*" *as in wood and
becauoe of this earth- jo*.Iwllv P!r1ff0,t Newhere down
aud &4 it


In,
rLgratlo" Of T
It t Old'Port Royal (strt
*Scape allother aww, nucuratig) pictnTe it as full, of stone-built llousea
low: of ch4mhe
property'and -n, but, It we could see itl 7
1W. Amd so the *0 Wuld form a very different,.
now KihgsWu bega:m-',:
to arise and contin-
ues to grow,, a King-
Ston which, in sonlo And
iof Itz princIpM thor- Ydrz turned-
GUOUres, is entirely 'y Plaact-
4Wereut from the hould be.
e$_W'0fj44uUry 13th, M ever after, and
7 14
I into a city. After,
X
white,, when: terror bad subsided, they forg6t_*1,,,
Sims the PjRY, and if a fire had not reduced the reuud%#
the V a r-t Port Royal 0 aFlhes in -1703, most of the. old
(which 0 -oyalists would have continued to live
new point ot dep4,0, the growth of Kingston would in con
ture In local hi beeii s1dwer than it actually was In,
-was -entury_ But fire was again the:.f
tory), so It In ri"o
the. decades prio Lt- Alaigh ed -Port Royal as a city-
year. Kin
ut.:.even when Port
hixtory is writte those dal%,, it the cafty did not m4*4r,
_V-61 It was not 9fto
Klux0on Ims..suffered from the '*akmW and dia-'
q, rpart of the colony;. Tt was oriw, whoAflor ,,, pmented -cnere tra e;, r
Vnvidence to be -the chlefto r
s situations the size' 44
i-s]OW that conclusively. to-
QPiposes-as long as"
he C ""N: the !Man4, the, pljtC('1. JtL'
preferred arish of St to ee old SP.
Ann, on e n mt ng -that
so thl
diove th fro? Plape of tarued their
4'"to which Is posaflijej 1*4e, Elite SPAnIsh To
came capital
tQ,-poxoVed, butthey did, tropolls,
iilaliAud SVaDish Town'
they er.
ion,1440 ground now Oct building
qV70- -,Vie one substantlO- stood.:
and not ly
e7 called the p,
Ahe M I n, St. Ja
often would
to iguccourthe,'


,n eh-r"
peal that OOCA genitl
d
he had 4r, and felt
bctt*r'dff'
so the emd the
so4pr,
for t ]h Port,
e
__beiag a m"h t place for thew







S'" 92526
.'iTE 'O f
a U.,.:< [; s ^ &


PLANTERS'


PUNCH


Mt.FSey held it unworthy of the resi-.vere living in the buildings In Harbour Street which
a men: they only transacted businessran from King to.Church Streets, and even before
Sin their view, a place chiefly of shopsthen there had been a definite introduction of a new
e shopkeeping class; on their own pro-.ype of all-buufnesa building. This good work was
the country would most of them reside,hastened by the.fire of 1882. But even after that
anish Town would they stay when polltiesfire Harbour Street, brom Church Street to East
high and mighty matters brought them3treet, remained what had been since the century's


r:


ELNG STREET, LOOKING NORTH, 100 YKTEA AGO


'ito town. And thus it continued for a long while, to
the manifest inconvenience of everyone. Kingston
was growing and growing; clearly it should be the
seat of Government as it was already the centre of
trade. But no, and again no! Thus said those who
had a dominant voice in such matters. And thus,
lor a long time did unreason triumph over conm-
*monsense.
S In the meantime fire was doing its beneficent
.work in Kingston. There are severe laws against
tn, and when, n these days, a Chinaman's shop
i.burnt down (an accident which sometimes occurs)
lestials are regarded with a most unfavorable
Sa bitter cry is raised against them. Yet per-
e Celestial knows what tire has done in the
SKingston's improvement, and who is to say
Celestial, if any, who burns down his shop
olly moved by a desire to bring about
al and other improvements in this city
ion? We should be slow before coming to
clusions, especially when we remember
e done for Kingston in the past.
Says every now and then there was
,and some of the flimsy structures
to be replaced by somewhat better
and again in 1782 this happened;
.,after the latter year, the east sec-
.Street and the upper portions of
north by west were burnt down.
s t swept along Harbour Street,
I .at about Hanover Street, and
.its way diagonally upwards.
:uldings which had been
East Streets in 1825 and
when the earthquake of
Vin the reconstruction of the
which had served for
a Kingston at the be-
rywere fulfilling the
same .ii glance at the pic-
ture of wiill give the reader
: ome idea tare looked in the


|Wtwo weei
i took at th8
ears ago. YoaU
Spdle of King S
%l1on of the Parfldtr
left are buildings witli
fior and railed veran
lower story of these btil
ones of wood; in their
rried on, in the upper iS*
gers lived. The roofs d
led the verandahs round
t wide; these verandalit&
Srs, 'and on them, wlei
Ily would sit and tab
jhJie d comment on the


s of thTir:
But not b 1m
g purposeM-2.1
rous meraE
tired to thti
p9outLof K
Pboutc 1862,


dawn. And King Street, from Tower Street right
up to the Central Park, retained most of its buildings
and all of its architectural peculiarities until 1907.
Some new houses were built in King Street in the in-
terval, but they were on the same plan as the old.
On January 14th, 1907, the greater part of King
Street was as it.had been in January 1807. On Jan-
uary 15th, 1507, there was not a single structure
left intact.
Our first illustration shows, on the left hand
looking eastward, itor conspicuous structures. On
the sidewalks of these are standing groups of people.
The street is Harbour Street, and there is no King-
stonian of forty yeas, of age who does not remem-
ber these tiwldings distinctly. The first was used for
business and living purposes, the next contained the
offices of Messrs. Harvey and Bourke, the well-known
Solicitors. Dividing these from the other two edifices
was Duke Street."iVthe corner of Duke and Har-


Ir--n ^ :r-
4,,~~ ., ~ :`' L
~~-s -I
';.',.


:in Kingi
Dncea. g
R s~ra"'.'.iAl


?~f4.t'(*~%a2A at:


reet a hundred
standing in the
~th--in the di-
ight and
the ground
floor. The
the up-
s was
to or
were
iK. a


e upper stories te r
y had been built for ti. '
t1.otilised tfiem as storeh.eif
p or country resldenoeea l
l eor the day's work w:'t'
for ale not many peaop d.
"PA


BANK)


AT or tHEn FOiAoiE dlfTE COLONIAL BANK (MBA


4


' .-.1..


l


iiTI;i*i;
;, -:`Ci.


bhb0our tood the old Town Ha l' -FPoot Office,
and next' :.thaat the old Courthouse., :,,
You wfEd4ittre that in the picture l places
wear a.sha ijppearance. They were sk
ing even in JI i.fl'.y scrupulously mainta'1
appearance everafi.r:. They were patched addr fl.
paired and painted 'l'intervals, but the dust and sut
of the city had t .iii .rw ith them, and they al-
wa)s did Lo9gr ruas'.:'~ ?f: 'began by looking rusty,
and our last impresaio6 n .t'* a. was of buildings in
a contented condition ot'f :.a i .hey would prob-
ably have been standing thr~it`4 .still utllised as
public and private structures fori ltts. asaction of
.:business, but for the earthquake. .N&ti0.sder that
Mr. Bernard Shaw saw the hand of ti'e1I4J in that
calamity.
WWeWill look again at the picture of. ag Street
as it was a hundred years ago. How entirely diflnreat
it ia fram, the King Street of our own times!
You. will notice that in one of the pictures de-
picting'thii thoroughfare there is a water pump at
the corner. For generations Kingston drew its water
supply from wells,.and if people died of typhoid they
were at least happy in not knowing the origin of their
ailment. There w ar pumps all about the town, and
in the yards there were wells. These wells were fed
by the underground. streams of Kingston. and also
by rain; they weOe Suppoed to be provided with
huge wooden covers: i ttoh:e .ept covered when
water was not baleg:. :drawn :bat. that would, of
course, not prevent-somee enterprit .urchin from
surreptitiously throwing into them, when opportunity
offered, a few mango seeds, some banafa peel, and
even a dead cat or two; consequently the water was
not always of the purest. But our ancestors too,:k
these things philosophically, and perhaps were lisp'
pier than we. When they caught the erring child
they half murdered him. More often than not they
did not catch him, and half murdered some suspect-
ed but entirely innocent slave girl instead.
Look again at the pictures of old Kingston, of
this city a hundred years ago. Pigs and goats and
dogs and chickens wandered about at their sweet
will and pleasure, hunting for food and making of
themselves the chief scavengers; light, open carriages
dashed up and down the streets, gentlemen rode
to and from their work, and would stand at tlhe.
street corners and on the sidewalks discussing busi-
ness, clothed in high hats and long coats which
would drive mad us who have become accustomed to
palmbeach and other such-like suitings. You will
also have noticed that in the picture showing the
Town Hail and the Courthouse in Harbour Street
there is a.large3-owd at- wn. The c rwdfil p:rtit-
larly thIrk in that: pint of thi- 1i wt l WfitAe Court-
house faces. The readan le i lm- lI important cases
are being tried to-day; nice, interesting cases of ar-
son, burglary and murder, preferably murder. That
sort oT thing always brought out the Kingston crowd.
In these days we still take a healthy Interest in the
crimes and misfortunes of our fellow men, wishing
good luck to the guilty on the principle that a fellow
feeling makes us wondrous kind. But we do not con-
gregate in such large numbers now when someone is







PLANTERS'


PUNCH


being trl a heinous offence. V-i w the
cinevma keep us entertained; we lhaei ticket and
ternpll Bournemouth Bath attlIe Hotel dances,
aiJ fteon shooting and mot.r-car joy rides, and
1 dlibrdiversions. For every tisA there is something,
tail more than one thing.. It was not so with our
ancestors. It was not: A6'n ven twenty years ago.
Hence the Courthouan:amled eien now "the poor
man's theatre," watigi~& great attraction to all
classes of the pe d:tU and when some thrilling case
was being trij re btzilding itself and the space in
front of it it:cibb, densely packed.
The. i.4_ that we see in our illustration
pro flr.walting to bear the verdict on a man.th
had killed his wife, or, worse still, stolen .-gaC
(t'r.the stealing of a goat, or any othli-efAtlh :
..~pBieaion, was a very serious thing.) ~W'40'
fencee the prisoner was found guilyiF~t be
sentenced to death, and the punifhi. bbe
inflicted in an open space in the .sl .f M city,
the space which now forms the wi facing
the Jubilee or Upper Market .f itn.. It was
there that the gallows was. ei reo was no
Central Park in those d"i" merely an open,
arid, ugly waste of- auIl cjie land called the
Parade, and on it. -t,:i pa were drilled. The
open space of thl. 6 a I4 accommodate a vast
throng of nightt. 4.'tifee never failed to attend
a hanging., .ys the public is not allowed to
attend a ia ."j :bSo there is something, after all,
to bh a.*' ie good old times.
.A'S-the streets of Kingston? Sand. Sand and
dirt.it- there was no paving and precious little
e e. ing of the (ity. When the rains came the
Ssitriets were transformed into raging watercourses;
,-when the sun shone bright they became stretches
of sand and dust, varied by heaps of malodorous,
decaying matter, the refuse of yards and kitchens;
and theie was always a sprinkling of dead cats and
dogs to keep the John Crows busy,
-and the air reminiscent of some-
thing not at all like the perfumes of
Arabia. An old writer, commenting
on our city of those bygone days,
speaks of "streets without a plan,
houses without the semblance of ar-
chitecture, lanes and alleys with-
out cleanliness and convenience."
Yet Kingston was the principal
town of the island a hundred years
ago, and nothing could eternally
keep it from becoming the capital
*.ur*ithia &sset tO rawia *'his-
it wasmade in S,:laU d tenyear
after that a fire-ocurred in celebra-
tion of the event-or, at least, one
may be permitted devoutly to be-
lieve so.
Seriously speaking, it is still
fires that are the potent agency In
changing the appearance of the low-
er part of Kingston. In nearly
every street we see types of struc-
tures that flourished a hundred
years ago: buildings, the lower
atory of brick, the upper of wood;
the.lower story used for business,
the upper story utilized as a resi-
dence. From many points of view
it is desirable that some of these BUILDING OF
should be preserved, but an abun-
dance of them is neither beautiful nor convenient. Yet
no one in Jamaica ever thinks of pulling down a build-
ing to erect something better. So long as the thing can


-u:

N


hang together
comes a fire, and
best grace poss


THE BOWAL MAIX

pansies. Then -a


"METROPOLITAN HOUH" OF ,MeaSs. NATHAN& a co., HA ,, ,,,

It is patched and repaired. Then there are Building Autheoai*.:and no one can
d the inevitable is accepted with the do just what he pleases, as in *4 :old days.
Bible, except by the insurance com- Kingston no longer builds ThII':Ii.IO0 houses,
its banks, its offe wood, or
even with brick. P'51 rete is
the material now emplflt con-
crete reinforced with iron- an
earthquake-proof material.
The King Street of to-day, for
example, is entirely different from
the thoroughfare of a hundred or
even twenty years ago. From the
sea to Central Park there is not a
residence in it, and every building
is of modern type. Parts of the old
street were widened by a great and
beauty-loving Governor of Jamaica,
Sir Sydney (now Lord) Olivier,
and, before the two blocks .,f Pub-
lic Offices, which he decided shiud,-.
replace the scattered 411 d
edifices destroyed b). Ae
and 4rM, ope gatdSn and
Yellow, are neand there
At:; i:. sBi' central por-
-.' : instead of the
ivwgin. g 'ii~ t. i "is the dominat-
I"::'lMi tOima. With directing arm
he halt o r guides the traffic as It
flows: motor cars, cabs, carts and
thundering trucks obey his slight-
est gesture. He is proud of his
position. being uniformed and act-
L STEAK PACKET COMPANY, PORT ROYAL STREET Ing with authority. He s.ms p h8
the new Kingston, for tIbIg
new structure rises on the site of policeman of Kingston is hinircif an innoyva


ht e old. 14 secordance with pla
approved by. the city's Building


O OF MESBBS.. a. ISBA a CO.. A, w3m STREET


ins submitted and
g Authorities; for In former days our hotels wereonl d
inhoritis; for g houses. There was a big one In l:,-and
two similar ones in East Street, are was
heavy and plentiful and the servieg- the mos-
quitoes fiendish. Now there are~ which need
fear comparison with none in the tropicq,
and the better lodging-bhoU ss lent in their
appointments and their too nU is now being
paved, every street, ever r th asphalt,. and
completely sewered;. will be largely a
thing-of the past sa.Sl ghfares will be a
pleasure to peduetrli riot alike. As for the.
residences of thie :: ssees, those who have;
seen them kn wr about their spacious air
f comort, led lawns, their ane
gardens. o 'fni".'nret, gravelled walks, and
airy, I.asL & new Kingston is coming .1At,9..
being. I being rapidly. More ehjsbs
have. thle last twenty years than i
tke ": tidred This is the age. at f
,tble, the telephone, and ot.a ha
feel contrivances to expedite wr
deavour. They are all hsul
-minds. It required an rt.a pa
W:k down and to shake iat.'t
ibut the influence.of
It took a great fire to.
-rbbish that was cumbe
Fre also supplied K.ncal
-3ing, with an energy w died dow
lte now is tuned to a slarr key;
:;pitaome have changed f-i One c
only has not change :ingston, I
to-day maintacittain of the
pitality, that horn praised b m
Hickey,M.izen.
., "" .


1925-26


-- --- -;---- -;-~--- -- '


.^'-







S1925-26


PUNCH


he Jamaica NIobility

| OR "THE STORY OF SIR MORTIMER AND LADY MAT"
By HERBERT G. de LESSER. Ai hr of JANE'SS CAREER" "TRIUMPHANT SQUAUTONE." Et.
trl*eooeeeoeooe SmR uor d elolEI'SCEMEloe ^ONeo^oo
.'." I


--AGENINE CHARACTER.
A GENUINE CHARACteR


CHAPTER ONE

THE NOBLES CREATED.
SW HEN Mr. Marcus Garvey constituted him-
self President of the African Republic,
which itself had not yet been constituted,
he bethought him of forming a court and of
creating a nobility to adorn that court. In repub-
lies honorific titles are supposed to be eschewed. Sim-
pie demAocratic and republican style demands only
: something like the Mister before the name. Thus
William Bailey in a republic is merely Mr. William
'Bailey, and is often designated by his friends as Bill.
;'"But the hunger for distinction defeats even demo-
eratic canons, and so in many a republic a man, not.
. .being able to purchase or inherit the Utitle :O. arl,
SLord, or Knight, becomes a Doctor of Laws,.a Colonel,
Sor a Professor, as Is the case in the. itpublics of
South America and the United States, even unto this
day.
Mr. Marcus Garvey,.however, was troubled with
Sso scruples about consistency. He was a man
Sot large and sweeping ideas. He had made himself
the head of a itton ntot yet in existence, and he
could sde.no oM-"ireason why, as head of that nation,
he should not combine the advantages of monarchy
with reelibltea-tsm. He himself would not be Em-
epoer .or. f ing; he would merely be President, with
the chairmanship of certain co-operative business
.asaocatlons thrown in. From the first he obtained
Shis dignity and prestige, from the rest he derived
that revenue which even a Republican President must
i. command. But there democratic simplicity ended.
In his republic there would be Dukes, Lords and
:. Knights. Or rather, these titled persons would be
".iof his republic, and not in it, for Mr. Garvey's most
.i..t fervent followers had no desire to visit Africa. They
fI:eared that the natives of that country might prove
inhospitable.
I Mr. Garvey, then, proceeded to create a certain
S number of new nobility, and, thinking kindly of
S his native land, selected from amongst his own
'bdffflen a few to be elevated above their wildest
an*bois. These persons had taken shares in the
BlacklStar Line or had otherwise contributed, to the
measure of their means, to the various funds for the
liberation ot. Africa and the return thither of its
scattered dEisgOuiantas; they might also be expected to
: contribute mbtem ence, when the patents of nobility
were published t6 the world, It was found that Mor-
Stimer Slimslam, an earnest and hardworking young
Raiter in one of the larger hotels in Kingston, had
:been made a Knight of the Nile, and that Nicholas
SBrimstone, who worked at the Jamaica Railway and
Sas a competent artisan, had been appointed High
f uoiucuous Potentate, though of what he was poten-
b'why, was not very adequately explained.
,announcement caused considerable excite-
rett Street, the little suburban thorough-
i h both Mr. Slimslam and Mr. Brimstone
&**' t Street was one of the better living
0 suburb, or "town," as the local term
.:were the residences of these gentle-
no in Kingston had heard of
SMitchell Town, though com-
actually have visited it. Cer
er have thought of it as likely
-tO.on the day when the African
T a d, and proclaimed in huge
black type m embers of the African
i. public's n fc, no fewer than two
sided in Ba thoroughfare awoke
o a sense of iti ce in the scheme
f things Jamal rally felt that it
ranked with the fliteidentlal locall-
a of Jamaica's capital... p-oints of view.
Barnett Street was than a quar-
of a mile in length, aiid l contained
re than five rooms. The:i residences
'efor the most part single of two
Shree rooms, which overlookedsl every
In which these little house's ti. row
ofI ooms, each the home of a separahu
I ine vardi more than halt a dozen n


Yal n 7 &- .i a


church the inhabitants of Barnett Street, and of the
Beighbourhood generally, would sometimes assemble
to discuss any really important question of the dayi
This had become something of a custom, so wheat
the news got brtited bout that two of the citizens
of Mitchell Town had been elevated above all possible
expectation by the President of the African Republic,
it was natural that those .ho knew these gentlemen
should hasten to come together before the church to
talk the matter Over.
It was felt by them that this was indeed a great
occasion for all Jamaica and that a new era was about
to dawn for the country's working classes. This
sentiment first found expression in the words of
Father Proudleigh, a tall, thin old gentleman of
loquacious habit who had long since quartered him-
self upon his son-la-law on the ground that rheuma-
tism made work an Impossibility to a man who was
nevertheless of suah an independent turn of mind
that he thirsted always to be up and doing.
"In all my born days," said Mr. Proudleigh, a
pleased smile illumining his wrinkled brown face,
"1 never bear before dat a man could be made a
knight by anybody except' de King. But we live an'
larn. I live to see Morty Slimslam becomes a knight,
an' Mister Brimstone a Postulate. What is a Postu-
late, Mister Brimstone?"
The gentleman referred to did not know, but
could not in the circumstances confess ignorance. "It
Is something like a Marquis," he explained.
This claim to a higher dignity and position than
had been bestowed upon Mr. Mortimer Slimalam did
not escape the note. of Mr. Slimslam's lady. Morti-
mer was down at the.hotel attending to his onerous
iut not ill-remunerated labours, and though this was
an occasion when he might well be celebrating his
admission to the Order of Knighthood, he had not
deemed it prudent to absent himself from work with-
out permission received. He would make his ap-
pearance later on;-but Matilda, the lady to whom he
had been "engaged" tor five years past, and who in
the interval had shared his home with him, and pre-
pared their meals, regretted bitterly that he was not
on the spot to prevent Mr. Brimstone from plac-
ing himself In a superior position from which It
might be difficult to dislodge him afterwards. Matil-
da, who was decidedly a good-looking and rather in-
telligent girl of about twenty-six, buxom, tall in
stature and of light chocolate complexion, knew quite
well that a marquils-xnktd higher than a knight,
though how much higher she was not certain. And
she had a suspicion that -Nicholas Brimstone was
talking at random in defining the exact status of a
High Conspicuous Potentate. Just at the moment,
however, she could do nothing save laugh contempt-
uously at his pretentions, a laugh immediately noted
by Mrs. Brimstone, who had long been an acquain-
tance of Matilda's. Mrs. Brimstone resented Matilda's
expression of contempt. She decided swiftly that,
at the first available opportunity, she must make
Matilda rue it.
Without observing the discord which his inno-
cent question had already caused, Mr. Proudleigh
proceeded with his observations. He loved an audience
and the sound of his own voice, and here was a sub-
ject upon which he could descant at length. He
thanked Nicholas Brimstone for his information.
"Well, now," said he, "who would ever think
that in me old age I would come to 'ave frien's like a
Duke and a Lord? An' if we.did wait till de King
meck Nicholas and Mortimer lords, we would 'ave
had to wait till we dead rotten, and forgotten. But
Mr. Garvey go to America and meek a republic, af
de first thing we know is dat every Jamaican can
look forwards to a title. Blessed be de Lord! I 'ave
lived to see signs an' wonders. An' I thinks that
de least Brother Morty and Brother Nick can do is
to stand us a drink all round in honour of what has
come to pass."
The suggestion was not favourably received by
Mr. Brimstone; Indeed, he affected not to have heard
it.
Mr. Proudleigh sighed and. resigned the burden
of his discourse.
"I wonder what de King will say when him 'ear


ez. temporary peace and potential diij n of it?" he queried.
le on fairly friendly terms. It don't matter what he say," rejoined a trucu-
..Itself was paved with maead:'b tlt i little man. "We bin too long kept down by Euro-.
'nly it boasted of concrete gutt fl ni titons; we are LEthbopans, and now that one of
h, but its walks were unpaved. As the n as arisen an' proclaimed that Africa is to be for
Swas littg,:g~prass grew upon these ai te t tArfcahs, we shqud ist6p. thinking' about the King
at and gave tO ..a touch of seemliness. Theritd g u JIo that sort of foolishness, an' work out our own
m the Inevitable-fc l 's grocery In this street, :ej ,,; What happens to-day is going to -frighten a
S rum shop also, S at the upper end of the e*i high an' big people In this country. We
-a a itle Ang.i lehbu lit all of wood h~te.:-, our own steamship line an' our own Presi-
*ithin t iy spacious plot .f land. Outside of thfs -we 'ave our own knights and earls. If we
;' J^ .


MB. E. W. F. NEEOD


Any number of people In Jamaica know Mr. ,
Reed, and any number of people like him. Long be-
fore the writer knew him he liked him-on account
of his laugh. No man laughs more unaffectedly and
spontaneously, and there is something about a
genuine, hearty laugh that is very taking: a good
deal of a man's character is told in his laugh. There
is the laugh simple and the laugh pompour, the
laugh unaffected and the laugh affected: the last kind
you hear at social gatherings and at dinner parties
before the wine has had time to circulate freely,
aft-r which you are likely to have the laugh mean-
ingless or the laugh very boisterous. Now Reed's
laugh is of the genuine, unaffected variety, and that
is the character of the man himself. That is why
so many people like him. He Is true blue.
He knows Jamaica and Jamaicans well. For
some time he was manager-here of the Atlantic Fruit
Company's business. Born in. the State of Maine
auil educated at the Maiine State College, Reed be-
came a civil engineer by profession and was engaged
on the lethmian Canal Commission's surveys of the
then talked-of Nicaraguan Canal. He learnt a lot
about Nicaragua at that time, he learnt Spanish also;
there he went into the banana business as an em-
pioyee of the United Fruit Company, with which
Organisation he remained for about ten years. He
was in Costa Rica, and in those earlier days of the
development of Costa Rica, when Minor Keith was
an active figure in the country and Mr. V. C. Cutter
was imbibing knowledge and experience about bana-
nas, oue either succeeded or went to pieces. If one
was not bitten by a poisonous snake, or killed by
jungle fevers, one rose high, provided always that
oce possessed ability. So Mr. Reed, as he did not go
to pieces, and as snakes avoided him or he avoided
snakes, steadily and quickly mounted'the banana tree
of success, came to Jamaica, made himself liked and
popular here as the Atlantic Fruit Company's man-
ager, then went to Cuba to look after that Company's
interests there. He has gone on climbing the banana
C.:ee since, with a tall cane stalk thrown in as extra.
He is to-day the Atlantic Fruit Company's General
manager of Tropical Divisions, which includes their
interests in Mexico, Cuba, Honduras, Jamaica -and
Cuba.
Mr. Reed possesses the New England QafluitTr:j l
Kneaness and shrewdness joined to a great heafrtnes
of 'dspoeltion which makes the Ameriacan (hen he
has it) a most likeable person. He' a do a good
stroke of business-New England again-and yet
give the other fellow a feeling of satisfaction. He
inA the openness of manner of a child, but one does
not become General Manager of anything American
if he has only a child-like intellect: that sort of
thing leads to banana-carrying, not to managing.
Perhaps bis temperament can best be described by
the word sunny. He is bright and genial, and his
Irugh carries him successfully through the world.
He is a grat talker, indulging freely in asser-
tions, but watching all the while the concrete facts
of sugar's.fall or rise in price and the state of the
banana market in America. Altogether a good eCa:-
panion, the sort of man you would like to hfee-iAt
your side in a tight place, the kind of ma&l .ptlrnb
you have confidence, and about whom oy7t not
hear expressions of disillusionment gad: 4ilpoint-
ment.


A

Ir


'I


j


only show courage we can do.wh.atWllke. The King
wouldn't make one of us a BDate, but Mr. Garvey
make plenty of dukes in Amirica, an' in this very
locality we possess a martulg an' a knight. What does
It matter to us what the King will say?"


PLANTERS'


A-... **


ra~
r.


,




S1** ..... -1



10 PLANTERS' PUNCH 1925-26

The speaker, Mr. Nicodamf kglass, was a for his llvin', and. I are also black, you none of you called 'me lady,' an' as there is no feminine for Postu-
stranger to most people taPit e eighbourhood, want to give him an' me our title. But we got it late, or whatever it is, she will 'aye to remain Mrs.
thbngh to a few of them he- wn by sight. He all the same, an' you can't take it away from us." Brimstone."
lived at the other. ptid*%-g ton and had not Here Matlda thought it was time to say a word. "Oh, is that so?" queried Mrs. Brimstone, with
hitherto found it .i.:1 e a frequent visitor Remembering that Mortimer Slimslam was now a ominous calm. "Is that the way you make it out?
to Barnett Street:i. W t which had been con- knight, aip tat she must stand up for titular Well, let me inform you that at any rae I am Mrs.
veyed to him ..i..,- '-the African World had distinctilfl. B.it: it was not at all to her way of Brimstone, an' no one can take that away from me.
brought him .. itchell Town; he wanted thlbhitnkib.g-.saney Brimstone should have the title But if Mr. Garvey did make the man you 'ave a duke
to be prese W al celebration o O.,te gl.. even, you would still be so-so Matty Lashmore, for
to be prceeration of the glorious
tidings politics ot sorts: that is to say,- "W ".ill 'tae to give the gentlemen their proper y'u 'ave no claim to the very name of Mortimer, much
hg wa .1. of Mr. Garvey, though he ha~i-. tfit" she put in, decisively; "an' the ladies also. But less to Sllmalam. I am a married woman, wid a ring
naev :: i4 td a penny to any of tha l ,et^ A.:,POstulate is not a Marquis, or Mr. Garvey would on me finger, an' everybody know I go to church an'
fundW Tses, ;and he figured prominently Iiapapt Call him so. Therefore, so far, Mrs. Brimstone can't be get married. I don't mean to say," she continued
S movements of a minor descriptlog... .-- hastily, realizing that she was hurting other feel-
.ry for the instant return to Africa of of aings besides Matilda's, "I don't mean to say that
Af.an descent, though, strange to a many who don't married yet are not as good as
afr aan desceni th at the. forn ex THE IDEAL L DE MOC .RA T myself, but some are not, an' those who don't want to
ample mght be greater grsua- -*.... call me marquis, or me ladyrshlpl aa do what them
sion in the world. He was sha 4K V'l sa speech, like. Only, when they are h mj w.. e needn't
e ai l n ing osses come to me to borrow aa sixpance, for ve none
clever at influencing othera;..'.:F.7. possess- .,. ;.
ed some ability for O tM r olgh he was le them." o "
adsm -aado is o g ood fea : Si xpences were frequently borrowed f~ro L k i.
Ss m and .e a -way well at iro t- Bit`e metone in that neighbourhood. There were some
tures and the aarr.::S always wel attr-
ed, made him P0 .. s.a. He had a way present o who had formed the habit. Her threat,
it te a hi ie es therefore, had its Intended effect. At least half a
with th.alwy 15the good points of aeyes dos : of the company rallied to her support-all
were &alway#, the good points Of a
.lady and t ~~ieton thereof. He had now i"" call y'u 'me lady,' for it is your proper
put in applaudedd. But his remarks ere de~stiatifa: :said one, and the others echoed that
S e the prudent as distinct dangerous. righteou.ery.. Mr. Proudleigh saw his chance of
S wh e loyal were not sure they weren't seditious. making fr l with the.. ammon of unrighteous-
.l' fo Mr. Proudleigh, who never willingly courted ness. He neve nglected any opportunity of doing so.
hnger in the .and matters He turned now to Mrs. Brimstone with his grandest
ner in the fields of sedition, dwho "You are e Marhione Bimtone he n-
political was too old-fashioned to be anything bht In- air. u ar d ahi o he
stinctively loyal, he strongly deprecated any sugges- nounced with finally, as though he were the whole
Lion that the King's views should be treated as of College of Heralds, "an' you' husband is a most Con-
on tt the n vis s d e rea spicuous Postulate. An'" I ay-at we should do like
no consequence.
no De King t a good man, me friend," he replied de white folkses an' mainta t'.I dignity an' decorum
"De KIng Is a good man, me riend," he replied of your position. I will set d.jo'exeampte, Sister
to the truculent little gentleman. "Him wish us all you n e e lett c r
well, and as we is born under his flag we better not wi ch he was rewadepd wih a upsn i':l A speech
talk too strong against him. Wtrhaps Mr. Garvey Then Mr. Brimtone, who, despite t.~i e, was
communicateThen Mr. Brimstone, who, despite ii ne, was
communicate wid him before him o anything; we really a man of pacific disposition, reminded his wife
t out here don't know all that is takiwl' place in a t t h sme hi t alk te
that they had something to talk about in the tm1vacy
S country like America. I only wish dat either de King of their own home, and she consented to be led away.
or Mr. arvey would meek me n-in-law, Jones, aawa
or Mr. -Garvey would mock me sen-in-law, Jonsa JBut before going she announced that she and the
knight, for then me darter would be Lady Sa ta High Conspicuous Potentate would shortly be giving
and could take a higher place in d society than she "a little fun," to which her true friends would be in-
'ave at present. An' now I wants to know what we pited. This considerably heartened Mr. Proudleigh,
will 'ate to cae l Mrs. BrImstone, for we can't go on iated. This considerably heartened Mr. Proudleigh,
will 'ave to call Mrs. Brimstone, for we can't go on who was wondering if nothing was to be done to cele-
callin' her so-so Mrs. Brimstone, or Janey, like some MR3. IHUMPHRIEY caUM-EWIN brate the bestowal of titles upon two. eminent citi-
Swa do. Ite o ld'e t peul an' it is not li Somone. recently alluded to Mr. Humphrey zeus of Barnett Street. Mr. Proudleigh knew he had
Sl i i~ delighted, and her Cru*tl-wiing as "an aristocrat." He is that, oaourse, earned an invitation, and departed home with the
) husband ailo. itp eaueed a quick thrill of elation. but usually you take that fact for granted, .not as a feeling of a man who had not thought and worked
SHere at last the were getting down to solid, practic- matter to be specially referred to. A man of Tery in vain.
He matters, for what was the use of a were ol family, a Scotch, Punglish and West Tadian lauded
a]c matters, for what was the use of a title It It ther
t to b i dal u proprietor, an Slton Public School boy and a graduate E
not to be in daily use? yAy Tt
"Wht s your title again, Nick"' demanded Mr Cambridge Univeity, he is what thb. Panish CHAPTER T
What s your title aga, would call an hidalgo, which means the "a~t: of' '
Proudleigb.
"I am High Conspicuous Potentate," announced someone". .hic means also that such a one s W ": C
Mr. Brimstone with relish. body.in his own t ght and person. That i.. tha i : ..l f dy of Sir Mortimer
"Den your wife must be Conspicuous Potenta- i an we call.n aristocrat in English,i no a t a happy woman he
tees," said Mr. Proudleigh, "but I never hear of a title plirsonality he can hardly-ever la.. p. ....ted in aI verbal encouat witt
like dat Yet."But also hard Mr. Cru n Aav- le di toness of Brimstone, or High
"It don't necessary to call me that," observed to as n"A demcrt" and that Is as thTi l a..sl .eten esL, as that lady might otherwise
rs. Bri n apotnate istheo same inthierdi ion. The bet ari it in tese She hal been reminded by the Marcho-
like a 11arquis, which it are, we can use the emnine da democratic manner. That s to say, nethatsh was not even married and so could not,
of marquls. The feminine of man is woman," she le may bie reervied but is never arrogant, he will by any stretch of the Imagination, consider herself
continued, with an obvious pride in her learning, be well bred and never show a touch of personal entitled to be called "my lady." For the first time
"The feminine Of gentleman is lady. The feminine of i aolme.. It is the new-rich, the anne-proud, the since she had heard of Mortimer's elevatiol. N re-
duke is duchess, an' the feminine of marquie---well, man unaertai of himself, who cannot afford to be gretted that Mr. Garvey, in his love forihie
I don't know what it is, but we can find out simple dAd unosteatatious. Because he is likely to future subjects, had made Mortimer Ja-
"It is marchioness," explained Mr. Douglass, who he seileghty or incline d t hom he feels ta o be his e riors, maicansmembers of his new No ,dors o
had some knowledge of these things, "an' the wife of ke Is haughty or inclined to be haughty to those he Knighthood, or whatever it was..O0"arvey call-.
a marquis is addressed as "me lady," same like the believes lbentath him. He Is never sure about his ed his court. But Matilda woman og
a marquis is ad d a own standing. His view of society Is distorted; he much spirit, and she felt to herself t
"Thwife of am "me ladyship," agreed Mrs. Brm- does not and. satisfaction in himself. To be really make life as unpleasant l for Mrs. Br;l-
lave to a demladUe sort of person, in the. finer sense of stone. So far an she Trma.. shs would never
stone complacently, "and everybody here will 'ae o a demeeratle t person In the finr sn of stone rat as s wshe would never
altecmplacetlyso." "and everybody here will 'ave to that word, one, it would appear, must be an aristo- bestow any title upon :..one.
deathly silence ensued. Here was a ellma at. Thus apparent contradictions are reconciled. Arrived at her ::Matilda set about the
It -::not,: without significance that those who congenial tarr o e Mrs. Brimstone wash.
ii. gh it should have been obvious to all o f nd Mr. Crum-In whg are devoted to ....s.Bistn
ti iS'' jot been clearly foreseen. Everyone was wo i ad r M Crum-Ew a t o a o: yard where shet
ready W :tht Janey Brimstone, by virtue of has a bt th wan atili Like Mrs. Brim-
.. right to the title o rs a heads fo'suln es in the West Indies, as well as stone oomed house, not a M
being ntiatr~ "h: right to the betitle ae Mrs. and t he l and banana cutters on his estates, yar ro a small servant or
should n0ot b t ily addressed on important occa- he is one Who commands both respect.and love. High- yard roo" a small household work.
sions. But that a'f ant nadry were now to speak to ly apre t f good service, he brings out the girl t th household work. So
a...........iy' f good service, e' brin out t se was
her and of her as "me s:'14tbi," was a different mat- beat t~ere : in ,the men who serie.him;. quick to personage; she was comfortable Pi
ter altogether. The men'idRi :bot mind it so much, notice 0loyaltye Is himself profoundly al to le tha. ; she could go to the Palamer Pi-
but the very thought of i wai ~ and wormwood to connected tr she him. He liked, and she r at-
the women. To see one of theAtreM set so supremely people at wM as say sH nd thei.s eo t a eo.m t:.save in a hired motor cs
people att!-'Ima s sy so and they.::
elevated above them, and they- plled to acknow- Heis ti Ths his natural uatnins ed by other mourners. .
ledge her social superorit the day prevent h ro wasting his substance on the hop, of course, there wert.-a
was enough to drive them half fra tle. One girl, lesrly underr: We can imagine h im.dsleati .pecunilary and social Th e
distinctly good looking, and therefore onsciouse of a at being l hea;erlu-t of a shilling:e hi d t P *a addressed her as "MSa. w
at.ein ...... -t "i a sshd them famillarly.ig.,:rtt c -r-c
6 0 ral distinction, gave voice to the 'iugw of the dence would," t atlthe thought. But he ~ med the"m familiarly-lip Christ
i trtan-t." gladly bestow a "nd on a derTo these she now made al appeal,
S don't see as it is necessary that we should 'ave no one save himself and his beneaie s ed their immoral sup
S,.she remarked, "as we are not stranger an' likely to know of it. His benefactions-. J .' :h explained to some of t: gw
w'l o friendly to one another this long tmb indeed, are substantial, but of these '. -A M=ortimer had been mad d
pat' .wvre a particular function like a danes from himself. Quiet, genial, friendly, h s~..' .ie clearly was entitled to a Ir r-
or i ~e"n adopt the formality which I- culred man, there are, it is to be fn r ;taler; how Mr. Brim
proper, i, we can go on Just as we bin W .a proprietors lke him Conspicou Potentatere, obvio
goin' on ".:'IJ muu has been in his family could not be addreord Her
"That io o 4tur people," rapped out Mrs.. ad-.ity:years. It has always been o phantic audience nd wera 7
Brimstone, we,1 stout but not very sweet pa tut portion and also as a wroth when she in
tempered person: .quldn't hear white people the w rker#le .treated well. Good voice and got mtoe st up
K syin' that. It weitWte.s orchionese' here, an' 'me justi. and geerosity seem to be q tlerent on being kuw.. iple,,
Irdy' there, and 'marqall0i ntate' all de time. But in the Crum-Ewing family, and the d g d?" a female de-
me husband' is a .jljck man an' got to work that family lives up to its best tradlUo ." handed to ear about steamship but not
-r "

a cj 2 -




- :r ;- -


PLANTERS'


PUNCH


t ladyship, an' I not calling' her anything more
Mrs. Brimstone, which is her truly title."
wittingly, this woman planted a fresh arrow
already bleeding heart of Matilda. Yes, what-
happened, Mrs. Brimstone was Mrs. Brimstone,
iad a title which even the Governor of the land
Snot contest. While she, Matilda-! Surely all
notwell with the world.
Mortlmer came home at about five o'clock that
oon for an hour. He was a pleasant-looking
of about thirty, not particularly bright but
willing and energetic. He would be on duty
the hotel later on, but he had hurried homeward
learn how the street and the neighbourhood had
on the tidings of his knighthood. It was only
t morning that a letter from some high dignitary
it the African Republic in New York, along with a
iny of the African World, had informed him of what
Happened to him, for Mr. Garvey had not thought
#necessary to ask Mortimer beforehand if he would
i-willing to become a knight. Mr. Garvey had as-
Mined that no man in his senses would hesitate for
.aioment about accepting a title; and now Mortimer
panted to know what his friends and neighbours
bought about the matter.
U" "Them Is envious," stated Matilda with luminous
rankness, for she had some insight into human na-
ure. "They are envious but they try to disguise it.
galy Mr. Proudleigh an' one or two others speak well
bout It, and old Proudleigh is always trying' to get
What him can out o' people, so he don't count. But
now you are a knight, Morty, what you goin' to do
iout me?"
SSir Mortimer looked at her in surprise. He was
pot aware that he had it in mind to do anything at
ll about her. He requested enlightenment.
S"Well, don't you see, Mortimer, that now you are
ob high hup, we can't go on like we going on at
resent? We love one another an' we get on well
With one another, but we not married. I didn't mind
that before, but now you not a simple man any long-
ir; wherever you go they must call you 'Sir Morti-
Bar,' an' when I go with you, what them to call me?
ok at the Governor? He is married. He have to
Swr people would talk about him. It is the same
way they will talk about you, for him an' you 'ave
the same title. Therefore, so far, you will 'ave to get
married, for there is no other way out of it."
"Gal," exclaimed Mortimer, "What foolishness it
i you talkin'T"
"No foolishness at all," replied Matilda decisive-
V, and then she told him of the scene that had taken
piaeo a little while before.
.Mortimer became thoughtful. "You see, Mat,"
-sald, "it is like this. You and me get on very
bi together, for we are not married. I know you
I me if you like, though you better not at-
you know what is good for you, and you
can leave you if I want, though I don't
h olnethat way. An' the reason we get
.y do is because we know what we can
J'me becomes a lawfully wedded
usban. h be different. The moment
rou get rtie(1r you might begin to
e stupid, -ri li it still abandon y'u, you
would have m&' Wii t the ring, an' I might 'ave
i support you." :
" "That is one part =t," returned Matilda, "but
peare Is another. What aibot respectability? An'
I.after all these years you an' me get on so well,
irat you 'ave to fear?"
S"Well, yes, that's true enough," agreed the gentle
"r. "But a woman is a funny thing, you
you may change later on."
r, perhaps, you are right," replied Matilda
-you will 'ave to make up your mind to
ry me now, for I am not stopping' with
Ies Matty. That suit yesterday, hut
y, It is not that I want anybody
jahip,' but I won't stand 'ere and
Brimstone 'your marchioness'
all If you wasn't a knight,
Syou 'ave a title an' If
s share it. So you can
ake .goin' to do."
Thi. shook Mortimer not
ttle. desire to be parted
Matt1id. Ifwilled, vain and
tions, ani 6rage with her
op cause th op alarmingly.
would thUsn gested, be less
ty for rest !...Jt he knew
,:ell enough to 1" gnity being
wounded, she w it he did
mkeher his wife. He that envy
%falousy were busy at"'*" in the
arhood, but in the p lnewly-
etontates lrnkniht ate


tFor instance, he ha
the hotel, that Mr.
his fellow-waiters, a t
had nearly murdered
.murder. So he und
4or Matilda, attached a
ig with him anywhere
tb twhatover, while the w
a :bout and Insisted upon -

:":" ske It .


did marry her? As he had told her, he could cut
the nuptual cord in fact if not in law it she proved
insupportable. Meanwhile, like a good and worthy
knight, he would do his duty and hope for the best.
"Name the day!" he said dramatically.
"As soon as possible, Morty," she cried, excited,
for she had won- "And let everybody know at once."
She whirled out of doors.
"Miss Susan," she called, "Mrs. Henry! Morty
an' me are to be married shortly by special license.
Morty say I mus' be Lady Morty without delay!"
The special-lcense part of the story was her own
invention and had come into her head without pre-



SIMPLEAND SINCERE


HON. CHAb. HOPE LEVY
The Hon. Charles Hope Levy is one of the most
likeable men in Jamaica, and one of the most liked.
Familiarly known to members of his family and to
intimate friends as "Pops," his genial disposition
endears him to all who know him well and wins for
him the appreciation of even casual acquaintances.
When be was appointed Custos of St. Thomas a
few years ago, the general feeling was that a most
admirable selection had been made and that Mr.
Levy would perform the functions of the office fit-
tingly. He had never filled any position of distinc-
tion before. He had been a retiring man and some-
thing of a valetdidinarian. Yet those who knew
him best were well awate of his sense of duty. They
felt certain that they were not mistaken in their
confident expectations of him; and as a matter of
fact those expectations have been more than ful-
filled. for no duty pertaining to the Custosship of a
Jamaica parish is neglected by Mr. Levy, and the
traditional and social obligations of the office have
been carefully carried out by him.
Mr. Charles Hope Levy's is essentially a simple
and sincere personality. You could not associate
him with anything mean or unworthy. As son and
nephew of two men who stood amongst the very
first of Jamaicans in their day, the late Mr. Charles
Levy, merchant and planter of Jamaica, and the late
Mr. George W. Levy, chief editor and proprietor of
the "Colonial Standard," Mr. Hope Levy has Inherited
not only an honoured name but a code of conduct
in public relationships exacting in its demands and
worthy of admiration in its fulfilment. That code
he maintains; hence to the affection which he wins
from his friends there is added a true and enduring
respect.


meditation. Yet, why not? It would be expensive,
and there could be no wedding feast. But with a
special license she could be married within a day or
two. She hurried back into the room. "A special
license. Morty," she insisted, "for I don't want to go
one hour longer than necessary before I make Janey
Brimstone know who is who and what is what.
Everybody understand what Is a knight, for de Gov-
ernor is one, but a High what-you-call-It Populate
sound like stupidness to me: it 'ave no meaning at
all."


0d "That's what I say meself," agreed Mortimer. "It
lt is not a title they use in England, for I never hear
,it.... down at de hotel, an' there is no good havin' a
W::title that nobody don't understand. It is only like
&.i ..:iLodge title; you can't make any proper employ-
Sir eat of it. And that," he .added emphatically, "is
I i;. t we 'ave got to make Brimstone an' his wife to
W R'i" he"; for he was hurt at the thought of Mr.
Si tne's claiming a marquisate while he, Morti-
h, m ii-fmsalam, was only a knight.
'. ..


.... <


. -' .


-26


~ I '~b~5ri~" "~


Thusfi one day, the neighbourh .. was lectri-
fled with two distinct yet related items of thrilling
information. First there were the honours bestowed
upon Mr. Sliaslam and Mr. Brimstone; next came
the news that in. a day or two Sir Mortimer eoml
.Matilda were to be marred by special license. Mrs.
Brimstone was muoh.:ilaadalised. This last was one
of the things that nevea tight to have happened.
She was all the morme-t s. about it because she
realized that It was her own Smeer at the irregular
marital condition of Matilda that .had brought it
about. Mrs. Brimstone, too, with her thirty years
o' experience in the world, was well aware that,
--splendid though her husband's title sounded, it would
not have the same effect upon the minds of men as
did the customary Sir or Lord. It was a new-thing,
It was a vague thing, and she felt that if people' be
gan to contend that she could not rightly be called
"my lady" It would be difficult to convince them
otherwise.
True; she could insist upon Potentatess; no one
Swoald deny her a right to that. But then it did not
sound quite right. She had never heard of a Poten-
tltess before. She'had been to school; she occasion-
ally read the papers, and even cheap novels: she was
by no means illiterate. Indeed, among the working
orders of the city she was an educated woman. And
she had never heard of a Potentatess and did not
believe that there could, ordinarily, be one. She curs-
ed Mr. Marcus Garvey. Why could he not have been
content with making her husband a simple lord?
Then indeed her precedence of Matilda, however
much married, would be unquestioned. As it was,
she feared for the future. Her only solace was in
the hope that Matilda and Mortimer would not hit
it off well as married people, and would shortly sepa-
rate, Matilda being compelled to live a life of wantf
and drudgery, for which she was obviously unfitted,
and so come by slow degrees to a dishonourable
grave.

CHAPTER THREE

SIR MORTIMER'S DOWNFALL.
3 Sir Mortimer married Matilda, and In Barnett
Street there were two ladles claiming the right
to be addressed as "my lady." Neither spoke
to the other, neither would enter a house
where the other happened to be; and the pity of
it was that, before this dignity had come to them,
they had been, If not friends, at least on amicable
terms.
There were other regrettable complications. Mr.
Proudlelgh's daughter, to wit, Mrs. Samuel Josiah
Jones, and several other ladles of the neighbourhood.
began to object to titles on envious, democratic, and
also aristocratic principles. They argued that the
only titles which they could recognize were those
bestowed by His Majesty of England, who would
never, they averred, have so far forgotten what was
right and proper as to bestow them upon the in-
habitants of Barnett Street. They openly scoffed at
the new Knight and Potentate, and this did not tend
to preserve cordiality. It is to be feared that Mr.
Marcus Garvey had brought to many of those who
had never harmed him not peace but a sword.
Lady Matilda and the Potentatess, or Marchioness
Brimstone, would not, however, abandon one jot or
tittle of their rights. They contended that if Mr.
Garvey could create a republic, with himself as chief,
he could surely create a nobility. And those who
accepted Mr. Garvey would have, perforce, to accept
his knights and nobles. This caused many a Garvey-
ite to desert the fold and return to his original
loyalties. There were even one or two hold and
enterprising spirits who, not having been ennobled.
were thinking of lifting openly the banner of revolt
against the Back to Africa idea.
Lady Matty, however, and Lady Janey, urged
that their husbands should more strenuously than
ever preach and maintain Garveylsm and insist In
and out of season on being properly addressed. "Don't
let anyone forget themselves with you," was the bur-
Sden of their admonition. "Malkethem call you as you
'ave a right to be called: in time.t.hey won't try not
to do it." Matilda was the more insistent of the two,
and their husbands promised to obey.
At the hotel Sir Mortimer was having a hard
time of it endeavouring to induce the waiters and
others to speak to him with due reverence and
respect. He did not suggest this to the headwaiter,
for that functionary had the power of high, low and
middle justice over him: that is to say, the head-
waiter could dispense with his services at any time.
But he would argue with his fellow-workers to show
them the error of their ways in regard to him, and
so, from being popular and liked, it came about tSft
he began to be detested.
They would not call him Sir Mortimer, and he
would not answer, unless he absolutely mut. either
to simple Mortimer or to Slimalam. Heae:dtlsagree-
ments and controversies.
And so it was also with the High Conspicuous.
The men among whom he worked foirhis living at the
Railway laughed at his pretensi ns. Now and then
one of them would address hi:.las "Your Dukeship,"
but this was understood to be by way of ridicule. He
(Conteined on Page 21.)


..~k~




s- : ,.-. I b


'12'





::To-


...:. PL N T E R S'


PU N E- 1925-26


iX Brc
o.. ;


. .ii --When Entr ise Waits on Skill

A STORY OP OF MY FRIENDS


DE LISSER,:..C.M.G.


. .: i .
.*** J'.,.i.s.'/


I take up an
.... magazine I am
li.. Un its pages with the
'.... .. y of some successful busi-
..:'e-oman. and the suggestion to me
:ilb'.| to go and become what he ha .'
become. Quite probably I am
that that particular person,
commanding features are: d
at different angles in a -lig
photographs, began: i
up a cent i:.:4iv is
down anotherbI
another nli te is
an .ea-ptti k-:
ag N Bthan
the-i A a w.with these
two Ic.b.roceeded to lay
the., :of the great bust-
S' now covers all the
-America and brings happi-
: .to millions of homes. I like
0 ie business that -brings happiness
.to millions of homes, though that
could not have been the original
motive of its existence. The reason
of a business is to bring happiness
to the pockets of its promoters, hut
jit happiness can be produced as a..
bye-product. as it were, let it .:b&.!
produced by all means. Happipet s:
is always emphasized in thefte bid
S graphical sketches, and- the idea STAr
suggested is that if I or any otherr
S;-reader have only got the same sort of features which
John B. Bumpkins of Milwaukee possesses, and suffi-
cient presence of mind to box.down a smaller boy pos-
sessing the cent which I desire for laying the foun-
dation of my businesses, I would arrive at the unique
S distinction of aecquirli : a ,rtune and of bringing

*: ."j .fl~i -i. iniJ i I.tfl ties do not lie In
:7 the diretto o~eif"bfbittitgiea lucrative profit-making
organisation. I am quite prepared to box down any-
one for anything I want, provided that that can
be done with absolute safety to myself. But even
after I had achieved that task I should still wish'tO
know the next step to be taken, and the secret of the
successful businessman is to know in a flash just
what is the next step he should take. The fact 's.
that businessmen perceive and utilise opportunities,
whereaa the literary man likes to write about them.
My. purpose in life has evidently been the manipu-
I" Odie, while the businessman's is the mani-
flings..- Pollowing my own career faith-
ftlly -af e At t w t to say something about,
Snot a lgraitg inaesmen, but it family
of Jamaleg: '' ilt: youth was more-;r:
less contempt bidsi(
cess is far more
Sme than that of aii". ri "
I do not mind reading
just as a fire next door M: i
one than an alleged conflagri tif.
struggles and achievements of :I'gaMt 4 W i
pie of greater concern to us than thoss:pf b~ : .e ....
:': :-.sri


F OF THE KINGSTON INDUSTRIAL WOlji |

buns df whom we never I heard beftie r a!n .
-shall never hear again.
TWNTY-FIVE or thirty years ag.l 41i LN :
Sthe qtestiot as to what to do '*t thj i l'b-ee
wa a bitift -a problem when the famnit y;~lauIl
and money to et i t p tn bn4u:i a c;~rt ts::
professions was not available. WhbAn tbqe1.a s W p:
still utder the age fB te a it exalted ysi'tiu4 lS
gratifed yao.:mind .to a ielate about w'Mf..i.t.,,.
should become: One woald be. a lawyeo:r.W 4i "ot
a doctor, ant as forth uaflbh on, untilStat & ft'
fourteei or iXte:enW: rehed by tbhe
.the ed eioBt ia l~Bi t a career becest.
.ive. Tha:-ei Htplfsl al t no much :a
-what y w- AtiI -th the boys as *:
*ttaiy ettidaii:i- the and JaMHtal
Sgrit-In kinl t $uu( ef, and t
STia Wfrom
I,.er Wk' t yi the o i -- r
loanksW. be q..uipped fkrTfirbers in
lif'hati;tt .ita I'alency thea wia4 to' ll any
.i.tiitt i pi Jamaaica, pUtbl :or private.
*ltiiwit aigilit nA toMM abroad. Thtie. was a eel-
lgg aft t1h d$s. could not be 'ent and in-
3,i.:Il !t^qitwtrking, which feeling was not
.... ,eii ilt, aieans themselves, but partica-
P ^ i-them. The saying is that a
..was-1ouse. And each Jamaican looked
::lite aOrt of prophet and determined
Ri Of course, if a Jamaican had
;.U,


.:.9 .'ti:.was excused for being
v:land, and much might
p aid in praise of him.
Butr .ha that was really
boeing g was the means
that he: ~onsequently
the JAmalt .. s.money had
to begin pr le:iding on t. lad-
der of succeaeb..ig s.wR as a ta.O
mendous suceelc to be
climbed before he 4ig to bere
near the top, and ple.N*
agement to meet him on
ward path.
It is somewhat different and
very much better to-day. Just as
strikingly as the appearance of the
priluc pal centres of Kingston is al-
teredi oe..that no one would recog-
nims 'the..Kiig and Harbour Streets
and the..resideatial suburbs of thir-
ty years ago as the same places
at the ptesent.uime, so have condi-
tions in other -re. .. altered al-
most beyond. a ae mid-
dle-aged ma ~ 9i dri
is an il utlaiii t ~ .eth
ability and b.. sevierance must have
gone to the building up of what is
for Jamaica big business by a group
of boys who had nothing to begin
upon but their own character. -h1r
f-icint telligence and determination, aid
.. .. a plan from which they never al-
itsw themselves to depart.

Bl ing Mthe Henriques brothers when they
".: y eai band contemporaries of mine. Some
:on T s- WeWi much younger than I, but there was
f: :ed. that. had not to go out to work when
t hp ullreh:l lixte.n n.years of age. The two elder
nsrehi .E S,,if b Vs.=woen, started at about fourteen
iyea-au ad p'm aStinlte has told me that very
nier, k. .ecommsetesd work he had in mind


I remember
te At that time
een earnestly engaged
ties and pretending ,Iyjb...
and Fabian were the01 tfdi
led by thoughts of the future.
to note how, as all these boys...
.rq~i: ti a when they must decide upon thelf
caflift tan life, they selected occupations that IWaU
enable them to establish a practical working p~.:ur-
ship between them, so that as a group they h .1
self-sulicient and strong.
Of course, they were followingl.
laid down for them by their father, cl
ing. Mr. Samuel C. Henrlques, 1; hli
seventy-first year, is by prof gneer.
He too began at the age fwas lin
his youth and primeatgeeoW rallarg
engineering undertake A work
engineer, however,. '. late a gr


... .... ......... .., .... I


Rff-









PLANTERS'


.= ;. ." #r;

.. 1-

13


lume of pence though he may acquire large and
t varied experience. If you work for others, those
ers will get the pounds and you will be welcome
I the experience you may obtain. Yet the'old
Although he may not have known it at the time,
ad really a great deal of capital in his six boys, and
experience was going to be of service to them.
lle he was wondering what would be their future,
at future was already being determined by
eir character, by the occupations into which they
went, and by the opportunities that, unknown to
them, were coming their way.

SR. HENRIQUES was, as I have said, a Civil
Engineer. We see his hand in the circumstance
that Emanuel and Rudolph began to work, the first
'at the Engineer's Office at Up-Park Camp, the second
with a firm of builders well-known in Kingston as
Lang, Lothian and Dunbar. Later on Rudolph went
:to Purdon and Cox, where Emanuel also found him-
self: Purdon and Cox were Engineers and Con-
Stractors with a very wide field of operations in this
: country. Then Rudolph left the island for the
i'United States, where he was engaged in scene
:' painting for about a year, he having done some por-
trait painting in Jamaica for some time previously.
But the call of the practical life was strong, or his
practical sense was dominant, for while in New York
Rudolph sat for an examination in the New York
Grand Central Railway's Office, passed that examina-
tion, and then was appointed draughtsman in the
office. So, when he went to Paama in 1906, he had
no difficulty in obtaining a position as topographical
Sdraughtsman in the Colon Municipal division of the
Engineering Works then being carried on in that
Republic.
Emanuel, on the other hand, left Jamaica for
Eluador in 1901, and for some eighteen months was
Employed there on the engineering staff
of the Guayaquil-Quito Railroad Com-
Spany. ..When he returned to Jamaica he
re-entered the employment of Messrs.
SPurdon and Cox. working for them
i along with his father on the great pipe
line and dam at Bog Walk (which the
: firm built for the old tramway com-
pany). and, also with his father, taking
part in several big jobs, such as the May
Pen Water Supply, the Port Royal Wat-
er Works, the Vere Irrigation Commis-
sion's canals, etc. After this he went to
Panama and served the Isthmian Can-
al Commission for three and a half
years as inspector of machinery. Ru-
dolph was in Panama at the same time;
:th s almost at the beginning of the
bu 'mding of the Panama Canal we find
thlitHse boys had seized the opportun-
ity of acquiring further experience in
construction and engineering work and
of making some of the money which
Panama afforded. Their line in life was
already determined, they were to be
engineers and contractors. They wanted
to learn in the school of practical
achievement as much as they possibly
could, and no greater school for learn-
in. than Panama at the beginning of
tI .century was to be found in all the


another brother, Vernon. From about the
urteen he was engaged in work on the re-
ion of the streets of Kingston begun by
alty in the days of Sir Henry Blake.
on then employed in the paving of
*ets was known as the Kingston Im-
any, and this company Vernon
opne year. Previous to this he had
to the semi-literary life and had
on with me for a position as
Astn of the Jamaica Institute,


Company, remaining connected with that branch of
the Canal Construction Works until August, 1907.
Thus three brothers had gone to Panama at a
time when the going was excellent for those who
could work strenuously, and who were determined
to learn all that the building of the Canal had to
teach to keen-minded people determined to succeed.

HORACE had began business Life in the employ-
ment of Hes r Nathan and Company. He was
in their office adding and-subtracting figures, making
entries In ledger learning to be an accountant With
them he remaite a.nufnber of years, then he..tog
went to Panam :t. Ta fact isthat Emanuel bad bei'n
advising his brfthers.to come over. Panama was not
exactly a ]a~d ehtdfowing with milk and honey, as
was the Promi i ',:&Land of the Biblical story, but
it was a couiu t ovirfbi~ing with work and money,
which after all tle :-th ractile equivalent of milk
and honey. So. ; lnimue, having surveyed the land
and found it good, aeorted his brothers to emigrate
and share in the groBlerity which abounded; and
we find Horace as a young fellow moving over to
Panama to join the others, and there he was at once
employed in the Audit Office of the Panama Railroad
Company as an accountant. In the meantime Owen
K. Henriques, better known throughout Jamaica as
"0. K.," had, immediately after leaving school, em-
igrated to Panama, where he joined the office staff
of the Panama Railroad Company. O. K. was not
more than seventeen years of age at the time, but
already his mind was fixed upon developing the idea
of Emanuel and the others-the idea of forming in-
to one group of partners the Henriques Brothers, and
the organising of the enterprises that should be un-
dertaken by them on a sound financial basis.
After working on the office staff of the Panama
Railroad Company for some two years, 0. K. was


ITrEBIIO VIEW, KINGSTON INDUSTRIAL WORKS

made Secretary to the Auditor of the same company,
which position he held for three years. That wAs
an education in itself. A man of natural financial
ability, with a power of vision and organisation, no
better stroke of fortune than this could have hap-
pened to him. As Secretary to the Auditor of the
Railroad Company he came into close touch with
important financial questions daily; he had to be
quick and resoureo.l, accurate and painstaking;
those five years in fAnama, indeed, laid the founda-
tions of his subsequent financial success. Fabian,


W cl ~~on hai, e'icarried a salary of not less the next brother, did not go to Panama. By the
tbvtn t i week. There were about time he left school his elder brothers had returned
seventy-t pot, and I remember to Jamaica, for now a new opportunity had opened
Vernon and ..nces of each other, before them. The earthquake of January, 1907, had
e were fri i was the elder and I occurred, and the Henriques boys realized that a
elt convinced ra abilities were great deal of construction work would have to be
Entitled to an tm ely, the highly done In this city. The group of them-the solid six
remunerated post at t r satisfactorily -represented practical engineers, contractors, archl-
nswering questions a ledge of Latin tects and financial men. During their time in Pana-
*-d Euclid, I was appo iii*~lon retired ma five of them had been well paid and they all had
;ompulsorily) from the thik he has saved something. Pooling their resources, they found
er had any reason to retr. at some- that these were not inconsiderable; above all they
at later on in life I again I he semi- had youth, energy and enthusiasm as their natural
S erary world as a reporter on .Daily assets. They came back to their native land, and
legraph of Kingston. That Di h:eld Fabian threw in- h1s lot with the others. He too was
Three months; in the meantime h.:.n- to follow the profession of an engineer with structur-
p yed by Purdon and Cox, and th"e 'S' t.. al steel work as his special department.
e Iof engineering and construct
seen, even as a boy, that while I' was not long after the boys had left Jamaica for
m resting profession, and t ie ama that I came.across one or two of them in
of the F 4'riexcellent thing to talk about 1*: .: tltt country. I was now a journalist. There was
ie In, the ry rewards were not very atta muc dispute in Jamaica in 1905 as to whether Ja-
t h So be -"ournalism, went to the 'diii maica labourers should be permitted to go to Panama
Sber Compatisl, he toiled and studied for to work, whether the conditions there would be
couple of. Then he left for Panama, favourable to them, and whether they would make
he was ap of the office engineers more money there than in Jamaica. In the midst
'sus'e itans If ka" was, ..of this confusion of opinion I thought that the best
subseqe y transferred to ae PFliama Railroad pe would be for some one to go to Panama and


investigate the situation; I put this suggestion "-
fore the Gleaner's Board of Directors and within a
week I was on my way to Panama. There I found
the Henrquesabrotiiers, and I have already told else-
where how during my stay in that land Emanuel,
with one or two of his American friends, would
come over to spend the evening with me at my house
in tie Zone, to talk over affairs in the home country,
and to entertain me with song. I enquired about the
boys whom I had not seen,.. and learnt that they
were doing well. I heard that, though they were com-
f ortable and prospering, they yet longed to return
to Jamaica: the natural longing of mafn who were
born in the country and whose asflA r was to
achieve success in their own territory.
Then, as I have mentioned, came January, 1907.
and the destruction of Kingston, and the boys caine
back.
They started at once on work of reconstruction.
O. K. took charge of the business affairs of "Henri-
ques Bros., Builders and Contractors." The work
of organisation was his. They were good contrac-
tors. The whole of the north-eastern block of King
and Harbour Streets, the block comprising the build-
ings now occupied by the Bee Hive, Canadian Bank
of Commerce and the Montpelier Cigar Store was put
up by them; so were the Coronation Buildings and
"The Sports," which is one of the most tasteful look-
ing structures in the business centre of this city.
A large number of the new buildings In Kingston
was erected by them, and when the bulk of this work
was completed towards the end of 1912, the dream of
many years materialised. The Kingston Industrial
Works, the Kingston Industrial Garage, and Heaitl i
ques Brothers, Builders and Contractors, watit
organized on a firm basis, with the six brothers co-
operating; and ever since then success has attended
upon success in all their undertakings.

B UT when this organisation took
place the businesses were, natur-
ally, by no means what they are to-day.
It was while the carrying out of their
building contracts was going on that
the other enterprises were started, and
started in such a small and unspectacu-
lar fashion that they attracted no par-
ticular attention. When one visits the
Kingston Industrial Works to-day, and
gazes down a huge workshop resonant
with the din of activity and carrying
on all sorts of operations in steel and
iron and wood, it requires an effort of
one's mind to go back to the beginnings
of this largest undertaking of its kind
in Jamaica. But I can recall the start-
ing of the Kingston Industrial Works
in 1908. The workshop was then situat-
ed in Long Road, was about twenty feet
square, and was made of packing cases.
It contained an anvil and a forge, and
a small drill press which Vernon Hen-
riques informed me had been bought
from the Jamaica Tobacco Company for
about two pounds. Vernon was chlef
of staff, and his staff was limited to one
boy! After six months he bought a
small workshop in West Street, and
ftcQ Z-_ from that there grew up the present
7I Kingston Industrial Works, with one
hundred and thirty skilled men in its permanent em-
ployment, and sometimes with over two hundred men
engaged.
In this foundry is collected every variety of ma-
chinery for the making and repairing of iron work
used in Jamaica. At the entrance you are shown a
crane capable of hoisting and switching to any part
of the foundry a weight of anything up to five tons;
you are shown an oxy-acetyline welder which is put
in operation as you look, and while the steel-blue
flame spurts from it on a piece of steel, you see ta
steel sliced and divided as though by a kniae, at-
though sparks flying in your direction and fallingg
upon your body leave no trace. Bre iare men skil-
fully making wooden patterns for. steel bands and
posts and spirals add what not; here are switches
being made for the Jamaica Railway; here is a ma-
chine that can at any moment be sent to any sugar
estate in the country for the purpose of effecting re-
pairs, thus enabling the work of the sugar estate to
proceed almost unimpeded, and rendering unneces-
sary the labour and cost of transferring huge masses
of estate machinery to Kingston. Here, in short, is
every tool and instrument known in the founder's
trade.
Once upon a time practically none of this work
was done in Jamaica. It used to be sent abroad, es-
pecially to Scotland; there was but little skilled .It:
bour available in the island, and there was even :1es
confidence in the labour that there was. N l0r,1a It
an easy matter to create a staff of skilled Workers
and to Inspire then with the necesaary esprit do
corps. Even to-day, as is obvious, the supply of
skilled aud reliable labour in this,.a in all highly
technical callings, is limited. But in the years that
have elapsed since the anvil and the drill were set
up in Long Road, a splendid (nd efficient organisa-
tion has been established, aad very shortly one piece.
of work which the Kingston Industrial Works is noq


1925-26


. -* ***


PUNCH ...







PLANTERS'


PUNCH


THB KINGSTON INDUSTRIAL GARAGE, CHURCH STREET


SHOW BOOM, KINGSTON INDUSTRIAL GARAGE


engaged .tpon, and is patenting, will be known not
only in Jamaica, not only in the British Empire, but
throughout the world. It. would not be fair to the
-Hanriques Brothers for me to specify what this is.
But I can at least say that it is an Invention which
ill be welcomed in Jamaica and by hundreds and
thousands of agriculturists elsewhere.

THE origin of the Kingston Industrial Garage is
one of interest. Very often large enterprises have
small beginnings; indeed, most of those of which we
read began in a humble and inconspicuous sort of
way. They grew, they were not suddenly created;
so it was with the Kingston Industrial Garage. The
Sboys, after their return in 1907, required some means
of quick transportation. They waflted to travel over
the island in connection with their building con-
tracts, and they wanted the sort of motor car that
would enable them to do this travelling cheaply. They
decided upon a Ford. They used this Ford for some
time, were satisfied with the results, and then Horace
"determined to apply for the Jamaica agency of the
ford motor, cars. He obtained it, and the garage was
established In West Street next door to the Foundry,
in a building of about thirty feet by eighty. Here
Henry Ford took up his local residence and here


for a time did Henry flourish. Ford cars were pushed
in Jamaica and Ford cars were purchased; the tri-
umph of Henry Ford in other parts of the world was
being repeated in Jamaica. Then Horace took over
the office management of the Kingston Industrial
Works, which his training and experience as an ac-
countant In the Panama Railroad Company and else-
where fully qualified him for, and 0. K. assumed en-
tirely the management of the Kingston Industrial
Garage, while remaining identified with the Works
and with the Henrlques Brothers. For all three diii-
nesses are fundamentally one. All the brothers are
Interested in them; they are dove-tailed, so to speak;
they are parts of one whole; they are the concrete
manifestations of early ideas, loyal co-partuersbtp
and of an ambition realized.
Today the Kingston Industrial Garage is one of
the most up-to-date garages to be found anywhere,
and the sale and popularity of Ford cars in Jamaica
steadily increase. Also, while these two businesses,
the Garage and the Industrial Works, were growing,
the construction part of the Henriques's undertakings
was not neglected, as the Kingston Theatre, designed
and erected by the Henriques Brothers, and the new
May Pen bridge, one of the largest and finest works
of its type in Jamaica (to mention but two instances)


most amply testiy. Building and construction in-
deed, demand today a great deal of the time and
energy of the Henriques Brothers.
Here then Is a record of which any group of men
might well be proud. To have an aim ang to pursue
it. a worthy aim and bring it to success, and this
while still young and able to look forward to further
achievements, cannot but be a source of pride and
satisfaction to any man or number of men.
In Jamaica no one can acquire an immense for-
tune; the field is restricted, the opportunities few.
The same amount of brains and energy put into a
successful business here would bring greater rewards
in a larger country. But when something more than
a competence has been acquired, one's chief reward
must surely lie In the realisation of achievement.
To have done the best that one could In the existing
conditions and circumstances affords gratification of
the highest, whether in Jamaica or elsewhere. So i,
looking around for illustrations of success, and of
accomplishment noteworthy, confine my investiga-
tions to Jamaica and my eulogy to the persons I
know, feeling that if incentives are needed and are
of value, and If appreciation is due, my examples
can as well be drawn from Jamaica as from any
country beyond our shores.


THE CITADEL

(Continued from Page 3)
haps half an hour a tropical storm would break over
the town. Such storms were always of short dura-
tion but of extreme violence. He glanced at his fine
blue coat with its gleaming buttons; it would not be
well to let this, his best apparel, suffer from the
downpour. Three squares away the Hotel de la Re-
publique suggested friendly refuge. There he could
dine until the rain was over.
HE long low room was crowded and the air was
pungent with tobacco smoke and the smells of
cooking. Officers of Chrlstophe filled the tables, gay
uniforms contrasting with the striped suits of cot-
ton or linen of the civilians. French was their speech,
a hum of Gallic words like the sound of swarming
bees.
At the table next to Bush five men were dining,
and he watched them with Idle interest. The bottles
were opened with increasing frequency and their
voices grew proportionately louder as they drank.
They were in uniform, officers all, and from the heavy
bullion on their green coats he identified them as
probably attached to some crack regiment of Chris-
tophe. They were discussing the King's great fort-
ress and their ignorant boasting amused him. Then
the talk turned to the King's court at the Palace of
Sans Soucl and the coarse stories of licentiousness
filled him with a disgust that might have been read
Sin his face.
J One of the five, a short effeminate-looking
mulatto. rose unsteadily to his feet. With amuse-
sent Bush watched his swaying figure and the filled
i Sat Iln his unsteady hand slop its contents on the
man at his right. He began to address a companion
acirs the table.
"Mona. her Nicholas-" said the little man. Like
a slap across the face the name galvanized Bush into
rigid attention. The mulatto babbled on drunkenly,
and then sat' ddenly down. From his chair Nicho-
las rose heat miAd lifted a brimming glass. He was
affected by the piJn that he had been drinking, but
be was still in command of himself.
S Leaning across the table, Bush strained his ears
\Sor the words. Niclas was responding to the
tast. In the most pofshed French he recounted a
''


coarse stoa. The very refinement of his voice and ed in recurrent green-white flashes. How long would
manner magnified its grossness. His comrades were they wait before some one followed him through the
laughing immoderately. He was still talking. Sud- door? A minute at the most. That would be his
denly from his lips tell a sentence that for a moment .tart.. He ..lMan U heid never run before, for death
made Bush sit rigid in his chair. Clear above the .t' owed. iTher were no passers on the street, but
tumult of the room he heard the name of Vhirgh. hef t and there a light shone in a house. The rain
The vile boast of this educated half-breed about the beat against his face; in the glare of the lightning
white girl whom he was to wed burned like fire he saw the road as through a silver curtain of falling
across the. brain qf the Philadelphian. water, black-gleaming with muddy pools.
With a single movement Bush leaped from his The pistol was still clutched in his hand but
chair. There was a crash of shattered china and the the priming was wet and it was worthless. He glanc-
small table rolled across the floor. Nicholas turned ed over his shoulder. In a quivering flash he saw a
toward him a heavy white face, and Between the crowd of black lgures about the door of the tain He
startled eyes Bush's fiat smashed like a hammer and dodged around a corner. There was the landing!
he saw Nicholas drop at the Impact across the table- "Luke!" he shouted. The mute steppe but from
top. There was momentary silence, then tumult fill- the shelter of a shed. :
ed the room. Every one was standing, jostling to With the nearo he scrambled da ito the land-
catch a better view. The little mulatto was scream- Ing stage and flung free the paintwa i Already Luke
ing vile words In a high, shrill voice. An ominous had the oars in the water. The i'Mt shot forward
note grew stronger in the roar of voices. From the and the dock disappeared in the blackness. In the
table Nicholas was being lifted to his feet, his face fqr distance Bush heard cries gj the sound of pistol
smeared with bright red blood. A thin sword blade shots. For the time being he as safe.
glittered at the side of the mulatto, and Bush saw
a knife.in the hand of the officer who had sat at the THE morning was gi e. 0 Cool and steoat
left hand of Nicholas. The mulatto was edging his the offshore wint4 a the Lucy northward
way around the table, the thin blade gleaming in the across a sea of unbeievable blue, beneath an azure
candlelight. sky. On the poop-dalhn Bush watched with half.
Blth could not have recounted coherently what shut eyes the ret wiig: coast line of the Island.
happened in the three or four minutes which imme- With the v vestigee .of a smile in his blue eyes
diately followed. As a while man, he was at best Bush recotle : m : incidents of that .crowded even-
barely tolerated at Le Cap; it required only some ing of yesterday. Huggett had been waiting at the
act such as he had just committed to turn everything top of thie lnfidewhen Bush climbed on board. I
against him. the faint, g1eam of the anchor light his black tar-'
There was a rush toward him. A pistol roared paulin:. gtieeA4 like glass in the downpour, a var/
like a cannon; a bullet grazed his ear, and a pall of nished i r'hat threw his face into complete. hltdo
powder smoke stifled him. With his back to the ana drteff water like a gutter.,
wall he swung the chair In which he had been sit- Li' .Ba had come to the point hurriedly. The rait
ting and saw the face of the mulatto sink suddenly wasasta: pping. On the shore more lights -were moe-
beneath it. .It was a chair solidly built and again he ing bout. Before long a boat would unquestionably
swung it in a half-circle that cleared an open place tid pLt off. If he refused to let them on board thy
before him. He was now near the door. A blacki': nmigt. try to take the Lury by force.
hand reached for his throat. He snatched a table. "Get the men on deck and make.
kniAt and stabbed blindly. There was the door! The He measured with his eye the.. -, 'to t(e
crowd was pressing forward. With his left hbendhe shore and studied the direction f~t. It was
groped for..hlN pistol; his fingers found It; he leveled blowing strong and directlyout.g. No time to
it at the crowd. weigh anchor. The wind iher offshore
"The first man who crosses that door I'll kill," they could put sail on her. .drifted. He vik-
he shouted. ed a boarding axe out of -and went forward.
T7W he slipped around the door frame t (bte As he ran, the boatswa was trilling ant a
street. The rain was falling in a deluge, the road Pound of voices tt h tr omttle,
was a quagmire. From the sky the lightning quiver; "voices ^ f hevy sleep. 'Tere was
,~F~'"~F


/


1925-26


.. --




w' w. -
**.


PL A N TE RS'


PUNCH
.:. -. .... "..*jr:t : :ia .i-


swearing; then he heard them coming up the
to the deck. With a stroke of the axe he sever-
Sstarboard cable at the hawse-pipe, and the
as free.
ome one had fired a gun as they drifted past
6own. The stars were out again and shone on
great gray foresail that was already swelling in
Wreeze. They were in plain view now, the ghost -
i hip sliding faster and faster over a black sea in
starlight. Then from behind the flying clouds
ie the moon. Far astern a longboat lay with idle
in the soft light. He was out of it none too

Bush came out of his reverie with a start; it was
uggett's voice at his shoulder. "We're all clear of
e land, sir. How shall I steer?"
SFor an hour, while he watched the receding hills,
t question had been uppermost in his mind. "Lay
her well north of Tortuga and then make for the
:Mole," he answered. Then, squaring himself until
li faced the stolid countenance of Huggett, he con-
tinued in a lower tone:"I don't know what the men
::think, but let it be as they will. They know well
.enough about what happened. I want you to know
the whole yarn though, Mr. Huggett, but not now.
We are going to the Mole for more coffee. That
sounds reasonable, and there may be some there.
Perhaps I'll have ydu take the brig home without
me." He gave a swift glance at the distant shore.
S "I'm deep in something serious, Mr. Huggett.. I'll
ask you to serve me in your best style."
Huggett's red hand hitched at: bhim waistband.
"Captain, you ain't found Tom I.aggett: lacking yet."
SOut of the corner of himt Bhe caughtt the man at the
wheel. "Keep her away theri ," he roared, as though
S repeating an order received from the captain. "Set
the topsail, ye lubbera I'ively now, loose the top-
gallant sail."
The /La-tli~ .away before the wind, but in the
Caribbeat' weie English men-of-war, and soon one of
them W8:.. bent in chase of her, for England and
Amel -were at war. The English frigate's guns
S cart~dG: far; they set the Lucy on fire, but she got
-mtay thanks to the swiftness with which she sailed.
Her day, however, was done; Bush and his men were
compelled to take to the longboat, and they watched
her till she sank. Then they headed for the little
island of Tortuga.
N the early morning following that night on
which John Bush had so hurriedly put to sea, Vir-
ginle Goutier awakened from her quiet sleep with
a presentiment of evil. Cheerful sunshine flooded the
: room and shone like a golden haze through the white
gauze curtain of her bed. The air was still, but lit-
tle household sounds came faintly to her ears. Peace
seemed to brood over the roof of Leroy Mangan.
-Then to her awakened brain came sharp as dag-
ger thrusts the terrifying thoughts--would Pierre
Nicholas attempt to consummate the wedding which
her guardian had sanctioned before she could effect
her escape, and had some misfortune fallen upon
John Bush, in whom she recognized her only pos-
sible deliverer? Four days had passed since she had
seen the hated face of Nicholas, but it was almost
as long since that evening when Bush had been re-
quested by Leroy Mangan to leave his house. What
,.,luld be the significance of this silence? Had the
I antagonism of her guardian followed the
American beyond the gate? She knew only
how cheap was death and how silently it


since I was a little girl. you have been very kind to
me. You knew m3 father and my mother. Can I
trust you with my confidence?"
"Mademoiselle, it would be my greatest happi-
ness to serve you."
She looked lantently at the dark level eyes of the
merchant and theit honest and friendly gaze confirm-
ed her confidence.
"Captain Bush--he, too, is your friend?" she
continued.
"Oui, madeiaqsel.e, there is no man whom I re-
gard with deeper.affection."
"What has.tappened to him?" She leaned for-
ward, her long fngers laced upon her knees, her e- p
eyes imploring. -
Monsieur Samatan made an expressive gesture of
despair with his hand. "It is a strange story, made-
moiselle. Hi ha` le[ft- Le Cap; quickly, for his
safety. But I shall tiil you." Then with dramatic
interpretation he. recounted the story, as he had
heard it, of Bush's eniounter with Pierre Nicholas,
and of his escape from. the harbour on the evening
previous. When he. had flashed, Virginie got up
fr. m the chair and laid her hands in his as he stood
before her.
"Monsieur Samatan,.he will return. For my sake,
he has done these things. You alone know of this.
My secret Is in your keeping. As his friend, and as
the friend of my parents, I appeal to you to aid us
if the need arises!"
Monsieur Samatan was deeply affected. "I will
promise that," he said, simply,
EVER since the "Lcy had been abandoned Bush
had kept a sharp watch on the horizon. Although
a sail might mean.a desirable rescue be was aware
that the chances were slight that it might be an
American or a neutral vessel, and anything was pre-
ferable to capture by an Englishman, merchant ship
or man-of-war. There was a large number of Yankee
privateers at sea, however, and if one of these should
chance upon the open boat nothing could be more
fortunate, for such. a rescue would insure their ulti-
mate landing at an American port or, for that matter,
at a neutral port, from-whence he could more readily
carry out his plan for a, return to Le Cap.
It was accordingly with no small emotion that
shortly before noon on the second day the topsails
oi a small brig were sighted on the horizon, apparent-
ly holding a course that within a few hours would
bring her within hail of the open boat. For a long
time Bush had been plining a course of action, but
he had not yet disclosed his plans to Huggett or the
crew. Now, however, he determined to sound their
inclinations, for the scheme which his active imagi-
nation had engendered required the implicit support
of all.
"If yon brig is at our people," he explained,
while the rowers trailedttheir oars and the others sat
with bearded faces turned to him, "all is well. But
I doubt greatly if a small trading brig-for such she
appears to be-would be in these waters unless she
is English or of another country. You will remem-
ber how much alone the Lacy has been, these years
of the war. If we are taken up by an English ship,
the consequences are well known to you. Escape is
impossible. But there sl an alternative which, if
you're the breed of man that I believe you to be, can
be attempted. Are you of a mind to follow me?"


r in the Haitian city. She flung her face A lank sailor with sun-bleached hair broke the-
e pillow, dry-eyed in the terror of her moment of silence that ensued. "Aye, captain, we're
with ye. But what may be the plan?" The others
nie Goutler the Philadelphian captain nodded in assent.
ed in all the romance of her dreams. "There are now eleven of us in all," Bush con-
Sargotten his stalwart figure and smil- tinned. "We have cutlasses and tomahawks and
First day that they had met. In there are six pistols in the store chest. I would have
rvened she had built around his all but three hide beneath the canvas, while the
of all the lovers of history. others with the sail will hold a course along the
I of her life he had become wind. If we make her out to be American or a neu-
he was the embodiment of tral, well and good, but if English, we will signal
All thatiBvery and gentleness and our distress; and if once we can get alongside of her
Passion. without their suspicion that others are hid beneath
But oIg zIf since that night, and the sails, there's a slim chance, but our only chance,
still no word thing happened to we can take her by force."
him, or was e .Ome daring move There was a murmur of approval from the men.
for her rescue? .nlety she played The black face of the negro, Luke, broke into a
with the latter th the fascinating broad smile and he wagged his head vigorously.
romance which her again and again "And it we take the brig and she proves well
Sthe prodding fear: life l le Cap. laden, will there be a division of the prize money?"
She breakfasted e ll was custo- asked one of the men,
mary for Leroy Mangan itJ in bed "There will be the usual division," Bush answer-
and to arise late in the m to her ed. "If she carries a valuable cargo there will be a
order her carriage was witi She rich reward."
:gave the coachman her instrl H back A half-hour passed and the brig was now not
Among the cushions. ... more than a mile away. Twice Huggett had stood in
SThe horses came to a stop b ll it the stern and waved his shirt above his head, but
Monsieur Samatan. From the st there had been no apparent, sign of recognition from
harbour. No vessel rode at ..,the ship Once again he steadied himself on spread
or rested against the w -i -'t Jtigs and shook the torn, white garment in the air.
where 'aof i. some reason the brig of i i:... lowly the brig swung a point off her course and as
as gone. .''he two watches recognized this evidence that they
Napoleoi1nBlatan greeted her with a pr isWe sighted, the red ensign was rapidly hoisted to
esy whlch.: no indication of the fr. ei' pry ak and again lowered to the deck.
i. E her earlyS call occasioned. Gsa .'. a'Bush passed the information on to the crew.
abwed her to a -nd flung back the shutTteota *i English! Ten minutes, lads, and she'll be
Lr: 4,katjhehMthcool the room. Iakieualad. Not a sound there until I give the word;
wr am 'safow me. A surprise Is our only chance."

towcoo.


THE brig headed toward them, the blue watea~ r w
I and then whitening beneath her bluff bow. Sho
was Itavily laden and in the light breeze laboured
almost as though water-logged. Bush had concealed
his glass beneath a thwart, for now be could clearlF
scan her deck with. his naked eye. A sailor in the
bow was the only aiga of life that was visible. Ap-
parently their appearance .had created no particular
interest. In an undertone Hugett called attention
to the gun ports pierced in the low bulwark. Peace-
able as was her appearance, the i f.g, like the Lucy.
.waa evidently armed to take care t-'erlf- Another
Ssailio now joined the watcher lnath-.bow. Bush
waved his arm to them and one of the -ef lifted a
coil of line above his head. So slowly' wa4i e brig
moving through the water that It was eideti.t that
the sailor intended to cast a line to the loniboat ad
bring it alongside without stopping his own progri.
Huggett gave a quick look of satisfaction at the cap-
tain. To be picked up in this fashion would not
necessitate the presence of officers or men on deck.
It may be questioned how a man of the integrity
and courage of John Bush could purpose to take by
force a peaceful merchantman thus proffering a ser-
vice of mercy to two castaways in a small boat in
an empty sea. But it must be constant remembered
that a war of singular.bitterness was then in pro-
gress between England and the United States and
that the impressment of Yankee sailorss by British
men-of-war had played no small part among the
causes of that struggle. Accordingly, in -the eyes of
John Bush, this slow-plodding English menfhantman
was fair game to bag if be were able to do IO.by the
ingenious strategy that he had determined to ex-
ecute.
In another minute the high, blunt bow of t"
brig loomed above them. An order was bawled at
by the sailor to the steersman, the coil of rope came
singing through the air and Huggett, catching it
over his arm, made fast with a hitch around a for-
ward thwart.
The gunwale of the longboat touched the bright.
planking and as he felt the slight shock Bush whip-
ped a pistol from beneath his coat and sprang for the
channel, his hands grasping the chains that secured
the dead eyes of the shrouds. As be leaped he gave
a shout. "Now then!"
But the men needed no word of action. The
palls were thrust back and from the bottom of the
boat they followed their captain with a rush into
the chains. So sudden and so unexpected was the
attack that not one of the ship's crew for a few vital
seconds resisted their onset. With a. leap Bush eless
ed the bulwvrk.and hisf feet struck.tb dd. ,.Alreaitd
Huggett was at his side. Irom:.the ~oop came the
roar of a pistol and a bullet sang past his head. He
saw the man who fired and the roar of his own pistol
was the instant answer. With a rush one of the
brig's crew flung himself against them, a long pike
in his hands that buried its lance-like head in the
chest of the last man to leave the longboat just as his
body appeared above the gunwale. Cutlasses were
clashing. Two, three, four more pistol shots roared
viciously. A man dropped at Bush's feet and rolled
bcreamlng into the scupper, his head cloven with a
cutlass. Two others were crumpled on the white
planking. Of the brig's crew who had been on depk
but one remained, and he was climbing now for life
to the maintop. The brig was taken.
During the next hour Bush inspected his new
command and interviewed the prisoaers. "Hercules"
was her name; a brig aboqt the same size as the
Lacy, but designed along the broad, bluff lines of an
Indiaman rather than according to the sharp, fine
mold of the little Philadelphia blockade runner. She
was English-built and English-manned and had sail-
ed four weeks previous from Portsmouth for Port
Royal with a mixed cargo of merchandize.
The armament of the Hercules was a matter of no
small importance and Bush observed with satisfac-
tion that five carronades comprised her main battery.
in addition to two small brass cannon on the poop.
Obviously no match for a privateer, she wa stl :y IV
no means defenceless, and for the plan. ltWhi c la
now deliberated her armament. waait tlt h he re-
quired.


CHAPTER IV

RISING sharply from a sea of glittering blue, the
island of Tortuga flung its green shadow against!
the pale band of the horizon. Early in the morn&g
the lookout in the foretop had announced the landfall:
to the deck, and a few minutes later Luke had roused
his master from the heavy sleep in which he ha';
sunk, wrapped in a greatcoat in an angle of the poop-
bulwark, to see the bearing of the now clearly vislbleA
land. His eyes were still lpavy with sleep and .Prt
a moment he stood in stupfied bewilderment, t:i-.
certain whether to believe the mad prooag-i or
dreams from which he had .been awakefli or to
accept the reality of the day. "
He had preferred to stay on- k during the
night and in the hours between itlight and the
dawn he had again walked in th garden of Monsieur
Mangan with Virginie's whib shoulder beside hinm
gleaming in the moonlight. -j0er were happy dreamS
(Continued oa Page 17)


-26


'Wo W







PLANTERS'


PUNCH


Y are buggy peo- r-e-s,------.-, --
'" pie," said Martha to T H
'Nary In tones of respect.
She was referring to
the folk who lived not a
hundred yards from them n-
and who were-visiteddt:i
friends in sltn.le:-... V
double buggles, t~ilfy
single or pair -- -es, ....----..-- .-
and who, of :eouiw, also
had a bugy'-:: two of their own. Martha and Mary,
like Lilin :and Lucy, or any other two or more yaMl.
*lWdSs:\j- t-tiis quite modest class, neither owt
.1ag 4ai -nor boasted of relatives who -did so. ''S
niw mainly tram-car people, who oceasm tiai ired
:a bus or cab, and to them the possehalw atbggy
ndiadated a definite social status; ads intance-
ship or friendship with "buggy peVpt' fus a privi-
lege not to be despised.
This was about twenty years aego.
The externajs of social superiority then were,
as now, a fine residence, many servants, and freedom
to attend the dances at.the best clubs and hotels.
But the chief Xea3W ba : ous hallmark of such
superiority was ik: j ,preferably one which could
accommod6ttit.t ( .fe l r personal besides the driver
and Lwhe-icr'fi! iWa'-'by a pair of high-stepping
horses that.- asiped the bit and seemed otherwise
conscious -that they were symbols of a great and
mighty state.
.ven then there were persons with buggies who
'Vwre not in society or not on the way to that sphere;
i neverthelesss the two-horse vehicle remained the out-
Ward and visible sign of inward social grace and
happiness, and there was a gulf fixed between those
'who had buggies and those who had them not, about
-as Impassable as that which divided Lazarus from
'blves.
S HE years passed, the buggy slowly began to give
-J place to the motor car, and n .some countries it
iWas said that a new gulf had opened between the rich
and the poor, between the people in. society and those
S not in society: this was said especially in England,
for in America Mr. Henry Ford bad made it Impos-
eible for the rich to monopol se the motor car.
It was said in Jamaica also. Those who owned
Marriages (which was another and grander name for
the larger-sized buggies) but who could not afford a
motor car, spoke bitterly of the horseless conveyance
and declared loudly that" they would never trust them-
solves in. one. More, .they aftirmed that they much
w.. sr a^- esrf .ea. tk "1' q r.-car (-which was Just
-t beairt.: hk they fiar inot the latter), and
-they pointed out the superiority of the horse to a
mere machine. All of which did not prevent motor
cars from steadily becoming more fashionable. It
-did not prevent the.gulf between Lazarus and Dives
from- widening and deepening. The buggies had to
give place to the motor car upon the road when the
car sounded its haughty warning and demanded right
of way, and it was most humiliating to have to lt
the car rush past, especially as it always left the.
buggy people in a cloud of dust thoughtfully stirred
up by the deliberate opening ol what is known as
the motor car's "cut out."
: The world of Jamaica then became divided into
iour main classes: motor car people, buggy people,
tram and cab people, and walking people. The walk
Ing people were for the most part disregarded. They
being only the sjority who grew food am perform-.
ed for a trifling 'remuneration the most necessary
operations of a country's life, did not need to be con-
sidered. They would always walk anyhow, and walk.
ing was no doubt good for them, whereas it was high-
ly detrimental to persons of a finer and more exqul-
S site physical and mental organisation. The folk
of this finer and more delicate organisation need-
d d exercise, it is true, but they could get it from
S ticket, tennis, golf; and as golf courses were few in
i ,iS, and would always he so, the motor car folk
\ gk'tflig as their chief form of recreational ex-
nt -U a further served to mark them off from
S other aRSi the population. And if they were
coanpelte ta-v theyy did it under protest, or rath-
er, with an excu~ and never for more than a hun-
dred yards at once. .
The tram and cab people..were mostly the better-
class wage earners, who always spoke of their pay as
"salary." They too had til highest social aspirations
and any amount of pride, but they had not, and
thought then that they never would have, the purse
which, with pride, would have landed them among
the buggy folk or the motor car hierarchy. They
watched-these from the outside, so to speal,,.with an
that was almost socialistic. Why, they asked
l es, why should some people have buggies,
A rse motor cars,,,others quite as good had per-
nt themselves with the ordinary street
car A~l.i occasional cab; and to this question
-aeithef m nor earth returned an answer. But
their ~tji .-was nothing to the bitterness of
buggy L.l these saw persons of more or
less the se .sphere, or lower, rolling along
the streets a 'ndlll n motor cars. It seemed then
to the buggy pe Providence had fallen asleep
or hd forgotten .. It was clear that some-
|hing had to be donVe t the existing wrong and


y.


MOTOR .



VEHICULAR PSYCHOLOGY


to readjust the sorelx-disturbed balances of social
4itjta


in Russia is mere child's play.


perforce had to drive
their own cars or keep
them on exhibition in
the drawing rooms at
home.
But a revolution was
still to come, the revolu-
tion which is now in pro-
gress among as and be-
side which that foment-
ed by Lenin and Troslky


*ajm W- In Jamaica we used to be sticklers for the pro-
- ND something was done. The buggfes began to per thing on the social side of life. We still are, to a
A disappear. The cost of a car, and of its yearly certain extent. But when the highest classes change,
maintenance, was much higher than that of a buggy and the classes just below the highest follow suit,
or even a carriage; yet it was met. More cars appear- then the classes just below the-classes that are Just
ed than there had been buggies; garages began to below the highest deem that they can change also
spring up all over the island, horses died of a broken -which is true democracy. This never occurred to
heart, the four classes of society were again reduced the men who first set the example'of "every man his
to three. It seemed as though the balances of social own chauffeur." These did not see that young men
justice and propriety were being nicely adjusted once who could never have become coachnil.i and grooms
again, and th., .e outward and visible signs .o..u- would consent to become their own: aehut~tfts. Yet
priority were auout to become even more immutt.bly so ft has been, and this change has been iifkiated,
fixed than before. even brought about, by the appearance of a 'le-
It might be that some who had no right to wn 1 noi enon known as the second-hand motor car.
motor cars did have them. It might be that men and
women who, quite obviously, should ride in the trams I tTlike this. After having used a car for three or
or in the cabs had actually been able to prhau four yarws, a gentleman's family finds that it Is
motor cars, and to pay cash for them too-which was no longer ft to be seen. Which means that they
setting a bad example. All this was deplorable,.yet no longer.care to be seen in it, It has become shab-
on the whole there was a difference established, a dif- by-looklag,:ft maxes more than the usual amount of
ference which went about splendidly upon wheels noise that I -expected. from any decently-conducted
motor car. It Is-not as nice-looking as irs. Richly's
and spattered mud about during and after rain. motor car. It Isrnot as nice-looking as Mrs. Richly's
"They are motor car people now," said Martha to Doix-cylindge, or even .orMrs. eay' Fhowem's balloon-tre
Mary in tones of awe. The buggy people hea become
completely transformed into higher and more celes- causes the RJchiy acdd the Showems to look down on
a man's family, and that Is the sort of thing that.
tia being no man's family can stand. BSo. :.arew car has to be
But no one can foretell the future. When we say got for love or credit, and aa lve oi a.not go very
that "this is a democratic age," we use words far in the business world the system ,harchase on
the full. force and significance of which we do not the instalment plan has to be evokeli iin tie
understand. Democracy really means that everybody meantime some ready cash is desirable. Indeed, it
wants -to do just what everybody else, of the -best is absolutely necessary. So the old car is anjpouc-
class, is .doing, and does not see why everybody who ed as for sale, and people who once would have been
.liott doing it should not do it. Thas when a labour- considered as condemned irrevocably and forever to
ei'.strfkes and at the same time protests-against the the cab and tramway class come forward with prac-
idle rich, what he means is that he wants to be idle tical offers. Thus cars that were originally purchas-
himself. And of course be wants to be rich, but ed.for three hundred pounds might change hands
simply is not sufficiently Intelligent to become oq. for ffty or so. The popular Buick, the appreciated
When Martha ceases to regard with awe those who Ddge, can. be had second-hand. Fords that origin-
own motor cars, she begins, and that quickly, to feel ally fetched a hundred and twenty pounds have been
that she and Mary should have a car sleo: at this known to pass into new ownership for a bare twenty.
stage she denounces people who have motor cars Mr. Jhnki sbuys one. He has saved with just this end
and wonders loudly "how they do it." The sugges- in vtewt He cannot drive a car himself and never
tion is that they do It on a basis of credit, and the will: it would be:auicide for him to attempt to do so.
hope indubitably is that bankruptcy will shortly But.hls son cin: Robert has learte- .oe, obert
supervene. Twenty or twenty-five years ago Vartha can take. *vcr.to.piaes-:*pa p
and Mary would not have thought it possible to be. tto rwalfei aiA d that I idptlon on
come buggy.fok, but.democrqcy had not then:/a.d~ noaiid4n aftrnn-d of this city
its appearance in Jamaica. It has since then] : t ia i...' i a B1 '!f%.. Bp motor cars, and not
that It Just what the orthodox buggy peopig e:- .t th1 .l..ioid:iatak In.terms of motor cars.
formed- into motor car people, never took'.t -"a aman who uses the tram
sideratioan. This class has never been ableoteej .i *b'motor car." He is golngt
see the fttare, :-":.....:;: .I tt| .abi .'It is a compelling ambition,
In the days of buggies in Jamaica, abot which u '- absorbing one, and no man who sets his
some erudite scholar will one day write an unreada- min 'N"na an object not impossible will fail to at-
ble.bhook, oachmen had to be employed, and no gentle- tain his end.
mAn woul4 have dreamed of being his own coach-
man. E ie eight drive his own trap occasionally; but THUS has the motor car shattered, or bids fair
his coachman iould always be seated at his side. to shatter, the structure of a wel -o-
Then there usually had to be a groom for the cieLy. The outward and visible signa-g al dis-
horItsemai~ies the coachman could be bribed, by "feed- tinction are disappearing. The.ng that
lng" ainuddltilon to wages, to perform the functions twenty years ago was thought: the most
of a.groom. For horses one required stables, and for striking difference between .is now help-
the be y or buggies there had to be coach-houses. ing to obliterate that dier nywhere, stand
Then ithe coachman and the groom slept as a rule on anywhere, and you will ti t g is so. Comes a
the preaiies, and for these there had to be out- splendid seven-seater .l and Its occupants'
hoeiNmie All this required a lot of space, and the ex- loll back in their aI aand goddesses off
PeIBeot:.Ialataining a couple of buggies was not in- ancient religions. tely after a Dodge
eonasldea1if; which partly explains why the richest or a Bulck that ham-ii r days but is still ser
of .Ae:~iaggy people were able at the beginning to viceable. s tmot capacIrtywhl. -
t'iransifN themselves into motor car people. But when is to say .t*t. crowded; it Maiis eiglg
those Bn t of .the richest class determined that, cost persons nat.iL it was built to accommo-\
what it .ig.t, they would have motor cars or per- date; It 'S e0nd-hand, it has been tinker-'
ish in the attempt, it dawned upon some of them ed .is rackety, it is noisy, but it
that tiler wold have to perish did they Insist upon -mos:i "r-st, and those who are in it, en-
havJagcBawffeure, who were the equivalent .of the tolf as much as those in the
orifg5inMeachman and groom. Then it was that tr. They love their car as .. ~i b
the spirit of democracy began to touch them:. Why Mam, who paid a thousand pounds -:
not drivo. their. cars. themselves? And as an old iforai~ y drive it themselves-all a
stable would make a suitable garage, and as t- ut "*1the girls are learning also, can
houses eonce .gien over to the service of coachman :q Pi: -I. it, and they make eacri. obtain
and groom-.ould be hired out to the loweiS. class s" oil and gas to supply t L. Th
and so become a .surce of irregular revenue :.-(tp a- open to them, and the their cuti
lower classes. lwv always a strong dlilncinaatte l- u when they rush the road.
to the paying of. a-at), a motor car might be a .:;f.. pi8gnal you to give them they race you
gained and .astal standards upheld in the very .iS .1ti ejoy leaving you behind perhaps yo(
of adverse ftaancia circumstances. : : astonished and indignant do they.dl.lt?.
: ell, how do we any of us d ng? BITivntinti
TO groom a horse and 'wash a buggy, to'dr.lTv .'' suiciently much to do it, f m te is a wim
vehicle also, was a menial occupation.] there is a way. The motAoevoked more wi4
drive a car required skill and might be rsiar :. power than any other fat aaica. The moto,
a gentlemanly occupation. "Every man ,.b 0*V6i car, which was at fir ive appanage ot
-cha4ffeur" therefore became the unutterea "td.s :of better-off classes, and of social supefiblt
may; .the. boldest led the way; the others j et: has now become th. 'md manifesata#n of
hi'aqZa 'devB men'with chauffeurs often d4i:their triumphing horse is going. T1F
`i ii tan: d delighted in doing so, no aseei tigma donkey wfll-- time everyqas w~a e
rested r4a those who had no chauffeai'and so in mo tor u..ry
.~lbE c ." ..

:


*LI


1925-26


- -----------Y----


AAR'I


'Y


:






PLANTERS'


PUNCH


THE CITADEL

(Continued from Page 1.5)
and reality came with a dull shock as he blinked his
eyes in the sunlight.
Bush ate the bread and coffee that Luke brought
to him on the poop deck, and by the time he had
finished, the lofty mountains of Tortuga were sharp-
.: ly defined against the sky. The men were all on deck
except the watch which had just been relieved and
had gone below. Forward, a guard was sitting on a
bitt near the forecast hatch, a cocked and loaded
pistol across his knees; there was no other indication
that the Hercules was not the peaceful merchantman
that she had seemed until the recent occurrences.
"Mr. Huggett!" he called. The first mate hurried
aft. "Muster the prisoners on deck."
One by one they appeared from the forecastle, a
sullen little group that stared boldly into the faces
of their captors and slouched nonchalantly against
S the bulwark. Bush walked forward and faced them.
"By afternoon," he said, "we shall be off Tor-
tuga. At that time I shall free you and place you in
the longboat with the necessary arms and provisions
for your sustenance. I shall instruct your captain to
proceed immediately to the shore and shall suggest
that you make your way to the harbour on the.,south
side of the island where you can obtain shelter and,
ultimately, passage."
L ATE in the afternoon Bush. Mve tlkh.: aerto the
steersman to bring the .~fit Oile ito the wind.
All day the breeze had steiadtlffheled and at four
o'clock the sudden re9Xti ftl the fore royal Into a
fringe of flying ritbbOatb.'Ieh that be must short-
en sail if he wtiii ,a 'i~ the old and rotten canvas.
Sithe green mountains of Tor-
tug f'li~jt~ i ter and higher above the torn blue
of the wtiit' g rolling range that stretched away
to the eastfard from the lofty rounded peak on the
western end of the island. Not more than a mile
of water now intervened between the brig and the
stibre. It was rough but the seas were not breaking,
and as they were now in the leeward of the land a
boat could make the passage with safety.
"Lower away the long boat, Mr. Huggett," Slow-
ly, the falls were let go through the creaking sheaves
and the stern of,the heavy boat dipped in a wave that
slid beneath beh The next moment she was riding
alongside the brfg, rising and falling on the passing
seas.
From the podp Bush watched the operation and
silently enumerated the various stores that were
piled high in her bow and stern.
"Have you everything necessary in the boat?" he
I' ljired. "Then muster the prisoners!"
One by one they emerged from the forecastle
and stood whistling and talking in a little group at
the hatchway.
Hugget glanced at Bush and saw him nod in
answer. "Over you go, lads!" he shouted.
The line Was let go and fell with a slap across
the bow of the longboat. Riding low in the water,
the boat slid slowly past the poop. .
SIn silence the men on deck saw the loilboat
grow small in the distance until Huggett's order to
man the braces brought them to their stations. Slow-
the sails filled as the Hercules' head fell off be-
.the wind and with her mast again staggering
the crowding sails she resumed her course to
east. her bow pointing defiantly toward Le
Smid-afternoon Bush called Huggett to
S ,nd led him aft to the stern rail where
verse out of hearing of the steersman.
Swas sailing with considerable move-
tmern rose and fell in long upward
t descents that caused them to
by a firm hold on the rail. Be-
wake churned out in a wide
i d 'soapy white water, a long
rail tht os curves tar behind them
Ain the ultraheaving sea. The air was
S strong and its burden of moisture
and ocean ira
SRIEFLY Bush ..his plan to Huggett.
V who listened wltance; but in his
S rugged face and honemt.:Z saw a disapproval
of the proposed venture. ed for a time
S to argue. but he realised:l convictions
w'. ere seldom open to com i j te alternative
of his own retraction quite nit ..lli not occur
ito him. Then for the first time i tinge of
Emotion in his voice.
S "You will instruct the men, Mrii i *to shot
carronades and these small ones"- he l car-
'iage of one of the two brass guns lthe
..as he spoke--"with grape. Havvir'thi
ft "':i E.S a deck and break out the mgai*SL-l
so servttatietlasses to all hands and have-%t*.i i
axes ready to repel boarders. I want this done: te.
ie cross the bar- You will wait for me untflnifi
*morrow. At that time, If I do not return, yOt wit
'*1 immediately ti'Plhiladelphia, where you will tp.
Vt Lt the ship and h'ier.rgo to my uncle, Mr. Gilder"
: smve. In the desk fn ly cabin you will find the
.I.-...- p -. -


necessary papers to authorize your command. Serve
a double grog to all handdi'Tbfd we enter. I shall
rely on you to see that the men conduct themselves
properly."
The first mate regarded the sail over the horizon
and then the now prominent landfall of Le Morne,
but his thoughts were quite evidently not concerned
with either.
"Have you aryttiag you wish to say?" Bush
concluded.
Huggett-hbltted.at Ifls belt, his usual prepara-
tory movement'b t6re-speaking. "Well, sir," he final-
ly muttered, "It's not fur me to say, but I tell ye,
Captain Bush, this is bad business. I've seen good
heads turned afore.by a pretty face. The devils they
be, and theb innocenter they be, the worse they.ibe.
It's yourself I'm thinking of, Captain Bush. There's
gals in every port: fine gals and yours for the choos-
ing. Ye asked me for my say; I've said it." He spat
over the stern with theemphasis of a period to his
words. It was a long speech for Thomas Huggett, the
longest that Bush.had:ever heard him make.
"Mr. Huggett. I tbAnk you for what you've said,"
he finally answered. 'Your words bespeak your loyal-
ty. As for what 1 purpose, that I shall carry out as
I have described to you. You can show your loyalty
by carrying out my orders to the letter."
"That I'll do, captain"
The afternoon was wearing to a glorious close.
High around the horizon the great creamy cumulus
clouds piled one upon another up to the blue vault
above. Beneath them was the sea, a moving, living
surface of deepest blue. And on the right lay the
high shores of Haiti, bright green in the mellow light.
The western clouds were flaming with unbelievable
colour. Sunset was but a short time away.
The sun was low as the Hercules crossed the bar,
its slanting rays striking for a brief minute the red
flag of England that whipped out straight from the
halyards at the peak. In a final conflagration the
sun dipped beyond the horizon. In the east the
smooth white clouds glowed pink in the reflected
light. Then the day ended. Two miles away a few
lights already gleamed like fireflies among the trees
of Le Cap. There was the warm fragrant smell of
land in the air. A mile offshore the Hercules came
about and with topsails aback ran slowly until tts
splash of the anchor told Bush that the nest chapter
In his adventurous career was at hand.
A S SOON as he had assured himself that the brig
was in readiness to sail on a moment's notice
Bush went down to his cabin. On the table Luke
had placed brea a a ad and meat and a bottle of brandy.
He ate quickly and sparingly and washed down the
dry crumbs with a gulp of smarting liquor. He dress-
ed carefully and with a quizzical smile on his lips
surveyed in the small milTor the fit of his coat and
the effect of the black military hat that he had taken
from the Englishman's cabin. From his cheat he
took a fat leather case and opened the cover. A pair
of finely chased dueling pistols lay gleaming against
the leather. Carefully he loaded and primed them
and secured them in his belt beneath the told of the
greatcoat. Next from the locker of the former cap-
tain of the Hercules he provided himself with a slim
dagger that he had noticed there when he had rum-
maged the cabin the day previous.
"Tomorrow morning," he muttered to himself,
"we shall be again at sea--we!" He spoke the word
slowly. Then he added, "If all goes well."
As he came on deck Bush glanced at the sky.
Overhead the stars were shining, but the east was
banked with clouds. The moon would rise late, and
if the clouds remained it would be later still before it
climbed into the clear. The darkness would prove a
friendly aid. A number of the men were loafing
about the deck, and he felt their eyes fixed on him.
Somehow their unabashed gaze gave him an unaccus-
tomed sensation of self-consciousness and embarrass-
ment. A lantern bad been swung near the gangway
and he saw Huggett's face stolid in the light and be-
hind him the black features of the mute, his eyes
white and staring against his ebon face.
"'You have my orders, Mr. Huggett," he said
simply.
"Aye sir." the mate answered.
Bush landed at a small wharf north of the main
landing-stage. a rough unfrequented structure used
chiefly by the native fishermen. Already he could
feel the warm breath of the heated land in his face.
and in the stillness faint indefinable sounds crept out
over the water.
"Luke, you will wait here until It is light. Then,
if I do not come, go back to the ship."
The small waves slapped and chucked among the
piles of the wharf and a fishy smell impregnated the
damp air. Quietly Bush swung himself up to the
top of the wharf. Beneath it already Luke was tying
the small boat. Unconcerned, Bush realized the negro
would sleep there unseen until dawn.
The little wharf was deserted, as was also the
Barrow beach on either side of it. Behind the beach
was an empty field. Beyond was a black row of
-palm trees, and then the road. Cautiously he cross-
ed the strip of open land and gained the trees. They
were lofty coco palms and from behind a huge bul-
blnatiile he peered up and down the white road. It
wa:sempty. No one had seen his solitary landing.


11Mult 111u mn11111111111i11111i111ii1nim timfnm Mi l
==iannniiimnnnin *. -....., :b g.



i Cc O










Motor






Trucks

































= LUBRICATION.

"AN UNPARAL.

L E LED ACHIEVE.

MENT." ......
Fir"Watc tem on the Roesad."








Cleveland






















A M oto lper doars



EACH "ONE SHOT"








CHURCH& BARRY SR
Firestone Tyres

Il-lost Miles per dolar." |




| EACH THE BEST

IN ITS CLASS =





R. W. MORTON,|

J CHURCH & BARRY STRtETS,
KINGSTON. "


Illlllllllllll llllllllllllll111111111 111111111IHlilllllllllllllll


1925-26


_ I_



~...
re






PLANTERS'-PUNCH 925-O-2


Why



a Cigar?


Because millions, the world over, find in a oi cigar
a joy and satisfaction which nothing else can give.

And every day, more and more smokers in every
corner of the globe are joining .the ranks of those
who find that satisfaction in "Golofina" or "La
Tropical" Cigars.

Cultivation. curing, selection, and manufacture of
the leaf by experts make "Golofina" and "La Tro-
pical" cigars all that good cigars should be.

Made in many shapes and sizes and ione of them is
the ideal smoke for you.


If its a "Golofina" or a "La 1 l


it Mut be Good.
";tll :'


rAftmraflt


B.& J. B. MAC
Kilu


... : ....,
Mahalmingii -
:IIADO; tcCO CO.. LTDr
inA. B. W. I.
,-:i "


p- -~ .y-~WeppLE:


o.A


PLANTERS'


PUNCH


1925-26


i
1
..r
a


;
;


'11-I.


"


~f
rs







1925-26


PLANTERS'


PUNCH


Boldly he pushed through the undergrowth and
. Uck out north along the road. He had come ashore
i h of the main part'of the town; the houses here
fewer and more widely separated. Ahead on the
i t a high white wall rose among the palms; the
ruin of a French residence. The entrance to the
grounds edged the road, a lofty arch on massive pil-
SJars. Suddenly his heart began to pound violently
for in the shadow of the arch he saw the dark figure
,aa man. Resolutely he walked on. Through the
tIned gate a light shone dimly; a native hut, doubt-
les, in the grounds of the devastated mansion. From
.-the corner of his eyes as he passed he watched the
-''man in the gateway. There was no movement o'
indication of Interest. Again he felt a distinct re-
lief; his presence on the road at least excited no com-
ment.
I' OR fifteen minutes Bush walked steadily. Then
A ahead he saw the white gateposts at the entrance
Sto the grounds of Monsieur Leroy Mangan. Beyond
the entrance all was darkness. He had not expected
to see a light, for the intervening barrier of the giant
.iLangoes concealed the house from the road, but the
silence and blackness of the place disconcerted him;
and he stepped into the shelter of the trees to deter-
mine his next step. The warm, still air was fragrant
almost to suffocation with the perfume of a guava
tree somewhere near by in the darkness. It was-very
ttill. As far as he could see in either direction the
road was deserted.
He stepped out again, and now walking more
slowly and with conscious caution, turned into the
drive, his shoes crunching noisily on the gravel. The
:" found of his footsteps alarmed him and be almost
i- -precipitately sought the enveloping darkness of the
i. rees. Here there was no betraying sound, his feet
:fell noiseless on the heavy turf.
Out of the night came a sound, so clear and so
t ear that he stopped abruptly. Some one was play-
ing on a pianoforte; sweet and sharp the notes sound-
ed. a fragile overture. Then, plaintive a woman's
voice rose above the tinkling accompaniment of the
Instrument. It was a French love song. Clear and
distinct the words fell on his ears. It was Virginie.
Through the bushes Bush could now see the
house clearly. On the side a light shone out against
the trees. Noiselttiiy he crept around the corner.
..: three wide French d ars opened di the lawn and
V'i throughuh them the lrelui-lrow of mnauyil dles came.
V:,:he whole interttM 6t'l room was- file. Then,
tgalalt the wall oi t ii tight, he saw her, her dark
air coiled about the small'head; her bare shoulders
ry white in the candlelight. She was sitting on a
ir before the pianoforte with her back toward
Uoseen by her he was able to scan the room.
I ^ihis eyes searched it. Each detail vivid-
k l W him; the dark portraits against the gray
walifjtOi maustve escritoire with panels of crotch
SaahogbaS.h. d. leaded glass doors in the high tlik-
S case ab table with claw feet of brass; the
"' ilded chRloi~S te i rses of flowers, and the yellow
tongues of tiJe-a.itdlea behind the screens of glass.
With impetuaus determination he strode to the
tre doorway.- She did not hear him, for hie feet
Sno sound on the grass, and as he stood hesitat-
her fingers ran again along the keys. Fascinated,
ted, but the little run died away in silence.
rginie!"
uely breathed the word but at the sound
rising from her chair with a little start-
.-.ended with a quick intake of her breath
funtd him.
-i;Azsthouh 'to. warn him from ahr, she
SDpalm toward him. He Ignored" her
i" across tire floor, his steps sounding
ed hoards.
e.d r.."I have Come as I prom-
-i, now, this very moment,

,-re't eyes sought his face.
k~l~t d she was so near
.hat ht'i I- eathing and see
Ser br te white bodice of
her dress. :' "I 'l peat-ed.
S"I have ri j(iat Is waiting.
shall take YOi -m--be safe. You
trust me?" He thequeption;
.e could read the :tI el pressure
if her fingers caught 1 mgl daged by
l.he shock of his coming unable to
p the reality of his
"Virginie!" The sua .hi. lips
ought her to herself. With' his
ds and Bush felt his arms smooth
White shoulders; the fragrance.. in
is face; her warm body clung to
Lifted her face. In an intoxeatit
r her; their lips met.
her head sink forward
eden movement she slip
d anM.R him from her. .. .
"Mon M ',ihe breathed. "I love yod! -Itj. -
N4, of whaa'.%m t dreamed: that you would co~d;
eyou wouit ...ime with you; that I might be


trailed I'In a little cry.


r her but she eluded him
.'"A you have come,"
L.gq..-Oh-I"' Her-Tlce


From an adjoining room a footfall sounded. Then
the tapestry across the door was flung back and Le-
roy Mangan stepped into the candlelight.

CHAPTER V

STO WHAT, may I askI"-Monsieur Mangan spoke
1 slowly and 'Wth cold distinctness. n every
word-"do I owe the honour of this visit?"
So unexpected hadl tree Malagan's coming that
he could not fail to read the startled look on Bush's
face as he stared at him. With a superb effort Vir-
ginie turned toward the'intruder, her chin uplifted,
her eyes fearless In their level gaze. Her lips mov-
ed slightly as it she were trying to speak, but the
words did not come.
Then instinctively her eyes turned toward Bush.
There was desperation in her glance, a combination
of resolution and appeal. Imperturbable and almost
casual in his manner, Bush stood beside the great ma-
hoghany table, the'"Angers of one band drumming
lightly on its shining surface. There were even the
wrinkles of a smile about his lips. Only the blue
eyes, half shut, were hard and cold.
"Monsieur Mangan," he s'ald in a pleasant tone,
"denied by you with, I may say, scant courtesy, the
privilege of calling on your ward, I have, I admit,
somewhat informally come without invitation for
that same purpose."
The two men stared fixedly Into each other's eyes
as though trying to win th6 mastery.
'I will even say,"' Bush continued, "that an
affair of the heart should require no explanation. I
would desire, moniaeur, to ask of you the hand of
Mademoiselle Virginie" in marriage.-
A slight colbur for a fleeting moment stained the
white cheeks of Mangap and his eyes Strayed from
those of the capttn to the slender girl.
"You aue awaie, Captain Bush," he said coldly,
"that my ward st.affianced to another?"
"I am." The' mille Withered on the captain's
lips. 1
"And you, sir, a mere American peddler of mer-
chandize, presume to intrigue behind my back and
tamper with the affections of this young girl whom I
consider as I would were she of my own flesh and
blood."
Before the eyes of John Bush the tall white-faced
man across the table appeared suddenly as though
seen through a blur of flashing light. He felt the
blood pounding furiously through his veins. He was
trembling. A mad fury overwhelmed him. With a
quick movement his hand felt for a pistol at his
waist. But as he snatched at the pistol grip the
white arms of Virginia enfolded him and be heard
her entreat from lips half buried in his breast-that
he would spare the life of her guardian.
Not once during the scene had Leroy Mangan
evidenced the various emotions that must have poss-
essed hin; not even when Captain Bush sought the
pistol and Mangan read the desire to kill in the tense
blue eyes, did the pale'ftce change its cynical ex-
piession; nor did the fingers of the lean hand betray
him by "an Involuntary movement. Rather, like a
distinguished and slightly supercilious spectator he
regarded the drama that was acted before hinL
"Come," he said finally. "These heroics, al-
though excellent examples of the emotionalism of
youth;' can accomplish nothing." He walked slowly
around the table toward them and instinctively John
Bush tightened his arm around the white shoulders of
the girl. Mangan touched her lightly on the arm.
'"This.cannot be, Virginie. It is late. It would be
best perhaps for you to retire to your room. Hard
words have passed. Perhaps Captain Bush will join
me in a glass of wine. Alone, we can discuss this
weighty matter to some purpose."
Reluctantly the girl allowed Bush's arm to re-
lease her, and with her face half hidden in her hands
she turned toward the door. Then, unexpectedly, she
lifted her head sharply and regarded with passionate
scorn the cold features of Leroy Mangan.
"A ONSIEUR MANGAN, I hate you!" Her voice
Swas high-pitched but calm. "In spite of all
that you hare done for me, I despise you! It is pos-
sible that you may separate us"-she gave Bush a
fleeting glance-'but I shall seek death rather than
become the bride of Pierre Nicholas!"
With her head high she walked across the floor.
Bush saw her arm very white against the tapestry as
she drew it aside; then the hanging fell back into
place. She was gone.
"And now," said Mangan, "will you be seated,
monpieur? Perhaps calmly we can discuss this mat-
ter hat so deeply concerns you. Cold reason is an
Excellent antidote for passion and there has been to-
night a preponderance of the latter." He waved his
hand toward a low deep chair beside tie table and
drew another chair up to face it. "But before we
begin to talk, if you will excuse me, I will get a bottle
of Bordeaux wine from a shipment that has been re-
cently sent to me." He moved toward a door in the
and-of the room as he spoke. "It is late," he added;
"tma servants retire early. I will get the bottle and
glasies myself."
Bush did not reply. T_ is unexpected turn in
Mangan's attitude confounded him. In the suave hos-
igtt tof the man he sensed an unpleasant reaction


which he could not analyze. He distrusted him now
mote"'t1orodtigly than ever; the man's strange
smoothness repelled him. Not less had Virginie'a
display of spirit taken him aback. in her hot flare
of anger and In the-b'urning indignation in her eyes
he had caught a glimpse of a strong and passionate
nature which, like his own, would dare all danger in
the great emergency. From- the next room came the
clink of glasses and tirnugh the open door he could
see the high white room '$t the far side Mangan
wai-bending over the sldebhard, a huge mahoghany
piece on the top of which Bash's eye caught the glint
of glass and silver.
Virgiine returned to his thoughts and he wonder-
ed how he could reach her if a chance to .escape
should come. His hand wandered beneath the coat
and fastened on the hilt of the slim knife.-That was
one way. A quick stab; there need be no sound, and
then to the boat and away before the murder was
discovered. The thought shocked him. Extreme as
was the situation, there was no justification for that.
Perhaps he could antagonize- Mangan to a point
where he would attack him; then the.homiride would
be justifiable in the light of self-defense. Again he
recoiled at the thought. After all, that, too, would
be murder. There was also a flaw in the plan. Man-
gan was difficult to. antagonize;--it-was he, Bush.










Jamaica Fruit

AND



Shipping Co.,

LII'TED.

GRACE BUILD, DING,

64 Harbour Street,

KINGSTON.


Exporters of


Bananas, Cocoanuts,

Citrus and other

Tropical Fruits.




Representing
Mesrs. DIGIORGIO FRIT CORPORATION,
laW YORK.

Messrs. CANADIAN GOVERNMENT
MERCHANT MARINE, Ltd., MONTREAL,
CANADA.

Messrs. ORR FRUIT & STEAMSHIP CO. lie.,
NEW ORIAM.


A Weekly Steamship Service is main-
tained between Kingston and New York,
a Three-Weekly Freight and Passenger
Service between Kingston, Belize, Nassau,
Bermuda, Halifax, and Montreal. and a
Ten-Day Service with Bluetilds, Nic., and
New Orleans.
Cargo accepted on through Bills of lad-
ing to interior points in Canada and for
transhipment to London. Antwerp, Car-
diff and Swansea as well as Australia,
New Zealand and the British West India
Islands. Through Tickets issued to prin-
cipal ports in United Kingdom and the
Continent.
For particulars as to rates, arrivals and
sailings of steamers, please communicate
with the management.







2. PLANTERS'


PUNCH


'who doubtless would flare first. That had been the glass by its stem between his strong, thin fingers. added: "It is indeed unfortunate that there sabuld be
case before. Bush rose from the chair and glanced down at the such disagreement between you. First I, unhappily,
Across the room a marble clock struck twelve tray with his hand extended. Against the silver the am the cause of your quarrel, and now a glass ot
with sweet lingering strokes. What could keep Man- yellow wine and sparkling crystal made a bright wine. Bieni Give it to me; perhaps both causes of
gan so L6ng? He had apparently left the dining-room flash of colour. Then beside the base of the glass his disagreement can be removed by so simple an act. I
for John could no longer see him nor hear him fuss- quick eye detected a tiny fleck of powder; yellow, it shall drink it gladly."
ing with the glaeseas.. e.e amined the room in which was,.. eleas bit of pollen fallen from a flower. Hiest
he sat with rQflit"g.ys. ,.The door at the other end aye cugf.'ti but -there was no regcl~bnoinifhi troub- wANeAN held 'the glass from her hand. His, lips
led to the .di "ii4- On bis right, was .the en- led brain. H~?td the glass. ..... ...... were twitching had there was an ugly- iet in
ledto t thei oicee 0 hee doosright.eway-to th clsedes .oie
trance to thoetpgdii and opposite. it bung.thii A* lt !s": .r meet t-lXXq'f:Mnap n, his the'hal"'rf-oed eye. "You ihall not drink it," heer Wl.
As he regarded the green and brown weave, it seepn- .w erd the mantled door. Slowly thep taestrfparted your God that I have spArd-d your life."
ed to filter slightly as though shaken by the bree.e. a7Ltn the.opening he saw Virginle. TIheir eyes met. "Easy. easy. monsieur. An hour ago your order
Imtincttvely he leaned forward that he might-glance As he looked, she raised her hand to her lips as wouldd have perhaps been justified. Now however, I
along the floor, to see, if possible beneatbftt? ifla. though to drink, then shook her head and seemed to refuse, until this little matter is settled."
By a few inches the hanging cleared it~AOr and dash from her hand an imaginary glass to the floor. Mangan laid the glass on the table and took a
in that scant aperture he saw in the fait i lef1ght Itt was over. in a flash, and as hle look6l Btit step toward Bush; but the latter.agalh leaned against
a woman's loot shod in a white stal:tieti The saw again the fleck of yellow powder "on the tray., the-chair-back, the irritating smile still bending the
foot was withdrawn noiselessly.t.. .It r inte's. Here was the answer to this studied hospltality; to corner of his mouth. What.Leroy Mangan Pw roed
Why was Virgine hidingbhehjiit*eur*itin The Mangan's long absence from the roni. can neverr be known. Bat at that.moment -he hi.hrd
answer was obvious. Was--ot diaeasblaih. as-he ab- "'Monsieui Mangan," he said with spontaneous a movement behind him. Like a startled cat he flung
sorbed in the-mygqtry .,,lBagtB'fluidden.aeLabllity? gaety that came with the realization of danger so i41seIf toward the table. Across it stood Virginle
To her even more. thbanttlaBUah .th outcome of this narrowly averted, "may I not exchange glasses with' and int Jifr uplifted hand the glass sparkled in the
awaited converzatonwa:we oafr:'tal import. His first you? I beg that you will grant so small a concession it ht..
inclination wa:.tota teal quietly :to the door and. warn to my curious desire to drink from your glass rather "flS.A".AS.odd mile, sneering and malevolent,
her to eaution,rtit that would probably only disclose than from my-own?" ared his:.tiee; "S6" Mangan continued. "You defy
her presence for he .now heard. Mangan crossing the The speech was blunt and there was no oppor- me. Drtlk,miaadempiselle, be it for love or for death;
dining-room. tinlty for Mangan to escape the significance oft fsh's I shall not; tat-ain you."
With .a :.mile the other man-laid the silver tray words. Slowly, h. r eyes n' the faces of the two men who
on the'tible. There were two glasses on it, fine thin ."Captain Bush, I hesitate to remind you that"you stood shoulder to ilh-lder across the table, Virginie
glase with fluted stems banded with dull gaold. Be- forger yourself. In your words there is an'implies- raised the glass. In JBlus's brain there was a seeth-
side them a bottle of yellow wine reflected the light tjon that. I hold as an ins-t to my hospitality, an ing that for the BeeondJltt him powerless. Would Vir-
like molten sunshine and threw dancing gleami of implication that I can scarcely allow to pass unno- ginie in desperation d nkl the,oisoned wine? Was
amber on the bright.surface of the tray, Both glasses ticed. .rink, sir, and let the act excuse your'word." it. after all, poisoaed- 'The- he saw the smooth,
were filled. k i raised the wine to his lips, lBat Bush set his round arm, the glae, m;ad abole it1-th great dark
"I am glad." Mapgan said, "that you willreasona own. gls is rmly on'the' table. eyes- with the tragic .appeal that he MIt. onee blefre
ably discuss with me tle problem wlth your pre- "Monsieur Marigan, I believe that glas of wi'U fathomed in their depths. With a cr warningg
sence aqd yoduri,.praonality hive.'c~re d'." i .is cold to be. poisoned. I accuse yo of the attempt to-kill he dashed around the rtabe;- hi outB Adl..hhands
eyes rested-on Bush-as he talked. aht.althouigh bit. me, .I,dare, you to drink the wWif-that you have clutched here. With a tinkling crsh th e f.~ .hiv-
lips mTved his features. were ,immobile asr though poured for me." ered on the table top.
cast l i.ljaster. Only thb-lean'light,. hand gave move' "Yeou.ti'mpudence, Captain Bush; demands more In his arms Bosh felt her body tense and cold.
ment;' the -Jong fingers carelessly toying ,Wth the than an apology." For the first time the colour flush-. Her head wai thrown back against his shoulder,- He
fluted ratffle 6f his stock. "Pierre Nicholas .is my ed Mangan's cheeks; his eyes cipsed .r narrow asts looked down into her face; the lips were parted, and
friend,"'he'-cntinued. "'Whlchk ir'e~ptlie forbid in you o: gray, while his hand nervously Anmer d the ruffled fia a whisper that sounded loud in the still room be
a rem'k. which-could n't-tfall tooffend me.- ]ut, ah;' neck-iece. "Drritk, damn ydu!',;e.snarled. h tid.her speaking.
monsieur, pemrit me to aticipati what you "would I the amse' measure that Ma4gan'i ormer.b -
say: that in ;my- friend ~Nichoeliathere-iatouch of nees -4hi'a talized Btsh into a dityia of pataSo,-..w .. tsue," she said wearily. From the door
colour which offeds'y6bi -cold, northernn code. I: nowl the 'bar0S ow of the .elae lan's control -' It e powder in the glass. Then he
true. Yes, but is it not poeslble that we mar 44fr- tabliahed sh the m ore securely, is easy defla i nce bro.i i tor. I warned you."
ently regard -thkse .thinj.hdri In.this far country~' anpd: ritating good :humourr*. Mm e wt.fumbhling with one hand beneath the
"Perhipt"' he iiaid wlt&la ptAant smile, "you tabe" H palledouft the drawer and his finers
NO~TWITMHSND ttBts ia- would pierpit MadesmotselleVirgilf to sioap from the qught Bsr o P !iag among the loose papers that
1M gah: i b "e ptle .his Tac the: i h t t ?" file d it.. '
younger mareatzed-p:tl thee-. fwas something "gi'rginl'e l' ot.here." Mogi#eur Mangan waa. "iK" sheik gave a frightened cry and tore her-
which he could'not fathem-b%* this smooth speech mainly t irte" t elf m. Pah .ara. "The pistol, there!"
and manner. There was. a. rustle bebhiid .e tapestry; the W1 ..nx too 0.-o .
"Monsieur Mangan," he said at last, "I amdrqnk- heavy hanging was brushed aside and from the dark- r.g e sta uain w
ly puzzled by this sudden gracotiosness. .Can .it be p smof-the.hall. yirginie. stepped Into the candle- ..WS -w whlpe M nW.. I the
that you will discuss coolly with me that quehtio'* light. She was very pale, but her.small chin WeVp he ,' s l. iaal n's hand
which is uppermost in-my mind? Will.you faith uplifted.and her large eyes surveyed the room witUiL' ."l ''* ad Sound it. '
consider the qualificatlois wthch I can -offer ap an exprjllF ,o;initdle. dfii pr a mao violently ag
compare them with those of this Niclolas, whose gaze rested on Mangan afd -iFW lips part"ed FIt t ." ,i t *g with the right
pretensions to the hand of your ward cannot be though she had intended to speak; but there was iAt ~ "J Ia ganb a1, Ba.so lt te adversary's throat
thinkable to a gentleman, the guardian of a defence- sound. Then she walked to the table. w tth ,l -Wht.. i* slet hand had slipped down un-
tl 16-us, oe,1awnmw-pito-1unc^ ti-te t resed'


leas woman?"'
Mangan, who was still standing, pointed to the
tray. "Perhaps, Captain Bush, you will honour me
by drinking a glass of a wine, of which, I am proud
to say, there is none better to be had." He lifted a


"How long have you been there?" Mangan de-
manded, confusion and anger in his voice.
She gave him a scornful look, and then, with
her eyes turned from him: "Ever since you requested
me to retire to my room." After a slight paused she


*******************************************************0*0**0o o*o o*o*oo o"



(BON TON I0





af. I









XIe. Irene Wheatle has opened at the above address an upto-date establihment;Z
Mak Millinery lei Hemtithing, and Covering and Mil Buttons donery






It is Fshionableorth your while to Dresit
"
,r *



fo -8c EA elg ROBES, LN E, AD D GS ATERIAL. A A.


**
JThe Tea Room attached to this Establishment is bright, cool and commodious. 1 !


for Sellig R BES, TL ND DS: S
Dr- an gMASTi'liREET, :g : KINGTaoN, JAtonAICA.


I*


tlI uhe, t no, held the pistol. unce tie felt it pressell*:
against his side but he thrust it from him. Loc r .
in their struggle, they reeled against a chair VH1110
crashed beneath them. Lithe as an animal, Mengan
writhed and twisted. In Bush was the streqngthaf
.vouth, but in the lean body of his adverse e b
a power, the existence of which he had muri4Ur'
ed; a sinuous, baffling power that e i their 5
strength. I
Once Bush wrenched his hi&* ';%j: almost
within his touch was the cordeAil 'i::throat. His
fingers tore at it but Mang: tactk bie hand.
In his face he felt the hot' Mangan. The
sweat poured from his a : rending sound
his coat ripped from his r
Back and forth ia. i':t -c:'room they struggle.
Mangan was now halan t0 the waist; te his -l
white body glisteua4tiB. i soft light. Backward
he reeled ag6aipt fl s His strength was yield-
Ing. Youth, t ,at uerable ally, stood at the .
shoulder o'mat t man. Slowly the long body
bent tow a i-X in the face of Bush seemed
as the tacei Stenaging angel.
There f lrainendous roar, and a flame leape -
from the 10lld tands beneath the table rim. -i
tmnok. u if stMe-ar. Mangan had fired, but sitflthe
supplee pressed down on his now fl. Gin g
striigi, i lWfith a twist Bush tore loose h 'right
.hadi&E'hja the other's grasp: the finge9l'seed a"
l al:iit ell and raised it above the white, drawn
fiaeeAt. wam now gazing up at him frot the dark
.g8i SmiBg mahogany. And then straight between the
seMdown crashed the massive metal block. With a
quiver Mangan's muscles relaxed,' j htt-.
udeles.e Swaying unsteadily, Bi h. :oup
right. Mangan's face was brtghtf'blood'
without a sound his limp body. n the table
to the floor. .... I :'';:." *
"Virginle!" -' i'
S She stood beside In *"aMed not try to t
you." She dropped to her bshide the body whicb
lay in the table's sr*d'i'le Is not dead?" she
cried. Her flngfrtfl Jheartbeat otqthbaafe hot
breast.. "Ni-h t i a-
(Oitii aon Page SO)


1925-26







PLANTERS'


PUNCH


"THE FIREFLIES"


[] f] @JAMAICA'S MOST CLEVERt AMATEUR DRAMATIC TROUP [] ] I


i~l I


' i


MRS. LMllNMY DOWNER, MR. L. ASKENBEKI, MISS JOYCE DAVIS. MR. CLINTON HART, MR. NASH, MBS. BINNET, MRS. CHARLIE BRANDON. MR. CHARLIE
ISAACS, MRS. THOMSON EVANS, MR. REOGIE TITMAS, MISS SW. MAIS, MR. BINNEY. MRS. ISAACS, MR. H. LYNCH. MISS LOIS ROBrINON, MR. A. E.
NORCHOSS, MISS O'WEN BIRKE. MB. FOSTER, MRS. SILVERA. MR. R. H. LONG. MISS HONIBALL, LT. 8INKE. MIRS. LAMBERT.
The above is a picture of a scene from one of the performance of the Fireflies, the well-known Jamaica companyy of amateurs who have done so mnch to
Stes the colony's life. Founded by Mr. Lindsay Downer some years ago, the Fireflies have developed much artistic ability and their entertainments
greatly looked forward to by thousands of persons. Singing and dancing form the major part of th exhibitions of the Fireflies. interspersed with
tme-act farces and comedies. It is hoped that liter on they will undertake to produce on the Kings.on stage more ambitious programmes, their previous
achievements having been of such an order of excellence as to lead their admirers to believe that they can win greater successes if they choose.


llmaa a jobhility

.t0sed from Page 11)
on the title of Sir Nicholas. but
S of t. He told them bitterly
er succeed because of their
envy l., who were distinguished
among tli l(ted to know why he
would .distinguished than
they. Thua't ithirj the poor High Con-
usplcuous Potesa to wish that Mr.
SGarvey had not l..o" r such high and
remarkable honousMi %i
One night Mortimaed with his wife
"'8 the future. '
"Mat," said he deje04Mi6Ji l)m.'t know what
do. Those boys down a*t ?lt i.LJutaka me life
burden to me, till I feel likeikeiit e job. But
it is a good job. an' I don't know:vib i :::'Vsuld go if
give it up. I am just sick an' tInt:W.'te title.,an'
w would like to drop it. What you :f ~t atr
.j "I say you would be a coward if y tS it t'ing
i a*rt," replied Matilda firmly. ".b:B tifpoa
.4to show perseverance an' you wll '*1i- d.
gain, Morty. If you give up now,' :yo
SCir Mortimer again, an' then you nll
l^ ^^f't you think Mr. Garvey had his
he become President?"
-jL he is really President of any-
S Idejectedly, at last showing a

F* ".'he is," assewfbertd Matilda. "He is getting
up a i Y.4y, anLaB aboli as he have enough he
will ngo k to Atreia, aCte, i.ty ou still 'ave .yu'
'tie. lt-'mn'g make you suOm fing there. But if


you show you'self a coward in Jamaica you will 'ave
to stay here till you dead, for a coward man can't do
well in Africa."
"I 'ave no wish to go to Africa." replied Mortimer
truthfully. "Here is good enough for me. But if
things don't change at the hotel, I going' to drop the
title, for it not doing me any good that I can see."
And in this he was prophetic.
He did not know, as he spoke, that that very
evening there had registered at the hotel a Sir Mor-
timer and Lady Cranbourne, just arrived on the last
boat from England, and come to stay a few weeks
in the island. Even had he known it, he probably
would still have insisted, the following day,-t6this
colleagues at the hotel, that his proper designation
was Sir Mortimer. However that may be, it happen-
ed that when he was moving about the hotel's dining
room a couple of days later, he heard, at last, and
for the first time in those precincts, the magic words
"Sir Mortimer" pronounced, and believed that it was
a brother-waiter thus addressing him.
Some things go to the head like wine. Who does
not thrill with pride to know that, at last, success
has attended one's strenuous efforts and that the
world is to be at one's feet? Swiftly, without even
waiting to hear who spoke, Mortimer loudly answer-
ed "yes!" His surprise caused him to speak far more
audibly than be would ordinarily have done, hence
his reply reached the ears of those for whom it was
nev6r Intended. Then he did also what he would
never have done under ordinary conditions: he turn-
ed abruptly to see who it was that had thus properly
addressed him, and, turning, bumped Into another
waiter hurrying forward with a tray filled to its ut-
most capacity with dishes.
Mortimer. too, had been hearing a similar tray.
'"eiWpcounter wai a shock. B6th men slipped, both


trays were'hurled with a hideous clang and clatter to
the floor of the dining room, and'cne dish with some
gravy stuff, flying off at a'tangent, emptied its con-
tents full in the face of the authentic Sir Mortimer.
Such a catastrophe could not but create contusion
even in the best regulated dining room. All the
guests-and the room was full-turned round to
stare; all the chief-overseeing waiters hurrledlup to
the scene of the disaster; the manager himelne who
was in the room when the accident fiapeined, being
that no less a person than Sir Mortlj~.Fi'4nlIburne,
a b aoael-of great wealth, was engaged in the un-
usual occupation of removing gravy.out of his eyes,
sped to the baronet.'stable with solicitide and con-
sternation expressed in every feature of his face.
Words failed him, indeed;'he could find nothing to
sa1 about such a calamity.
But'SfrFMdrtienr Cranbourne was vocal enough.
He had' heard his name distinctly mentioned.
He had distinctly heard a waiter answer to the name.
But why thenan should have fancied himself spoken
to as Sir Mortimer. and should have turned in the
direction of the sound with such imbecile abruptness,
Sir Mortimer Cranbourne could not understand, ex-
cept on one hypothesis. The waiter was drunk.
He Explained to the manager. "Someone called
me, and that ass of a waiter answered. Is his name
Sir Mortimer?" And then another waiter standing
by, frightened perhaps, and without evil intent, re-
plied hastily, "yes, sir."
"Go out the room and don't make a fool of your-
self," commanded the manager; and then he himself
assisted the ill-used baronet to leave the table.
Usually, an accident, even so serious an accident,
would have been dealt with by the headwaiter. But
on this occasion a great man had been almost in-


1 925-26


___








PLANTERS' PUNCH 1925-26


Jured, and the employee responsible for the misfor-
tune had been alleged to be Sir Mortimer. Clearly,
therefore, this was a case for investigation by the
highest authority in the hotel. The investigation
took place that same afternoon, when there were pre-
sent:
(1) The Manager,
(2) The Headwaiter,
(3) Mortimer, Knight of the African Republic,
(4) The man into whom he had bounced,
(5) The man who had volunteered information
as to his name.
It was a court with one man as judge and jury.
Defendant was not allowed to be represented by
counsel.
The manager eyed Sir Mortimer of the Republic
calmly and asked:
"What was the meaning of your peculiar conduct
to-day?"
"The meaning, sir?"
"Yes, the meaning. My question is plain enough,
isn't it?"
"It didn't have no meaning, sir," stammered the
knight, who had been vainly racking his brain for
some adequate excuse or explanation to offer to the
justly incensed head and chief of the institution;
indeed, poor Mortimer felt that if he had never be-
held a Potentate he was now in the presence of one.
"I understand that you answered to the name of
Sir Mortimer when you heard it in the dining room,"
said the manager; "is that true?"
Mortimer would have denied it had he dared.
But he was surrounded by a cloud of witnesses.
There were too many men in the hotel who had
heard him insist upon being Sir Mortimer for him
to declare vehemently that the idea of being Sir
Mortimer had never once entered his mind. He saw
himself reduced to the miserable expedient of telling
the truth, which is the last thing that a defendant or
one of his witnesses ever dreams of wanting to do.
"Well, sir," he admitted; "I did; but it was with
qualifications."
"What qualifications?"
l Mortimer remained silent. He saw the hopeless-
ness of attempting to explain the situation to a gentle-
man who might not even understand his claims to
knighthood, and who would certainly have no sym-
pathy with the Garveyan Nobility. The manager turn-
ed to the headwaiter. "What do you know about
this?" he asked.
The headwaiter had a sense of humour. He had
just been enquiring into the strange and peculiar
conduct of Mortimer and had elicited full and damag-


ing information. Of course, he had heard something
about the knighthood business before, but had regard-
ed it as merely a joke. Now he knew that Mortimer
had taken it seriously. Questioned thus directly by
the manager, he told with brief dryness, though with
a smile in his eyes, the story that he had heard,
while the manager listened in a sort of stupefaction
which merged into anger as the tale went on.
"My good man," he demanded, looking full at
Mortimer, "is this true?"
"Well, sir, it is like this," stuttered the miser-
able Mortimer. "As Mr. Garvey make me a knight,
I just mentioned it so to speak to a few fellows here
and elsewhere, and being as I was busy to-day an'
became confused in me thoughts, the moment I hear
me name called I turn sort of quick-like, and this
other man bounce into me. But if I had thought for
the moment-"
"Are you sure you are quite sane?" interrupted
the manager sharply.
"No, sir."
"You don't think you are, do you?"
"No, sir."
"You have been sending money to America to
support this propaganda, perhaps?"
"Yes, sir."
"Then it is clear you are not sane."
"Yes, sir."
"Well, it is quite impossible for us to have in
this hotel a man who calls himself a knight, who
throws down trays and injures guests, and who ad-
mits that he is not sane. I am sorry for you, Slim-
slam, but it is out of the question that you can re-
main here. Everybody will doubtless hear that
you are a knight. and this is a hotel, not a comedian's
hall."
He made a slight gesture of dismissal, and Mor-
timer knew that his minutes in that hostelry were
numbered. At the back of his head he was aware that
he had been given a hearing which he might not.have
had and could not have demanded, but that brought
to him no solace. He was dismissed. For claiming
his titular rights he had lost a good situation- that
was how he put it to himself, for at the moment
he had forgotten the damage to Sir Mortimer Cran-
bourne's eyes and the sensation in the dining room.
He could find no words to utter, no argument to urge
on his own behalf; he knew that in another few hours
it would be known that he, a knight, had been sent
about his business for answering to a form of address
which he could claim, if not by right divine,.at least
by Garveyan creation. Without another word he


turned and went, uith the dazed feeling that some-
how justice was being defeated in this world.
The news flew rapidly among those who had ob-
jected to his knighthood. But now there was no
longer any ill feeling felt or expressed towards him.
All his colleagues were sympathetic; two even spoke
to him as "Sir Mort," giving him, for the first time
in their lives, the title which, but a few hours be-
fore, would have sounded so sweetly in his ears. But
he gave no indication that he noticed it; he merely
bade them farewell, and turned his feet in the direc-
tion of his home. His wonder now was how the Lady
Mat would take his downfall. He was inclined to
attribute it largely to her indirect influence.
"There is no justice in the world for us!" ex-
claimed Matilda when he told her his sorrowful
story, "My God! you didn't do anything at all, an'
them send you away like that. If I was you I
would write to Mr. Garvey about it!"
"What good is that goin' to do?" Mortimer want-
ed to know.
"Well. I would write all the same, so far. And
Perhaps you could take out a warrant for unlawful
dismission."
"That wouldn't help me, for I am lawfully dis-
missed," confessed Mortimer. "Them could always
get rid of me, but it Is unjust all the same."
"Then what you going to do?"
"Get another job, if I can; if I can't I will 'ave
to go away, and that is all."
"An' in the meantime that fool at the Railway is
a High Postulate and all that sort of foolishness,"
commented Matilda bitterly. "My God, this is not a
just world!"
But even as she spoke thus the High Conspicuous
was having his own troubles. It was not safe to be
too conspicuous in a Jamaica Government Depart-
ment.

CHAPTER FOUR

MR. DO'OGL.ARR MOVES
T HERE had for some time been rumours of ap-
proaching strife at the Jamaica Government
Railway. All over the civilized world men
were striking for higher wages, and the em-
ployees at the Railway perceived no good reason why
they should not do the same. As a matter of fact,
their mere threats to strike, on previous occasions,
had brought the authorities down to business; their
demands had been granted: but, as the appetite grows
with eating, so did the desires of the workers in-
crease with the prospect of success. They were now


11-111 11111 1 1 1 I I l li i i I I 1111111111111111111111111111111111111IIlIIIl' I I lii' 1I




PROTECTION AND INVESTMENT:




WITH MAXIMUM BENEFITS AT MINIMUM COST

HAS ALWAYS BEEN THE AIM OF


Jamaica Mutual Life Assurance Socie


PROMPT PAYMENT OF CLAIMS:

Iecognising that a death claim paid quickly
is of the greatest assistance to a family at a
time when money is most, needed the Society has
established an unequalled lengthened record for
this important benefit'to its policyholders.


For Rates


SPENCER T

TRj


Etc., Apply to:-


HOMSON, W. D. SOUTAR, ,

AVELLING AGENT. ...ASST. TRAVELLING

ERNEST B. NETHERSOLE .:


ERNEST B. NETHERSOLE, S.... w

'"... ....... :: : :. .


* v~e~.in. II~h~I~h~liIIU~flIa


The


BONUS:
Operating on Mutual Principles there are no
Shareholder Profits to be first, taken out of the
Bonus to the Polcicholler with the result that
ihe Policyholder receives as liberal -a Bonus as
is possible.

1927 is the next Triennial Bonus Award.


1=


=1


1925-26


PLANTERS'


PUNCH







PLANTERS'


PUNCH


ring another strike, and as a prelude to It
displaying an unwilling and somewhat surly at-
Naturally, news of what was pending soon
:the ears of the Railway's Director, who al-
sfit when the situation was explained to

man of choleric temper. He believed in
and reflection afterwards, such reiee-
if he did indulge in it, the form of com-
justification of his acts. This threaten-
he determined, should not occur, not if he
ipeharge every man at the Railway and stop
g of every train. He himself would do the
first and thus prove that he was not to be
with. In the meantime he demanded from
ing subordinates the names of those they
likely to be at the head of the trouble, and,
y, Nicholas Brimstone was mentioned.
that Nicholas was in any way responsible for
station going on. As a matter of fact, he had
whatever to do with it. He was just then
alar, add so had not been consulted; but var-
Bips and talebearers knew that he was one
Garveyan nobles, and they had suggested to
higher up in the Railway hierarchy that a
ul intimately connected with Mr. Marcus Gar-
liust of necessity be at the root of any annoy-
or disorder, past, present or to come. This
ed plausible, reasonable, and therefore when
Said before the Director that there was in the
ment of the Jamaica Railway a man wbo was
*n less than a High Conspicuous Potentate of
*rfcan Republic, the Director forthwith decided
.that man should seek a livelihood in Africa, or
*ibre if he liked, but certainly should not con-
ae to obtain it at the Railway.
..'I," said the Director, in an explosive burst of
"am going to be the only Potentate here, and
in tell that d-d mischievous fool so. Give him
keeke' notice! And watch what he does, for I
retain that he is the ringleader of all this non-
you have been telling me about."
i'te notice was handed to Nicholas in due form
with something of ceremony. It was to begin
Ithe first day of the succeeding week, but it
1siBded to him on the very day that the Director
lld his fate. This was intended as a solemn
to all other malcontents; it was announced
tee would be given to every man who wanted
or who had it in his mind to strike. It was
that the Director was anxious, eager, to
more discontented persons to whom, with-
aioment's delay, he could hand a notice of dis-

I*energetic and even savage way of attacking
waftitng to be attacked had its effect: no In-
rer but suddenly found that he for one
dany intention of following the evil
uble-makers. A scapegoat had been
bear the sins of the Railway people.
:n Jplcuous Potentate, anyhow, and ex-
noted self-sacrifice for the good of
t -quite another view of the mat-
ly, that if any man could plead
hage of striving to dislocate the
irking of da government institution, it was he. But
that counted would have believed such a plea?
r there was nothing to do but to submit to the
lcee passed uron him, which sentence had been
Stwo days after that which saw Sir Mortimer
0-&to a jobless condition, through being a


R ett Street that evening, and in the
t residential thoroughfare, there was
The decline and fall of Bllmalam
di dcuaped at length in. inany
i'nmed some more, and the mis-
tu.onaages formed the text for
siureh as that pride goeth be-
hty spirit before a fall,
Satch bulldog, monkey's
Mr. Proudleigh who gave
nations. There were
-in-law's house that
Proundleigh that now
thder an obligation

'I nsev lord and duke
e," e ow could a
likthem is lord or gHere am I,
ie be dead, even ho to-day
it much better .... Norry tell
*r is a knight Nick wans of
' now that Mnobility, an' now thas
k hat ckn's the useof are
them is h lord r daughter, Mr .d
yen don't 'ave quatitea






"at any rate the titl 4iENs (.
n to-day, and that is

ed Mr. Proudleigh, "It



Y


depen's. Marriage good for some people, but it don't
good for all. It I was Morty I would never married
Matilda, for I can see them will soon divert. Now
dat Morty lose him job, and even a dawg would-
n't call Matilda "me lady,' Matty will soon get disgust
an' leave 'er husband, which is what I bin expecting'
all de time."
"Yet, old massa," said his son-in-law good-hu-
mouredly, "you was the first to call them 'me lady
this,' and 'me duchess that.' And only last night I
hear you address Morty as 'me noble prince.' "
"That is true," agreed Mr. Proudleigh, in no way
disturbed. "If y'i find that foolishness please a man,
give him foolishness. It don't do you no harm, an' as
Morty offer me a drink of anisou las' night, which
I did really need, an' you wasn't gwine to give me,
him was really a noble prince. But he not goln' to
be a noble prince no more. for he won't have a penny
for bread, let alone a warming' drink."
"And will not that be a disgrace?" passionately
demanded a voice.
The speaker was Mr. Douglass, the turbulent, the
man who had originally hailed the bestowal of Gar-
veyan titles in Jamaica as marking a new era. He
had since become acquainted with the Brimstones,
but had not yet been able to get on friendly terms
with the SIImslams. He had made up his mind to
do so, however, for he had formed a very high opinion
of Matilda.
"Isn't it a disgrace," he continued, "that a man
who hath been singled out for high distinction by
the head of the African Republic should now be re-
duced to penury and want merely because he answers
to his indubitable title? Do you think any other peo-
ple but we would stand that? We see oppression and
we cringe under it; would the Haytian do that, or
the Cuban?"
"But what would them do?" queried another of
the guests. "What can y'u do when an advantage is
taken of you?"
"Oh," cried Mr. Douglass, "you admit that an ad-
vantage is taken of Mortimer and Nicholas, do you?"
"It seem so, upon a second thought," agreed Mr.
Proudleigh, who always believed that nothing could
be lost by being upon what seemed to be the popu-
lar side. "Now that I teck another thought, I see dat
a distinct advantage has been took of Mortimer, an'
no doubt it is de same wid Lord Brimstone."
"But what can anybody do?" persisted the man
who had first answered Mr. Douglass, "what would
them do in Cuba?"
Douglass glanced round the room carefully, and
read hostility in the eyes of Mrs. Jones, Mr. Proud-
lelgh's fiery daughter. He knew from experience
that what she thought her husband was likely to
think also; while her father simply did not count.
He concluded that it would not be safe to say then
just what he had in his mind. They might not be
exactly inimical to him, but they might not be friend-
ly to his ideas. He rose.
"What I think we ought to do," he said, "is to
bring about a reconcilement between Slimslam and
Brimstone, which quarrel because their wives couldn't
get on together. But nowr that they are both in the
same boat, they will 'ave to be friends. Let us go an'
play the part of peacemakers, for it is written that
we shall be called the children of God."
Anyone looking less like a child of God than
Mr. Douglass, it would have been impossible to imag-
ine. But the men in the room were ready to become
the children of anyone so long-as that gave them the
opportunity of discussing the martyrdom of Mortimer
and Nicholas with the two martyrs themselves. Mr.
Douglass. however, did not include Mr. Samuel
Josiah Jones in hisa fIvitation, and acquiesced with
alacrity when Mrs. Jones remarked to her Samuel,
"you better remain where y'n are, Sam." Mr. Proud-
leigh. of course, rose hastily to accompany the de-
parting visitors to the respective homes of Sir Morti-
mer and the High Conspicuous, so as to be able to
report unfaithfully later on upon all that he might
see and hear. But, knowing quite well his intention,
Mr. Douglass assured him earnestly that the night air
would be bad for his constitution and refused to
agree that he was as strong as an ox. Only five
men, therefore, left the Joneses on the proposed peace-
maker's mission. And after they had gone Mr. Proud-
leigh consumed an hour in expressing the most un-
complimentary opinions on their characters and
lives.
Nicholas Brimstone's house was the first visited.
Mr. Douglass and his friends found Mr. and Mrs.
Brimstone. or, to speak more correctly, the Poten-
tate and the Marchioness Brimstone, alone. The Mar-
chioness was in a state of 111gh anger; she was blaz-
ing with wrath against the Government generally
and the Railway administration particularly. Brim-
stone was silently angry, but she was shrilly vocal.
For some five minutes her visitors had to listen in
Silence, but with approval, to the flood of invective
which she poured out. Then. because she was tem-
"psIly exhausted, she paused, and that gave Mr.
,iugil-as his opportunity.
"We have come, High Potentate," he began with
.:solemuity-for he was in the habit of addressing pub-
liC meetings--"we have come to offer you our con-
iRlence an' to assure you that you 'ave the sympathy
eo the entire people. The white men may think
nothing of you, and we all see how they have spite-
*-. -


*e**..**********eee**** o*** 0000*** *

e
0
0


0


*0
0
0
*









*0
0

*
*,












*


*
0
: Lai irnsa :
























Dayligh Daes
*
*0































*
0
*

*
*
4 1~ EIIL RE~ I)



































give 000 candle power


Sof pure white light that.
iS as soft as Sunshine !


*










: D..HENDERSON & CO., :

~KINGSTON.

*
*






































* *
I~lI e'i IIlPUUIilllll I l~ ilI
*t 0
*I ~ ~ er 0
*II


* 0
0
*I fl.t.LLL
*I tauqurg
IYI
I C
I .





I CoeIn' Iuc-lt

V


0 0
a
0 0
0 0
0 0




Col Lanternsk-it




0 0







Daylight Makers








0 0
0 0
0
0 0
0 0
C S

* a
*

* 0
0
S
0
I IS
Goofla Lap

0




* S

* 0
* 0
* 0'
* 0
*

* S
* 0
* S
* S
* S
* 0
* 0
.JEDRSN&C.
iKINGSTON.~~





PLNTRS PUC 952


PALACE THEATRE,


KINGSTON,


Excellent Orchestra!


The Latest and the Best

Pictures from all the First

Run [Theatres of the World


Every Evening two Shows from


7.30.


MOVIES THEATREE:


ST. ANDREW.


mim





E
INflf ENA


The Resort of all Picture
Fans. Nothing but the


Best Shown. Goo'


BIG SUPER SPECIALS AS SH(


wo Shows from 7.30


d Music

OWN IN LONDON.


Every Eve. i


..: ^.: :!!!..-;;i: ;

.:.1,'-. .. -
.''-j" */
."''.! :':S




NE

N
:.:
:13"'

o:,3
n m~

1e


A.:;~-


1


I I


INK


EWE ENGOs~~iBU~ia~iKl~csEMEEEEEEE. WEEEE


C I


- -- :- .


PUNCH


1925---26


PLANTERS'


-----~---~-~`--~--







1925-26


.Ully used you. You are to be nothing an' they are
tb be everything; but never mind. A day will come!
I is coming now. And what we say is that we must
stand by one another and work for that day. We
must be friends an' brothers in prosperity and adver-
qity; wherefore I say unto you that we must reconcile
our differences an' join together."
"I am no High Potentate, Brother D.," sighed
poor Mr. Brimstone. "If I was a High Potentate they
couldn't kick me out of me job like they doing, for
nothing at all."
"I don't agree with you, Potentate," answered
Mr. Douglass firmly. "Look around, an' what do you
see? Everywhere crowns are tottering and the high
brought low and the low ones high. Look at Ger-
many, look at Russia! Look at Africa! Garvey is
making a Republic there, and if we 'elp him here"-
he paused significantly.
"Yes, if we 'elp him here?" repeated one of his
friends interrogatively.
"Then we will see what we see," replied Mr.
Douglass with a short laugh.
"But how will that help me to get back me job?"
demanded Nicholas, who could not perceive the drift
of these remarks.
"You won't want a job like that," Mr. Douglass
assured him. "You will 'ave a position befitting your
Potency. All we want is to trust one another, to work
together, and to keep silent. It is cock's own mouth
that kill cock. It we don't talk, no one will know
what we doing. In the meantime, let us all join in
friendly communion an' break thebread of fellowship
together."
For a moment, Mrs. Brimstone did Mr. Douglass
the injustice of supposing he was suggesting a little
supper at her husband's expense. This, at such a
time, she considered most unreasonable; indeed, mon-
strous. But his next words reassured her.
"I am asking you both," he continued, "to bury
past and future animosities and to make peace with
Sir Mortimer and Lady Slimslam."
It was not supper he had in mind. That was
now clear to the Marchioness. But he was proposing
something even worse. She gazed at him as at one
who utters rank blasphemy.
"Do y'u means to tell me, Mr. Douglans" said she,
"that you teck the trouble to walk all this way
to me housee to tell me to make peace with that for-
tWard woman that say she 'ave a title an' I don't have
none? Let me tell you, me friends, that though poor
;ck will shortly be out of a job, yet I am glad that
Matilda Slimslam's husbandd Is kicked out, for that was
.*hat I bin praying for. Brimstone can get another
easy; he are a good mechanic, an' I am not afraid.
n.ot the work, it is the injustice that boil me
if I could lay me ban's on the Railway Di-
e law wouldn't do me nothing, his own
a n I't know him when I done wid him. But
I hope -it that Matilda Slimslam will walk her
toot to iB6 '.borrow a sixpence from me, an' then
I will thrt'W ;herr an' curse 'er about it. You mark
me words."
S "'VengeaiCIrlBpe, saith the Lord; I will re-
Spay,'" quoted Mbsit'i gllb unctuously. "I agree with
ill you say, Lady Brimstone, but there is a time for
l things. This is a time for the leading members of
's r race to come together, and if you and the Poten-
.tate are not leaders, who are?"
"Not Mortimer Slimslam," said the Marchioness
emphatically.
ell, but he has bin selected, you know," object-
ugass soothingly. "He has been taken and
SWe must put aside personal feelings.
noticed what white people do when they
f" Lady Brimstone?"
o, Mr. Douglass?"

want; after that they fight
S.:..That is history, Mrs.-I mean,
that I am a man read plenty
or fight for black people:
they d^i l e their to rob us, which they
doing SC Id't we do like them?
iow Is thEa the day of salvation.
'ou are a tt ey is still alive, an'
f you went t.rd< all the African
folks there woledfS i '...Nobedy can take
that away from yo i !fe.how foolish
. : look that you and MEkbe fighting
on" '.ne another when you. your forces
sgatnst the oppressor?"
"It's really foolish," co the men
th him."


S"Only we do it," said ano'il .were
4nted, being we are in the mal'fld
be in a different position." ''
"Ah! exclaimed Mr. Douglass;
1i Now you saying what I bin wan'
stand; divided they will kick:
bWe if they can get a white ~,l'

.ibefore, Nicholas Brimstone, t lun"
S Igt .Ib., contradicted such a statement,
h'.n a ed himself with it. But a
.a situation M1 .man who has lost one, tale
leant view, Misame question, and Nicho-
"' I wa not now the mL:: he had been. Besides the
natural, feeling consonant ath his new honours and
dignities, he was-suffering -ghtfrom a sense.of


P LA NT E.R-S PUNCH 25


deep injustice. Therefore he agreed with Mr. Doug-
lass.
"What you say is quite true, Mr. D., an' they
mean to do us worse," he said. "It will go on till we
won't be able to breathe as we like in this country."
"Then we ought 'to stop them from breathing
firs'!" volleyed his wife. "If this was another coun-
try-"
"Just what I say," cried Douglass triumphantly;
"but It won't be another country so long as our chief
people in it won't even speft-treachWf other through a
little disagreement which tholrought to obliviate and
bury in oblivion."
This, so to speak, brought the Marchioness up
against It. Mr. Douglass had made It apparent to her,
by suggestion, that famaica might be made another
country if only she 'would consent to hold out the
hand of amity to the Lady Matty. Dodglass saw her
face change and instantly pursued the advantage he
bad won.
"I am inviting you to come with me to pay a call
to Sir Mortimer and Lady Slimalam to-night," he In-
sisted, "before the sun goes down upon your wrath.
Let not the sun go down upon your wrath. It is
gone down already, but I am speaking metaphorically,
so to speak, for, you see, Marchioness Potentate, that
as you and you' husband are really in a higher posi-
tion than Morty and his wife, in that you 'ave a
bigger title, it Is in your place to.hold out the olive
branch. They can't do it, but you can. Will you come
with us?"
This admission of her superior position, coupled
with curiosity to know what plan Mr. Douglass had
in his mind to bring about a different Jamaica, de-
cided Mrs. Brimstone.. .
"If you say'so, anidas I am a Christian woman,
Mr. Douglass," she answered, "I will go with you to
make peace, although I must tell you truly that I
'ave no sort of good feeling for that Matilda Slimslam
at all. Me husbandd will have to answer for himself."
"I will go if you go," said Nicholas, perceiving
that she had already decided.
"Well, that is.signed and sealed," said Mr. Doug-
lass heartily. "So long as Africa and her defendants
stand together, we need fear no foe. A man's ene-
mies are of his own 'onsehold. Let us go to see Sir
Mortimer and Lady Slimslam without delay."

CHAPTER FIVE

A OOANFAbERAflO F OnrME
a,, SHILLING a month Is not too much to pay,"
insisted Mr. Douglass; "but females can be
A sIxpence."
"I will pay a sixpence a month, though
me husbandd is not working regular now," said Ma-
tilda, "an' if the subscription was more, I wouldn't
say a word against jt."
"But you 'ave a title, an' you will get more out
of anything we do than the rest of us," objected
another lady. "Howsoever, I will give sixpence a
month, for, after all, we pay a sixpence to go an'
see a picture show,, an' we can do the same for the
absolution of oppression."
"Abolition," corrected Mr. Douglass, but with in-
finite tact, for he did not want to offend anyone with
sixpence a month to donate towards the funds of
his newly-formed society, even though he was well
aware that many of the members would be shortly
in arrears. Sixpence per month, paid irregularly, and
with much grumbling, and only after repeated solicit-
ation, was nevertheless a sum of money not to be
despised in the alleged interests of racial propaganda,
and it was for nothing less that Mr. Douglass had
hurriedly organized his Up and Be Doing Confedera-
tion of the Oppressed, of which he had had himself
elected Perpetual .resident and Minister Plenipo-
tentiary.
Mr. Douglass had been successful in effecting a
reconciliation between the Brimstones and the Slim-
slams'six weeks before. Brothers in misfortune.
Mortimer and Nicholas had recognized the silliness
of remaining enemies in the face of a disaster com-
mon to both of them. Their wives had tacitly agreed
o admit the right of one another to formal titular
distinction, and nor. addressed each other punc-
llously as Lady Brimstone and Lady Slimslam.
This had set a good example to others, and even the
woman in Matilda's yard, who had vehemently pro-
claimed against any sort of "ship" save a steamship,
$ad consented to say "your ladyship" to both ladies
yn learning that a mysterious movement was on foot
whereby these ladies might become very great and
prosperous personages indeed.
What was that movement?
J No one knew exactly. Douglass was a clever
an in his way; he realized that an element of mys-
y made for success, especially when one was deal-
t.:*lth a people that revelled in the mysterious.
S titvely 'ud'erstobd the psychology of his
,No sooner had he brought Mortimer and
icholas and their wives together, than he pro-
iounded to them a scheme. This was to institute a
ciety or Confederation of the Oppressed, the aim
Which was to be the uplifting of the working
sees of Jamaica, the putting,of them in touch with
amafcans resident in Cuba and in Central America,
he afdliation of the Confederation with Mr. Garveys
'-


greater society in America, and "the freeing of Ja-
maica from all shackles."
What did those last words mean? Mr. Douglass
had enunciated them with a sort of sinister emphasis,
with a bitter Intonation, which had frightened the
timid, shocked the loyal, and thrilled the foolhardy.
But he had never explicitly explained them. He was
a bitter man; to a certain degree he was a bold man;
but be would not venture so far as to make crystal
clear his meaning, for fundamentally he was a cow-
ard. Let everyone read into them his own implica-
tions: that would be enough. But some took the
shackles to mean the hold of the British Govern-
ment upon the country, and when these said so
openly Mr. Douglass did not contradict them. Be
simply talked on some other subject, smiling the
while significantly.
The Confederation had been formed. At this
meeting they were discussing a matter which he had
discreetly left over for a later occasion. The first
thing he had had to secure were a couple of men
with a real grievance, men who had been exalted by
one of the great leaders of the neo-African move-
ment, namely, Mr. Marcus Garvey, and'who'had been
ignominiously hurled out of their situations because,
not being of the dominant race, they had dared to
accept titles which made them superior to the

I--- ~------------------ -







The Royal Mail Steam Packet Company
(ROYAL CHARTER DATED 1839.)


The Pacific Steam Naigation Company
(ROYAL CHARTER DATED 1840.)




PASSENGER AND FREIGHT SERVICES

BETWEEN
New York, Cherbourg, Southampton and
Hamburg.
London and Liverpool and Brazil and the
River Plate.
Liverpool and the West Coast of North
and South America (via Panama
Canal and via Magellan) with calls
at Jamaica as occasion requires.
New York, Havana, Panama Canal, and
West Coast of South America.
Canada and Bermuda, The British West
Indian Islands and Demerara.
United Kingdom and Continent of Europe
to the West Indies, Central America;
also to China, Japan etc.


Local services West Coast, Central and
South America.



Tours De Luxe:

During Winter months from New
York to Jamaica, and other beauti-
ful spots in the Caribbean by the
palatial triple screw liner "OHIO"
19,000 tons registerr, 27,180 tons
Displacemede'

Regular Frequent Freight Service:
Between Jamaica, United Kingdom
and Continent.

Regular CoastMse Freight Service:
Between Kingston and Outports of
Jamaica by the Motor Ship 'ARNO'
about every 10 days.


For full particulars apply

THE ROYAL IAIL STEAM PACKET COMPANY,
KINGSTON, JAMAICA,
B.W.I

R .







PLANTERS'


PUNCH 1925-26


highest in the land. Next, with their active coop-
eration, he had had to draw together a number of
men and women, animated with a sense of griev-
ance or filled with vague ambitions, who would con-
sent to support personally and financially a propa-
ganda whicn could be developed as time and circum-
stances permitted. Douglass left unexplained the
end he had in view. But there was something in
his mind that every now and then betrayed itself
in words, and when he let slip some remark about
the sixty thousand Jamaicans in Cuba who must
have learnt how the Cubans fought, and about.the
ancient successful struggle of the Haytians for com-
plete freedom, there were not a few to feel that he
looked forward to the day, not distant, when a great
crowd of Jamaicans in neighboring lands would
come flocking back to Jamaica, all secretly armed,
to set up in the island a part of that African Repub-
lic about which so much had been heard in recent
days. Most of those who took this view determined
to allow their attitude and action at that time to be
determined by conditions. At moments of emergency
they could always fall ill and be forced to remain at
home. They would gladly leave others to fight
actively the battle of the oppressed. In the meantime
they were enjoying the sensation of heroism.


Furnishes Go vernme nt
Guaranteed Security to its
Depositors.



It brings the facilities of
the Savings Department of
a Bank to the principal
Towns and Districts of the
Island.



Remittances may be made
Free of Postage and Reg-
istration.



Interest of 3 per cent, per
annum, compounded half-
yearly.


KINGSTON
MORAN'T BAY
PORT ANTONIO
ST. ANN'S BAY
FALMOUTH
MONTEGO BAY
LUCEA
SAY-LA-MAR
BLACK RIVER
MANDEVILLE
MAY PEN
SPANISH TOWN
PORT MARIA
HALF-WAY-TREE
CHAPELTON
ALLEY
INSTEAD
BUFF BAY
PORT ROYAL
GUY'S HILL
CROSS ROADS
GORDON TOWN
EWARTON
GREEN ISLAND
HIGHGATE
GOLDEN GROVE
BROWN'S TOWN
BALACLAVA
STONY HILL
RICHMOND
PORUS
ANNOTTO BAY
CATADUPA
OLD HARBOUR
SMITH'S VILLAGE


But even the most noble and distinguished
cause needs money in these materialistic days, and
Mr. Douglass was. too practical a man not to recog-
nise this.
Indeed, the collection of money had been his
Immediate principal aim in forming the Confedera-
tion.
Mr. Nicodemus Douglass loved to work hard-
with his tongue. Manual labour did not appeal to
him. He preached its virtues, for it is necessary
that there should be manual workers if men of the
mouth are to live; he insisted always upon the
dignity of labour. But he was willing that other
people should have all the dignity of actual labour,
and nothing moved him to greater concern than the
possibility of any of his numerous friends and ac-
quaintances being out of a situation. He always saw
oppression in that, oppression of himself incident-
ally, for he felt that, indirectly, he was bound to be
a sufferer.
He had formed several societies before. For
some six months The Awake and Be Alive Associa-
tion had been a very flourishing concern, but the
members went to sleep again and subscriptions fail-
ed. His scheme for the Repatriation of Indigent
Jamaicans in Panama had worked very well, though


NEWCASTLE
HECTOR'S RIVER
TRINITYVILLE
MANCHIONEAL
MONEAGUE
ALEXANDRIA
FRANKFIELD
DARLISTON
PETERSFIELD
LAWRENICE TAVERN
HAMPDEN
TROJA
MONTPELIER
MAGGOTTY
ADELPHI
DUNCANS
ULSTER SPRING
GAYLE
CHRISTIANA
OCHO RIOS
ORACABESSA
CROOKED RIVER
STEWART TOWN
SANTA CRUZ
HOPE BAY
RIVERSIDE
CAMBRIDGE
BETHEL TOWN
PORT MORANT
MILE GULLY
SPALDINGS
POINT HILL
NEWPORT
PRIESTMAN'S RIVER
ELIM
NEW MARKET


no indigent Jamaican bad ever been repatriated. Mr.
Douglass regarded himself as a sufficiently indigent
Jamaican to need all the assistance that his country-
men could possibly afford him, and he had not hesi-
tated to appeal to Jamaicans in Colon for necessary
donations. These had come in liberally enough for
over a year, and then, as in all these societies, the
interest had died out. But Douglass was an inde-
fatigable man, and shrewd also; he had studied the
progress of the Garvey movement in America and
had recognized that the head of that movement
was never content with a static position. Always
he was moving forward. Always he was doing some-
thing new. Always he was generating enthusiasm
by some more daring scheme than before, some
striking proposal. If he, why not others? Anything
was possible in these days. A Nicodemus Douglass,
conscious of his desire to uplift the people-for Mr.
Douglass never doubted his own motives-might
effect wonders if only he obtained sufficient support.
He was happy this evening. He and his helpers
had summoned a meeting of those interested in the
Abolition of Oppression, and no fewer than two hun-
dred persons had attended. Sir Mortimer had not
been able to put in an appearance; he had obtained
employment for the evening at a small hotel where
a dinner was being given, and he had concluded
that he would be oppressing himself did he neglect
to take this opportunity of earning a few shillings.
But Mr. Douglass had insisted that Lady Slimslam
should be present, and had taken her to the meeting
in a cab; and the High Conspicuous was there with
his wife, and many other persons of importance and
eloquence. The High Conspicuous had, as Lady
Brimstone had predicted, found another job which
was almost as well remunerated as that which he
had recently lost. But his sense of grievance re-
mained, and he was one of the foremost members
of the Confederation and its best financial support-
er.
"One shilling a month from males, sixpence a
month from females-that is decided," announced
the Permanent President; "and now, ladies and
gentlemen, I have something else to tell you. Our
High Conspicuous Potentate, who, as everybody
know, is a man with means, in spite of what the
Railway do to him, has decided to contribute to our
Fighting Fund no'less than twenty pounds-twenty
pounds, ladies and gentlemen-and Mr. Sharksey and
Mr. Green have given five pounds apiece, and, though
a poor man, I will give ten pounds; thus we will 'ave
a fundamental Fighting Fund of forty pounds to
begin with."
When the applause had died away, Mr. Douglass
again rose, as though struck suddenly by a happy
thought.
"Ladies an' gentlemen," :.i that
most of you would be.a heat and
burden ot the. a. .:Si~ii of us. I am
therefoae propouir:ug eacha man In this audience
halU contribto" s 4pllkr as a sort of counterblast
to the big sums I have mentioned, Just to show that
.Sery member of us is independent In mind and
pocket. I will appoint Lady Brimstone, Lady Slim-
alam and six other ladies to go round at once an'
collect this amount, and those who haven'tt the
ready money-though I am sure such gentlemen as
I see around me to-night are not poverty-stricken-
can give a faithful promise to send it In to-morrow:
in fact, I will call and collect it meself."
The applause at this was not quite so,. nthusias-
tic as it had been before. Indeed, an imtci 4b-
server would have said it was remusjiSy feeble.
Yet no man in the audience walted44ie'tipear mean
or poor, so, in spite of the genertbeft that some-
thing of an advantage was bp@f.l4n of the situa-
tion, at least fifty pertaes o:Igtlbuted a dollar
each on the spot, and .ibt fifty others made
promises which they hopa g be able to break. The
women were asked to- .nothing by way of ini-
tial contribution. tD.,sias was too wise to ven-
ture too far.
When this oleetam. had been taken up, Lift
Brimstone, without batting for any further an-
nouncement frop: tih Permanent President, remind-
ed him that a tfkmrer bad to be elected and hinted.
that this m.attlhad been privately discussed before.
"Why, Mei"' 'e agreed instantly, "and no one
better fttet4dlorthat most exalted post can be found
than the. otentate. A man who gives so liberally
can be entrusted, with all due and proper safeguards,
wif.. top. funda of this Confederation. Gentlemen
and ladles, I nominate the High Conspicuous Poten-
tat.toe-oub r Most Exalted Treasurer."
.Thla nomination was immediately accepted, and
then. Brimstone, acting on his wife's suggestion, re-
jDrked that it should' be decided at that meeting
who should draw money out of the bank for the
purposes of the Confederation. .
"Quite right," agreed the Pr.Butj* Most
Exalted Treasurer, will have the flQ Lto do so, on
being presented with a et~K.f4Wt authorisa-
tion from me to that efet, 1 1...leertiflcate will be
duly handed to you whenevq~ b Committee of Man-
agement expresses their dsiM that money should be
drawn. Thus you apd i*Itl1 act in unison at the
dictates of the Confede4ilt."
This seemed UaUtp ::iper to the audience. But
Lady Brm ahtone.s, i amilllarity. with indigent


THE GOVERNMENT SAVINGS BANK



(OUR IAHNK9


LIST OF BRANCHES:


.1


mmmmmmmmmmmmmft







PLANTERS'


PUNCH


S!!j o6if stzpences had rendered her some-
ompidetos of human nature, was not so satis-

Ei-the money be lodged in me husband'ss
she analred.
~i afraid that that would not be constitu-
.Lafdy BIiiistone," replied Mr. Douglass with
: precation. "You see, you have all done me
lour to elect me as Permanent President and
It Plenipotentiary, and I must have some
a, otherwise I am become as a mere figure-
Suas sounding brass and tinkling cymbals. I
mIloble to each and everyone of you, and if
iJted Treasurer could both lodge an' with-
Mt funds, where would my responsibility be?
by must be lodged in my name. But I can't
1W t-not even me own ten pounds. Only the
inr can do that on being authorized by me.
.o agree will please hold hup their hands. "
of those present held up their hands.
*s reasoning appeared quite sound to
m any case they had not much to lose.
,shouted "hear, hear," enthusiasti-
strongly supported Mr. Douglass
meeting, and this had not tended
Brimstone any the more satisfied with
ings. But that lady felt the influence
S istam that prevailed. Mr. Douglass was
t6as a new Leader, a second Mr. Garvey, and
i not have been wise to question too closely
BaM that he proposed. But there was her
o. tweaty pounds, which could not now,
ieitNy, be withdrawn from the general fund.
imautone began to feel that the liberation of
Ijrsaed might be purchased at too high a

pmwsl saw that she was dissatisfied, and
I'te best means available to divert the atten-
:ltie audience from her. He launched out
lupafinloned speech on the iniquities of op-
u pon the glory of titles bestowed by Mr.
"ta then he made an announcement he had
Sibi hack for the proper dramatic moment.
ilogh a poor man, through working for the
Determined to make further sacrifices for
ia of my people. Ladies and gentlemen,
on to go, at my own expense, to Cuba
to get members for our Confederation,
tei' virtues of unity, and to raise money
ting Fund. At me own expense I will
fryfusfto allow a single penny to be voted
." He paused to give someone an op-
f.. contending that the general fund
at least part of his expenses, but it was
l04yone there was willing, nay, anxious,
11 wear undiminished the halo of
ce. Not a single voice was uplifted
should not carry out his campaign
Matilda did open her lips to
lbut she caught the tone of the
and refrained. So Mr. Douglass

to take any of your money,"
LHVil not. Me mind is made up.
A&qium High Potentate Brimstone to
t U* P.;i adsaU'I am going shortly, any
teivd in me absence will be lodged in his
rrow, ladies and gentlemen, all the cash
ere this evening, an' what we get be-
i. the bank, and I want you to select
now who will go with me and
I:i.:' the bank."
pted to perform this impor-
.after some further desultory
hp. Old Mr. Proudleigh, his
gtth daughter, Mrs. Jones,
b e in Mitchell Town.
.Who can talk!" exclaim-
f admiration. "An' the
Ida look 'pon him as
s to say dat be is,
af I it was notten

dalighter, Susan,
'him alone is to

ode bank,
ii ti.As a fair ar-


nut under-

t~iirdlen MierhapM,"
., "ano l!i out of
1. didn't an'

.t. But don't t is

? Who in t,'
anything about
or me. Them
'want it they will
-Affe have the whole
Mr. Proudneigh.
s is notten but"
all the time meseiz:i..:
.A man did say one
a,,t meeting, dose P.:
death. Lord, Jamaidca
him Stuttle, an


: ..: .. :. :. ..


if you had taken me advice, Sam, you would have
you' dollar In you' pocket now."
"I didn't hear you giving' me no advice, Old Mas-
sa," returned Jones dryly; "you must be dreaming.
Well, I can spare a dollar, an' I rather lose it than
look mean. But I didn't say Douglass was going' to
rob the people; I only say be can draw the money
when he like. I never hear anyone call Douglass a
thief yet; he only live by his brains. I guess the cash
is all right."
"I wonder what Matilda say about it," put in
Susan; "she looks like she agree with every word
Douglass speak."
"Did you notice dat, Sue?" demanded ter father
eagerly. "It is what I bin noticing meself. Scandal
an' me don't walk together, an' nobody ever hear
me say one word againstt anybody's character. But
if I was Mortimer I would Leck a thought an' watch
them two night an' day. Mister Douglass is round
at Mortimer house very often now, especially when
blorty gone out. Why him going' there so frequent?
I took a walk towards Morty's place only yester-
day, 'bout de hour I know Mister Douglass was
likely to be dere, an' I hang about outside to see if
God would 'elp me to hear anyt'lng, but them was
so quiet inside-no mouse could ha' beat dem-that
I 'ave a suspicion which, howsoever, I keeps to me-
self. But I don't like it. It's not my business, an'
from I was a boy I larn to mind me own business,
ever since a man nearly broke me back because I
follow him one night to see where him going. But-"
"Mind how you talk, pupa!" warned Susan, but
immediately made up her mind to repeat faithfully
to her numerous friends all that her father had just
said and hinted. "Mind trouble! Mr. Douglass is
a powerful man, an' he so popular now that If you
say a word about him, them may make you sorry
for it. It is Morty's business, after all, an' if he
don't mind if Mr. Douglass is always round at the
housee when he is not there, why should re mind?
No man is coming' all the time to see me when Sam
Is gone out, an' that is enough for me. Don't let
us say anything more about it. I wonder it when
Douglass take Matilda home to-night him went in-
side, or only teck 'er to the gate? I would really
like to find out."
"P'rhaps I could teck a step roun' to de place,
an' enquire 'bout something as a-sort of excuse, an'
find out?" suggested Mr. Proudleigh hopefully.
"What y'u t'ink of dat?"
'I am not telling y'u to go," said Susan, "an' I
can't tell you not to go, for you are a full-grown man.
But if y'u go, be careful."
Mr. Proudleigh not unnaturally interpreted this
speech as implying consent, and immediately de-
parted from the company of his son-in-law and
daughter. "I wi' see you later," he remarked hur-
riedly, and proceeded in the direction of Mortimer's
house.

CHAPTER SIX

HINTS TO SIR MORTIMER
M ORTIMER'S residence, which consisted of
two fairly large-sized roo ooms looked out up-
on the street, its frontage being flush with
the premises' boundary. To enter it you
had to go through the yard, for both rooms of the


house opened into the yard, whose gate formed th-
principal portal of all those dwelling in this typical
Kingston tenement. Mortimer's house, indeed, was-
the most considerable single building in that yard
of tenements, which circumstance had always placed
Mortimer and Matilda socially above.the other peo-
ple in the yard, and had helped to render them the
equals of such persons as the Brimstones, the Jones-
es, and those others in Mitchell Town whom fortune
and a superior ability had assisted to success.
The foundations of the little building stood high
above the level of the thoroughfare It overlooked.
Decades of erosion had worn down the surface of
the street some feet below its original level; there-
fore anyone standing in it and endeavouring to gaze
into the interior of our knight's little domicile, was
compelled to look upwards and must needs stand
on the opposite sidewalk to do this with any degree
of convenience. Even so, the range of his vision,
in his effort to discern what was afoot within the
place which piqued his curiosity, was restricted; and
as it happened that curtains shaded the two sash-
windows of the house, a further bar was erected
against one's natural anxiety to learn what the occu-
pants of that discreet home might desire to conceal
from the outer world.
It seemed to Mr. Proudleigh that his worst sus-
picions of Matilda were confirmed as he stood outside
the little domicile and strove in vain to catch a
glimpse of Mr. Douglass and the Lady Mat. He saw
absolutely nothing of them; therefore he concluded
that they were hiding from him, or from others, and
he was justly scandalised by such an endeavour on
the part of the suspected persons to cheat him of the
evidence which his sense of sight desired. Why did
Matilda live in a place into which you could not
easily peer? Why were those curtains so arranged
that they obscured the view? Why was the large
kerosene table lamp so placed that it did not illu-
mine just those corners which Mr. Proudleigh would
have loved to explore? Why were there no steps
leading up to a front door, at which a righteous
seeker after information might have silently and
cautiously placed himself, in the hope of hearing
something of an incriminating nature, before loudly
knocking and demanding admission like an ordinary
familiar visitor? It is true that Matilda had not
built the house, and that it was Mortimer who had
rented it; but at this moment Mr. Proudleigh was
not disposed to be impartial and,just. After all, in
spite of his rheumatism, he had walked some dis-
tance quickly in the hope of being able to gather data
of a character damaging to the reputation of Lady
Slimslam, and it was most unfair to him to find that
he had taken all this trouble for nothing. A feeling
of virtuous indignation filled his breast. He knew
that he was being badly treated.
He did his best on this unpromising field of
operations. He crept up against the side of the house
and listened. He heard a murmur of voices but
no distinct words. He went over to the opposite side
of the street, balanced himself dangerously on the
top of a large stone lying there, and strained his
eyes in the effort to discern even a shadow from
which he might be able to draw some positive con-
clusions as to lover-like embraces proceeding at the
moment. But no silhouette, however faint, appear-
(Oontinued on Page 42)


Wholesale & Retail Dry Goods Merchants


SPECIALISTKING STREET,
SPECIALISTS
I KINGSTON.
Ready-to-Wear
Clothing
Largest
Variety


DRY GOODS Every Mail
in the
Isand. Brings us
Island.
The very Latest
and
Newest of
Gents' Hosiers Fashion's Fancies

STailors, in the
Outfitters, etc. Dry Goods
World.

Largest Stock of Linens in Jamaica.

/ Kingston's Lowest Prices---Always.


=L


L_ _i~_~__


I


AMIS





UNCH 1925-
PUNCH 1925-26


DODsE B3ROTHERi

MOTOR CARS





The car has a substantial kind

of beauty that grows on you the

longer you contemplate it.




This is due, in part, to the unusual

grace and symmetry of the body

lines. It is also due to the fact

that quality materials always and

unmistakably reveal themselves

in the finished product.






JOHN CROOK, KINGSTON
DEALER. JAMAICA.


a- .. -


I


I
; ~-


w


PLANTERS'


,,
' `:~:;A:


:
.~ca~
::;
~r;i.
-


:s
: i.
~tl
'.;g-~
i .
*:
;;2
*.;~-
;
,;.
:i
:I::::*
...:.:s


I


. *-"-"1.


i*


I .-. -


I







PLAN TERS'


PUNCH


The Lindo brothers, eight in all, emigrated from
Jamaica when mere boys to seek their fortune in a
foreign and undeveloped country. They came of a
family well-known in Jamaica and intimately con-
nected with the island's history and fortunes. The
father of the subjects of this sketch was for years
a merchant of Kingston, coming originally from
the northside of the island where the Lindos had
been settled for generations. One
uncle was Mr. Abraham Lindo, the .
head of a large business in Fal- .
mouth, which at that time, as the ...-
chief town of that section of the is- -:r
land in which the sugar and rum
industry flourished, was the com-
mercial rival of Kingston. To-day .
Falmouth is much decayed, but a g ',.:'
large number of its closed and ruin- ,-.
ed houses and business establish-
ments attest to a former prosperity. r
With the creation of that prosperity
the Lindo family had a good deal
to do. and prominent among them
was Mr. Abraham Lindo, the inti-
mate friend and adviser of sugar
planters. and the proprietor of what
was in its time the colony's leading
journal of influence.
Abraham Lindo was himself a
writer of marked ability. He was
a man of liberal and cultivated
mind, great: moral courage,, and of
a wide' and unstained philanthropy.
Another brother, Mr. David Lindo,
r was even more distinguished. David
fLindo had the tastes and apti-
of a scientist and owed his scientific training
bila own endeavours. Business was his
Chemistry was his avocation and the
love i heart; unaided he made important chemi-
Sal d Ov6flawhich were welcomed in English scien-
titlc circles. His portrait shows him to have been a
man of deeply reflective mind. a broad brow suggest-
Ing Idve of a pursuit of knowledge, which was indeed
his dominant characteristic.
l Bt sugar fell upon evil days, Trelawny and St
James decayed, and most of the ablest men of tihe
northlside were compelled to leave their ancient
home! Some went to other parts of the island; a few
members of the younger generation determined to
try tleir fortunes overseas. Amongst these were the
Lindo 'who went to Costa Rica. There they devoted
S raihb and energy to the tasks that came to their
.I~htid, ..acquired wealth, and in 1916 returned-many
.:I" to settle in their native land once more.
:il: .'Mi:th et:. ne of their return to Jamaica everyone
Sltle Mtllh. t Was talking about the prospects of the
"la.'ul 'tigar::dii opment and the necessity of adopt-
ing medos-ntiMi tof sugar manufacture. The cry
was that the ikfrtbnient should establish one or
two central facti eia aan example and encourage-
; ".'. "::* .i .:


This year is the Centenary of J. Wray & Nephew.
S he Firm was Established in 1825.
It now starts to work lor its next century.


ment to possible investors. The Lindo Brothers,
however, without waiting for Government example
or encouragement, and probably with the idea in


their minds that any business enterprise which had
to depend upon Government initiative for a begin-
ning would never materialize, went straight ahead
and established, in co-operation with Mr. A. L. Keel-
ing, the first sugar central factory in Jamaica, now
known as Bernard Lodge, on the St. George's Plain
of St. Catherine.
' The estates of'the late'Colonel Ward were then
upon the market. Colonel Ward, and his uncle Mr.
John Wray, had built up a flourishing rum business,
and had done much to make the already famous
name of Jamaica Ruin still more fahious for high and
reliable quality. The Lindo Brothers entered Into
negotiations for these estates and business, acquired
all of them and continued operations under the
old name of J. Wray and Nephew. It was all done
in a \ery little while and done with that energy and
thoroughness which they had shown in all their
business activities. They went into business largely
in Jamaica as they had done whenever practicable
in Costa Rica. They are believers in considerable
ventures and they never allow themselves to be de-
pressed by adverse conditions.
The firm of Lindo Brothers consists of Mr. Cecil
Lindo, whose headquarters are in Costa Rica, and


T/F" ". ....... ....... ......lumu


AN],IlYTE)IOB VIEW OF THE LINDO'S BUM STORE
~'* .^ ^.jlly


1925-26


INITIATIVE, INDUSTRY-SUCCESS


THE STORY OF THE LINDO BROTHERS
UBt___________________________1i


29


SPECIAL RUM STORE FOR STORING THE LINDO'8 RUM


who travels constantly between that country, Ja-
maica, New York and London in the interests of the
firm; Mr. Percy H. Lindo, who is the general resi-
dent manager of the business in Jamaica, and Mr.
Stanley Lindo, who is the resident manager of the
Costa Rican branch of the Lindo Brothers. Two
other brothers in Jamaica, Rupert Lindo and Robert
Lindo are connected with the firm of J. Wray and
Nephew, and one Mr. August Lin-
do. has retired and now lives in the
United States. Mr. A. L. Keeling
Sis the only man not of the family
t ~ associated with the Lindo Brothers,
r being a partner in the Bernard
S Lodge Central Sugar Factory. Mr.
Keeling is also a Jamaican. Thus
a small group of Jamaica gentle-
men are entirely responsible for
the initiation of the Sugar Central
Factory movement in Jamaica, and
for the carrying on of a large Ja-
maica business with long and hon-
ourable traditions.
Bernard Lodge Is equipped
with modern sugar making machi-
nery, and the output of rum on this
and on the other estates of the
Lindo Brothers is so great year by
year that a special Rum Store to
the west end of the city has been al-
located to their use by the Govern-
ment. One of the illustrations ap-
pearing on this page shows a part
of this Rum Store; but a consider-
able portion of other Government
Rum Stores is also occupied by the
product of the Lindo distilleries. Here are stored
rums made but yesterday and rums that have been
maturing for over thirty years. The care which J.
Wray and Nephew displayed in keeping up the tepu-
tation of their firm for matured spirits is assiduously
observed by the Lindo Brothers, who are determined
That Jamaica rum shall never lose its name, if.they
can conserve it. in any country in which it has von a
deserved reputation. In Jamaica itself the seal 'of J.
Wray and Nephew on any bottle of liquor is a guar-
antee of that liquor's quality, the ambition of the
Lindo Brothers being to uphold and, if possible sur-
pass the standards they inherited in taking over the
business at the head of which the late Colonel Vard
stood for so many years.
No more hardworking Jamaicans are to be
found than Mr. Cecil Lindo and Mr. Percy Undo.
It is the universal feeling in Jamaica that they de-
serve the success which has come to them as the re-
ward of hard work and striking forethought. Be-
ginning life with but an excellent name and the
knowledge of what their ancestors had stood for In
Jamaica, they have placed the family fortunes as high
as ever they stood in this country; they have s own
themselves in no way unworthy of those whobore
their name before them, and Jamaica feels that their
return home from Costa Rica was a good thing for
this country.







PLANTERS'


PUNCH


THE CITADEL


(Continued from Page 20)
Bush lifted her to her feet. "Come! There is no
time to lose."
Even as he spoke there was the sound of running
feet in the hall, the tapestry parted and a black face
peered with staring white eyes into the room.
"Back!" Bush shouted.
Bending, he snatched the empty pistol from the
floor and levelled it at the door. The face disappear-
ed and the opening closed.
"We must go now," he whispered, "while there is
yet time."
With the pistol butt he shivered the glass globe
that surrounded the candles, and extinguished them.
Calm and white the moonlight fell in wide bars of
light across the room. Mangan lay in the shadow of
the table, with his feet protruding into the light, two
small, black-shod feet motionless as In death.
HEY turned to the open door that led to the gar-
den, but already a tiny light bobbed among the
trees. From the servants' quarters in the rear some
one was coming with a light. Bush ran to the door
through which he had entered. The moonlight bath-
ed the dark mangoes with silver; beneath them
slept the night.
Halt supporting Virginle, he ran across the strip
of silent turf. They were now in the shade of the
trees, but her dress showed very white against the
darkness. Their feet crunched sharply on the grav-
elled drive. Ahead, between the gateposts, was the
road, bright in the moonlight. Behind them in the
house, a wild cry of terror startled the stillness;
lights flashed in the darkened windows; there was
the sound of excited voices.
A cluster of banana trees leaned long, broad
fronds across the road, and in their shadow Bush
stopped and drew the girl into his arms.
"Beloved,' he whispered, 'Luke waits for us. The
brig is ready to put to sea." He buried his face in
her hair and breathed its fragrance. "Will you go
with me? Will you be mine, forever?"
She did not answer, but he felt her head sink
back: he saw her face white in the dim light; he felt
the sweetness of her lips. His arms crushed her to him
and her heart beat palpably against his bare breast
where the coat had been torn from him. Then he
felt her warm body grow suddenly limp and yielding,


and he lifted his head as though in defiance of the
world.
"Come, we must not linger; already perhaps they
are following." He caught an arm about her waist
and half running, half walking, they hurried down
the road in the moonlight.
From the trees beyond a broken wall a dog bark-
ed sharply and ran yapping to the gate. Then tar be-
hind them Bush heard taint but clear in the silence
a voice. The sound inspired a new vigor, and he be-
gan to run. At his side he heard Virginie breathing
heavily and his own breath was rasping in his throat.
The road bent slowly to the right and crossed a
stone culvert. From the sea a coolness-struck their
heated faces. Bush had marked the place mentally;
it was half-way between the house and the waiting
boat.
He stopped and listened, panting for breath.
Ahead, clinking on the metalled road just beyond the
turn, was the sound of horses' hoofs. The sound grew
suddenly loud and clear, and then two horsemen turn-
ed the corner, riding abreast, black figures in the
night. Bush seized Virginie in his arms and turned
toward the shadow of the trees along the road, but he
was too late. Her white dress shone like a light in
the moonshine.
"Stop, there!" a voice called In French.
In the mad impulse of flight Bush kept on toward
the cover of the roadside; again the voice called,
and the clatter of hoofs following told him that the
horses had been spurred forward. At the edge of the
road he paused. A bold front might carry off the
situation.
"Who are you," he demanded in the same tongue,
"that you should stop a man who walks in the moon-
light with his sweetheart?"
The man on the horse laughed. "Come into the
moonlight," he demanded. "It is late for love-mak-
ing on the highway."
In the circle of his arm Bush felt Virginle trem-
bling. Then she flung his arm from her shoulder
and walked toward the horsemen. Her voice strug-
gled to steady itself into an even tone.
"If you must know, I am Virginie Goutler, the
ward of Monsieur Leroy Mangan. Is it necessary that
I must report myself to any man whom I meet on the
highway before the door of the house of my guard-
ian?"
There was a momentary silence. "Perhaps,"
said the other man, who had not yet spoken, "we
have been in error to have halted you but, made-
moiselle, th roads of Le Cap at this hour are at best
unsafe. You would do well to return to the villa of


Monsieur Mangan. You are far in your walk from
the gate."
Bush silently regarded the two horsemen as they
sat motionless In the moonlight. They were In uni-
form, for the cold light glittered on the epaulets and
caught glints of fire from polished buttons and sword
hilts. Now and then their faces lifted as they spoke
and he saw that they were men of color, officers of
the Emperor, returning doubtless from some late
celebration In the town.
"Blen! Let's on! Pardon, mademoiselle. Our re-
gards to Monsieur Mangan!" He touched his horse
with the spur and the animal sidled toward the road-
side. "Eh, what?" There was another tone to his
voice. "Monsieur, there, out into the light with you."
Stolidly Bush stood his ground. The man who
had spoken reined his horse nearer.
"Philippe!" he called. "This fellow here, have a
look at him." The two men rode nearer.

AS THEY inspected Bush, puzzled by the torn
coat and the signs of his recent encounter, there
was a sound of running feet coming down the road.
Bush heard it, but there was no indication of his
consciousness of this new danger. Escape was yet
possible; a quick dash Into the dark cover of the
trees and then a cautious retreat to the waiting boat.
If he were alone that would be a chance at which he
would not hesitate, but he gave no consideration to
the thought. With Virginle It would be impossible;
There was a loaded pistol in his belt, but the two
horsemen had already sensed the situation and the
one whom his companion had called Philippe already
had Bush covered.
"Run! The servants are coming." He heard her
voice in his ear, but already the pursuers were in
view, two dark figures coming swiftly along the moon-
lit road.
"It is too late," he answered. Protectingly he drew
her to him, his arm about her shoulders. "Don't be
afraid; there will be a way out, somehow."
She clung to him. In spite of the hopelessness
of the situation there was something in his calm and
quiet assurance that gave her confidence. It was per-
haps that curious combination, the Quaker imper-
turbability and the romantic daring; the blending
of cool sagacity and impassioned action.
As they approached, the two servants appeared
to hesitate. Then they saw Virginie's white dress
and the uniforms of the two horsemen. In an in-
stant a torrent of explanation burst from their lips.
Mangan had been murdered. In passionate French
sentences they narrated the details, and the story
sounded black enough even without embellishments.


I .l


For Fire, Motor Car, Personal Accident,



Baggage, Burglary, and Marine Insurance.


Branch Managers
Jamaica

Travelling
Representatives }


MANTON & HART


R. BRAHAM HARRIS
R. A. FIGUEROA.


SUB-AGENTS IN ALL TOWNS.





-.. ....d._._..o. -.,


1925-26


OBTAIN PARTICULARS FROM


The Commercial Union Assurance Company, Ltd.


The Caledonian Insurance Company.


The Queensland Insurance Company, Limited.:








1925-26 PLANTERS' PUNCH


Bush shrugged his shoulders. "Let me speak,
gentlemen," he addressed the two officers in French.
"Enough of this exaggeration. I and Monsieur
Mangan disagreed and blows were given. That I
would have escaped. I do not deny; nor shall I con-
ceal the fact that this lady was to accompany me.
There are authorities in Le Cap Francaise to whom
I shall be taken: let us be about our business, if that
is your intention."
The calm, even voice was not without effect. He
put his other arm about her and drew her close to
him.
"Virginie, you must return. Be brave." Then
in a lower voice he whispered: "God protect you,
Virginle. Be ready when I come again for you." He
felt her lips against his own as her arms drew him
down to li;r.
"Must I go back?" she questioned. "Yes, there
is nothing else possible." Then with an impulsive
passion she clung to him. "John, John!" she cried
softly, "I love you, I love you."
As he walked down the white road to Le Cap he
glanced over his shoulder; a few yards behind him
the two horsemen loomed monstrous. There was no
sound but the click of the hoofs on the stony road
and the jingle of the bridle chains.
"It is necessary." said one of the riders, "to keep
your eyes to the front. And." he added, with an ugly
inflection to the words. "the murderer of Monsieur
Mangan need expect no quarter if he is so foolish as
to attempt escape."

CHAPTER VI
iT WAS with a feeling of perplexity that John
Bush awakened the following morning. His mind
groped at first for an explanation, for health and
youth had given him a brief but dreamless slumber
from which he slowly aroused himself; then in a
flash the experiences of the past night were vividly
recalled and he became acutely conscious of the ach-
ing shoulder where Mangan's shot had given him a
superficial wound.
From a small window set in the stone wall he
could see between the iron bars a patch of blue sky
and through the aperture a cool breeze blew steadily,
clean and invigorating. Around him the massive
walls, dingy and scratched with French names and
coarse phrases, supported a low-arched ceiling. Op-
S posite the window was a door of worn mahogany
with a small barred opening in the centre. The floor
*. was paved with great uneven flags, moist and cold;
: and set into the wall In one corner was a pair of iron
S imrge to each of which was attached a short length
chain. The straw on which he had been
piled deep and matted in a corner of
W at he sat up quickly as his nose became
conBiu.diii ths masty, acrid smell.
StiEte g ot to his feet. His body was sore and
aching, aiM,: shoulder pained with burning twin-
ges. He rneisfls o hau, 1.11 wsat grimy in the
slanting bar :ugi. ,a t'isporered when he
touched his face that eatybbe' of -a beAd itwai i
too evident. He walk'.&i t low Trid aow.-ad per'
ed through the opening, hit luh g dflating in the
cool air from the water. Before him in the morning
sunshine the harbour extended blue and sparkling far
to the east, where a smooth green peak reared like
a sentinel from the sea. Almost furtively he thrust
his face into the deep opening until it was pressed
against the bars. Now around the edge of the stone
he could see where the Hercules had anchored. The
blue water glittered empty: the Hercules was gone.
Perhaps she had been brought nearer to the land;
more likely, she was standing out to sea. The jut-
ting stones and iron bars made it impossible for him
[ to* sB.e
S.' With his eyes fixed on the distant shore, he re-
,: ; the last few hours of Lhe previous night. He
indeed, eow Mangan fared that morning. He
could not have killed him. Hard as was the blow he
had struck with the leaden Inkwell, it was not a
blow that carried death. It would leave a mark.
however, on that sold, impasalve face, an ineradic-
able mark. The thought pleased him.
At the edge of the taow his captors had awaken-
ed a guard of soldiers; black, barefoot and half-dress-


ed, the guard had stumbled out of the thatched shack
where they had been sleeping, guns with fixed bay-
onets trailing noisily. He was a criminal, a mur-
derer, caught with considerable difficulty, so the of-
ficers implied, a dangerous man whom they should
watch carefully. He had demanded that Monsieur
Samatan be notified, but they had laughed at him.
Still, he reflected, Samatan would know soon enough;
it would not be long before all Le Cap learned of what
had happened.
With his hands tied behind him he had been hur-
ried down to the old fort, a bayonet now and then
pricking him forward when his feet lagged defiantly.
And now from a barred window he regarded the emp-
ty bay. He walked across the room and put his
shoulder to the door; it was locked firmly; there was
no give to the iron-studded planks. A bar of sun-
light fell on the stone floor beneath the window. The
sun was high; it must be late in the morning.
Purposely he had kept his thoughts from Vir-
ginie. She was safe, he was confident. Leroy Man-
gan, intuition told him, would not hold against her
the escapade of the evening past; he would try to
mollify her and win her back to obedience. But what
would be Virginle's reaction? Unhesitatingly John
Bush knew that she would suffer no retreat. Her
words and her eyes had told him; her lips had seal-
ed their covenant
It was characteristic of his nature that he would
even yet hold her apart from the situation which in-
volved him, although she was the central figure in all
that now concerned him. All his life he had lived
with men and the inheritance of his Quaker ancestry
had given him a coldness of manner that his life had
intensified and hardened. But beneath this austerity
that found its only apparent relief in occasional dis-
plays of reckless daring burned the fire of a romantic
nature of which he alone recognized the existence.
Often in the lonely hours of solitude In his cabin or
on the heaving deck of the brig he had allowed his
imagination to draw himself the central figure in
desperate adventures in which always figured a girl
of his own imagination, a girl such as he now saw In
the living body of Virginle.
Strange as were all the happenings of the recent
past, there was nothing new in them to surprise him.
Never before had he felt the warm moist lips of a
woman given freely to his own, and yet often he had
imagined that delicious moment; so often and so
clearly that it seemed a realisation of something he
already knew. Not yet had he given himself entirely
to Virginle; there was a surface that he had not
broken through that still separated them. Not yet
had he bared to her the hot love of his passionate
inner nature.
THERE was a sound of feet in the passage and two
voices indistinct through the thick walls. Then
a key scraped, feeling for the lock; it clicked in the
keyhole and the door pushed slowly open.
The jailer and Monsieur Samatan entered. For
a moment the two men regarded Bush as though
started by his appearance, and they might well have
been, for the young man who confronted them with
-lsbhevelled and matted hair, unshaven face and torn
-td blioodyjcoat presented a contrast to the always
immaculate Captain Bush whom they bad known.
Monsieur Samatan was dressed in white linen and
carried a closed basket in one hand and a bamboo
cane in the 'other. He handed the basket to the
Jailer and bowed with a flourish of his broad-brimmed
hat.
"I have come," he said, "to the assistance of
my friend, although I must be cautious because of
the feeling that the injury to Monsieur Mangan has
engendered. Gubo"-he pointed with thin, dark fin-
gers to the jailer-"may be trusted. We can speak
freely."
"Tell me," Bush broke in, "how serious is this
injury that It was my privilege to inflict on Mangan,
and what is the price that I must pay? How long can
I be confined here? What will happen to me?"
"Leroy Mangan will not die," the other answered,
"but feeling is high against you. Pierre Nicholas de-
mands your life and there are others who would have
you shot for your attempt on the life of a man who
holds great prominence here. Escape is impossible.
Could I aid you, I would do so. But that cannot be.


= THE EDUCATIONAL SUPPLY CO.,

-- 16 King Street, Kingto, Jamaica.


BOOKSELLERS, STATIONERS AND PRINTERS,
it TOURISTS' BOOKS, VIEW POST CARDS, &c.
TENNIS AND FANCY GOODS,
SCHOOL APPLIANCES.



W \V. R. GILLIES, Manager.
EillElIIIIII I mIIIIllflllllHlli llHimllllm uIIIIIN!! unIIIIII inlluuR IIllill RllH I lmininH i


PYRAMID



















A PURE BRITISH PRODUCT











MORE POWER,


MORE MILEAGE





USE-



PYRAMID


GAS


AGENTS:


H. IM.BRANDON & COY.,

44 ORANGE STREET,

KINGSTON.


i


___j


PLANTERS' PUNCH


1925-26







PLANTERS'


PUNCH


I would suggest, my dear captain, that you plead for
mercy and forget speedily the unfortunate attach-
ment that has brought this difficulty upon you."
The suggestion brought a flush to Bush's cheek.
The thought that such a remark could be made to
him by this man of colour affronted him. Then he
saw in the brown eyes of Samatan a friendliness that
he knew to be genuine, it was a look that came out
to him like a helping hand; a look that brought his
gratitude instantly to the fore. He put a hand on
Bamatan's shoulder.
"My good friend," he replied, speaking also in
French, "I cannot tell you how deeply I appreciate
your coming, although what you tell me promises
little for my security. You have referred to Made-
moiselle Goutler; that is indeed, reason for my pre-
sence In -Le Cap.ana without her I- shall not leave,
even It mny freedom be given me.' -
Samatan-shook his head sadly. a.Dvtaln Bush,"
he said with evident emotion, '". e have been friends,
yes? I am a.map of'colour, but you.Jiave not noticed
my skin; you have seen oily. my blood, which is red
like your own. You have'been honourable with me
and we have made money together and drunk wine
together and we hare.eaten at the same table. And
now you .reapirlsonr 1lt my country. I cannot tell
you how greatly* I deslie to aid you and how difficult




THE



TOBACCO EMPORIUM


4 KING STREET., KINGSTON





I.NPORTERS OF

Pipes,

Tobaccos,

Cigarettes,

Smokers' Articles,

Etc.,





VE ALSO KEEP IN STOCK A
COMPLETE ASSORTMENT OF



"IiA TROPICAL"


AND


"GOLOFINA" CIGARS



r



DUNHILL f
B, B. ,
DD. B. L

COMOY.




Your PatroSage Solicited.


[ e. -


QUALLY silent was the house of Monsieur Man-.
gan that bright morning. From a cloudless sky
of burning blue the sunlight flooded the house and
garden. In the penetrating light the plastered walls
flamed white against the vivid green of banana.palms
and mangoes
Monsieur Mangan's bedroom was darkened. It
was a great room on the ground floor with white
walls and a high calling. On one side tall. green lat-
ticed doors, now tilhtly closed, opened to the garden,
and through the chinks little needles of sunlight pen-
etrated, tongues of still flame, to the inner gloom.
Opposite the doors and on the far side of the .chamber
iwa an enormous bed of red mahogany designed after
the new faslion of the Empire with graeful curred.
head and foot. The white mosquito bar was. drawn
back .and caught in a brass book against the M :;:
Bome French chairs and a table, all of ted mahogblqiW ,;
-ne chair placed at. the bedside, comprised -the lamuni
ture, except a massive wardrobe that stood at lest.
eight feet high .against the wall on one side ot.. t::
room. ......
SIn the centre of the other side and facing.. tbt.
wardrobe was a small white-panelled door. The IW.i.
latch lifted quietly and as the door opened Vgi
entered and stepped softly across the waxed bnoj d
to the bedside. As in death she saw the outline Ot -
long lean body beneath the sheet.. :Aw.
Tall and commanding as Leroy Mangaanta
ly appeared, the white expanse of the= gaLmt -"eld
dwarfed him almost to insignificance. He. lay upon
his back, his head sunk deep in a single pVillw, his
face covered, except for the lower half, with f L:olded
napkin. Below the cloth was visible th atitth. a
straight, thin line formed by two bloodl.es lips, and
the asar ..jaw.zow blue with stubble*-lthae-aght's


DIRECT WEST If
CO., IS



PIONEER IOF.:I
LO.W.

:" .,i:,% "D',w


kBLE


I RAPID
iC RELIABLE
- I"
IF **.W


,:YOUR ILIESSAGES
:''VIA BERMUDA."


i ..e,.at E BEST ROUTE FOR JAMAICA
'i$,Z- 'AND orHERl WEST INDIAN ISLDS.


IN:--CANAD.,: hand to C. P. It. Telgam '
S U. S. hand to Commercial Gable
U. S. A. hand to Postal Te i


Head Office: .;"': KINGSTON JA.
LONDON, .0C. R' yal Mail Bidg.,
S Old BroadSt. 8 Port Royal St.


1925-26


I_ __


it is for me to do so. Be strong, monsieur, but be not growth. His hands folded on his breast beneath the
foolhardy. The good God, whom we both know, will sheet increased the suggestion of death, an effect
not desert you." Then in a lighter tone he continued, which would have been complete were it not possible
taking the basket in his hand and removing the to see the even rise and fall of his breathing.
cover. "Here is a fowl and bread, some fruit and a "Virginie!" His quick ear had caught her quiet
flask of wine. The fare of Gubo is coarse, but the footfall'.-een before she reached the bedside.
best he can offer you, so I bring you these trifles." "Moasleur?"
Bush took the basket and set it on the floor; then "You will sprinkle some water on this cloth from
he clasped the hand of Samatan in hi own. "My the basin." His was a strange hard voice, a voice
friend," heasaid, "I thank you.", seemingly devoid of tenderness or love or pity, a cold
Samatan averted his eyes. dead voice, Judicial, impersonal. "Perhaps," he said,
"But what have you heard?" Bush continued, you may wish now to explain some things that have
"You have not told me all. Tell me the truth.; it is happened, in order that I may plan how best to con-
a kindness. You know what is my fate?" sider the future."
The merchant walked slowly across the stone The girl lifted the basin from the table and car-
floor and stood looking out through the barred win- ried it to the bedside. With Blender fingers she spat-
dow to the sea. In a corner Gubo squatted on his tered the water on the cloth. She did not answer.
haunches, a bunch of huge keys that hung from his t
belt tinkling against the stones. this Bush b een taken? re was a t least an-
"I do not know," Samatan said finally, "what has swer a question?" There was an unexpected
.glint in his voice, a hardness that made her in-
been finally decreed. As yet there is no decision, but, ..Uat tively turn from the bed and relae.t he b in
-sitiuCtively turn from the bed and replace.the basin on
my good friend"-he turned and faced Bugh--'" ifU the table.
believe in the God of your fathers, I bid you pay to e ha a ,
him, for from what I hear and from what I know of "e ha ee t sheeh
my people, you will not see Mademoiselle Goutier l"YO are aware that I shall ask the extreme pen-
agate, or any others of your friends."
ga, or any other of your friends." a moment dizziness caused her to put out
Y OU mean," Bush interrupted, "that whether .r her hand to steady herself. A numbness held her
not this dog Mangan dies I am to be killed?" body.
"Yes. You were captured red-handed, monsieur, "You will ask that?" she answered faintly
escaping from an act which can find no justfication "Can I forget that this man has sought to thwart
in the eyes of my people. You were rapturqd in the my wishes, that like a thief he entered my house, that
company of the ward of the man whom you attAked, he tried to kill me and* escape with a member of my
attempting to abduct her from those who consider household who, moreover; aided him in his vile pnr-
themselves her rightful guardians. And in the per- pose?"
sons of Captain' Nicholas and Monsieur Mangan, you She heard his hands .rustlc the sheet as he un-
have given insult and personal injury to two who are folded them and thrust them out straight on each
among the highest in the kingdom of Chrittophe." side until he lay stark as a heroic crucifix. The
"Does Mademoiselle know of what has befallen thought held her and she cowered aiatnat the door
me?" as though from a blow.
"She will know soon enough. Mangan will live. Back through years of memory she reeled. him.
Your assault was painful but not fatal," he added. To others, he had always been cold, cruel atid.untor-
Bush glanced at the jailer squatting in the corn- giving. But she had never before associated thii as-
er. "Perhaps when I am taken from here there 'will pect of the man with herself. To her he had been
be a chance. A quick dash. My ship; that Jls e, a distant yet splendid person whose casual caress had
the Hercules; she flies the English flag." ... warmed her affection. Never had she forgotten her
Samatan shook his head. "I carry but evil U.w, obligi&on; to him, she admitted, she owed all. One
my captain; the vessel of which you speak is g~io .ijt.alone that stood out from the even retros-
At dawn she sailed. You must find another way N 4 iit was the night he had told her of his de-
your freedom." ..'cilio tlhat the should become the bride of Pierre Ni-
"She has sailed!" Bush shrugged his ahouldr .4::, olas. She remembered the stifled cry of terror that
"Yes, that was the order. And yet! Huggett-I ad escaped her lpa how she had fled finally to her
would not have thought-but then-." He slapped gasmall white room and on her knees sobbed out her
Bamatan lightly on the shoulder. "Come, my tried, misery before the ivory crucifix above her bed. It
there are yet cards unplayed although we may.not hadr.releted her, :that. impassioned hour of com-
know their faces. Go now. I will not compromise ninao, Buat she haad:riae from her k i
you by your presence here. Perhaps I may need you numbed, itto a blind a
later. I thank you for your friendship which bade cest :~hpqeart
you come." s i : evening
The two men clasped hands. Gubo, see -e: ..m-v*er permit the
the meeting was at an end, unlocked the dq r ...6 :. pushed open the.great oak panel. They W91i; .on, accepting the bur-
and Bush heard the key click in the .100lo*a*:u4 'a#S: b he hope of an ultimate
sound of their retreating feet melt into thetta i. rs iu .
Casually he turned to the basket Sams ji ... S" ..i.isj tedI in a passing flash of thought the
brought. Beneath a bit of white cloth was arroasted evenings-that Nicholas had spent in the house of
fowl, two oranges, a half-loaf of wheat bread and a her guardian. Not once had she permitted the
quart of wine. Then his fingers encountered a knife slightest breakdown of the barrier. She realized
-a slim sharp dagger blade in a leather-sheath. With that the suave Pierre Nicholas felt embarrassment
a furtive glance he concealed the knife t ais breast.
Then he turned his head quickly, hias.. e catching
hold of the silence. There was the sound of feet in
the passage. I
I ITHE I







P PLANT E.R:S'


PUNCH


Sn her presence, and she raised higher the wall be-
tween them. To him she was inaccessible, incom-
prehensible.
Then came that evening when John Bush had
walked across the waxed floor of the candle-lighted
room and his clear blue eyes had sought her own.
Sthe touch of his hand had sent a tremor through
her. ,Vaguely she wondered It this was the answer
to her prayer; if this Yankee sailor in his bright-
buttoned blue coat was the hand of God stretched
down for her deliverance. She remembered him
vividly from the years before when he had visited
Le Cap. With the passion of budding womanhood
she had seized upon him and herolzed him in her
r daydreams, her lover and her champion. Ever
since she had first met him, two years ago, she had
played with his memory. So in the very hour of
her need he had come to her. Surely he had come
by the dear God's direction.
Wearily she regained control of herself. She
felt weak but strangely calm and composed.
S "Virginie!" The low incisive voice startled
her. She crossed the room to the bed.
"There is something I can bring to you?" she
S asked.
S "No. It is this: Until you receive my permis-
sion, you will not leave this house. Under no cir-
cumstances will you try to communicate with this
man or with any one concerning him. You will obey
me implicitly?"
S"I shall not promise."
From the bed came no sound or movement. She
watched the lean jaw protruding from the damp
napkin and the thin, firmly closed lips. She knew
those lips. Not a month past she had watched them
close in silence. That was the last night she plead-
ed with him to release her from his promise to
Sicholas. At first she had sensed his weakening. In
a cold way Mangan loved her as an austere father
loves his child. But his resolve could not be shaken;
he had closed his ears to her entreaties.
Mangan's long, white fingers groped along the
heet for the bell cord. Bending slightly, she put
the green tassel in his grasp. Far off in the house
she heard the metallic jingle as he pulled the cord.
That was all then. She knew he would not speak
again. "I am going," she said. "If you require me,
I shall be in t he mraI es, .Te,d ; etx? wil
come again I erv. A, ,..:: .,,'*. .:,.
In S the h '. a;
seirvas -.Nu Ohep snow-white hdir
S-'e -gave an indeation of his great
| W.. as' barefoot but Wore long and heavily
ad white cotton trousers and an old plum-
S6oured velvet coat which had been at one time the
property of his master. The old man shrank back
ipat the wall as Virginie passed, two rolling,
Hle following her as though he expected
'I er some new and unexpected apparition as
as the happenings pf the night before.
..though suddenly recollecting something, he
a' blagk fnger to his lips, his frightened eyes
Ill rolling grotesquely.
"Mademoiselle Virginie, man waiting to see you
in my house." His voice was a rasping whisper
and the French words came almost incoherently from
his toothless gums.
: HERE was no door to the cabin, built against
S the wall with half a dozen others; the small
S.w. washed buildings with their thick-thatched
palm presented a row of open doors to the
r ^ aden strip of earth that was the recreation
..:.. r MangaCs servants. Now only three small,
t ;I children' played quietly in the shade.

the door frame adjusting her eyes
y Then she saw a gigantic negro
int the corner and advance toward
aue.n him before and instinctive-
nt tt. 9Then she noticed a look
in the' ltssred her.


The ma
mouth. Then
queer clucking,
slow fingers he
a crumpled paper
spread it out. '
If you would save'
must not delay. It is wit1
Monsieur Mangan or Captaind


and pointed at his
MAd violently and a
Sihis throat. With
beland produced
le took it and

I ,1 friend you
r: either
.... S.. hI-


-- -'
Impetuously she raised her ii M *lSla .
a dozen questions on her lips, but the ei'l ok
,his head. Again she read the paper.' V ae l lhe
Tealied that vengeance moved swiftly at Lis -A
. -:.on understand me?" she asked. an oy
The antro's thick lips parted from his gleamin
*teeth and he nbdded, smiling in affirmation.
"Remember tiln," she continued. "no one amut
'know that I have seen you except the friend that.
egnt you. Tell him, whoever he may be, that I shall
"'.all that I can. You cannot speak, but you can
2eear: They will question you. You will shake your
head, yes. You understand?" He nodded again.
-* -- '...^


"You will perhaps. ee Captain Bush? Yes? .
Then, if he asks you, I am well and no harm come
to me. He must not risk his life again for me."
She turned and retraced her way beneath the
leafy roof of the garden path to the house. Who
this strange negrp was or whence he had come did
not for the moment occur to her. Her mind could
grasp only the single thought which those few writ-
ten words Implied.' Th'e life of John Bush was for-
feit and if she would help him her assistance must
be Immediate. Lerey Mangan and Pterre Nicholas-
either of them could save him. But would the man
who had been assaulted in his own house aid his
enemy? There were men who even under such a
circumstance might be moved ty her entreaty, but
not Leroy Mangan. Nicholas? Perhaps; there lay
her solitary hope.
In the dining-roam Luclen was setting the table.
It must be noon, then. The day was half gone. Al-
ready probably John's fate had been decided. Per-
haps by sunset, all would be over. The horror of
the situation salaed her with all Its terrible signifi-
cance: her helpleasmes, -the fate that awaited her
and particularly the fate bf this man who had be-
come to her a perionlfication of all the strength
and beauty and love of which she had ever dreamed.


EDWIN


THE sound of a horse's hoots startled her. Some
S one was coming up the drive. There was si-
lence. Then a man's step scraped on the floor of
the vestibule. She could hear it plainly in the
stillness. The steps came down the hall. In a mo-
ment the tapestry would be parted and he would
ntter the room. Only a few of her guardian's most
intimate friends came so unceremoniously. She
turned her head as she heard the rustle of the tapes-
try. Pierre Nicholas stood in the doorway, mopping
his beaded forehb&d with a yellow handkerchief. .He
was immaculately dressed in the uniform of the body-
gunrd of the Emperor; high black boots, white
L'reeches, and a green coat heavily ornamented with
old. His waistcoat was of cream-coloured satin with
brass buttons, and the high white stock about his
neck met in a heavy ruffle of soft white fabric.
"Mademoiselle," he said, bowing low, "a vision in
white in this quiet house is cooling on so hot a day.
I trust that you are in health and happiness."
Virginie studied him and his glance dropped be-
fore the gaze of her deep dark eyes. She saw before
her in the doorway a man of perhaps five and thirty;
tall, well built and alert in his every movement, his
sallow face slightly inclined to heaviness. 'His hair
was black and straight, the nose narrow above but


CHARLEY,


1925--26


I!


Producer and Exporter of Jamaica Rums.



HOLDER OF THE BEST MARKS:


Wedderburn's & Plummer's,

From 1' to 5 years old in Puncheons.

Can also supply very choice brands in Cases of 12 Bottles.





Buying Agents Wanted in all Important Countries.

CABLE ADD lBS: POSTAL ADDRESS:
"EDICHAELEY," 62-64 KING STREET.
JAMAICA. KINGSTON, JAMAICA.
A.B O. 5Tr EDITION {IMPROVED.)


HEADQUARTERS
IN JAMAICA FOR


JOHNNIE WALKER

Red. & Black Label
SCOTCH WHISKY.


J. & R. TENNENT Ltd.,

Ale Stout and their famous
Scotch-Lager.


CHARLEY'S V. S. 0.

RUM.

Very Special Old.


ALSO FULL STOCKS OF

BURGUNDIES, BRANDIES, CLARETS, LIQUEURS and SAUTERNES.


WM. GRANT & SONS,

Liqueur & Stand Fast

Whisky,


KRUG CHAMPAGNE,

The Classic French Wine.


CHARLEY'S "ROYAL

RESERVE" RUM.

Every drop 15 years old.


_~_I


- I






i. -' U


UNITED


FRUIT


COMPANY


STEAMSHIP SERVICE.


(Ni
WEEKLY SAILINGS Ti
I
from TO
P)
KINGSTON TI

FORTNIGHTLY To (si
SAILINGS ITi
UNITED FRUIT COMPANY.
40 HARBOUR STREET, KINGSTON.


EW YORK-CRISTOBAL, C.Z -and ATLANTIC
COLOMBIAN PORTS.
rough Bookings Via New York By Rail to all parts
of U.S.A. and Canada.
7--
Connections at Cristobal, C Z., for:-
ANAMA-BOCAS-DEL.TORO- PORT LIMON-
ELA, HONDURAS-HAVANA-NEW ORLEANS-
and for the PACIFIC COAST of
CENTRAL and SOUTH AMERICA.
ANTIAGO (Cuba) BELIZE Pto. BARRIOS-
ELA-Pto CORTEZ--Pto CASTILIA-


HEADOFFICE: 17 BATTERY: Pfl4iS
.. .


ELDERS & FYFFES, Limited.
.jl~-jJLkJ L JL1 1 -L/J) llllll ,U


FIRST


REGULAR R
WEEKLY

FORTNIGHTLY


CLASS


PASSED


SAILINGS

To J

TO 5


For Rates and all information, apply to':-
UNITED FRUIT CO.. 40 HARBOUR ST. OP
KINGSTON. JAMAICA.


LGER STEAMNERS.

FROM KINGSLN.
mouth Docks, BRISTOL.
ton Docks, LVERPOOL. ., "
TELA, HONDURAS,--
PORT LIMON, COSTA ^ ;
CRISTOBAL, ,CANAL,.i-2


ELDERS & ~PES. LTD.
3 l-32 BO 8~ 1, LONDON. W.C. 2.


I- a. ..;;W. -


- -.i


HOTELS:-


Myrtle Bank Hotel, Kingston;
Hotel Titchfield, Port: Antonio.


PLANTERS' PUNCH


1925--26


-~---- ----" --'---- ~- --


'---


I -- -








1925-26 PLANTERS' PUNCH


KINGSTON.


THE MOST MODERN


AND LUXURIOUS


HOTELS IN THE TROPICS.
REPLETE WITH EVERY DETAIL OF SERVICE AND EQUIPMENT.


THOMAS G. S. HOOKE.
RESIDENT MANAGER,
United Fruit Co.'s, Hotels,
Jamaica, B. W. I.


1925--26


PLANTER S'.


PUNCH


Ayrtle lank 3otel,








PLA TES'IPU CH 92I2


widened slightly too much at the nostrils; the mouth
was large and the lips, full and sensuous, were drawn
back slightly from a row of perfect teeth; the chin
was heavy and there was an Indication of fatness
about the jaws.
"Will you please be seated?" she said finally.
'There is something I would say to you."
With a slight indication of surprise he walked
across the room and sat down before her.
"You are, of course, aware of all that has hap-
pened In [be last few hours?' The colour was gone
from her face and her nails whitened as her fingers"
clenched the table rim.
"Yes, the story of these unhappy occurrences
has been brought to me."
"I love Captain Bush."
Nitholas had not expected her statement. His
heavy face twitched with agitation. With a forced
calmness he said: "I can imagine that a more than
ordinary interest in this man prompted your action
-may I say, mademoiselle, your most ill-advised and
incomprehensible action."
"What is to be the fate of Captain Bush?"
A look of malevolent satisfaction glinted in
Nicholas's eyes. He did not answer her question
Immediately, but watched the bar of sunshine that
lay like glowing metal on the floor before the door.
Then he answered almost casually:
"The Captain, this Bush, has now twice offended.
He has without provocation attacked an officer of
the Emnperor, and later, last night, he attempted the
murder of Monsieur Mangan in his own house and
the abduction of his ward. He is now a prisoner
In, ort Picolet. It is ordered that he be shot at
sunset."
A gasp, a quick intake of her breath, came from
the girl's lips. She swayed slightly, then she flung
herself into the great stuffed chair of Leroy Mangan
and her body quivered with the torrent of her emo-
tion. Nicholas got up and walked to her side and
laid his hand on her shoulder. As though touched
by a hot Iron she recoiled. Like a wounded animal
she cowered deeper in the chair as though to es-
cape him.
"Calm yourself, mademoiselle. This frenzy can-
not save your lover. There are other things that
can do more. Let us talk sanely and perhaps to some
purpose."
SLOWLY Virginle straightened herself. Her dress
had slipped from her shoulder but she was un-
conscious of the smooth, white curves that it dis-
closed. With a steady gdze of appraisal, Nicholas re-
garded her. His eyes were fixed on the white skin;


he -saw her breast rise and fall beneath the sheer
bodice.
"He is to die to-day" she repeated, "at sunset?"
"Yes. mademoiselle, unless--"
"Unless-- the word came from her with a little
cry. "You mean, monsieur?"
"You have forgotten our wedding day?"
"Our wedding day?" She repeated the words
without understanding.
"It has been set for Easter-"
"If'I die by my own hand, I shall never marry
you!" Her voice rose in a high scream as she
spoke, "No, never! Oh, the very thought is' m-
possible! You, you-I hate you! I loathe you! I
shall die before you touch me. Go!" Quivering, she
regarded him, a flame of terror and anger scorching
her cheeks.
"Softly, mademoiselle. Hard words are evil
messengers. You would save the man you love?
Bien! That yet is possible. I would marry you."
He leered at the bare shoulders. "There are reasons
other than yourself. Our wedding day is long to
wait for. A week, perhaps, and so you will promise
me, and this Bush lives! Ouif You say you love
him. and you loathe me, Pierre Nicholas, intimate
of the Emperor. How much do you love?"
Her momentary passion had passed. Dumb and
stunned, she looked at him. The shifting eyes
dropped before her. With an attempt at nonchalance,
Nicholas flicked the dust from his boot-top with the
yellow handkerchief
"You will barter his life for my body?"
He did not immediately answer.
"Do you not understand, monsieur, that I do
not love you, that the thought of such a marriage
is a terror to me and that I love this man whom it
is now in your power to save?. You ask me to marry
you; you desire that? If some esteem for me prompts
that desire, can you not be generous and earn my
eternal gratitude? Oh, monsieur, I beg of you, I Im-
plore you, be merciful!"
Nicholas shifted uneasily in his chair. Then a
cunning look came into the shifting eyes.
"You have my proposal, Mademoiselle Goutler.
My orderly is at the gate. Time passes. I go now
to Monsieur Mangan. Your answer will send ry
orderly to Fort Picolet and his life will be spared
Persist in your resolve, and I shall not again o~ler an
alternative. The life of your lover is in your hand.
Is it yes or no that I shall hear?" He walked to-
ward the door. "Eh bien," he continued over his
shoulder, "it is Iest that this Yankee cur should die.
Ouif"


"Monsieur," she said, hardly above a whisper,
"you will swear by the good God that this is the
truth, that his-life will be saved?"
"Yes, if-"
"Yes," the word burst from her, "I consent."
With a smile Pierre Nicholas thrust aside the
tapestry and walked down the hall to the room of
Leroy Mangan.

CHAPTER VII

THE sound of feet that John Bush had heard from
his cell grew loud in the corridor. The noise
stopped abruptly before the door. An order was
given, gun butts rattled on the stone, a key clicked
in the lock.
The young lieutenant who entered wore a worn,
green uniform and a gilt scabbard hung at his knee;
the bare sword he carried in his hand. He was a
tall, thin-hipped, wide-chested negro with akin so
black.that his face might have been cut from a, bloc
of ebony. Behind him a guard of six men stood at
shambling attention.
"Monsieur Bush," he said courteously In excel-
lent French, "you will accompany me, if you please.
The commandant-.desires your immediate presence."
He bowed-.id..Bpush returned the formality.
'The little room to which Bush was escorted was
damp and odorous. On the whitewashed walls,
names and obscene French words and phrases were
scratched or written with charcoal. Through the
narrow windows was a glimpse of the green of palm
trees and a fragment'.of -blue sky. Dirty straw lIt-
tered the floor and In one. corn l a low cot was piled
with soiled bed linen. A small table stood in the
centre of the room, and behind it, in a gilded chair
upholstered In crimson brocade, sat Antoine Pelletin,
commandant of the garrison of Le Cap Francalse.
In the slanting light from the windows Bush saw
a small man with close-cut gray hair and a face
striking for Its unmistakable stamp of cruelty.. He
was pot so black as the young lieutenant of the
guard; there was an ashen colour to the wrinkled
Skin that hung In pouches beneath the yellowish
eyes, an ashen colour .accentuated by a stubble of
gray hair on the broad square jaws and across the
upper lip. The mouth was loose and sensuous and
the. half-ppened .lips disclosed a row of teeth sharp
and irregular. Then he raised his head and regard-
ed Bush with a look in which hate and satisfaction
were clearly dominant.
"You ire convicted," General Pelletin began as
though he read from the paper in his hand, "of as-


; .: ... ____.._ ........_ .... '.....





Imperial Life Assurance Com ly 0ot Oa



\ JAMAICAN OFFICE: 71 BARRY STREET. KINGSTON
'rI


In every manner care has been
taken to so organise the business
as to series the Jamaican public at
the Branch
Office here.
Claims are
JAMAICAN paid, loans.


ORGANIZATION
-

) .


granted and
interim poli-
cies issued at
the Local


Office imniediately'on completion
of the necessary papers; In fact
the Imperial Life-offers, all the
advantages of a Local Company,
and in addition the high interest
earning kpoWfr of C-na.dian In-
stitutions. -.*- -, *= .


The Imperial Life Bonuses are
highly satisfactory. The surpiu
earned during the year siow* an
increase an'd::~ lcy-
holders. : ,conf-
denti sub-
BONUSES stan rn on


c ...


ance protect
., "'* .. '..

-


vt

-. ". % ., "
.. ..........- ~: ? .


LOANS are made on REAL ESTATE in Jamaica and every facility given or speedy rpt ent.
: >,... '


I III .. ... .~i ui... --- -- 1 .......... mmi...i .


at-


Lindo Bros., & Co.
50 Port Royal St ,
Kingston. Jamaica,
January, 1tith, 1925.


Mesrs Manton & Hart,
Agents Imperial Life
Assurance Co., of Canada
Kingston.


Dear Sirs,
I have your letter notifying
me of the Bonus payable on my poli-
cies with you. The Bonus ,riS lts
are very gratifying and far beyond
my expeotatious. Such results
prove that an Endowment Insurance
policy with the Imperial Life com-
bines life insurance protection and
investment i i a remarkably antis-,
factory degree: -
Yours faithfully,
PERCY LINDO.


pie from
ee in addi-
Life Insur-


; .,~sa*r:


- g


PL A N T.E R S' .


PUNCH


-1


1925--26







PLANTERS'


PUNCH


saultt with intent to kill on the person of the Em-
Speror's officer, Captain Pierre Nicholas; of attacking
With the same purpose Monsieur Leroy Mangan in
his own house, which you entered by force; with
i the attempt to abduct 'the ward of Monsieur Mangan,
S and with other acts of violence against officers and
Subjects of the Emperor." He turned his eyes--to
the lieutenant. "The firing squad at sunset."
Under his torn coat Bush felt his heart pound-
I' Ing; the sweat trickled in hot drops from his fore-
i' head. The horror of the situation sickened him.
Then he flung back his shoulders. He must not let
this man sense his agitation.
"So, I understand," Bush aild with a studied
slowness, "that I, a citizen of the United States of
America, am sentenced to be murdered without trial
or hearing. Mark you"-he pointed a finger at Pelle-
Stin-"my country will not suffer this insult to pass
unpunished."
"Bah!" General Pelletin spat on the straw.
"What Is it, these bragging United States, a race Of
traders and upstarts. Do we, who have run the
French and the English into the sea, listen to the
boasts of an American? Where is your flag? Have
Snot the English driven it from every ocean? Do I
fear a country such as that? No!" He glanced at
the lieutenant. "To the compound. You have heard."
From the corner of his eye Bush estimated the
distance to the nearest soldier. With a leap he
could reach the table. He could feel his fingers
tighten about Pelletin's throat. It was an idle
thought; death would only come the more swiftly.
A few hours at least of life remained. The lieuten-
ant touched his elbow. Pelletin's head was bent over
the strewn table. There was nothing now that he
could do or say; with his head erect he walked out
into the cbrrldor; behind him he heard the feet of
the guard rustling in the straw.
L E CAP was simmering in the sunshine; even the
palm trees seemed to droop in the breathless
heat. In the long street that edged the harbour,
dust rose from beneath every passer's feet and hung,
a yellow cloud, in the air. From the water the sun
was reflected as from a sheet of metal, and down
trom the high, green wall of Le Morne it was flung
back again on the stifled town.
Outside the walls of Fort Picolet a dozen negroes
uched in the shade. .With languid interest they
.- ehed John Bush and the guard emerge from the
: trance and turn down the street.
S. His hands were tied behind his back and Bush
could feel the cord bite the flesh. From his fore-
Shead salty drops of sweat coursed down into his
smarting eyes. His body ached and yearned for rest
sleep, A few hours more, he thought, and then
Suld be over, and a long rest begun
Ai bt". the '1'.iaprshy plain.
a-pla--,.
V dayshe bad.ridden past
I. that@ t bt aldgss


quagmire of
weather. From i i
twenty miles to tht :Rwh
range of towering mountains piled W:g:.a
barrier. And there, on a high peak overlooking tif
plain, was the citadel of the Emperor, and in the
green valley of Rlillot under the shadow of the for-
tress was the palace of Sans Soucl.
The dust caked his tongue and the cord about
his wrists pained cruelly. At the roadside people
stopped t gaze at him. They were black, of various
S" sihadeo:i jd types of features, and all regarded him
. :Wiki;t. ieidly eyes. A feeling of despair depressed
a sw. .had. be felt so desolate: in all the world
so place so alien and remote as this
vd :f.it the Haitian capital. He did not
': terror of the days'of French slave
Sp their primitive minds. He
h 'an, an intruder in a black
ma n'i ?1he black man and by the
:' black mai. sacrifce.
A few smlt a.ancnor in the harbour.
SBy now the HErcei~ l btlas well out to sea.
S There would be a brs~Eta beyond the Island's
lee. On the left th.e :1;1e up close to the
road. There was Sa iata' ..a beouse; there the
S Lucy had discharged her irgd: Ol the right a con-
S tinuous row of buildings.liblitaSb'tfA teet There was
Sthe Hotel de la Republiquei, : 1t ialed in the sun-
'.-. shine; within the closed shuttief'-t- air would be
S cool and damp and there would 6 tiknfigi to drink.
HiKe could hardly swallow for the a .. tb-s throat.
One of the soldiers pricked himlr&tb: ack with
the point of a bayonet. A tall, biti' girl at the
roadside laughed in a high, clear voice.''Ti iganOi-
of his position made his face flush hotlyt It was
Igood to realize that Virginie couldtindt see
I.ed captive driven by a band oa-tblck
1 place of slaughter. She was "ItS
'he must be again secure in Mam
San' -t4lt jHt had been brave, and she had
lared. all dt:i~rFi felt her clinging lips, her limp,
b:. O ody in thlWitter of his arms. Would she
ity Nicholas? SbflBtow the thought no longer
l' distubed him. He had flAher courage; he knew her
love, he was assured that Virginie would die before
'. she would surrender to Pierre Nicholas.
.;'" -,,, .. .


High, ruined walls flanked the right side of the
road. Through tall windows Bush could look at the
sky beyond. The masonry was blackened with
smoke, the stones cracked with the heat of flames.
The roofless rooms of what was once the finest man-
sion in Le Cap were new tenanted by a dozen squat-
ter families. In that wide dodrway Raymond Fer-
rier had died holding the entrance against the revo-
lutionary mob that illed the street, a black flood that
poured with fire and sword into -the frightened town
from the distant hills aid 1da ::the -iaoking ruins
of plantations -on the plain ifl eifebut' few days be-
fore they had been slaves.
BUSH often had heard stories of that terrible
night. Now it was his turn, but not to die
fighting; he was toa.meet death standing before a
whitewashed wall, shot down by a squad of ragged
negro soldiers. He wondered when his uncle would
hear of it. Perhaps never.. No, Huggett would re-
port to him. But perhaps Huggett would not know.
What did it matter? Virginie? He put the thought
from him; it could not, no, would not, be withheld
from her.
The tall lieutenant ..ordered a halt in the scant
shade of a fig tree.
"Monsieur," he said softly in Bush's ear while
the men squatted on the ground, their guns dropped
as a child throws down a toy, "it is hot; a minute of
rest will refresh you." There was a friendly glint
in the black eyes, an expression of pity in his face.
"Merci! Can you but loose the cord a little? My
bands are swollen with pain." He gave the lieuten-
ant a look of appreciation and a friendly smile curved
his lips. "That is better, my friend. I thank you."
Again they marched on. The buildings of the
town began to give way to native huts. Ahead was
the plain, shimmering with heat waves. There were
the barracks. A high wall surrounded a number of
buildings, a solid wall of masonry built of blocks
of stone evidently robbed from ruined houses in
the town. On each of the tour corners was a sentry
box and In the centre.of the eastern wall a low door-
way gave ingress. A couple of sentries in uniform
slouched about the entrance, which was further
guarded by two bronmi cannons placed on either -side '
and covering the road.
One of the soldiers pushed open the door and
in single file they went through It. As Bush passed
the shadow of the arch he experienced again the
sense of hopelessness that had possessed him when
he stood before :General Pelletin in the little room
In Fort Picolet. It was another step, irrevocably
taken, in the progress..of his destruction; another
door had closed between him and the liberty that
had- always been the very essence of his existence.
An indescribable stench greeted his nostrils-
the sweet, sickish smell of.decaying refuse, the smell
of a place long frequented by.unfortunate humanity.
in the shadow of the walls they swarmed like flies,
- .two or three hundred prisoners, men and women,
a.Sel~ i alf-naked bodies decked in thepitiful rags of
1iditai:garfments. With-smUien eyes they regarded
lot-as. a fellow suferer in their misery but as
,i:'i'a' hated white Mnan. An old woman, her
I:t Ufted by disease, clutched at his coat as
: -- mnll'i kuMI:hm iLn. a rasping voice. On
.' l 2~p!, tth e compound were the buildings
whea K gijiipidespewate prisoners were confined. It
was there h: ied, that he would be placed.
They. etiWAii e compound and the lieutenant
dismissed the g9 and conducted Bush to a small
room foul with refese of former occupants. There
was no light except through' the barred window in
the door through which'the gloom of the hall feebly
penetrated.
The lieutenant put a friendly hand on Bush's
shoulder. "I am sorry," he said simlily, "that this
must be. It Ls not wise that we should incur the
hate of another nation. If your friends hear of this
they will be angry, sh? Perhaps a ship of war
from the United States will come and ask for you.
An answer would be hard to find."
"I am afraid," Bush answered, "that is not like-
ly. We are at war with England. Her great navy
surrounds us. There are other matters of far
greater importance to the United Staten than the fate
of a single one of her people. You are my friend?"


The lieutenant looked guardedly belftfI him.
The corridor was empty. "Yes, I am your friend,
j but that cannot save you. At Fort Picolet Monsieur
Samatan talked' with you, and so I dare to be a
friend to you. He knows the order that has been
given. Perhaps he can help, for he is strong. He


/


Oar Departments include




Books

Magazines

Stationery

School Supplies

Perfumery

Drugs & Medicines

Confectionery

Photographic Goods

Victrolas and Records

Sheet Music and
Instruments

Sporting Goods

Remington Typewriters

Office Furniture

Ofice Supplies

Electrical Supplies

Fancy Goods






THE

Times Department Store


8-12 King Street


1925-26-


- Kingstonl


\ /



GORE LRMRTED


Import-Export Merchants

Food Products-Fruit-Produce, Etc.
Ice Manufacturers
KINGSTON JAMAICA


/ .


q


i






PLANTERS'


PUNCH


wears the ring of Dessalines. But you have angered
Nicholas, and he, too, Is a great man."
FROM the compound came a wild cry that filled
the little room, a long wail of anguish, terror
and anger. It was the sound of human voices, but in
it was an animal note that dominated. Higher and
higher it sounded. Bush looked inquiringly at the
lieutenant.
"What is that?" he asked.
"The prisoners," the other answered. His voice.
was reluctant and he turned as though to end the
Interview.
"They cry because-"
"You will hear the guns presently. The con-
demned are being marched to the wall. They, whom
you saw in the compound, sing their death march."'
"They will be-"
"Oul, monsieur. It is hard to speak of these
things to one who is soon to take part in them. They
go even now to the killing place. Twice each day
they march. Sometimes but one or two, more often
many. There is always discontent among the peo-
ple." Again he looked down the hall and his voice
lowered to a whisper. "Christophe is hard on his
people. These are political'prisoners that die thus.
They have talked too freely. They are many."
W ILD and terrible, the walling rose and fell; then
as though by the closing of a door the sound




FIRE INSURANCES ...

SHOULD BE INCREASED


owing to the enormous advance
in cost of Building Materials,
Labour, Machinery, Stock,
Household Furniture, etc., of
every kind.



Insurance Previously Effected May No w be
Totally Inadequate.


Call in and see me To-day If
you are not fully insured.


L. P. ALBERGA,
Attorny & Agent
GENERAL ACCIDENT. FIRE & LIFE ASSURANCE
CORPORATION. LAd.
18a Duke St.. Kingston.








ROBERT MARLEY




r '


ceased. Even more fearful was the silence. Neither
spoke. Each waited for the ensuing sound. Quick
and jarring came the rattle of a volley of musketry.
then a few seconds later three pistol shots. Shrill
and piercing followed the scream of hate from the
compound. Pandemonium had broken loose.
"It is always so." The lieutenant spoke weari-
ly. "They, too, will die, but in another way. They
starve 'there and the sickness comes. Even the
strong man, he does not last; it is too difficult to live.
The bullet, it is more quick, awd best, perhaps." He
put his hand on Bush's shoulder. "I must go," he
said. "Courage, my friend!"
Time passed with incredible slowness. Outside
-the barred door two ragged soldiers stood guard over
their prisoner. For a while Bush tried to overhear
their muttered conversation, but the few fragmen-
tary sentences that he caught were meaningless.
Slowly he paced up and down the little room. The
heat was stifling and from the foul floor and its
covering of straw came a moist, acrid odor that at
times almost overcame him.
Not yet, even, had he recognized the fact that
in a few short hours death awaited him. Through-
out his life John Bush had constantly experienced
dangers that held Irrecoverable alternatives. With a
twisted smile on his lips and a steady look in his
blue eyes he had played with life and death daringly,
it had been a game to him, this existence that had
been thrust upon him, a game in which the highest
colour seemed to glow when the danger was the
greatest. He had made money readily, and he had
distributed it again with a free hand. There had
been nothing for which he had desired wealth; no
one at whose feet it might be laid. Then had come
Virginle.
At the thought of her his face softened and he
stopped his nervous pacing and leaned against the
wall. So, that was over. If only her problem were
as completely solved as his own! He wouldwalk out
in the mellow evening light; there would be a volley
from the squad of ragged soldiers, and then it would
be over. He would not even hear the howls of the
prisoners that would follow. That would be all! But
Virginie would still face her living death.
-There was a scuffling of feet in the passage.
Some one was coming; the two soldiers assumed an
awkward attitude of attention. A voice inquired the
location of the cell of John Bush: he recognized
the voice of Pierre Nicholas.
"This is where you keep the white man who is
to be shot?" he asked. "Ouif Bien! Open the
door." The lock was turned and the door opened.
"Back there, to the far end of the passage, you!"
Nicholas continued to the soldiers. Then he stepped
into the cell and pulled shut the door behind him.
"Bon jour, Monsieur Bush." He swept a half-bo*'
at the silent man who stood watching him. "It is
unfortunate, indeed that we meet under circum--
stances such as these."
Steadily Bush regarded him. There was soake-
thing In the man's insolence and daring that alumbt
attracted him. Nicholas was the bigger man, but
Bush knew his own strength. A sudden rush! It
could be done. But Nicholas doubtless wa s aried.
Not otherwise would he dare to close the door be-
hind him and stand alone before a mortal enemy.
"Perhaps you will explain why you are here?"
Bush spoke slowly; distrust and scorn were evident
In his words.
"Ah, Monsieur Bush, that is simple. With so
little left of life perhaps you will listen td friendly
advice, 'eh?
"Friendly?"
"Is it possible that I could have another mo-
tive?" He glanced about the cell. "It is too bad
that we cannot sit, and over a bottle of wine, per-
haps, talk more easily. You would like to live?"
"Your question is offensive. I have asked no
mercy. I would accept none from you. If that is
all, please respect the short time left to me. Soli-
tude is nftilitely preferable to your company."
The fleshy face of Pierre Nicholas reddened per-
ceptibly'and a forced smile disclosed his white
teeth. "I am conscious of your dislike for me, but
possibly you would, consider the intervention of an-
dther. I have talked with Mademoiselle Goutler:
we made plans for our wedding day. She is so young,
so tender in the heart. It gives her pain that the
death of a friend should be necessary at such a time.
She has asked me to make other disposition-you
understand, eh? Perhaps now you will hear me?"
"I have made my answer. Captain Nicholas."
The desire again possessed Bush to reach at the
other's throat; a,passionate yearning to destroy this
creature who taunted him. Would it not be better,
he wondered, that they both die here on the mat of
filthy straw on the cold damp stones, than that.
Nicholas should live to carry out bis designs? Death:
waited him a few hours hence against th'e white.
washed wall. What matter if it came sooner? Then
he was conscious that Nicholas was again, speaking.
He listened to him, his eyes studying the other's
throat.
"It is that you will instantly leave this country;
that you will never return. Mademoiselle this morn-
ing repents her actions; she has asked the forgive-
ness of her kind guardian and myself."
"You lie!" Bush, spat the words romt his lips.


ICHOLAS ignored the interruption. "She is ten-
aer," he continued, "and begs you to accept
your life on that basis. She desires never agaiWs l
see you." ,
"I repeat: You lie! That Mademoisege hat- *
terceded for me even to you is possible; the rest is
falsehood."
"So you decline, eh?" Nicholas turned slowly
toward the door. "You forget, monsieur, that you are
young. The world is filled with young women. Is
it not childish to throw away your life for one young
woman you can never have? It is a fine gesture that
you make and a useless one."
"There is the door. You will honour me by avail-
Ing yourself of it."
Nicholas wheeled suddenly and thrust forward
his face. "Bah! You fool! You try to interfere with
Captain Nicholas and you see the consequence! I
shall think of you on my wedding day. You refuse
my mercy. Bien! We shall see who is the stronger.
The guns shoot and some one digs a hole for you.
No, that is not my revenge. You must be alive; you
must say to yourself, 'This is the wedding day of
Nicholas.' So! 'This is the night that Virglnie be-
comes the bride of Pierre.' It is not my pleasure to
have you dead. No, it is more pleasant for me that
on'that night you are alive to think of me. You live,
or you die, It is as I wish. A week from today I shall i
be wed; I beg of you to think of me."
As he spoke the last words Nicholas backed
swiftly to the door. With a jar it closed behind him.
Then for a moment his face appeared In the window. d
"I hope you will enjoy yourself. It is true that I
give you life because a woman has asked it of me.
It is yours, such as you will find it."
It would seeing only natural that this sudden re-
version of Bush's fate would have lifted him, at least
for the time, from the despair that. ld settled about
him; but it is to his credit that it wa not so much
his own life or death that then affect:edhha as the
words of Nicholas which told him of' th I.tpeding
marriage. In the main he believed what Nic4fptad
told him. To be sure, he had detected the eiw,~
falsehood that Virginie had desired him to leaver.ii
country; she would sacrifice herself, he knew, for
his safety; It was the way that Nicholas spoke that
betrayed the lie. But the wedding day-that was
different! There was something in the voice of
Pierre .Nicholas that bespoke verity. And the stay-
ing of his sentence beyond that day-there was a fine
cruelty in the act. Doubtless Virginie had persuaded
Nicholas to exert his influence and delay the sen-
tence, but undoubtedly the girl had never realized the
sinister advantage that Nicholas would take of the
fulfilment of his promise.
Vaguely he wondered what would ha"pe to ,
but always his thoughts tutae"bb ack t
girl with the great. ark eyes ito I
he had seen burn the glinat e love ..as ha il er r
face up to him. Again and again the aw her, but
never could his ta jy complete the- picture. There
wa one .harp tail and then aa a, and occasion-
4lty a haunting, tantal$ing vdton of her that, when
he tried to see it more vividly, faded completely. He
could see ]er mouth, the full, red parted lips and *
the white teeth; and now he felt again their warm 4
pressure against his own, and her hair against his
forehead. His arms were about her; her breathing
body suddenly became limp as she relaxed in his em-
brace .. ....
In the compound a tom-tom was beating, a weird,
'monotonous booming. The cell was almost.ip adur-
able with the heat of the afternoon sun that.il d
down on the flat roof. He sat down cro.mriie
the corner, faint with the heat, with lactk ofeood,
and with infinite weariness.
SAgain his thought recalled the.- at. Never had
he loved before; this was the fl~teagnpe on of the
pent-up emotion that he had c~AIl8.ce boyhood.
And because it was the flrti-:tbed as though his .,
love rushed from him uSalied. Suddenly the
gates of reserve had bid .ed; uncontrolled his
love poured out fromhit :V soul.
Outside, the wheels ,a wagon rumbled in the;..1:
compound. He h0i* torses' hoos.
But Virgi'f-Lner before had he imagiw j~. a
woman could :aJ'i~ter his will. Not by-m en
thing didlaba.- 4 him; it was the rare blending of
her chastafc-risat had turned the whole direction
of his life,. Iner was all the breeding of ancestry,
and the ealttie of France combhmd with that tre-
meandoaueastionalism that reflected the fire in her
souL. -.e:could he calm, gentle, clinging in apparent
weaknas, and she could grow white with anger, and
liren with:u passion that left him shaken by Its inten-
.sty, .Now she was to become the bride of Nicholas., i
(leirly be saw and understood; she had bought his
lUfe, bought It with her delicate white body.
If only she had let him die! But uo: i.t'f
would not have saved her, unless by .he'
she had chosen to join him in death;U .l 'ayes a !'
It was so soon. "Seven days; sem is*. He re-
peated the words: then he gotely to his feet,
There was the old light again it_ s'wide, blue eyes.'
Seven long days in which toftlw Fate. Love and
life were the stake. FluNp-afisl face was the chal-
lenge. In some way he *6td find her, would save
her from Nicholas. fAgiM he saw the great, black
eyes, brave but app'lha g. A smile quivered his lips.
""" ^x''''.


1925- -286


WINE & SPIRIT


MERCHANT








146 HARBOUR STREET,

KIIGSTON, JAMAICA,
B"". IM '


Bac-~---------


_ __







1925-26


':?


PLANTERS'


PUNCH


CHAPTER VIII


D OWN the corridor came footsteps. The door
Opened, and the lieutenant flung his arms about
Bush's shoulders. As he began speaking in a voice
thick with emotion, he released Bush and regarded
him at arm's length. The black face was alive with
gladness.
"Monsieur! Mon ami, there is an order from
Captain Nicholas, an official order, that your life is
to be spared. Mon ami. it is a miracle that he who
hated most should show such pity."
"He has himself told me."
"Ah, he has been here in his mercy. But you
do not know." His face grew grave. "It is not free-
dom yet. On Le Bonnet I'Evdque the Emperor com-
pletes his citadel.
"Five thousand labour there, of whom many are
prisoners. It is there that you are to be taken, mon-
sieur. Be brave; be strong. It is not a certainty of
life that has been granted you, for thousands have
died at that bitter work; but it is at least a better
thing than a bullet, and"-he kicked a hole in the
straw-"a grave that is not deep enough to keep out
the dogs."
"I go?"
"Now! The day is late. Already the sun is low
against Le Morne. To-night the prisoners march along
the highway to Millot and the citadel. It is with
them that you will go."
He fished beneath the gay coat of his uniform for
something at his belt. "1 am sorry," he said, "that
it must be so." He held out a slender chain that ter-
minated in bracelets of rusted steel.
Bush held out his hands. The -warm smooth
circlets embraced thear.
S "Good-by." The negro held out his hand. "We
cannot speak again but perhaps some day we may
meet; you may find freedom and you will not forget
Jean Riou, who had only friendship to give."
Their hands met. "I shall not forget, I thank
you."
"Come." He led the way to the door. "You will
walk ahead with the guard."
Ow either side a ragged soldier fell in beside
Bush. No one spoke. With eager lungs he drew in
great breaths of the warm air of the corridor. After
the stifling heat and stench of the cell it seemed pure
and almost invigorating. A glare of sunlight struck
his eyes as they passed through the door to the com-
pound. There in the late light of the afternoon it
lay much as he had seen it in the morning a few
hours ago, hours that seemed as long as so many
days. Only the black swarm of prisoners had shift-
;: ed their position; now they clustered in the shadow
western wall.
a.- guard shuffling at his side he marched
to N'itle. The thought of escape was upper-
most i4n hi allid, butit seemed not the time. Then
he began h:, row they would get to Millot,
and when .th'gofD trimeare would tart He was
thus speculatit itSi;ita -ilart;seimtd ^sadd him
look sharply beflind hi.: .fae *westtr wall
of the compound the weird cry that tbeWtd heard at
noonday welled louder and loaBer in the quiet air.
More even than the first time he had heard it, was
he struck by the strange, animal note in the massed
voices. There was no tune or rhythm. It wai.a wail-
ing sound, plaintlv, melancholy, awe-inspiring.

FROM one of the buildings three men guarded by
a dozen soldiers walked across the compound
at right angles to the direction in which Bush was
being taken. Curiously. he watched them approach
as their paths converged. All three had their hands
pinioned behind their backs; all were hatless and
the disorder of their clothes suggested some days at
-lest of imprisonment. They were black, but he who
walked in the front showed in his lighter skin a cross-
isg .'qf.White blood which was also evident in his al-
moist'utlntli features. All tere obviously persons
o! some Intelligence and standing In the community.
One of the soldiers turned to Bush, a grim laugh
in his throat. "That man there"-he indicated with
a toss of his head-"he, all three, go to die." Then
he added. with ignorant awe in his voice, "Christophe
is strong."
They passed. "Christophe Is strong." The sen-
tence rang in Bush's ears. Like a reincarnated Ne-
ro, this black despot ruled his kingdom. Under him
the people, ignorant. superstitious and cowed by fear,
slaved at his harsh command. The power was placed
in the hands of a few chosen officers. And the firing-
squad, or death in -some other form, awaited those
who dared question the right and justice of the Em-
peror.
The sun had sunk well below Le Morne, which
i now rose exaggerated in the blackness of its shad-
ows. Behind the clean-cut crest the light of the sun-
set flamed up into the blue, bars of golden, light that
radiated and faded imperceptibly, a luminous haze
as from tie door of a mighty furnace. And now with
the evening came a tremor of air from the sea; an
air faint, cool and saline that stirred among the
fronds of a royal palm before the gate, moving list-
lessly the green plumes as though with idling fingers.
Inside the gate a dozen men were collected, man-
acled in twos. wrist to wrist. All were negroes, big
powerful blacks with broad shoulders and lean limbs.


kInk4ia
SIIn S ..
maUn-g- b.-
-- SSE


Throughout the World

More People Ride on Goodyear Tyres

Than on Any Other Make.


If it runs on petrol,
it will run better
on GOODYEAR.

NEXT TIME BUY GOODYEAR.





Retail Dealers Throughout the Island.


BRYDEN & EVELYN,


Wholesale Distributors.


Sd--%


P I~nnuonnn~-nn~.......Illlllmnll**nllvll YI~IIII~.IYY~IIIII*IYIIIIIIIIX~YIIIII -


-..............






40 PLANTE RS' PUNCH 1925-26


It was evident that the Emperor fed only prisoners
of Intelligence to the firing squad and conserved the
young and strong offenders for the great building
operations with which he was chiefly concerned.
Bush studied their faces. There was no chance
of help here. Low-browed, thick-lipped and sullen,
they returned his gaze from steady eyes that seemed
to reflect no thought or emotion. A few had squat-
ted in the dust; the rest idly regarded their cap-
tors or tinkered with their manacles, as a dog will
worry with the leash that ties him.
The wailing of the other prisoners had stopped.
Arrested by the silence, Bush turned and with eyes
wept the walls of the compound. Even as he look-
ed, from behind one of the buildings came the sound
of a volley of musketry and as it died away in a
feeble echo against Le Morne a wisp of thin white
smoke rose above the roofs and the wild cry of an-
ger and terror burst again from the black throng in
the shadow of the wall.
A feeling of mingled horror and disgust made
Bush turn away his eyes and look down through the
gate to the blue water of the harbour. A little turn
of fate and he might now be lying.there in the dust.
But what was the price of his deliverance? The
thought sickened him more than the thought of the
death that had been averted. He must not weaken,
he told himself, too much depended on his strength
and resourcefulness in. these brief seven days that
awaited him, days fraught with disaster or success.
T WAS night when they started out along the broad
white road that led south from Le Cap Fran-
caise to the mountains. On the left, the harbour
lay smooth and black in the starlight. Salt marshes
were on the right, dark blotches of low vegetation
broken here and there by expanses of saline soil that
glittered like snow. Far ahead under the pale blue
night sky the long wall of the mountain stood as
though offering an impassable barrier to the people
of the plain, a towering frontier behind which des-
pots might find security from all the world. White
lay the road, a long wide band of whiteness, curving
slightly from the harbour. The dust was thick and
soft and irritating. Here and there great flags of cut
stone indicated that the way bad once been smoothly
paved. Now it was rutted and broken, another tragic
memory of a departed civilization.
A dozes soldiers marched with the prisoners, and
in the rear followed an officer on horseback. With-
out order they marched, a black cluster of human
beings stumbling forward in the starlight. No par-
ticular attention was paid to the prisoners by their
guards; the shackled wrists made escape impossible.


And In this strange company John Bush found
himself, each mile that passed putting him that much
farther from the house of Leroy Mangan and the girl
who at that moment was watching with tired, wist-
ful eyes, the same stars which illumined the road to
Fue citadel.
She was sitting in the garden, on the same seat
where, another night which now seemed long ago,
she had sat with the young Philadelphia captain and
had first heard from his lips words of love.
Within half an hour she would bear the sound
of Nicholas' horse on the drive. Then he would stand
Tn the doorway and call to her. For the first time in
her life she desired his presence, for to-night he
would bring news of the man who alone filled her
heart; the man who at this very minute was stum-
bling along the ruined road in the starlight to the
slavery of the citadel.
Then like an echo to her thought she heard the
beat of a horse's hoots, and a few minutes later Pierre
Nicholas called her name.
She answered, "Oui, monsieur," in words scarce-.
ly above a whisper, but he heard them and came down
the low, broad steps. his spurs jingling on the stones.
Then she felt him sit down beside her. .That was
where John had sat; that he should sit there in the
place of her lover filled her with a flare of anger. She
got up quickly and with her back turned to Nicholas
gazed blindly into the capacity of the shadows.
"I have kept my part of the agreement, Virginle."
His voice was smooth and placating.
"He lives?" she questioned.
"He lives!"
!'Is that all you have to tell me?" she cried.
"That he lives, mademoiselle-is not that enough?
But I shall 'tell you more. Already he sails on his
way to the Mole and from there he will by some ship
reach America without difficulty." He paused, but
the girl made no sound; and he continued, evident-
ly satisfied that she was accepting his story. "I Wish
you could have seen his gratitude, mademoiselle: it
was touching. That bravado of the American Was
gone absolutely. The fear of death was In his face.
He could not start quickly enough. I assure you."
She turned and faced him. "Pierre Nicholae, I.
do not believe this. Too often in little things have
I known you to forget the truth, to believe now this
incredible story. If John Bush lives-and that I doubt
-he has never left Le Cap in any manner such as.
you describe. What proof do you bring me that he
lives?"'
With scorn she watched the heavy lips struggle
for an answer. In the starlight his face seemed very
white, a bloodless mask.


"John Bush lives, I swear it. But for the last
time you have seen him. That I have preserved his
life is sufficient. Now you must keep your part of
the bargain." He spoke slowly and with a tinge of
anger.
"Bah!" Virginie tapped the stone with the tip
of her slipper. "1 do not believe you. Bring me proof
that he lives. Your word means nothing to me."
As though to strike her, Nicholas sprang from
the seat, but the girl stood motionless, her impene-
trable eyes steadily fixed on his.
"So!" His votce was thick and the words came
like a snarl. "This is a woman's trick! A proof!
You but seize on this to crawl from your promise.
But I, too, little one, can play the same game. A
week? A week irom to-night? Ouif Perhaps the
time is too long for you to wait. If you would delay,
I would hasten."
He turned and took a step toward the house. "I
go to talk with Monsieur Mangan. In my absence,
mademoiselle, remember my words. It is not-well
to cross too far the will of Pierre Nicholas."
M OTIONLESS as a statue, Virginie stood until he
was gone; then she flung herself on the bench,
her face buried In her hands. Was John Bush alive?
The horrer of the uncertainty numbed her brain. The
story of the sailing vessel and his gratitude for the
opportunity to. escape was incredible. But if he had
not left the island, where could he be concealed?
There were dungeons in the foundation of Fort Pico-
let where he might be put away to linger and to die.
That was more likely. But what reason was there
for her to believe that Bush was alive? Surely, for
the purposes of Nicholas, it were better that he were
dead; Leroy'Mangan, she knew, Would-have no com-
punction.
There was a faint crunch of gravel Bn tDe-path.
She peered into the inky shadow. That was a foot-
fall-there could be no mistaken the sound-but no
servants used that path. Who could be spying upon
her at this time and place?
"Who Is there?" she called In a low, firm voice.
There was no answer, but from the blackness a
man .came into the starlight, silently as a niAving
shadow. There was not even a perceptible sound of
his feet on the stones of the path. She retreated a
step with a little startled intake of her breath. Then
she recognized him. It was the man who had come
to'her that same morning. She pointed to the house
where the open doors glowed with the bright yellow
light of candles and raised a cautioning finger to her
(Continued on Page 49)


CARGIL CARGILL & DUNN, Genel Agts,

4 DUKE STREET, KINGSTO1n
N-_.- ,--- ,--'"-"-'r" **'"
%,


WT4J'U


YOUR.RES" E FRT
9"-"..


SASSO& MILLER




We sell goods

of quality and

distinction.




We offer you protec-
tion against anything
that makes shopping
unpleasant.




We specialize in
Ladies' Dress -Goods,
Hosiery and Men's
Outfitting.



Our stock is unri-

valled for quality,

selection and good

value.




SASSO & MILLER. 81" KING ST,
KINGSTON.


THE CROWN LIFE MAN



WILL SHOW YOU HOW BEST

TO ADAPT YOUR INSURANCE: .

TO YOUR NEEDS AND TO Y I'*

INCOME, ON THE MOS1 :FAV-

OURABLE TERMS..' .









CROWN itFE INSURANCE

.C COMPANY


71


.. :.;,: .









eeeeeeeeee*****************************************************************************************************ee


OUR TOBACCO INDUSTRY

AND THOSE WHO BUILT IT UP
e**************************************************************************************************************


W HEN the members of the Parliamentary Delega-
tion, headed by Mr. J. H. Thomas, came to
Jamaica in January, 1925, one of the places that some
;-:. t them visited was the tobacco manufactory of
t!.the Miehado Company in Victoria Avenue. Those
vh'l Sit so expired themselves as most interested
b:at they :sq, aud one can well believe them.
,~;.ia idp...t-,-ie modern establishments of
.ranufqtory conducted on up-
e tyn'ged that it combines tro-
s ffletency and convenience.
-t411ik a long, low, single-
ipbae, natt like a
Jhi f cing:* clgars
Miiai tr~fre cin one
one is shown "hss .hPi-rd enS white,
which might easily be a w 0r1had, dt p.arlWtps was
one at some former time. In Kingston, When one
wants to visit the city's tobacco factory, one is taken
to a long house, with red roof and green Windows,
open and airy and situated away from the dusty
thoroughfare. In front of it is a spacious lawn
with. hedges on either side, the lawn itself being
n'sli ed from the street by a low ornamental
|.: er fence and a broad strip of concreted
T..he hedges, all vivid green and scarlet,
:i lawn, the bright fresh paint of the
he':iarmonise with the blue and gold of
I*. and It is here that the famous
and cigarettes are made. But the
goular purposes alone, it has a
S fttalar use. Pass by this factory
Idn ytime from four o'clock, and
you af~t~ Ms being played. The play-
ers are thlhe t factory. The lawn was
Made for thi b 'ic i~ded for their recreation,
just as the i was designed with a
view to their cols~a A:A t Ltaenience, for this To-
bacco Company hi l a~iuidii e...that a happy spirit
means a good worker:.ia. that pleasant surround-
ngs conduce to eftilemb g.
S OULT enter the factory ainy tiOj. rr eight in the
I forenoon, and you n will l mena and wo-
Smen at work. The making of t iedone by
inecial machinery, machinery vWifhri e seems to
think, but which is tended and ti y skilful
:hands. The making of cigars is a tiTqr the hand
4 ly, and each brand of cigars has 'j;t' one lever
o. These are paid by results, and as'.he cigar
s2 a skilled workman the pay is suot 'When
et demand for Jamaica cigars th l eti-
P :,irdly time, being proverbially gelteron '.
rl tth.j ira. They are also known as a m64 1;
]M ttellttigst iU. i citizens. taking an interesting '
.unbic matters Iiand what the uninformed stranger
Seipect.
The.room n Which they work is airy and well-.
4ighted. A part of it is shown in one of the illustra.
Mions on this page. Often a bhum of conversation is
heard; but often a worker Is too absorbed in his


;i


occupation to pay attention to anything save the job
to be accomplished. He is dealing with expensive
materials. Mistakes will cost the factory dear. So
brain as well as eye is concentrated on the work, and
from shaggy, shapeless masses of tobacco swiftly
emerge long dark rolls and then the perfect cigar
as we know it. These are taken to another part of
the factory to be banded and packed into boxes
made from cedar and excellently finished. Then these
boxes are sent to the downtown selling depot, in
King Street, to hundreds of' places in the island
where the Macbado products are sold, and to different
countries. Some of the cigarettes go as far as China.
And so, in scattered quarters of the world, the name
of Machado is known.
You can buy these ligars in the Strand or in
Piccadilly to-day, you can buy them up in San Jose
de Costa Rica, they are in great demand in Panama.
They have an excellent future in England. With the
preference now given by England to Empire tobacco,
the Jamaica cigar and cigarette should steadily win
to popular favour with English smokers. For the
Jamaica tobacco is of very fine quality and has only
to be known to become a serious rival of the famous
Havanas.


MESSRS. Machado are, of course, a branch of the
British-American Tobacco Company, but the
Jamaica factory enjoys an individuality of its own.
It is under the personal management and control of
Mr. Pedro Machado, a Vice-President of the British-
'American Tobacco Company, and a direct descendant
of the original founders of the business in Jamaica.
Emigrating from Cuba some sixty years ago, when
Spanish misrule had driven all the Cubans of the
better classes to vigorous protest, the Machados set-
tied in Jamaica. They had capital, brains, energy,
and an unequalled knowledge of tobacco culture and
manufacture. They started in business here; they,
and other emigrants from the neighboring island,
made the tobacco industry of Jamaica. They found
that Jamaica possessed excellent tobacco soils; they
trained the natives; they began to supply the local
market with cigars and cigarettes and then to create
for these articles a market abroad. Other factories
came into existence. The well-known Golofina Cigars
were manufactured. the capital being British-Ameri-
can. Then came the merging of the Golofina and
Machado factories, with a saving in expenditure; but
cigars bearing the names of "La Tropical" and "Golo-
fina," respectively, are still manufactured, though the
direction and factory are under one management.
The tobacco industry is an important one to
Jamaica, and it will grow. Mr. Machado says that
there is plenty of good tobacco land in the country,
and constantly he is experimenting at the production
of new varieties of leaf. He has succeeded In cul-
tivating a leaf for cigarettes of a golden hue and ex-
quisite flavour; he believes that what Virginia can
do Jamaica can also do, and he is going to prove it.
IN Cuba and Porto Rico the native cigars and cigar-
ettes are heavily protected; in Jamaica they
have to bear an excise duty more or less correspond-
ing to the import duty levied on the foreign article.
Thus the industry cannot be said to owe anything to
Government assistance. It has had to stand on its
merits alone; and those merits had to be high for it
to survive. At first, and up to quite recent days, it
was apparently not regarded as a very important in-
dustry to Jamaica. But opinion has changed; its
potentialities as well as its actual position are being
recognized; the attitude of England towards Empire
tobacco is regarded as likely to have a highly bene-
ficial effect upon the Jamaica tobacco industry., In-
deed, Jamaica cigar manufacturers could of late have
done a larger trade with England had they agreed
to make cigars to be sold there under the name of
some English manufacturer. But this they have con-
sistently refused to do; Messrs. Machado especially
contending that every cigar purporting to be Ja-
maican must be of a quality that will uphold the
reputation of the Jamaica cigar, and this could not be
guaranteed unless the name of a Jamaica factory
were stamped upon it. By the care of this firm for
its reputation Jamaica benefits. And she will benefit
still more in the future.


THE PACKING BOOM WHERE THE VARIOUS BANDS ABE SORTED AND PACKED






PLANTERS'


PUNCH


1925-26


The Jamaica NJobility

(Continued from Page 27)
ed to reward his virtuous exertions. Reduced to
despair, he was about to stroll homewards, having,
as he expressed it to himself, been made a fool of
by Douglass and Matilda, when, a little way up the
street, he caught sight of a man standing still and
evidently observing his movements closely. --
Mr. Proudleigh's heart gave a violent leap. The
old gentleman, though animated by a curiosity which
was almost religious because of its Intensity and
of its origin in a firm belief in human depravi-
ty, and though ready sometimes to indulge that
curiosity at the risk of serious personal conse-
quences, was not a man of the type from which the
heroes of adventure are drawn. You could never
think of him as leading a forlorn hope; you would
rather feel that at moments of rapid retreat he
would always be ready to show the way, in person.
fe was ready to show the way now, to himself, but
apart from the fact that his knees were trembling
and his legs evinced a strange disinclination to
obey the command of his will, an instinct warned him
that to attempt to move off would assuredly render
him liable to grave suspicions and perhaps an un-
pleasant encounter with the police. The man watch-
ing him might be a detective, his prolonged scrutiny
of Mortimer's residence might be regarded as a pro-
fessional burglar's survey of a crib which he intend-
ed to crack later on in the night, when all honest folk
should be asleep. These reflections came crowding
into Mr. Proudleigh's mind and determined his line
of action. Inwardly cursing that devotion to the
cause of marital fidelity which had led him to try
to spy upon Matilda, the old man tremblingly walked
towards the silent watcher with the intention of
asking that person if he knew exactly where Sir
Mortimer Slimslam lived. An answer in the nega-
tive or in the affirmative would have sent Mr. Proud-
leigh to the gate of the house in question, and the
detective, waiting to see what should happen, might
be a witness of his polite even if not over-cordial re-
ception by the Lady Matilda herself.
But as soon as Mr. Proudleigh got near enough
to the man he dreaded, he experienced another shock
of surprise. Standing there was Mortimer himself,
whose comparatively early return from the scene
of his night's duty Mr. Proudleigh had never once
taken into consideration. Mortimer had perceived
in the semi-darkness of the street a man reconnoitr-
ing before his premises, and had, not unnaturally,
paused to observe what the fellow intended. His
recognition of Mr. Proudleigh took place a second
or two before the latter was aware who it was that
had been remarking his movements, and as Mortimer
had nothing on his mind he was not disconcerted as
Mr. Proudleigh was.
"Hallo." said he to the old man, "what you doing
before me house at this time o' night? Anybody sick
at home?"
For one wild moment Mr. Proudleigh thought of
announcing the terrible illness of Samuel his son-in-
law, or of Susan, but even as the thought entered his
mind he knew that that story would not do. For if
it were believed, he could only explain his presence
there as due to a mission of appeal for help, which
would infallibly bring Mortimer to Jones's house at
once.
"Nobody sick at 'ome, me dear Sir Slimslam,"
Mr. Proudleigh assured Sir Mortimer volibly; "not
a single soul sick. In fact, them is all quite well
and will come to see.y'u as soon as dem can. How is
yourself? A man like you ought to 'ave perfect' good
health, for y'u work hard and you is a noble gentle-
man."
Here Mr. Proudleigh paused in the vain hope
that the conversation of the night would be entirely
confined to the subject of health and its everlasting
continuance.
"But," laughed Mortimer pleasantly, "I sure you
didn't walk all this distance from you' house to my
housee to ask me about me health, Old Massa. Some-
thing must be hup. What bring you out here so late
to-night?"
"Mr. Mortimer," replied the old man firmly, "it
is a vtry nice night."
'"The night is all right," answered Mortimer, now
slightly puzzled and wondering if Mr. Proudleigh had
been looking upon the rum when it was red with too
loving and prolonged a gaze. "The night is fine. But
you didn't leave you' comfortable 'ome to come an'
tel me so. Yet you must ha' been waiting for me,
for' notice you was trying to peep into me place
an".qiake no effort to go Inside. What is hup?"
"I wasn't trying to peep into you' house, Brother
Mort, my most noble lord," asseverated Mr. Proud-
lelgh. "You know better dan anybody else dat I
wouldn't do a t'ing like dat. I was only looking An'
if a man have eye, him is supposed to look."
"That is all right," Mortimer readily agreed.
'But a man will only look If him see something or
expect to see it. An' if you walk a long distance to
come an' look into me house after ten o'clock at
night, it mus' be because you expect to see some-
thing. -Why you afraid to tell me what it is?"
"You t'ink I would be afraid of you, my mighty


duke?" gasped Mr. Proudleigh, whose terror was now
getting the better of his wits. "I would throw me-
self upon your supplication instead of run away. You
are de sort of man dat-" But, for the moment,
Mr. Proudleigh could not decide what sort of man
Sir Mortimer was, and so left this important matter
in perpetual obscurity.
Sir Mortimer was not a person of giant intel-
lect. He had not the intuitions of genius. He was
merely a very competent young waiter who had
made in salary and tips a comfortable living, and
who had been recently elevated to an Order of
Knighthood, which doubtless he adorned quite as
well as, in their respective spheres, other knights
of other Orders did. But it required no giant In-
tellect or flash of genius for him to grasp that Mr.
Proudleigh had come to his house that night for
some special reason he was endeavouring to con-
ceal. This conviction, not unnaturally, made him
resolve to find out what Mr. Proudleigh had in
mind.
"See here, Mr. Proudleigh," he said with a per-
ceptible note of anger in his voice, "you can't fool
me. Here I am, coming' from me work to-night, an'
I find you outside me domicile like a thief in de
dark, prowlin' about an' peepin'. An' when I see
you, y'u run towards me to tell me the night is a
nice night, an' that you wasn't peepin' but only look-
in'! What it all means I got to find out, for this is
police business. I know and respects y'u, and I
knows you' son-in-law and daughter, and all you'
family, but them can't be aware what you doing to-
night, an' if I call a policeman an' give you In charge
for suspicious conduct, them won't blame me for it,
they will say it is your fault. So you know now
what I going to do."
Of course, Mortimer intended to do nothing of the
sort. He was much too good-natured a fellow to
adopt any such course; besides, he would not have
offended Mr. Proudleigh's family for worlds. But
Mr. Proudleigh, fear gripping at his heart, could
not have been expected to reason calmly at that cri-
tical moment of his life. He did not realise that no
policeman could possibly arrest him for merely look-
nlg at another man's house. Sad to relate, he al-
lowed himself to be bluffed completely. He felt that
he would have to tell the truth, but must tell it in
such a way as to show himself to the best advantage.
"Sir Mortimer, me lord," said the old man, "it
Is because I respect' you dat I am here to-night."
"Thank you, Mr. Proudleigh," said Sir Mortimer
calmly.
"I am you' friend. "
"Go ahead, sah."
"I don't like to see nobody teck a mean advan-
tage of you."
"I don't like It myself," said Mortimer with con-
victLon.
"An' when I see.de way Mister Douglass put you'
wife in a 'bus to-night an' drive 'er home, I may
to meself, 'If Sir Mortimer was 'ere, Douglass would-
n't do dat, an' him not acting fair and square to my
noble knight."
"You mean. you mean?" queried Mortimer.
"What you mean?"
"I don't mean a t'lng, my friend Mr. Proudleigh
hastened to assure him, for he did not like the
tone in which Mortimer had asked his brief but
pointed 'question. "I don't mean a single t'ing.
But I teck thought an' say to meself, I must protect
my friend' Sir Mortimer interest. You don't know
what kine of man I am yet, Mortimer. I are a good
man. You ask anybody about me an' hear what dem
say. But I will 'ave to tell y'u good night now, for
I feeling' tired, an' me foots is even weaker dan when
I was in Colon. So ef you will excuse me-"
"I not excusin' you a dam!" said Mortimer brut-
ally. "You will 'ave to say more since you say so
much already. What do y'u mean about Douglass
putting me wife In a 'bus an' bringing' her 'ome? Is
that all you means to say, or you 'ave something
more In you' mind? Why you come all this long way
to peep into me housee from de outside? Why you
try to. tell me a lie 'bout how the night Is fine? What
you trying' to say? What do you know? What you
see Douglass and Matty doing ? Remember, I don't
forget you are a old man, but don't go too far with
me. I advise yu to be very careful to-night, Mr.
Proudleigh, for sometimes ole people gets 'urt."
Mr. Proudleigh already knew that only too well.
Once or twice he, as an old man-it semeed to him
he had always been old-had got hurt badly, and
he desired no further experiences in that direction.
But what was he to do?
"I only wanted to see fo' meself, Marse Morti-
mer," he murmured brokenly. "I didn't means no
'arm."
"Y'u mean,' said Mortimer, "that as you want
to mix up me wife name with scandal, you, a old
sinner that ought to be in you' grave, come all
this way to-night to spy upon 'er. That Is what.yonl
mean. Why didn't you go inside, you wort'les aol
feller? Why you stay outside like a thief in. e.
dark? You old Jezebel! You not ashamed ot yot'-
self?"
"I more than shame, Mister Morty," walnA the
old gentleman. "I feel so shame dat I could. aink:.tit
de ground. But don't teck no notice of me; let
de pore ole man go 'om;e to him bed, an. GO w...ill


bless you. Wish you a good night, Mazse Mort, an'
sleep well, me son, sleep well! I gone home, y'.
hear?"
"No, I don't hear," snapped Mortimer. "Don't
you dare to move yet. I am thinking. "
And so Mortimer was.
What bad Mr. Proudleigh seen? What had
aroused Mr. Proudlelgh's suspicions? Mortimer had
come into contact, in the course of his daily and
nightly duties, with hundreds of ladies and gentle-
men, and he was well aware that they mixed freely
with one another, did not appear to harbour mean
suspicions, and would think nothing whatever about
a man taking home a woman from an entertainment.
That people of opposite sexes, whether married
or single, could be on the friendliest terms with
one another and no scandal or Innuendoes result,
he knew; and, unconsciously, he had been influenced
by their way of thinking and acting. Besides, he
was not himself suspicious by nature. But here was
Mr. Proudleigh, whom only the prospect of a free
drink ever stirred to unwonted physical exertion,
confessing that doubts as to the conduct or inten-
tions of Douglass and Matilda had brought him forth
as a spy that night, and surely Mr. Proudleigh's peo-
ple must know something about the old man's mis-
sion. And perhaps it was not merely this night's
bringing home of Matilda by Douglass that had given




JUSTIN McCARTHY LTD.

14 KING STREET

STATIONERS, BOOKSELLERS, TOY DEILBRS

Also Games of all Styles for Table,
and Out door Purposes
For The Xmas Season Now' Approaching
WATERMAN'S FOUNTAIN PENS,
THE IDEAL OF THE AGE.
XMAS ANNUALS & PICTURE BOOKS
for the Children in great variety of styles,
sm Prpetation Books by the best Authors,
Ir Children and Adults.
FANCY BOXES OF FANCY STATIONERY
a superb assortment.
XMAS CA '
a charWaft Lot, Siugfft4f



fq TAT4 GOODS in a great variety
ul..'c... f, to suit all ages.
REM BMBERN SrtL y Leads, and their Prices
are reasonable on all Lines. and
Keep all up-to-date goods.
JUSTIN MeCA TIHY LTD.





THE ARISTOCRAT M ART
OF KINGSTON.


GEORGE SEAGA SONS

83 KING QREET.

Branches 3-5 West Queen St.






We d il.y'our goods for the benefit

aof or dicriminatimg Customers.





We guarantee refinement ias t

high-grade quality and uiaes,



TO SUIT ALL POCKETS.


I





1925-26 PLANTERS' PUNCH


Atlantic


Fruit Company,


LIMITED

(INCORPORATED UNDER THE LAWS OF JAHAICA.)


Manager: LINDSAY P. DOWNER.


HEAD OFFICE OF COMPANY:


King Street Kingston,


Jamaica.


EXPORTERS


T


and

SCARRE R S



tropical Fruit,.
ropical Fruits.


-" ": *:.


PRINCIPAL AGENCIES IN JAMAICA:


Port Antonio
Port Morant
Morant Bay
Manchioneal
Annotto Bay

,: ""*'


Port Maria
Oracabessa
Rio Nuevo
St. Ann's Bay


Rio Bueno
Falmouth
Montego Bay
Lucea
Green Island


STEAMSHIP

AGENTS for

PASSENGER

SERVICE

to New York and

Philadelphia.


.1


I


1925--26


PLANTERS' PUNCH


" `
~i:iii
ai'(~* ;p
'"~,. ; ;
;!~~L'
!;i




















better come with. me an' see. But I advise you .to' ;*ile'.e~: liastetas to what ,i~df;) .d ; self in so many words to an optiio o Mr. Douglas :
keep a wine tongue between you' teeth. It is not me Mr :ag~: es asked Mr.Proudleigh it hel thgi ta s but the vigour with which he assaulted the food e:i
alone, but Douglass an' Matty you 'ave to deal wth." soan-ltula would be up at that hour. '.f.tuig .tt..,,; ftore him suggested that he was trampling met:'i
"I ,would prefer to go 'ome," Mr. Proal. will take a walk with you, sir, an' diL~PiI "tCia phorically on the carcass -of Mr. Nicodesia Dougl~aa;
earnestly assured him. some business of the Confederation. No I .iur t' .. "And you you'Self, Mr. Proudleigh,ha hear him s
"I not thinking' of what you preferr,. repled Mor- late when one is working for 'Is people." :,:' that Mortimer 'ave more sense than husband a.'
timer, "you coming inside wid me." ,-;:.I believe," returned Mr. F.rodleigh .:'a .''::- t be Vice-President, for all that me 'Usband harvi
As they approached the house, t.y~. ard the i notas sympathiing wid your move f T "
sound of conversation quite audiMgicted; in- am." e dear Mrs. Conspicuous," implored Mr.
deed, Mr. Proudleigh could .ha e::t M d outside "I miy be able to persuade hinV."-ma-fi "..beg you not to tell a soul dat I tel
and made out distinctly itmoclt what was being cDougm. "I shall beglad to accompany y ;i hii: 'i q't dat I love you an' you' husband'
said. Fifteen minutes age :.-lag.: striven vainly to M Proudleigh dimly wondered if M'A -~'f.Ms word, but I couldn't hear what
catch a single deflA~ e .W ;s:w ',whole sentences also desired to pu through a ocalTeais $ ..y u know."
were being wahwFi ti':- by Mr. Douglass. why he was out that:aight; and knowing. a friendly act for you to
Mortimer .. ]e iZP e w ltly, advising the old about that truculent-little gentleman, MIr. me," agreed Lady Brml .
man sterfniy ed even t.oMi'. iriWslgh frightened understanding unpleasarat he .ib .ald only say, s it k SWistY, .he ware quick
that Mortirwiahed to some as close as possible to e you like, M h.ouglass, though. I,: ~ an" God. only
'ki owla n i idetoe -andetected. But the couple in the o. m stea ldi ol
little ball were apparently oblivious of the proximity must be g"neo .bed bMortimer," a" 6s' altwfih as
S f. Mortimer, Mr. Proudlelgh, or anybody else; they pleasan'lyd l% ou .bePermanent Vtimr i."a.I : .S....-te al Bri
Were earnestly discussing the affairs of the Confeder- l:.asU ,i.. l- I' b r ed Ma..ne4nt:.:::.wi ... .* ;. .' -,
nation, and Mortimer and Mr. Proudleigh heard Mr. "l yo t..
daouglass protest that he would never be satisfied I want to :t'as!l p important. Hii lr tt thllere in-re'ii.
until his friend, Sir Mortimer, whose brain and eIBi.il St: th, wictked way he boeebs it M- a istilda, eh?" YoaWt1t
character were superbly above the average, consented- '. t tak o tha exclaimed M Mr. MPrdleighl?
to accept a distinguished position in the Confedera- pias -"i kes ine blood .oiL l '4 "I wouldn't suspicion a.y
get evei,.:w 'il,' a word or two.ttoy
lon. get esyea hll ii fa word or tiwo' ^et f the hfgh-minded moralist, "buta
"I won't leave here to-night, Lady Sllm lam," Well, .Sflriig-ryoua egree, eh?" .alt Iteck a thought an'y t
asseverated Mr. Douglass, "until I see your husbandd i : E.fi1ber agreed, now once w F iln I was so long outside at Sflri'r w- dpt
an' persuade him to take office befitting his knight- to .se .,r:like good humour, and. iMr,. i ad. dat when me and Morty was Sgaoi
hood and intelligence. That's what I am waiting for, ai1ithat no man was better .A I A f em talk so loud an' plain? What waa
though he is much later than I .did originally ex Vil.CbG li"f thee Oppressed than he ii t-. so.before that them didn't want
peet. It is true that Conspicuous Brimstone has lart: VMwith but one cryptic i t.It- Itas not my business, an' it der6ew
donated twenty pounds to our funds, which shall be tfrot* i :: to the wisdom.f hel. erl .:, it:.lio. mine me own business. But
lodged to-morrow with all. due point and circum- med ::t*b 45I between .thet;: ..me, ear Lady Brimstone, an"
stances; but we want intellect as well as money; we M~i:iaide up his miTn i :out of me ind.":
want sterling character; we want prespbctive.- ''lo b, i mou" TtWg 'ay nothing : Wt.e. "I know from'
husbandd must consent to 'elp us. There is a&' c a u I. WO s. HIe would* I said so. I
from Macedonia, 'come over auid 'elp uk.' 'That a'i tt:mly :..means certain tmaf .i.. anT' m a other
my cry to him... Pleae use your influence with him .u i; ap)iatilda was altogether what .-- a.s he was
-. CE -;~:


Ir


- *' ;e '~"' ~"' ;"'*C- "


"*;" 'ffl~'': Si~.Z1 ;"~ :"-`
C::: :3~i.,- c~~~zr :'
;.: !i
: ; : .~. :1, ~~.; :.:; r:~d6
...~. .,
I
:,I:;'''': "e-~~.;
;i ")'
~*
1.
I: :
~ ; '?
~~i': "
i:i
~:
~~ '*
C.;'iiL_7~::j


JLEIONAI




2 TE.' A


.*.***;:^^

*i i2
KN-TN :i::

KINGSTON. .....
;; ;
.._. .,,
...__ :_.i;,- :
., -., ..: :.


l~i;
I~e~Zi:,l:l
?;:;:~:-- ~
u
~f~t


'" I 1 ...":""" .. ....I~~m| i ^ !,!l~ JJ~~. .;





HARDWARE AW LUME

..-- ....j. ^.:- ; ,.. :"' ...
... ; ...,. ". ,.. ..

...; ..,''; ..


ANE


JAMAICA

t: : .


.. ..
'.,.


m


. :


S -
. ; ,"


1NT.


:. '. '

'.. :
.2 ..
. ,. ; :.*. ,.='..a


* .4i


I -.. .". .. .....~~... ...~......Laii. ~~ ... ;-------


I _i I _


~~::~i*i;,:I:,:-;:igr \:. I:
:;. -';'::':"~':' '`


.:..;i
.;:' ri


ilI:


--m


l..j









i '


"
;;j~g
~f,
.*,.
;.:.;n?ii?,
?'itiiQ
Y:i;P:*
:- ::ja~~ ~C~~K!
i~~~i~ .......
i'.:' '.4


.1


: ~g*' ) :'' '1:; :
....;
i
V


(C(DRDOOVA







PLANTERS'


PUNCH


'before, an' Douglass dress up and 'ave plenty of
batteryy an' talk; an' Matty don't 'ave no principle.
k:So what you to expect? When puss gone out, rat

as day, an' President Douglass can call around to
'see how Lady Slimslam getting on. He know very
|well how she getting on all the time. Both of them
Vare getting on quite sweet. So it Is President Doug-
laes this, an' Lady Slimslam that. Lady Slimslam!
',Y'u ever hear such foolishness?"
"But you are a Lady Potentatess," Mr. Proud-
leigh reminded her, anxious that she should under-
Sstand that he respected her title and position, and
not unmindful of future meals.
"Me dear ole gentleman," cried Mrs. Brimstone
&bitterly, "it is only we foolish Jamaica people that
i'alkin' about title and Potentate an' the rest; but
since when you ever see black people wid a real
title? Don't you see it is all foolishness? Who call
i'me Lady? You? Yes; but even you don't believe in
'it, an' when them find out at the Railway that me
husband' is a Marquis or whatever it is, they marquis
him of the place before he could say, 'jump!' An'
:what Mortimer Slimslam get for being a Sir? A
kick out of his job. What's the sense of that?"
"But Mister Douglass say- "
S "Yes, Mr. Douglass say a lot; but he are the
only one that getting anything out of all this title
Sd Confederation foolishness. He got me husband's
Eenty pounds, an' a lot more money, and I want
to see how I can get it back! And all he think of me
.h:usban' was to tell Mortimer and that wretch, Ma-
kIfda, that Mortimer 'ave sense an' me husband have
-tone. He don't too far wrong either, for if we did
Avre any sense it is we an" not Douglass who would
ktlve our twenty pounds today. But perhaps Morty
losin' something too-though Matty was never much."
"You t'ink you-ean get de money back, Sister
t.?" asked Mr.. Proaleigh eagerly, for it came to
Lhis mind that. ii t eidid, a tiny but highly acceptable
Swindftal liS K'Ai etiot~ting to him.
"I "'ealge i'f.*' yet, Mr. Proudleigh, but I 'ope
so. g. i i no! Tell me! When last y'u see
.:t ,...:ouglass together?"
.~eaterday. I took a walk down town, an'
Sat King Street an' Harbour Street cor-
rbho should come along in de street car but
of dem! Them was talking' quite confidential
sweet to one another, an' look like them was
driven' quite up to Hope Garden."
"An' meantime Mortimer was working' hard for
that wretch," commented Mrs. Brimstone. "Y'u gon'
Sto tell him what y'u see?"
"Me, Mrs. Brimstone?" cried Mr. Proudleigh,
? I wouldn't do such a t'ing! I would never come
men husbandd an' wife. I don't meek mischiet.
if I could get a sort of hints to pore Morty I
i d do it. Bf I could tell somebody dat wouldn't
l4*e name, I would really do it, for it not fair
fMolrty dat Mr. Douglass should be caryin' on wid
fl wife. It don't respectable an' he wont 'ave de

.-' gna get the blessing of Matilda,
EA Nbi~~ 'ktothing else," commented Mrs.
BrImstone rypttlilly, "an' he have the blessing of
my twenty ponn's in the bargain."
Then the conversation ended, for Mr. Proudleigh
completely consumed his meal. In the meantime
ither opinions on the intimacy between Mr. Doug-
IBsa and Lady Slimslam were also being expressed.
r. Proudleigh's wedded daughter, now long a ma-
n, was scandalised, but nevertheless she became
more frequent visitor at the Slimslams than ever
before. S..he wanted to see what she could with her
Swn- to to speak. Perhaps Susan had inherited
cM father'ss faculty of curiosity, which, it is
St parent of scientific investigation.
slapering and prying could not possibly
of Matilda and Douglass. They
..nor dense, and Mr. Douglass es-
woobserve signs and gestures that
t have failed to perceive. He
I'F when Mr. Proudleigh had
Impart l" K ito Sir Mortimer, had pre-
pared for tit these two gentlemen in
the manner "t afribed. The fact is
at he had 't"i i .'. lted the spying figure
Mr. ProudleiBh e.t'tn tl Ati.it eight, and, looking
tionsly forth, had qdi: t-'in. meet another man
or up the street, wheat Ite rightly guessed
ibe Mortimer. His whipbi 4,Aa iggaetions to Ma-
a had been followed taith i:i ad since then
of them had been on the iaboaittor indications
upicion on the part of frientdllr d neighbours,
of Mortimer particularly. They c sen highly in-
t at all this prying and gossippnlag Very often
expressed their outraged feeling to one an-

1 hat is the worst with our people." satd Mr.
ut a week after Mr. Proudleigh had Im-
'wis to Lady Brimstone. "They 'ave
suspect everybody; they sty an'
-rry-go-bring-come, an' make tron-
n' up the whole thing an' de-
..know why I waste me time on

'1 know!"Wy, either," agreed Matilda.
f.a great nEiS6 :.il' y'u work for them, an'
do is to talk you an' me behlne our back.


You see how low they are? "Y'u would think they
was pure like snow an' spotless like a lamb them-
self, they so fond of suspicioning other people. Why
they' think we doln' anything wrong?"
"We do nothing wrong!" protested Mr. Douglass
stoutly. "I can't 'elp loving so sweet a female like
you, an' if you care for me, who is to blame? Love
come as it likes, an' if you 'ave the misfortune to
be tied up, well, that is not our fault. Let him that
is without sin cast the firs' stone. If I was to tell
what I know about some of them, a lot that's going
to church and singing loud wouldn't hold up their
'eds."
"Me, too," asserted Matilda. "We not doing any-
thing worse than other people, an' therefore them
have no right to talk about us. But them talking' all
the same. An' suppose Morty teck a suspicion of us,
what we going to do?"
Mr. Douglass had a shrewd idea that Mortimer
had already become suspicious. Mortimer had let
fall certain little hints which Douglass had been
quick to understand. Some of the ladies in the
Confederation had also grown jealous of Matilda,
who now spoke with authority at the weekly meet-
ings, confident of the support of the Permanent Pre-
sident. He, indeed, realized that she acted indis-
creetly in this, but Matilda loved to show off and
would risk much to gratify her vanity. She delight-
ed in being a Lady, she delighted even more in being
the favourite of the Permanent President who, as
head of an organisation with funds in the bank, was
in her eyes a much bigger man than a knight who
was out of a regular job. Mortimer had foreseen,
more truly than he himself had grasped, that as
soon as Matilda had*secured the position of a law-
fully wedded wife she would develop in not desir-
able directions. She thought less of her position as
a married woman than she had believed she would
do, and Mr. Douglass's advent on the scene had
caused her to think much less of Mortimer. She had
an element of the adventuress In her composition.
She found a constant thrill in her intrigue with
Douglass. That had come to a climax on the very
night when Mr. Proudleigh had started to spy upon
them; it was while that gentleman was prowling
outside the house, in a spirit of disinterested virtue,
that Matilda had taken Douglass for her lover de-
finitely. Mr. Proudleigh had a flair for such things;


Pure Drugs,
Patent Medicines.
Perfumery,
Confectionery,
Teas. &c., &c.,


20 KING STREErT,


he had sensed more than Mortimer had done. ILt.
the seeds of suspicion he had planted In Mortimer's
mind that night had never withered and died; and
since then there had been kindly friends, anxious to
bring about quarrels and separations, to suggest to
Mortimer that the State of Denmark was not in per-
feet condition.
"That old man, Proudleigh, is making a lot of
mischief," said Douglass slowly. "He begin all this."
"Can't y'u do something to stop him, then?" de-
manded Matilda. "Y'u not goin' to let him teck away
me good name as he like?"
"No; but he gone pretty far already," admitted
Douglass thoughtfully. "An' Brimstone going on
very peculiar. Trouble may be coming, Mat."
"Then what you going to do?"
"I can't say yet. We mus' watch it. Perhaps
it will be all right; I will soon know. But In the
meantime I am going to get that old rascal, Proud-
leigh, to keep a silent tongue, if I 'ave to frighten
the soul out his wits." And as he said this, the lit-
tle but fierce and overbearing President of the Op-
pressed looked quite capable of oppressing Mr. Proud-
leigh until that gentleman should collapse with fear.
He had not long to wait for his opportunity. A
couple of days after this conversation Douglass met
the old man strolling aimlessly, as it seemed, in the
direction of Mortimer's house, which seemed to have
for Mr. Proudleigh an almost deadly fascination.
"Hey, you!" Mr. Douglass hailed, and Mr. Proud-
leigh gathered from this form of address that all was
not well.
"Yes, my noble-" he began; but Douglass cut
him short.
"Don't want any compliments from you, sir. I
merely call you to tell you that I am a bad man. You
understand? A very bad man!"
Mr. Proudleigh understood him very well indeed.
In his case, as in so many others, a guilty conscience
needed no accuser. He wanted to protest that he
thought Mr. Douglass a good man, a very excellent
and virtuous man, but the words would not come
fluently. So he waited to hear in what particular
manner the badness of Mr. Douglass now proposed
to express itself.
"I hate a liar," said Mr. Douglass; "I hate a man
who go about an' make mischief. I am not afraid of
anybody; I who don't afraid of the British Govern-


PRESCRIPTIONS CAREFULLY AND ACCURATELY DISPENSED.


IL


American Iced
Soda Drinks of
Fine Flavoured
Syrups and
Ice Cream.


- KINGSTON, JAMAICA.


Opposite Bank of Nova Scotia.


SPECIALTIES:
OLD HUM and NATIVE
WINES.


IANr FACTUREltS :
CELEBRATED
"LA-PALOMA" CIGARS


When you want the Materials for a real PLANTER'S PUNCH, call at


G. Eustace Burke & Bro., Ltd.


EXPORTERS AND IMPORTERS.
Wine, Rum, Spirit and General Commission Merchants.


Then don't forget to try our L

4 & 15 KING & PORT ROYAL STREETS,


,A P


ALOMA CIGARS.
- KINGSTON, JAMAICA.


I1I


1925-26


E. D. IN KEAD,


Dispensing Chemist and Druggist








DEALER IN


ES'IA BLIbHEI) 1885


1. i


I


L-


r I








M''44:V *t .2:, LU~


DANIEL FIUZI & CO.,
LIMITED.
ESTABLISHED 1848

30-32-34 PORT ROYAL ST.,
KINGSTON, JA.


ThI 0at H.iude inh the bland
After the Colonial Bank.


Finest Blends of


OLD JAMAICA RUM


In Bulk and Bottle.


Bottd r ua. ear Specidlt
and Shipped h adl parts if
the world in Ca or o1tcr


Rums of 20 Tropical

Years Old and

Upwards

ALSO:
Star Rums
Ten Medal Old Rum
Special Reserve
Gold Seal & Anchor Brand
Black Seal & White Wing


SOLE AGENTS FOR:
Veuve:Clicquot Champagne
JohnaIBai & Co, & Haig & Hali Whiskies
HoordsfOId Tom Gin
DunvillesBirish Whiskies
.i e's Belfast Ginger Ale
MaibleBrie lrd & Roger Liqueurs
Good4i : W Wort. Canadixn Rye Whiskey
Gonzaeis& Byase &Co's. Sherries, Ports, Etc.


meat of th is lt.jd" and who will soon make t e "* "1 are glad to hear that, A tl
Government ta fai ,~ : s hot iitily to care a you' best for them. And how i SF'
brass faithing 'bfta say old brows rascal knocking lady?
an' bunmiu.ariVsnd 4thli neighbori6odo. I will cut "."Qite Wett, I thank yu, me
out the. t s aut of' it head II It. h Ie interfere with tIlda, also in her-best society manner; t'
me, qr I ty don't like. Ytir )iu etone was doing her utmost to play 1th:
*r .iii.llped .e.perate by wVa of.- f r .:
it R *tiaitteas ii attentoit. w .ayor thee o r dt
SaVt I are to say," concluded '.wa s 1ant one, doing a little ii
.n:w lie now. t lteln ',m.'ia ntit z nf d ado glad to hear. 3 in1
MP w t loIe t Cab a who, st 'w oid be left alone so often, tjg.
r 1.161 e, will ca ;e o .t.fer. and .; .... alt:" tB gh., with a kihe friend i i
... W.:;l3 ty anWl I wat t to teachh ka l aa i.ny iiXtniYa lw*'e company."
"out iso wr Mr'. Dp my alip *Wto ksep. ia. touch with ite
a"Tot another word Mr. DOangla~ t~s .emlie.r thi. Cfettio6." exaplaied Mr. Doug.
walked away. Mr. Proadlelgh btreat hegl s la
with difficulty. He had been exptlctti .' ."Y night an' day, ehLideot, y a.do you' work,"
Men were to be brought over from CubaI '; .d Lady. iintone, "an'ji.e laie appreciate it.'
to cut out hil tongue and to "fick" him itti : Mbitmor m' be glad t~., lP itpw r loZ
a place or itae whose acpqalnta;inebie i :i.b:#.Je hlady when he is not at '"ine. J don't know
asot of desire to ISke. M. DoU g laSti a..Da W" aMiie of us would do without you, ir. Donglasa."
That had been ihati '.ati state. d~o l i::' )l m:le':i:v.aa:fnt: pause ensued. ad bfimatore, H
writy let kiti t betell hi. terf more vigorously thiat. blaire. teHr
..1 iswounid MA ad up him inua.aizevse ;aere killing, but there was a hard look in t4hi
hei woid.:SB itar m' ei ilhts gaiil 'tealo of that lender of sixpences. The weight ot
aad It. was inerstn mit law of E[r.P tPpt' pounda arna on her heart.
bet tat W i.. cditd149 11is ife0 1 am afraid, ie lady." she resumed, turning to.
AhpIes danbsiei:to Batheto a "f;,ftiida,. "thit it.me bandd was to go to the country
*pktheti&,lel yo ur, 1 we ld 'atesmuch nice gentlemen like
golaien I* S ious ~j 1. ilas coaW. i~t mee me. Them wouldn't
.garutw4 nd dat, a4nd the b At r .wth mie" :.
t :go "a. ," be e ..tfrel. .ery likely," .'. ..
was o, e:,tioght, to : ady Bratoin'~ Shbe had not
~ flone:'w mptbetray li, iptected this sort of
A'" l.te J i6e from the arLita bel h too open, to InS ill
tnow t i i tall u;on hi4 tar Mtilda ahd Douglass for t
..% :.tM i 'T). kcanall hgh moral principles, and
a~ iout Dout fgit~ ,feo ls themselves in a peculke
." he had c:'e, .her castigation meekly
at4Sz .at theme two erringo
Q h. tmase s wo er a peak scathingly about them toMo-
Smi& fe ilmarks to l erds. she had counted upAo0i
*~el- m eft that A Mltw wile she was right eigi -ai.
iit fal Sei ng pof the way Mr. Douglass would t e. t,
S .oral metmtl i,she had forgotten that Mft
-f more( anavoury S 4t of young woman to put up with tot,
4,:hii f :to......
esfr tthat Matilda was too rec-
t 3: oartl h..sef .metaphorically, between:.,
..that iMr. Dougia s..

:.s.lriJ She Das...a woman of .. ,a.'. tt e.rb .B .ofte
Lady
.that
a e ws. -. iju. e Lady"


: I f JAY Y AND LADY AT
o. ...40...i~W. here now," sa.d ;j'
.,Pas iaass but Somebody,
Sh:iam. Them never w ....
S before.-G an' SC V


p -wax vever; an, u
d. But because as
S.a..t smo tcome o wi.
S a out me. o
i'there Iaon'lkoa
Ser flashing fno.ipyey.''. W
.fs treated by:.y e own people, ior
'sommuch an' am plrojectinso much a
Sgr..eat work they i.-te thinking of,
a find out about me: you to whls- ii
it. They prefer a scandal to eleva-


ii


:~.fim the beginning that y'u couldn't
";.iA te~~-hiem," aid Matilda sagely. "y'u
high as y'u like, but them will al-
.."hat they was.. Y'u could give them
.: Ji .j. ,t'hiley would be peepi' under the
'i t '"you an' me doin'. An', mark you,
.' s.'wi *i.itbL.. them. Wele li a et live."
S:i' .. B c.' hll-dbor sounded, and Matilda
'4 r:;' "another one." Lodly ahe. said,
w;.at. hearty w~eleome.n: e n!"
h' nastone entered. The Lady Brim-
ha obscured the. aternoon'sa un-
Slsg ws*hqe' for a second or two in the: doaway;
Ih forwardd and secepted the outi
'JA47 iMatilda, an. .Sdit stub
f'.tile hand of the PerantZle-,
Ami rapr round -dee.
ac*ed;.as she deposited'her
-.air.and. gained herself rfgoroi'
a ~ ghgt that her flesh was on the:'
S"'l, the Uian hot! Yes, I become:
rft:. saeial-visit, knowing as that.-
b tobthe country, peqa'is you;
b I ft sBee y'u 'ave ompait, s*ao
!b. rii 'MTy! it is hot!" ..
S.l it..all the way ft0m y he
U .?" asked Matilda.
'.,tr; I can't afford to take a t;ay
t* t n theas days, for. Nical
4vtE e er isu whKa. he was eiapiey
hw ,i hee .e ate twenty po.W' to
Sp'tvo to 4e eiotomtcal. How .wI
g t in, President ,
."Th are flourihitng," replied '
*-..,: -; ":," "** ". ",^ ". ".
J::l


.to bring g ,
h l ly meannothin
ta. Why''u teek me up so hot?" .
S"'pla -i 1 didn't teck you up at all. Onlt
slii* ( iuestlob, y'u ae, as I didn't quite undeottilt


I. SOLOION. & SO,
144 HARBOUR T...


Co
Agem
. .'. ,,::


MND BEEF
OIL
"8I'AR FLOUR
RYS BEST F
N, COUNTEI


e'trs for

.and N


solicit your i


s,


:/ls**--------~l*--~acl--ac~-c3~-~


% .py "- w .' -* ", .,.?
.i .-. ..
..I:-top',
oh,


""'":






1925-26

what y'u mean. But since y'u don't mean nothing,
1 can't mean nothing, too."
S "No; we are all of us friends and united In a
great cause," interposed Mr. Douglass with a short,
affected laugh. "We are too united to take one an-
other up. I wanted to see the Potentate to-night at
the meeting--"
"Don't bother call him Potentate, Mr. Douglass,"
interrupted Lady Brimstone. "He Is no Potentate,
an' I are no Lady."
"But, me lady-"
"There is no but about it, Mr. Douglass. Brim-
stone an' me talk over the whole matter quite a lot,
an' he come to see bow foolish it is for people like
we to call ourself lord an' potentate when we 'ave to
keep humble if we to keep our job. Mr. Garvey is all
right, an' you is all right, but when B. lose his
job he will be all wrong, and I don't prepare for him
to be all wrong agen. So we dropping all title, an'
I beg you to call me plain, so-so Mrs. Brimstone in the
future. An' Brimstone is plain Brimstone, or Nick."
A look of fear swept across Mr. Douglass's face.
This abdication of a noble position meant more, he
felt, than appeared on the surface.
"I think you making' a mistake," he said heavily.
"Well, maybe," replied Mrs. Brimstone calmly,
"but we going' to make it."
S "I never did care for no title," defiantly put in
Matilda. "It can't make me better than I am."
"No," agreed Mrs. Brimstone sweetly.
"An' I am as good as anybody else," added Ma-
Stil`a hotly.
"Now, yes, y'u are," agreed Mrs. Brimstone. "'or
y ou married to Sir Mortimer Slimslam, an' as long
as y'u are his lawful wife people mus' look up to
you. If y'u was to lose the position, of course, it
would be different. But it is a high and respectable
Position, an' a decent woman-like you-would never
do anything to oe It."
Another uncomfortable pause. A short, affected,
deprecatory laugh from Mr. Douglass. Mr. Douglass
felt that there was no need for undue emphasis to be
laid -upon respectability. There were other topics of
coaereatlon In the world.
"Oh, about our meeting to-night, Lady Brim-
stone," he remarked. "Are you coming?"
"Yes, Mr. Douglass; but I beg y'u not to forget
that henceforward an' forever I am so-so Mrs. Brim-
stone. Yes; I are coming to the meeting to-night,
for there are some question I wants to ask, an Brim-
.stone 'ave to get some explanation likewise. Yes;
;.-swe both coming to.the meeting."
"That's right!" cried Mr. Douglass, with an effort
-eartiness which almost choked him. "Be regular
dance an' all shall go well. Ask for any ex-
RI A kie,. Mrm, B.; it shallbe forthcoming."
e .. returned Mrs. Brimstone doubtfully,
thei ': I iqerture.

srted Matoo?"til ii ii.."
S b tedM.. "


noooay TO cal yo. ;.
Garvey make you' h [l Jbl i .*l:
me plain Mrs. Blim.lazr.a l..ra..& .
needn't call me, 'me lady .' :. : : :':":: :
"Just as y'u please," smiled Mrs. Brimstone. "A
Married woman's lawful title is the best, after all, so
.-------------'."----


T4e Linen Store

ai ii are of Incomparable Values



SPECIAUlING IN .
Linens of .every kind and
grade
High Grade Hosiery
Household Requisites
Gents' & Boys' Furnishings
Up-to-date Dress Materials


For the utmost value from money spent and
Civility, Celerity of Service,
SEEK

;L..I 'INEN STORE

.pri"trs: rE JAMAICA TIMES, Ltd.)
L& iamer King & lirwbofur Sts., Kingston.


PLANTERS'


PUNCH


long as she keep 'er name unspotted tram the world
like I do."
"Would you like me to walk 'ome with you, Mrs.
B?" enquired Mr. Douglass solicitously. "I would be
gratified to see you 'ome."
"That wouldn't be right to Mrs. Slimslam," ob-
jected Mrs. Brimstone. "Hi! How could I come 'ere
an' take away her guest? After all, she is lonely here,
an' I 'ave me husband' waiting for me at 'ome. Good
afternoon, Mr. Douglass. I will see y'u to-night."
"You bear what she say?" demanded Matilda, as
soon as Mrs. Brimstone had disappeared. "Y'u see
\ih It I 'ad to do to keep me temper wid dat woman?
She was stabbin' me every time she open her mouth."
"It wasn't you alone," said Mr. Douglass sadly.
"Butrou are a man, so it don't matter so much
to you. It is me them want to injure, just as if I was
interfering' with them."
"It's not you alone Mrs. Brimstone come here to
talk to, Mat," the sagacious Mr. Douglass assured
her. "Don't you notice how she speak of 'er hus-
band's twenty pounds? Don't you hear how she say
she want explanation to-night? Don't she say she
don't want her title any longer? Don't you see that
she mean to make trouble, an' not she alone? Trou-


ble coming, Matty. I always know when trouble
coming."
"Well, let it come!" rapped out Matilda defiantly.
"What can them do me, after all? If I don't 'frald
for Morty, I not likely to afraidd for them. An' I
don't suppose you rob their dirty money."
"No," said' Mr. Douglass; "every penny can be
accounted for. I 'ave the bankbook with me here."
He drew the book out of his pocket, and showed
a credit balance of about eighty pounds. "Every
penny we pay out pass through Brimstone's hand,"
he said.
"Well, then, what y'u afraidd for?"
"They want the money back," he asserted posi-
tively. "I know me own people; they never stick to
anything long, an' that is why they can't get on."
"True. Then what you going to do?"
Mr. Douglass scanned thoughtfully the tall, bux-
om form of Mrs. Slimslam. and noted with renewed
appreciation her undeniable good looks. A wave of
affection surged through him. He would trust her
with his most secret plans. He brought his chair
closer to hers and sank his voice almost to a whisper
so that no one listening outside should hear his
words. These he poured into her receptive ear, while
every now and then she puckered up her brows in


1'


REINCORPORATED BY ACT OF
PARLIAMENT 1925


Authorised Capital 10,000,000


Paid-up Capital
Reserve Fund


900,000
- 300.000


HEAD OFFICE & CITY BRANCH,
LONDON 29 & 30 GRACECHURCH STREET, E. C. 3
General Manager, CHARLES H. HEWETT. Secretary,.J. D. RACE.
Assistant General Manager, O. BARRIT.


:: HLL-T6 Whitefriargate.
LIVEEPOOL-23 Castle Street,
HAMBURG--A


ANTIGUA
St. Johns

BARBADOS
Bridgetown

DOMINICA
Roseau

GRENADA
St. George's
Grenville


MANCHESTER-21 York Street
NEW YORK-3 South William St.
dolphsplatz 4, Hamburg.


WEST INDIES
JAMAICA
Kingston
Annotto Bay
Falmouth
Golden Grove
Lucea
Montego Bay
Morant Bay
Port Antonio
Port Maria
Savanna-La-Mar
St. Ann's Bay

BRITISH ;UIANA


DEMERARA
Georgetown


ST. KITTS
Basseterre

ST. LUCIA
Castries

ST. VINCENT
Kingston

TRINIDAD
Port of Spain
San Fernando


BERBICE
New Amsterdam


BRANCHES THROUGHOUT BRITISH WEST AFRICA

AGENCIES
Canada, Newfoundland and Mexico: BANK OF MONTREAL
France: BARCLAYS BANK (Overseas) LTD.


GENERAL BANKING BUSINESS CONDUCTED


CURRENT ACCOUNTS are opened by the Bank in London and at its"Branches.
r. . . ..l. .


BARCLAYS BANK

(DOMINION, COLONIAL & OVERSEAS)
FORMERLY

THE COLONIAL BANK


INCORPORATED BY ROYAL
CHARTER 1836


I

I


i


................ ... ...


, I





48 PLANTERS' PUNCH J.* .:4-'2as6

thought and nodded approval. Aftbr a while the nods of the members knew. Mr. Douglass had fallen under the time was ripe for another great e.t.
became more.frequent and emphatic. She was agree- the spell of the .Lady Slimulam and gave more at- gross, and there were ever able le
Ing to his plan entirely. tention to her charms than to the noble work he had to think the time was ripe. R
.- more-----_ taken upon himselL Like Samson aot: o.l, and some With happy smiles of anticipation, hM
CHAPTER NINE mre recet trqng and mighty leaders at their peo' did th emgmbers of the Oppressed Me into the .11
pie, he hAld grown weak through the wiles. of a w.R- nettn .roin where the weekly re-unions were hale
MRB. Dfi4LABB PLAYTS A. TRUMP. ma. Everybody pf tua rtaonce was there. Old Mr. Proud-
ri D o had quitancre t he discontented care a boass e leigh cape early ith -his soni n-law and daughter:
Mt S ct". bult raou l of swmhe soret s ewas brewing. te nlovir n bee w o with a isu,:'ed e lady r the igh Consplenous, now conspicuous no longla
1t.t&.roube of some sort was brewi Mr.wasInlove with a maed, lady, or by degree of his wife, came- accompanied bythaQ
"Iate t o M. o kind of troubles he must exp a .t ine. Eu w ledW les. a .tt.. ll.: t tha t as e h i
sadr eten the kind ao trouble he must exdtl a ige r atioled ladies. They ami that. that ady, o Mr.- Green and Sharky, who eachnd ha
He had..not beeu.for so long a leader ,at. e f.t.i.i;-1,. his o .. bu inem .-a tist llfl:.they lady; Mr, Grees and.r. .hakuy, who each t
Hnt eo hadoe dteno ne.for so dou a leaderstolaes ae> os o te eabt hi s lon thie on, e a4 t rhat'iloet a .donated five. pounds to.te Confederation's fund, wera
u'ts recognie the signs and omens of apprcqhig 'er~qfrhee to talk about his lavron,t- te"..f ad- y much In evidee.. And, as if by -pre-rrange1
Criction and annoyance. The members of ,et:e Con- niinii -tgoseip and laughing comment' t -ie.re n very muthe in evdens of the as it by-pre-aanted
federation of the Oppressed were scattered all over nimacy between him ana the spouse lif 'i. tofik re m t, the members of the: Od position seated theol
selves inone: aisle o the roomfrc ts forming a ao
the city, but they were more or les always meeting of.their number was nothing to.be a 'isset. i;;eut bNlo
one another, and an Opposition, or party somewhat they also argued that he should not.: aloW p::l re 'M. a he
hostile to Mr. Douglass, was sprigi g:f ip, Had to interfere so much with business; t lhis t ;ouglass was inrdl nervous, he diR
there been a rival society all lwoQs..a have en well. ,alnled relations. ith the Lady Sisailal_:" but the- Ogt show it. He had long ago appointed himself
,t would have denounced Mr. D.ougilund the whole eRect of those relations on the Con lt d ti t Sereta to the Confederation, and now he-clearly
Confederation, and, thip. we ujd ar e kept the Con- uved theto stepr read oit the minutes of the last meeting.and atsed
federation together ,as, th 'litter's critical and "'Pi este crit ln wei e those wvhoi had. a'i. t~: .:that they be confirmed. One or two persons would
antagonistic energies ,e~.i halted to the denuncia- money.to t he .ghting Fund. They in ika'. Sve:-i aked to question the accuracy of the minutes
tione.o the rivsa pto. Had.tihere been some mild id paid..ia. tw monthly subscriptions sad n' eiita but as they did not quite remember just whathad
but nnfavoura jpi eCnnta on the Confederation in that. there was noa goa d reason why the.a t 4 a:.:l .tken place last'week, nothllg of importance having
the newspaperl tis t eoo m t eight have cemented the a inatoer. 'T hii t rluctance to part .ti.:'s a t~~* l ..ay taken place, they agreed that the. minutes
Muion.of the tOpp" ssed; they would have experienced ea~nted ~ ash h.ad much to do with al -i; u ,ati- should be confirmed.
the delietfens isatsion of being publicly oppreased ltade. 0i. it b noteworthy that the .ii.~ii' That done, there- was a stir among those who
without any igttreaant personal consequences; they defenders of the President were prectSl t ais:j'e occupied the same bench with Mr. and Mrs. Brim-
would have w stked proudly in the limelight; the...- tiers who. were in arrears and who h d, Ston, anep. Mr. Proudleigli, who sat behind those two
might have stood solidly together, behind their PeF tin .fremaining so. friends of his, noted this and prepared to act at the
nanent Preasdent, .~ eng that they had won .a great B i'.t, :jinhey wer in the majority, (;aDig proper moment in accordance with the dictates of
place in the world and were accomplishing a won- .o. nd alwa rea :count upon outivtir9t -ifs :pruence and reason. Mr. Prondleigh knew f
derful work. But no rival society had made its ap.- Au ~.d ::ag.lsiae knew it. :: ort" was to be made 'that niet to da t ~te
pearauce, the Press took no notice whatever'of the. ,'.i-'iad. tb: collect subse rij!l 'Sident, break up the Cotfeditratld recoe-
Oppressed, and the Confederation itself, though it ng ginee lqakt the value of the contributions, and he entt. ly7- .t of it. -But
held weekly meetings, made no dramatic movement, i n .and hiat. of a society. T .i.~ he Iknew also that the' Preo ite .ri ehip as
did nothing to maintain that first fine ardour t Its ...; i'ag t a ithkL :..What -tiby no -of the causes of these, p *da.:"
members, and was distinctly inferior to a Palace i 'rerlda ,,' acia l assistant e t~.l 'i had a vivid recollection of i k t&- r
Moving Picture Show as a source of .entertainment.. mate:p f:. at critical moments, tir -it.aiig the appearance of men. ii OCub an t
No wonder that it was developing an Opposition W tD .. : i o inflict condign punishment on a really
in itself. For one of the characteristics of humn t'flat'. anieet that night, at. nt "and virtuous old man. Therefore r
beings is that, in the absence of absorbing .ati.eto eaad s`fied emphatically whe hopaig that the worst might
ass, resolved .toa ppadhe os is ht NO
they must find someone or something to quarrel ith :a'i pr .eat, for. explanation amongglass, resolved to applaud his speeq
and to denounce. e on ot ke it appear as though the whole
Besides, the dissatisfied members had some l .. ;i. r : se.i gii: W- ble :lted, a. le.. ;was flled with admiration .i
ground for discontentment. Mr. Douglass sal -not :.: ~ 'or. a to t;` :t with a .. ..uiatones would understand h
made his promised visit to Cuba, at his owaqn%41pg A'.. i e.ie arotl, .the,-hrli nog i ~-i they 4Ud not, Mr. Proudleigi
to recruit more members and collect'l rge t'. nds f i .A dSi members springlmi ....W.ith V.those men from HayS
the Confederation. In spite of his brave if t :ag..ae .i.i: e alui ols; :an orgy. .- -.I
talk as to the ultimate aims of the Confederation, t~iat 4ts i wod:.l-...-? di .6wed by 'thde a '" ise," when, to his
organisation was the most :9pea sul and nl a. b0- s. .-iitltin blLo-4hey wire well aceuntemed t. -.. ; tronm his chair
gerent of its kind; even the President's speeches that;:'And they iwa,: y enjoyed it. Another soc lef -r-. o d
lacked their former fire. What was the reason? Most co ld as ly be formed whenever anyone thought... 4:'ii :: :.


;: .,.., .


The best 00 8

made still etter!

Perhaps you think coco .
could not be further i :m
proved. Just, taste the new a
Fry's Breakfast eo al It0
will come as a delightful
surprise to yoUa .
Ever since 1728, Fry's have
been finding out new ways-of
making cocoa better. The,
present great improvement
.makes a world of delicious *
difference in flavour-it'. sso
mellow, smooth, chocolate
and refreshing. Get a tin
to-day.


T R R N OVER THE cOW

:`:N

AGENT SS
r U



144 harbour. St., Kingston, Ja. ,







PLANTERS'


PUNCH


I


A CORNER OF THE OFFICE OF MESSBB. LASCEU.E8 deMEBCADO AND COMPANY


This illustration gives us a glimpse of the general office of Messrs. Lascelles deMercado's establishment in Port Royal Street. Here
is transacted a great volume of the country's produce business. The building itself was erected shortly after the earthquake of 1907, and
the then principal took good care that it should not only be earthquake, proof, but so arranged that every clerk in the office would have
an easy and safe egress should Kingston ever be visited by another similar catastrophe. Below the building, and in large concrete struc-
tures opposite and opening on Harbour Street, are the storehouses ol Messrs. Lascclles deMercado. South of it is their commodious
wharf. Port Royal Street is one of the busiest in all Jamaica. From early times in the history of the capital big Commission houses were
established there. This tradition is carried on by Messrs. Lascelles deMercado and Company, Limited.


iTHE CITADEL

(Continued from Page 4(0)
Ipsf. The man retreated a few steps into the shadow
nad she followed, her while dress marking her.
With an imperative gesture he held out a great
r and she saw a bit of white caught between
SShe Look it. wondering. It was a small
-N fp3er folded many times. In the light of
difit would be possible to read what the
'.ed; she hurried across the court and
steps to the door. Guardedly, she
The note was in French, and it

openly assist begs you to be-
Iieve talltde to secure the freedom
of our mtit:# i.s,.afe but in captivity.
Once aliit~ ithe brief message; then
she thrust the Mi p'::a; eom and walked with
affected slowness tbia*:, l J-ace where she had
:'oeived it. There tiW ier. As mysteri-
oJily as the messenger "A 'Wii*l silently had he
4isappeared.
: Then Nicholas had not ~if tto her! John
IPuh was alive afn a priloierhliii e. The real-
:Itilon made her feel weak. 'Thie-iWiaie e was tem-
i bltkrtfy broken. For a little whi.ktRifVWtfW Iirt a few
iit..l she could rest. .
HY. To any one familiar with the we&lMpt, ok of
S ieur Samatan the writing of theij l.iM lhiech
lAt had thrust into Virginie's hand woualii-liUeen
Mb sizable. Shortly after sunrise. h.:fe 6ti
e from his sleep by a low and pefalatost
d-.oor of his house. From a Winaow.
iefully examined this early,,selltP
in the huge black the personal
S ,' a negro on whose faithfulness
l ia t- B4a o had often commented. Sling-
i:. m a!j-'imn, he let Luke into the
Ia i panti. ;.:the mute endeavoured to
'tthe story of Capt.hi Bush's capture and Im-
|omnt. t was tbis information that had led
..ir Spaan._to a r.cz n what he had conjec-


flirpd, and later to call in person on the unhappy
P'Inadelphian in his cell in Fort Picolet.
There was much of the white man in the charac-
ter of Monsieur Samatan. How far back had oc-
curred the infusion of white which lightened his
blood, no one knew or bothered to calculate. A plant-
er of the nobility, the owner of one of the great
estates that had once made a garden of the plain of
Le Cap, had owned his grandmother. Probably that
was the source of his light color and particularly of
*he sharp. active brain beneath the close-cropped
head.
Monsieur Samatan was rich. Furthermore, he
was lucky. The gray-green scarab of his gold finger
ring had come from-Egypt, but to the superstitious
negroes and men of color the curious beetle possess-
ed an unknown but sinister significance. It was a
little thing, thip bit of ancient carving, but in form-
er years Dessalines had worn it, and men did not
forget that death inevitably followed his accusing
ting r-always the finger which wore the ring. It
was the sign of death. So, without doubt, it was the
guardian of the wealth of Monsieur Samatan, per-
haps even more powerful than he himself realized.
No one had ever beaten him at a bargain, and never
had he lacked the means to finance any transaction
which promised profit. He.was hard and cold and
yet he had a weakness; there was in the world one
man whose friendship he valued above all things.
And that man was John Bush.
So it was with an interest more than casual that
Monsieur Samatan uncovered the details of the mis-
rortune into which the precipitate Quaker had pro-
jected himself. Monsieur Samatan was rich and his
wealth was safely secured: he had powerful friends
among foreigners and on his hand he wore a ring of
*very particular significance. All these things carried
weight not alone with his fellow citizens of Le Cap,
bht with the leaders and even with the all-powerful
Christophe. He recognized these things; they were
factors valuable to him, but he was too sharp a trad-
er to play his cards carelessly, too often, or for a
stake too small.
W FTHN Monsieur Samatan left the fort he hur-
ried to the Hotel de la Replblique, and here in


a far corner, a glass of wine at his elbow, was the
man he sought, Pierre Nicholas. The meeting was
cordial, and after a second glass of fine Bordeaux,
Monsieur Samatan stated his desire. It was that
Nicholas should intervene and secure the life of Cap-
tain Bush. The request was based on a statement
eloquently expounded of the friendship existing be-
tween himself and the Philadelphian. Humbly Mon-
siPur Samatan implored the intercession of the friend
of the king. No mention was made of a sum of gold
I(ng since borrowed by Nicholas from the thrifty
merchant, or of tfre interest now due, and- perhaps
none too convenient to be met. Nor was the green
srarab mentioned, although it was the ring hand with
which Monsieur Samatan most frequently lifted his
glass.
It was very evident that Pierre Nicholas did not
welcome the proposal with pleasure. John Bush, a
very irritating thorn in his flesh, had been, or was
soon to be, disposed of in a manner that was final
and satisfactory. It was annoying to contemplate
the possible continued activities of this extremely
fearless and foolhardy American.
The name of Virginie was not mentioned. The
question of the reprieve of the prisoner revolved en-
tirely on principles of justice and politics. In every
instance the argument favoured Nicholas. Monsieur
Samatan as a loyal citizen could not but admit the
impropriety of his own proposal. White men were
not wanted; fire and massacre had, not long before,
registered the black man's wishes in the matter.
L'Ouverture, Dessalines. and now Christophe, had
fought to break the rule of the foreigner, to conserve
Santo Domingo for the negro. And so it seemed
highly improper that this white man should be per-.
mitted to run wild and unreproved.
Monsieur Samatan hinted at the possible effect
on the United States of the summary execution of an
American citizen, but Nicholas smiled with gracious
tnleration at the jest. So long as England continued
at war with the young republic the life of an occa-
sional citizen would never be missed. Monsieur Sam-
atan agreed; and agreeing, he again lifted the ring
hand with a health to his companion. It was but a
whim, this desire of his that John Bush should live.
Perhaps on that ground alone Captain Nicholas would


1925-26


r|r




i p



F..:








give his aid. But now behind the heavy, pallid face
of Nicholas a thought was suggesting interesting pos-
sibilities. Sooner 'or later he must yield to Monsieur
Samatan's wishes; the debt necessitated that, the
green bug was already unpleasantly affecting him.
But if be must yield, why could he not capitalize his
magnanimity with Virginie? She need not know that
Other motives had influenced him. The thought en-
ticed him. He was already eager to be off to the
house of Monsieur Mangan to test its effect.
"It is a pleasure," he answered the merchant
abruptly, "to be aMle to render so insignificant a ser-
vice. I have already given orders that Bush be shot
at sunset, but I can easily change the sentence. What
would you have done with him?"
Monsieur Samatan thought for a minute. With
his left hand he absently moved his glass on the wet
table-top, describing a series of moist circles From
the corner of his eye, Nicholas furtively followed
the gyrations of the beetle. Sincerely he wished that
the interview might terminate.
"They are sending prisoners to work on the cita-
del, eh?" Monsieur Samatan finally queried.
Nicholas was surprised. He had anticipated that
the merchant would propose giving Bush passage on
some outgoing vessel, or at the worst a continued im-
prisonment tn Fort Picolet. Prisoners employed at
the citadel died off with appalling rapidity; a sen-
tence to that work was not much more than a death
sentence deferred.
"It shall be as you suggest." he agreed.
On his return to his house Monsieur Samatan
dispatched Luke to carry to Virginie a message of
encouragement The presence of Luke in Le Cap
would excite no interest or suspicion. His inability
to speak protected him; it would be presumed that
he bad come in from another part of the island. He
explained this to Luke with much gesticulation, and
the big black nodded his understanding.
The next step would be more difficult. In the
quiet darkness of his house he considered how he
would proceed. Then. with a plan half formed, he


PLANTERS' PUNCH 1925-26

drums, a dead man lying across the road. a patch of the king, Christophe. A hundred, and in some places
moonshine on the ruined wall of a sugar mill. Like two or three hundred. feet, the solid walls of mason-
a continuous stream life flowed down the highway ry towered against the sky. Black squires. n long
toward Le Cap. The air was resonant, the world lines indicated ports for the cannon that Christophe
seemed filled with life. had obtained for its defense. And in the centre Bush
They marched slowly, for the guards were show- could see higher towers and parapets uprearing from
ing no desire unduly to exert themselves, but Bush the mass, a final pinnacle against the sky.
was exhausted before they left the outskirts of the But now the road began to twist on a slightly in-
city; his feet were sore and swollen, his whole body creasing grade among the low foothills. Slowly the
ached, his head throbbed with dull, continuous pain. march was resumed; slowly the little band of pri-
I"o one spoke. At his side, ahead, and behind, the soners and their guards toiled forward. Black faces
other prisoners plodded doggedly. Manacles clanked were white with dust save where rivulets from
monotonously. sweating brows had coursed black gleaming lines.
It was midnight when the first halt was made, The guards, wearied and irritable, lagged in the rear,
and the men threw themselves on the dry, hot earth occasionally prodding the hindmost prisoner with a
a: ":e roadside, too exhausted even to seek the rela- bayonet or urging all forward with a curse. A band
tive softness of the grass a few yards beyond. of officers, courtiers from the palace, passed them,
For perhaps two hours they slept, flung limp and gold-encrusted uniforms sparkling in the sunlight,
lifeless on the ground. Then the prodding Vin and silver chains and spurs clinking sweetly. The
muzzles awakened them. Groaning and mutterlfg uniforms flared gorgeously against the green, and
strange vileness, the prisoners got to their feet and their black faces seemed very black beneath their
round the road. The clanking manacles resumed brazen helmets. The prisoners crowded to the road-
their monotonous theme. ide to let them pass, heads bowed and eyes down-
There was an enervating dampness In the at.. cast before this evidence of the power and magnif-
Like white clouds the night mist hung over the plla:. c' 0o.. the despotic king..
For long spaces the air would be sharp an. :, ,t:t .t',h etyl midafternoon, and the more frequent
then the nmist would dim the starlight and thel aIE... ..lthe road indicated that they were ener-
ness would become chill and tangible. .:' : ai:': of ltt. Now and then Bush caught
Dawn was paling the night, and the ima ler ht *.tra vill or sugar mills among the trees.
Hig......ts of finttelsy carved stone marked the
stars were disappearing from the sky when the aeH- Henb '4*r of Aei .Vcarved stone markeenc d cthe
ond halt was called, and again they dropped almost entrances. Here in.t days the French had cul-
where they stood into a stupor of sleep. Wheln John tiated their great ii tthhese splendid dwel-
Bush again became conscious of things, the sun was ngs, slaves by the hi.d thousands had tilled the
flaming hot in his upturned face and his body glow- hills. Su gar, rm, codt:.if, 1 hsa owd troi the r
ed with heat. From panniers at his saddle, thetoder hills Sgar rm cffee l Ai of the tre-
had taken a ration of coarse bread, and .a lag hard pic yielded wealth .mmeasunab A ktrd of the
cake was doled out to each of the men. They ate. income of al of France am. front W ~ nd soil
crouched on their haunches, and washed l W.0 the Eah year the ltinenof the royale iried
dry particles with water from a stagnant pdeal a the across the broad Atlantic to be biile l e to snowy
roadside. whiteness in the Santo Domingo sunshine. Here had
been life with all the wealth and splendour and indol-
-T HE food and water refreshd Buih andl "kS ee eace and viciousness of the capitals of Europe blend-
Hm fod nd wterrefrshe Bus fAA W..k ....... .. ... .. ..._ Europe -


blew out the candles and went to bed. And while he 1 had relieved the pain behind his temples. wv.: :s wiln tne gotten sunshine. Here had been song and I
slept the object of his solicitude stumbled along the a characteristic revival of interest he looked:; a oa-. laughter, culture and beauty. And then up through
rough i ad that led south from Le Cap toward the him. White and glaring, the road swR nbTh .Iititt crust of an effete civilization had been
citadel. resting-place, appearing and ending on eitWi.:m,. th. a gaunt black and. Toussaint I'Ouverture
in the varying green of tropic foliage, +?te. .. :f W: .tt revolt and died finally in a prison in far-
T HE experience of that terrible night was to Bush studied the mountains. On a sheer peak l .iiaih :pin the dikes that held in check the
a stretch of Interminable hours punctuated a it *ite block of stone seemed supertim-Inpol..:i.,6:.t.A#Lt on. Fire came with sword; ter-
here and there by vivid and unforgettable incidents. very summitt. Distinct through the clear sir he coj bi't- -aa.by niight horror Indescribable. Lust,
Trivial incidents in a sense they were; pictures see it as though through a spy-glass. It was the -e ;''crnelty nd wept. before. their savage rush
flashing out of the luminous night, a fire burning ffei that tremendous fortress which under the dtree- the amlam 4t.;u ltio, and.the looted villas
back among the banana trees, the liquid booming o tlion of English engineers was nearing completion for flamed. tar:ls tB.:tl.pk hordes reigned.


SUGiAR MACHIl -R.Y. ...-

........Iiie'e ned since the revolution re-
A. ..... ..f... Again and again t..he untrained

I 1. ....' ..)1.8 patriots had risen against French':
W ith aagi d
*t*t hed sn he

-an- -WtIsh invaders. Again and again Le Calf
n. ranca ie had lighted the night skies with the
O R nearly ri5 years D a glare' o her burning buildings. Napoleon's picked
.". Stewart and Company have veterans had finally abandoned the vain attempt to .
b ee ar cane mpacneyh subdue an arouse people. Dessalines, following the
Seen .making aene sugar machinery patriot Toussaint. had become emperor. He was
ofaeuperiorclass. Estimatescheer- assassinated, and now Christophe ruled, a king. In
fully given for the fitting up of a Port au Prince in the south, Petron disputed Chris-
single machine or for the complete tophe's title, and a constant war existed., : the
equipment of the largest mlnode-n : brain of Christophe there was increasingu..a: trthe
equipmBentB ofS t he dopdgatn wall. -'% :
cane staugir factory. They specialise a neath which had become so frequent an- lt the
Sinthe q ipment of n ue sugar fac- land he ruled. And so he was now- o ipltting an
tortes with capacities of from 511 Impregnable fortress where, if the need came, he
Sato 6o,000 tons of ctan lmr day. could withstand his enemies.
Sto s oof cae pr day. In he quick To light John BilB saw the glory
of Millot. Wide and grassy t.he br.d central street
*.* opened from the winding road .:Ahead the mountains
CA RUSHERS, CANE ILL cut a dirk silhouette agass inst thsaffron sky of sun-
CANAa U. KobSERS, C : IACsSNl^Er;
SC set. From rich gardens.,~ the i th e intense olour of
r FILTBER PRESSES, CANE ELEVA- the bougainvillea an .t..e flamboyant banana trees
*AN T SSR AND CARRIERS, J U IC .E : drooped giant frop spnIvr ruined walls. Their was .:.
7a stir of life ever~~~e ,. aMen and women nimoed i,.

Sof limpid .Frteu ad4ords, the sweet notes of la I
PORATORS, V A C U U P U 31 P 8 the il gloe. l gver-mounted harness. Bright'n
SiOrYSTArLLSERS CENTRIFUGALS. : f0ormt a ,ri4ae ts of vivid color among the wh
S. ru ',s, ALL TYPES. :ments:etthbe common people. All was life, s !f
SA.. nity sait beauty. But, footsore and weary,
T WTLbat.d -.irsonerg stumbled along the raLtU n-
... .... n o o cing. ....

: DU .-CA.N SACo. A were cries and a smart tina 'lime.
L "T"AR T *O ,&tlo.,l'ite horses, their shining harnae g l or-
.d R ad lsgi a intefi with silver, came at a faflt down the
London Road ron works .GlaeSgo Scotland. -:ue. Behind them. swung on log lker springs,
.. a French chariot. Outrider n.. --
Cables:"STEWART, LASC :: E d 184. mounted the off horses; on a
S: ": chariot rode two black footmain
'0 livery of crimson. And in .the
S* deep seat lolled a womau years, a
S dark mulatto. dressed In.. the latest
Agent: Allan D. Roberts Parisa fashion. the .
The prisonerse-haroadside while the
76 Harbour Street, Kingston. Jamaica. fatigue, Bush wsed. r o the soft cloudinite
* ofEu ist that m"e orse hoofs. More slow-
*eseeesseesseseeseessesseeee*****su*esese* ly they 'heir tdetination now at
J ".;





PLANTERS'


PUNCH


hanju, the guards no longer pressed them forward.
Then at the end of the street Bush saw the palace,
and in spite of his weariness its unexpected magnifi-
cence absorbed his attention. On the left the dome
of a low building rose among the palm trees, and
beyond the entrance on a high terrace formed by a
long level hill was the palace of the king, a tremen-
aous chateau of French architecture four stories high,
surrounded by a garden of indescribable splendour.
Like a man drugged, Bush slept that night on
the earthen floor of a thatched building on the out-
skirts of the town. Sleep came slowly, for although
he was now freed of the manacles his wrists ached
and his feet and legs were swollen with walking. All
about him on the floor lay his companions, black
bundles of rags from which now and again a tossing
arm swung in sleep in the gleams of moonlight that
fell white and clear through crevices in the root.
Through his tired brain past events marched again
and again in interminable succession. He felt the
swinging deck of the brig beneath his feet; he saw
the honest face of Huggett, the shining ebon coun-
tenance of Luke, he saw Nicholas' sneering lips and
small eyes peering at him; he saw Leroy Mangan,
cold and inimical, and then he felt the moist warm
lise of Virginie; he felt his arms around her yield-
ing body, and with a tremor he aroused from his
half-sleep to see again the moonlight and the tossing
foFrms bf the sleeping men.

lllllllll il li i111111111111111111iillllllllll l illlllilllllllll

= HAPPY HOMES

BECOME

HAPPIER HOMES

S W tirW Croceries are supplied by


: JAMES DINN|

a BECAUSE
5 the big stock of High-Class delicacies,
biscuits, wines, meats and vege- 2
e tables are alw.1\s fresh
and quality
I THE BEST ONLY.

I Come and ipect our XMAS supplies. We
n.- y a afine aiy.of rich daitMies for the table. =
i dAlA will make vour Citri t


Si Ai d-. 3OYABE -- -
Ssa::dlP ENJOYABLE.
.*fc^^^^- *


- t. m.a-
:.. ";*^; 'L. i


5 JAMAICA'S -

Kingston. Jamea. c .W.
.Hllllllilllllllllmlllllllllllllllllllllli Hi ii ii llillllm



THE SPORTS,

'7 KING STREET-

GENTS' OUTFITTERS.


Sofa Large Range rJ
|High Gr *.., ds
Worstei, ...
Flannels, : .


Blue and Cream Serges,
Mohairs,
Silks,
Assams,
Poplins, Etc., Eto.

SITS MADE TO MEASURE
AT SHORTEST NOTE.
SUA RANTEErr.
... -


8


E SHOES

ts and Children.


-. :~~- `~ 'AX ~


CHAPTER IX

T HE dew was heavy on the grass. Some parrots
tied screaming In level flight from a copse of
banana trees. The light was clear and mellow with
dawning day. Along the worn and rutted road be-
hind the sleeping palace they marched in straggling
tile, a hundred and more prisoners, black, mulatto
and quadroon, and one white man, John Bush. At
the roadside were the brickyards where for years
had been made the red brick for.the citadel. Every-
where were the cabins of the workers ait.'bhuge bar-
racks where the prisoners Were quarteied. And
among the buildings the white boles of the paln trees
reared immaculate to their clustering fronds.
The road wound in and out among ravines and
gullies. Streams of sparkling water gurgled down
over shalTiw fords, the broken rivulets glittering in
the sunshine. Steadily the road climbed the side of
the mountain, and at each turn a new view of the
valley was disclosed, a vista of green-clad hills and
a great wedge of azure sky between.
They halted on a level stretch. Lashed to mas-
sive carriages with solid wooden- wheels a half-dozen
bronze cannon lined the roadside. With his eyes
Bush measured their bulk; their weight was enor-
mous. They were guns of the greatest size from a
ship-of-the-line, or perhaps selge guns purchased from
the French, guns that had, spoken at the bidding of
Napoleon before the walls of some invested city.
The prisoners Were divided into squads. In and
out among them a dozen-petty officers of the king,
burly blacks in sweat-stained uniforms, bustled offi-
ciously. All the soldiers were armed with brass-
mounted flintlock pistols and sidearms, and each
carried in his htnd a.lithe whip tipped with a bit of
sharp Iron. Loud -and strangely discordant their
vituperative orders rose above the steady purling
sound of the stream, amd like animals the men dumb-
ly obeyed.
Bush found himself in the middle of a long
double line of men harnessed to the traces attach-
ed to the foremost gnns. There came the sharp or-
der to, start. BUwlry the black shoulders bent against
the inert mass behind., From corded necks strained
muscles appeared liih twisted rope; beneath the glis-
tening black skin of btirai backs the lacing sinews
stood out taut as the resistance of the tremendous
weight flexed the strutsgllng bodies.
"Allonsl" The long whips cracked smartly.
On the shoulders of the tman before him Bush saw
the black skin oien beneath the lash into a red gash
from which the tiny dropi of crimson trickled like
sweat.
A negro in stained red trousers tucked into high
boots of Spanish leather g;lloped up and down the
line on his horse and screamed invectives at the
straining men under whosle[oencerted urge the wood-
en wheels of the cariage, squealed finally into life,
.:d. slowly for a dosea ySeds the gun moved heavily
(*luAlng the road. Then a:'eroe rut intervened and the
:ji 1akls-doubletd n tje :effort.
,was the heavy reprt to a pistol. With a
Itij .re the soldUer lifted the smoking bar-
:head.,In tie road the leader of the
t..IO~ a moment t and then stretched stiffly
7j trair 'beneath the feet of the
i::.tes tlle shattered by the lead-

7iulf K'lBitl i.,he ro. "Pull, or I kill the
next man, ~ta took a second pistol from his
belt.
With the terror of death driving them, the long
lines of taut bodies leaned against the traces. Once
more the greased wheels of the gun carriage protest-
ed as they turned. The gun was going forward. The
foad dipped slightly. A momentum was attained.
With a rush they gained the succeeding slope. At the
end of each ascent there was a brief rest; then the
next incline was taken.
The edge of the road dropped away abruptly in
a precipice of two or three hundred feet. Standing
near the edge, Bush peered over into the depth.
down beneath the sheer wall of rock was the thatch-
ed roof of a native hut; a thread of soft gray smoke
rose from it in the sheltered air; there was the
sound of voices." clear but very distant.
His eyes wandered to the man who laboured at
the traces just in front of him, whose back had been
so cruelly scarred by the vicious iron-tipped lash.
He was crouched on the ground, staring off into the
limitless distance through small, dark yellow eyes.
He was a negio of powerful build, an enormous man
with finely moulded limbs, but the head was small
and round, and there Was an expression of hate in
the coarse features of the face. Conscious of the
stare of the white man, the black lifted his eyes to-
ward him; there was a malevolent glare in the small
eyes. a snarl on the -thick, red lips.
EHIND him and below a bugle cut the stillness
with three thin rising notes. In an instant the
soldiers were on their feet. The officer on his horse
waved his sword wildly about his head in a frenzy
of excitement.
"Back." he shouted, riding at the prisoners who
had flung themselves along the road when the order
to halt had been given. "Back! The king comes."
Whips sang in the air. Wickedly the lithe


thongs snicked against human flesh. Before the on-
set of the guards the men crowded against the cliff,
leaving clear between them and the precipice the nar-
row road.
A mythical being Christophe had always been to
the Philadelphian from the day of his first voyage to
Le Cap. Throughout the island it was the king
whose name recurred most frequently in every con-
versation. He was a hero, the saviour of the coun-
try, an invincible and magnificent monarch at whose
touch the armies of the great white war-loving na-
tions Eaded as the mist over the plains melted be-
fore the rising sun. Once a waiter In a tavern in
Le Cap, this uneducated black by his inherent genius
had become the leading general of his predecessor;
and when an assassin had struck down Dessalines
it was General Christophe who had become president
and later by his own edict king of Santo Domingo.
Bush recalled fleeting fragments of the countless
anecdotes he had heard of him. To his subjects the
ruthless king was a demigod. With the characteris-
tic tendency of a simple people, his tyrannic power
had won for him a mute affection. They boasted of
his cruelty, of his bloody revenges, of his mad licen-
tiousness. And yet through all the sequence of'anec-
dotes were occasional instances of rude justice and
ot rewards justly given for faithful service. By the
rule of fear Christophe was king, but there was
another side to his nature that Infrequently gave it-
self expression.




RAE BROS. LTD:

91-93 HARBOUR STREET,

Kingston. Jamaica B.W.I.



REPRESENTING:
NASH MOTOR CARS
NASH TRUCKS
AJAX-NASH BUILT CARS
HOOD CORD TYRES
COULD STORAGE
BATTERIES.



WE SELL:
ALL ACCESSORIES
REPAIRS to any-make Car
GAS-STATION Day and Night.

EVERYTHING FOR THE MOTORIST.





DESNOES & GEDDES,

Limited.

29-35 ORANGE STREET,
Kingston, Jamaica, B.W.I.



MANUFACTURERS OF
Highclass table waters and Soda.

BOTTLERS OF
Kola Wine. Ginger Wine, Orange

Wine and Native Cordials.

BLENDERS AND BOTTLERS OF
MONOGRAMN" RUM.


AGENTS FOR
"White Horse" Whisky, Arrols

Ale Stout and Lager Beer.
I-


1925-26


II


1!





PLANTERS'


Up the incline came the foremost of the king's
escort. Their black horses were lathered with sweat;
foam clung like froth to their champed bits. Polish-
ed brass and silver shone in the sunshine. They
were in the ornate uniform of the king's bodyguard:
tall, thin-hipped, broad-chested men who rode their
horses like centaurs. Eight, Bush counted, riding in
a single file. They passed with only a casual glance
at thie prisoners and a mere recognition to the salute
of the self-conscious officer who sat on his horse at
a fixed salute. the sweat coursing in shining rivulets
down his face.
There was a little space behind the last horse-
man. Then over the crest came a huge white horse,
magnificently caparisoned; and on its back rode a
man who, Bush instantly knew. must be the king.
He was a full-blooded uegro of middle age and of me-
dium height. for his stirrups were drawn high against
the crimson saddle-cloth. Lolling easily in his sad-
dle, his massive body swayed with the horse's gait.
But it was not the graceless body or the broad face
that held Bush's attention, although the face was one
that, once seen. was impossible to forget. Beneath a
kide-brimmed velvet hat encrusted with gold and
ornamented with a tuft of snowy aigrettes Bush saw
a pair of black eyes that moved with a nervous rapi-
dity in contrast to the gross inactivity of the heavy
body; the whites of the eyes were prominent and in-
tensified the blackness of the pupils. They were
rr.........---"--.....--......-------------.....-...... --........
THE

Rapid Vulcanizing Co.,

82 HARBOUR ST., COR. DUKE ST.,
A. C. CAMPBELL, Proprielor.


Dealers in

Ford Parts

Tires and Tubes

Gasoline and Oils

General Motor Car
A accessories.

agents for

"FRANCIS-BARNETT"
Motorcycles

"ROYAL STANDARD"
Bicycles.

"Reliance" Tire Pumps

Allbestos Brake Lining

"The best in Asbestos"
.------- -----------------------.----------------------- I


PUNCH


eyes in which could be read all of those characteris-
tics that had made Christophe the hero of a thousand
tales. In them were boldness, vanity, cruelty and
fear. Uneasily they shifted as though they feared
the fidelity of the men of his own bodyguard. Then
they fell on Bush and for an instant the two men re-
garded each other with mutual interest and sur-
prise. In that brief period Bush also saw the wide
cheek-bones and the heavy, sensuous mouth, thick
!:ps parted, revealing large white teeth. It was a
gross, bestial face, but the eyes so dominated it that
the other features at first glance passed unnoticed.

DIRECTLY opposite the prisoners Christophe
reined in his horse and with evident satisfac-
tion regarded the gun lashed to its crude carriage.
Slowly his eyes shifted from the huddled men to the
broad panorama of the green valley and the distant
plain of Le Cap. In the stillness Bush could hear
the white horse paut heavily; he would hear the
sound of the approaching rear guard as hoofs click-
ed on stones. Then directly beside him Bush saw
the body of the negro who had toiled ahead of him,
tife man who only a few minutes before had turned
on him a face filled with hate and passion, crouch as
though to spring. It was the movement of a tiger,
a movement that he did not comprehend. In a fash
the realization of the purpose of this lithe, straining
creature just in front came to him. He saw the body



'"o the traders of


PLANTERS' PUNCH




When in doubt as to were you

can procure wholes-ome Groceries,

choice Wines and Spirits, please

refer to this periodical, or, take

our word.




"OUR SERVICE AT YOUR SERVICE"





The Army & Navy Stores

136 HARBOUR STREET,
KINGSTON.


1925-26


lean forward, poised on bent, black fingers, the bare
ieeT working a firm toehold on the road. With a
strange apathy he watched the muscles of the half-
bare back tighten until the contracting flesh started
again the trickle of blood drops from the dust-caked
cuts left by the merciless lash. Cautiously the round
black bead lifted and the yellow eyes stared fixedly
before him. Bush followed their gaze.
Sitting on the white horse, the king wiped the
sweat from his forehead with a hit of gaudy yellow
silk. He had taken off the velvet hat and uncover-
ed the mass of crinkly black hair tiat was brushed
back from his brow and gathered in a tight cue tied
with a black ribbon at his neck. From his comforta-
ble saddle Christophe gazed off through the twilight,
ant perhaps to gain a better view, he edged the horse
slightly over toward the rim of the precipice. It was
a striking picture against the back-drop of the sky;
the superb animal, the magnificent equipment and
the powerful figure of the negro gazing off across his
domain.
The crouching black drew back slightly for a
spring. On the brink of the precipice the king, una-
ware of danger, continued to feed his eyes on the
distant scene. Then as though impelled by some sub-
tle a-d intuitive force, he turned his head abruptly.
The -cruel, penetrating eyes met the glare of the
crouchingnegro. His hand shot to his belt. It was
too late.
As though flung from a catapult, the prisoner
leaped from the road. There was no one between
him and his prey. One blow from that hurtling body
and horse and rider would perhaps be flung into
the void. In the brain of the assassin consequences ,.
undoubtedly were unconsidered; better, perhaps,.
that he too might fall spinning and turning through
tile limpid air than to die later at the hands of the
king's guard.
There was no motive or thought behind Bush's
action. It was the instinctive act of a man prepared
by stern training in daily emergencies to act on im-
pulse. Possibly history might have been better serv-
ed if he had remained passive and watched this ter-
rible episode -without interference. But that did not
happen. The whole act had been a matter of sec-
onds.. Unreasoningly, instinctively, as the prisoner
sprang at Christophe, Bush leaped simultaneously;
and .a the.negro flung past him he caught in midair
thi leg of the man and crashed with him on the road.
'WWith maddening strength the negro struggled to
tear himself.loose from the binding arms of the white
man. Writhing.and turning, the two twisted on the
rough stones. Through the dust Bush saw the pink-
ish palm of a hand reaching. for his throat. A pistol
thundered in his Oars:fii MS fled him..

with a inal effor tha A W
fe te treneth.a m si i-r ft
frbm'a.. 'pu.i tured ,klin. a "ily tuhe fn ii
pa :ha sibie, Fram h W ib th the dead weight of the'
Bit: B sh pUlld6dhit entwined arms and sat up, look-
.: li daU.'y ,bout him, his head still ringing with the
.pstol'r detonation. .
Unmoved, Christophe looked down at him from'
his saddle, a pistol smoking in his hand. Already
the king's bodyguard had leaped from their horses
and were gathered about him. With a long sword one
of the men pricked the breast of the dead man; no
tremor of animation greeted the thrust. Stiffly Bush
got to his feet. There was a sudden excited flood of
voices; men until that moment silent through tep-
sion gave tongue to pent-up emotion. But Slletly
Christophe regarded John Bush, his u itching
eyes appraising the white man, his thif: :ed lips
drawn slightly back from his strong white teeth.
Fearlessly Bush met the gaze of the king. No
line or movement of the broad, black face indicated
what might be passing through. Ch2 stophe's mind.
Only the parted lips suggested a friendly recognition
of the impulsive act.
HAT are you doing here?" Christophe spoke
S in a hard, throaty voice, enunciating each
word with distinct native accent. It was not the
French of Nichola,. or Mangan, but the French of
the Santo Domingo ilave.
"I am a prisoner, your Najesty." -There was a
drawl in the infection, and the corners of Bush'%
blue eyes suggested a smile as he spoke the word
"prisoner." _
"A prisoner?" Chrislophe seemed to ponder for
an explanation. "It Is not usual for me to see white
prisoners here. You are an American?"
Bush -nodded. "I am a Philadelphian."
Behind the broad, black forehead of Christophe
thoughts seemed to be struggling for expression.
Then his eyes turned to the dead man In the road.
ZHe waved his hand expressively toward the cliff.
Tie body of the would-be assassin was lfted.troam
the road There was a sharp commat.
turning slowly over and over, arms l'
loosely, down toward the distant .'haps
there was something in the sfl b calling ob-
ject that crystallized the tho g the king. Had
it not bepn for the quick at:~ white man he,
Henri Christophe, might nOiw' ytng a broken thing
beneath the trees. A ki 'Virtue of life, but the
sudden thrust, and he,'- phe would be no more
than the mangled caret the slave. Perhaps such
.".f .'0.00%








1925-26 PLANTERS' PUNCH


was the train of thought that possessed him, for the
hird eyes softened a little, the parted lips broaden-
ed to a smile.
Again Christophe turned toward Bush, who stood
silently watching the slowly changing expression of
the king's face.
"W\hy are you here?" he asked.
"A number of untortunate circumstances, your
Majesty. Some actions of mine, although well inten-
tioned, have brought down on me the enmity of seve-
ral of your subjects."
"'You are a man of education?"
Bush bowed gravely.
'Possibly you have had the command of men?"
"For the better part of my life I have command-
ed men. The brig of which I was both captain and
part owner was but recently sunk as the result of a
skirmish with an English frigate."
Again the black face reflected the slowly worl-
ing mind. "Your name?"
"John Bush, your Majesty.' The repetition of
the title was not without its effect. Again the strong
white teeth gleamed between parted lips.
"Captain Mitchel!" An officer on a black horse
at the king's side saluted. "This man goes to the
citadel with me. He is pardoned." Christophe turn-
ed to Bush. "Your offenses were serious, perhaps?"
be questioned.
'Not murder or a crime against the state." The
blue eyes seemed to demand respect, to defy a further
questioning.
"Bah!" Christophe waved a square black hand,
thick fingers heavy with gold rings encrusted with
jewels. "What is a life worth unless It is the life of
the king or of one whom the king regards with fa-
vour? I pardon you, John Bush. I do not ask your
offense. It is a reward that I give you for the ser-
vice you have rendered to the king. But there is fur-
ther service that you can do me. I shall not forget.
I reward ... .Captain Mitchel! A horse for Mon-
sieur Bush. There is a horse."
He pointed at the red-clad officer who sat at a
respectful attention in front of the prisoners-the offi-
cer who not a quarter of an hour before had cursed
the white man who struggled at the traces. With
alacrity he scrambled down from his mount and
came forward, the bridle in his hand. He was abject
in servility, but in his lowered eyes Bush caught a
glance that Indicated the resentment that his Invol-
untary sacrifice inspired.
i O it happened that once again John Bush found
himself plucked from the veritable depths of des-
\pair and placed in a position from which he could sur-


vey the future with reasonable hope and equanamity.
With characteristic light-heartedness he fell instant-
ly into the spirit of the new adventure and began
mentally to cast about to determine what possibilities
it afforded. It had been on his tongue to ask Chris-
tophe for his safe conduct to Le Cap, but his intui-
tion told him that another motive than mere grati-
tude had prompted the king's action. Undoubtedly he
believed that the young American could be of further
service to him.
What that service might be, Bush did not at-
tempt even to imagine. The court of Christophe
teemed with men Imported from every capital of Eu-
ripe to assist him in the rule of his black subjects,
men who for the nrout part contributed more largely
from a knowledge of the vices of civilization than
from a familiarity with those virtues which alone
can create through a just and enlightened ruler a
happy and prosperous people. Undoubtedly in John
Bush, Christophe had sensed a man who might be
valuable to him. The future would disclose the ans-
wer.
There was another reason why Bush had hesitat-
edl to plead for immediate freedom. In Leroy Mangan
and Pierre Nicholas he recognized enemies of not in-
significant character. Both stood high In Chris-
tophe's favour. There had as yet been no mention
of names. If Christophe realized that it was the dis-
pleasure of these two men that Bush had incurred,
the case might well be altered. Sooner or later he
would learn of it. but for the immediate present Bush
would he safe, and what was of greater importance
to him, he would be in a position to attempt an es-
cape with Virginie.
So it was that his resilient disposition respond-
ed to his unexpected trick of fortune with a flood
of high spirits, and again he was planning his next
move almost as soon as he had swung himself into
the saddle of his late captor.
A SORRY figure was John Bush in this new com-
pany. Half naked, barefooted, gray with dust,
he rode surrounded by the very flower of the officers
of the king. Polished metal sparkled; gay coats flam-
ed against the green roadside. The spirited black
horses completed the contrast. Only in his face
could be seen that which neither rags nor dust could
conceal. Among his companions he rode, a man who
demanded recognition, a gentleman.
For the first time Bush found opportunity to look
around him. Although he rode now a privileged
character in the midst of the king's men. there was
no converse between them. In their eyes, be realized,
he was still a prisoner, relieved from menial servi-


tude to a more agreeable but none the less hazard-
ous position in the household of the king. And so
there was time for thinking and an opportunity to
sudiy the astounding setting of this mountain fort-

Up from Millot on the southern slope the road to
the citadel had been cut back and torth, ever as-
i.ending to the three-thousand-foot pinnacle. The road
snung in a wide curve. Perpendicular above them
rose the walls of the citadel, a tremendous face of
brick and stone pierced with innumerable gun ports,
row upon ruo to the summit of the walls.
Around the foot of the prow they rode on a
narrow graded path. Another level platform opened
and above it was the south wall of the citadel, flank-
ed to the east and west by the towering turrets. A
row of light field guns commanded the approach. The
bare earth of the platform was crowded with tether-
ed horses, piles of saddles and equipment. Every-
where were the black soldiers and officers of the king.
Through iron-studded doors of oik they entered
the base of the eastern tower. Soldiers had taken
their horses. On foot they passed -under the high
stone lintel. Inside it was dark, and from the gal-
leries a chill wind blew steadily and made Bush con-
scious of his wet and heated body. In iron braziers
inset in the stone tawny flames of oil-soaked wood
accentuated the gloom. Up broad stone steps, turn-
ing steadily, they mounted. At each landing Bush
had a glimpse of long black torch-lit galleries re-
ceding into gloom. Everywhere there was the sound
of voices and of foot-steps. The vast fortification
seemed with life.
From the upper landing they turned into a cav-
ernous corridor and then through a door into an open
tuurt. Above, the first stars were faintly flickering
piu-points of white in the luminous sky that flooded
the court with a soft radiance. On all four sides rose
the battlements of the citadel, completely enclosing
the spacious area. It was the heart of the fortress,
the inner fastness of Christophe's impregnable re-
treat.

CHAPTER X

T WAS eight o'clock and in the dining-room of
Leroy Mangan a dozen candles in silver candle-
sticks gleamed on the white linen and sparkled in the
polished glasses. In his dark green livery, old Lu-
cien moved noiselessly about. Virginie sat alone at
fth foot of the table. Opposite her, set as though he
were expected to be present, was the place of Leroy
Mangan.


t!hat Does the Future Hold


.. .




W ILL your old age be one of
misery and strife or one
of peacefulness ?

There is no better provision for
a peacel-ul old age, ais well as for
your dlepenilents when you are
gone than ;in Insurance Policy in
a well established C.'onpany.

Therefore see that you are mak-
ing this provision while you can
by taking out your Insurance
Policies in





The North American Life Assurance

Company of Toronto, Canada.



SAll claims are settled locally by the Agents,

LIVINGSTON & ALEXANDER,


6 Dake Street,


- Kingston, Jamaica.


..... .. .......


Are You Free from Anxiety ?



F not make yourself at ease by carrying an Insurance
Policy in

THE

Norwich Union Fire Insurance Co., Ltd,,

of Norwich, England.



This company will set your mind
at rest in regard to Fire, Motor
Burglary, Personal Accident,
and Disease, Third Party,
Drivers' Indemnity and Fi-
delity Guarantee Insurances.

Write or call on the Local
Agents at once anl take out the
Poficv you require; and remem-
ber that in going to this 'om-
pany you are going to an old
established Company, anI that
you will not have It wait months
for the settlement of your climbs,
as all claims are settled locally.


LIVINGSTON & ALEXANDER,
AGENTS,

6 Duke Street Kingston.


I


1925-26


PLANTERS'


PUNCH






PLANTERS'


PUNCH


The girl's hand trembled slightly as she lifted a
glass of claret to her lips. Monsieur Samatan bad
called a half-hour before; he was in her guardian's
room. She had been dismissed when he entered, but
she had stood for a few minutes outside the closed
door. Somehow, she knew that it was of John Bush
that he was speaking, but she could not hear the
*wrds. only a tantalizing murmur, dulled and unin-
telligible.
Monsieur Samata.n, she realized, was a true
frfind of the captain's. Perhaps it was to plead his
calls that the merchant had come to Maugan's bed-
side. Perhaps he would have a message for her.
Except for the promise which Pierre Nicholas
had given her she had no word of Bush since the
Cay previous. Had Nicholas lied to her-and she felt
scant confidence in his word-the threat of her guard-
ian might already have been carried into effect. In
that case life would be over for her also. The keen
stiletto that for years had rested in her guardian's
cabinet was concealed beneath her pillow. That
morning she had tested the sharp point against her
white breast. A little thrust, a very little thrust-
that would be all.
There were steps in the corridor; Monsieur
Samatan was leaving. Stealthily she pushed back
her chair, and hurried through the drawing-room to
intercept him at the door. Monsieur Samatan was Im-
maculate in starched linen and a high white stock on
which his chin rested. He was agitated and pulled
nervously at his long pointed mustache.
"Monsieur Sanatan!" Virginie spoke low and
hurriedly. "Does he live? Is he safe?"
The merchant glanced over his shoulder down
the dark corridor as though he feared to answer.
"Oui. nmademioiselle." His voice was hardly more than
a harsh whisper.
"Where is he? Tell me all. What has hap-
pened?"
Monsieur Samatan edged toward the door. "Mon-
sieur Mangan forbade me to speak with you. He
knew you would question me."
Virginie raised her voice slightly and there was
a tinge of anger in her tone. "Monsieur Samatan,
you will answer me. You have claimed the friend-
ship of Captain Bush. It would be his wish that you
tell me all."
"Do you doubt my desire to serve you, made-
moiselle? Have I not twice already sent the dumb
man with a message to you?" He walked slowly
through the door as he spoke and Virginle followed.
As they passed from the confines of the house the re-
straining influence seemed to fall from them.


"He is alive, mademoiselle," the merchant con-
tinued more easily. "It was ordered that be was to
be shot but I persuaded Monsieur Nicholas to order a
reprieve. There is a matter of some money between
us, and Monsieur Nicholas was amiable."
"Where is Captain Bush now?"
Monsieur Samatan made a gesture of despair.
"It is the only thing that could be done. made-
moiselle; he is sent with the prisoners to the cita-
del."
She gave a little cry and covered her face with
her hands as though to shut out the picture of her
imagination.
"Oh, monsieur! Death is as certain there.
Would it not perhaps have been best for the good
God to take him at on(e?' She was sobbing softly
and her fingers were wet with tears. "Have I not
seen them go. hundreds and hundreds of them, every
week for years, to die at that cruel work!"
Monsieur Samatan put his hand on her arm.
"Hush! The trees are listening and they will repeat.
Hasty words can only bring certain ruin to the man
iou' would save."
"Can he be saved?'
"Perhaps. Monsieur Mangan does not know
that he still lives. Later he will learn. Then per-
haps you can win him to give his release, if he will
leave here never to return."
"Captain Bush will not do that."
"Then, mademoiselle, what more can be done for
him? I have gone further than even my position
permits. I have saved his life and I shall still try
to save him, but-"
A thought occurred to her. "Would Monsieur
Nicholas have prevented the execution had you not
talked with him as you did?"
Monsieur Samatan shook his head. "Monsieur
Nicholas desired his death. He had taken no steps
to prevent it."
'"Thank you, monsieur, for all that you have
done. Gbd will reward you."
She went at once to her room and from its hid-
ing-place took out the stiletto and again tested its
point against her breast. He lives! Yes, and he
might some day return to her. But in five days
Nicholas would exact of her her promise. She thrust
the knife back. At least a little time remained of
life and hope. Then, If necessary, here would be her
answer to Pierre Nicholas.


T was ten o'clock when
self on her bed and sank
a sleep of exhaustion. And
John Bush, bathed and refr


lay down to a troubled repose in a room in the prI-
vaLe apartments of the king in the lofty citadel.
At this same hour. under the warm, starlit night,
two men might have been seen walking steadily along
the white and dusty highway which led from Le
Cap Francais to the town of Millot. They were an
ill-matched pair; for one was a negro of unusual
height and intensity of colour, while the other was
a white man, short, stocky, and with the tarred pig-
tail and varnished straw hat of the sailor. No con-
versation passed between them, but occasionally the
white man made some audible comment on the char-
aLter of the country through which they were ad-
vancing, at which the black would nod vigorously,
shaking his head until the wide brim of his woven
palm hat flapped violently.
"Luke," said Huggett, "I think the captain must
have found this a hard passage, beat up and out like
h,! was."
The negro made a throaty sound and the hat brim
fanned his face.
"Must hev been two hours since we left that
trader. Samitan," Huggett continued. "White he is,
says I, if he be black. Eh, Luke, my man?"
Again the negro signified agreement. Huggett
hitched at his waist and his fingers confirmed the
presence of his sheathed knife inside the wide sash
around his hips. Then he thrust his hand inside
the open front of his shirt. Suspended from a piece
of line around his neck, a small package rested
against his hairy chest.
"Samatan sure sets a heap of value on that ring."
His blunt fingers pinched the small package as he
spoke. "Stone bug, that's all it be, except there be
magic in it."
The whites of Luke's eyes rolled excitedly and
he made a gesture with his arm which Huggett either
ignored or failed to recognize.
"Says if we gets on a lee shore and hard put to
it, to open the package and show the ring, but on no
account to give it to no one 'cept the captain, and to
him the sooner the better."
THE light of the new day had already touched the
citadel when a bugle aroused Bush from his
dreamt With a start he lifted himself on his elbow
and looked about him. In this lofty mountain fast-
ness he was, if not a prisoner, at least unable to fol-
low the:ome delre that motivated his every action-
to return to Le Cap.


Virginle finally flung her- Sitting on the edge of the bed, he examined the
k almost Immediately Into clothing that one of the king's aides had brought to
d it wad ten o'clock when him the night before. The high black leather boots
eshed with food and wine, were of French make, and the whlte knee-breeches,

11111111111111111111111111Hllllllllll llllllllll HIB





SAMUEL & CO.,

131 Harbour Street.





Jamaica's Leading Wholesale Dry- oods Warehouse.



Town and Country Shopkeepers!!!

We invite an inspection of our Stock before
making your purchases elsewhere.

We carry a large and well-assorted Stock of
Fancy and Staple Goods. Boots and Shoes.
Haberdashery, etc., etc., throughout the
year.

S We guarantee -satisfaction.



= _I.".. ,





SSAMUEL & C

S131 =-.AiOUR STREWB|



,.IIII lI IIIIIIII lllII HII Ui!! IIIIIII IIIHtHHIM Itl I|ItIf III lIllII!III I Ih:l
7.;7 "'


i'

I .


1925-26


.1


















.i
'I


Keep That



School Girl Complexion








BY USING





PALMOLIVE SOAP













E. M. MARTIN, DISTRIBUTOR

76 HARBOUR STREET,

KINGSTON.


:ilj











'-.;


Ii


I






PLANTERS'


PUNCH


from the fineness of the material, were obviously now drying in the sun. A short, fat officer, whose
from the hands of some Parisian tailor. The coat gray, grizzled beard hid the black skin beneath, re-
p was of crimson broadcloth lavishly adorned with bul- ported a rumour of revolutionary talk among certain
lion, and the shirt and stock were of the finest linen, men at Limonade. The king's eyes narrowed to a
It was the uniform of the king's personal guard. slit and his lips bared the big white teeth. A com-
Was it the intention of Christophe to hold him pany of fifty men would proceed at once. No one,
indefinitely? Carefully he considered his situation. however slightly suspected of the treason, should be
Possibly this was simply an attempt to reward him allowed to escape. Their execution must be reported
for the act that be had performed. At all events, he to him as quickly as possible. Another officer fol-
realized, he must not seem unappreciative of the lowed: two sentries had slept at their posts. Again
honour tacitly conferred upon him. And at a suit- the eyes of the king closed, catlike; again the lips
fble time be would plead for.his release, retreated from the pink gums. It Was his expression
Then he saw again the leering face of Nicholas indicating death. In curt rasping words the conflrma-
-. and beard the boast of the wedding day. The recol- tion of their immediate execution followed.
election galvanized him and he sat on the bedside Constantly the sinister figure of death seemed to
trembling with a powerless fury. Two days had stand at the shoulder of the king. Instant execution
S gone by; this was the morning of the third; what- was his prompt solution of every problem. His pow-
ever might be done must be done instantly. There er was the fear of his subjects; and his symbol of
was no time to lose. might was the leaden bullet of the firing squad, or
He dressed slowly, pondering meanwhile. To con- the assassin's knife.
Sceive a plan was impossible. Out of his present situ- The papers through which Bush had been wan-
ation,there seemed to be no loophole by which he during, his attention half occupied by his interest in
might effect his own escape, much less the rescue the conversation of Christophe, were of a miscellan-
.of.; rginie from the power of Pierre Nicholas. eous character: reports from various officers in charge
T here was a knock on the door, and an orderly of villages and districts, statements of taxes received
intbiitered. and military disbursements, confidential communica-
S "Monsieur Bush?" He saluted as he spoke. tions containing reports of secret agents and occasion-
"Yes?" ally a plea for the mercy of the king from some high
"The king requests your immediate presence." officer caught in the web of the espionage system,
They followed a short corridor and passed into which, next to the actual military forces, seemed to
the circular room In which Bush had last seen the be the king's most potent arm of strength.
S king on the evening before. The interior was as yet "Does your Majesty desire to read any of these
Unfinished, for the white plaster walls were devoid of papers?" Bush inquired.
paneling or ornament. The ceiling, was circular, The eyes of Christophe rested heavily on him,
rose to a dome that gave an exaggerated effect of but Bush met the stare with a look of bland inno-
S height. On the highly polished floor a dozen gilt cence. The king waved aside the proffered papers
chairs were clustered in disorder around a large table Bush had selected.
of yellow mahogany on which were piled maps, books "Later, my young friend, you may read to me
and a great clutter of papers of every description. A whatever I should hear." He had relapsed into the
fire was burning in the hearth although warm air native dialect which he invariably used when he talk-
was already flooding In from the courtyard through ed familiarly, and the mongrel French words and
the open door. pronunciation seemed to confirm his Ignorance.
Against the fireplace with his back to the hearth "Write," he commanded, "to Captain Le Brun at
atOM Chrlstophe. His legs were spread lightly and
todChristophe. His legs were tspreah d lightly and Le Cap and say that he shall report at once to the
his hands were caught together behind his back. He citadel, and I shall put at the bottom my name, the
was quietly dressed in black knee-breeches and black c itael a I shall pt at h vy chet swelled per
name of Christopfe." The heavy chest swelled per
silk stockings which seemed to emphasize the power-
ceptibly beneath the white ruffles.
ful muscular development of his legs and his large also," h continued "write to Captain Pierre
flat feet were encased in low leather slippers with a
Nicholas."
silver buckles. He wore a loose shirt of fine linen and pen
the open throat disclosed the thick, corded neck and The quill suspended in Bush" hand did not
powerful chest tremble nor was there a perceptible flutter in the blue
poAll hese th h n d in a s eyes. Calmly he waited but underneath the crimson
g All these things 3ush notice coat his heart was pounding with suppressed excite-
ht. and hbeld attention. Negroe n e its every charac- meant, for suddenly there had occurred to him a plan
tandherwastenthion.eginthvel rehea which the next few minutes might make possible, a
now defiant and now furtiveehead, and plan which would perhaps circumvent the designs of
Nicholas and give to Bush the opportunity to attempt
L sneuos mouth with its array of strong, another flight with Virginiae.
L wh itat made the face unforgettable. It was
the ta ty mercleas and cruel. "You will say," Christophe continued, "that he
i, n, thi uniform-of my favonriths, mon- will remain at Le Cap and by this order is advanced
di ieur." 'r hBaft-hbut tiewtmsa d: ent to the command of Fort Picolet. Also write to Gen-
SIn the toneL' to.' ES rJ le9::='" ":Melfatl Fourneir, who now commands the fort. Let him
Bush bow*el. al :'i-:' i'' I;'~jtijij y ea come to me at once. Bah! That man, there! He Is
SMajesty." :.. ...i;- : g. I will teach him how to follow the commands
Steadily Christophe regarded him Without ia f "'.hf.ttophe."'
ing. From the courtyard came ie sound of f86t 'and hin:.M bold flowing hand Bush wrote the three
the sharp order of command. The troops were at orders.. Ttenhe sanded the drying ink and carefully
drill. Another order, and musket butts clanked read what: he had written. The penmanship was ex-
against the pavement.
"You can write well, eh?" Christophe spoke at
last. "You are som-thing of a scholar, perhaps?"
"I can write, yes. English and French. Of Span- ESTABLISHED.
ish, a little.'
"Yes? That is good. Paul Dulac, it is he who
doe.the e things for me; he is sick. Until he returns
.,:f1.:*ii1 ..write for me." G


B :-&'Blush recalled the gossip he had so often
tihit .s illiteracy of the king. Formerly a
IJi'aoft the cafes of Le Cap, he had risen
durinh':k e retig .o his predecessor to the rank of
general by the.slieer virtue of his power of leader-
ship, and on Dessalines' death had by that same dom-
ination brought about his own election to the presi-
dency, an office which he had soon afterward changed
to that of king. In his rapid rise there had been no
time for educational advancement. It was said that
the waiter-king could neither read nor write. The
i future would soon tell.
An hour passed. Bush had breakfasted and re-
turned to the circular office of the king. Before the
:fire, which had burned down to a little heap of white
*and faintly smoking ashes. Christophe stood in Napo-
ii-donic pose. one hand concealed beneath the soft white
riffles of the shirt front. From time to time an
orderly entered and with a click of his heels and a
s: rt salute announced the name of some one who
:see the king.
o. presented themselves were necessarily
at the citadel. Their reports were
affairs whenever the king was pre-
:t.contact by which Christophe inti-
iig operations of his armed forces
ad6bAt whtiIR entire kingdom was operated. A
'i::rainstorm iittight before had caused a leak
h i the magazine alf. a barrel of powder had been
Dampened. Christophe personally was informed of
-the oecurrence and of th fact that the powder was
JJ "*-*S"! --"****- ***** .. -^,


KINGSTON.


cellent and the flowery phrases of the orders seemed
in keeping with the distended chest and Napoleonic
bearing of the king. A second time Bush read.the
third letter; then he pushed back his chair and with
a grave bow presented the three sheets of paper to
Christophe.
The king waved them aside. "Read to me what
you have."
Slowly Bush read the letter he had composed to




THE


LONDON STORE

21 King Street, Kingston, Ja.





=-FOR-


Millinery, Hosiery,


Fancy Goods, Silks,


Men's Furnishings,


Tourists' Requisites.




MEN'S SUITS MADE TO
ORDER
AT SHORTEST NOTICE.




Satisfaction Guaranteed.





P. C. LAING,
Proprietor.




I


-i


79.


BRANDAY,

JAMAICA.


SHIPPING and COMMISSION AGENTS.

EXTENSIVE WHARF ACCOMMODATION & BONDING STORES


EXPORTERS OF

Coffee, Cocoa, Pimento, Ginger,

Sarsaparilla, Honey, Orange Oil,

Dyewoods, Hardwoods, Hides

and Goatskins.


AGcNTS:
CANADIAN PACIFIC RAILWAY CO.
A. M. SMITH CO., LTD., Fishstuffs
A. E. HICKMAN CO, LTD., Fishstuffs
SMITH & PROCTOR CO., LTD., Butter
and Cheese.


- HALIFAX.
- NEWFOUNDLANND.
- HALIFAX.


1925-26


KINGSTON.






PLANTERS'


PUNCH


-Captain Le Brun; then the one to Captain Nicholas,
and last, the order to General Fournier to report in
person to the citadel. He read distinctly and with
exaggerated emphasis the rounded phrases, but there
was a slight difference between what was written and
the words his lips uttered, for the letter dictated to
Nicholas to take command of Fort Picolet was ad-
dressed to Captain Le Brun, and that letter which
should have summoned Le Brun to the citadel was in-
dited to Captain Pierre Nicholas.
*Y OUR signature, your Majesty." It was the eTu-
1 cial minute. Carefully Bush spread out the let-
ters on the table and dipped the quill in the ink. Then
be pulled out the chair that Christophe might seat
himself.
From a distance the king studied the three
squares of paper as though undetermined whether or
not he would obey the suggestion of the young Ameri-
can. Then with dramatic dignity he paced across
the floor and sitting heavily in the chair, took the
quill from Bush's hand.
One by one he appeared to read the letters before
him. Behind the chair Bush, fascinated, watched
the powerful black hand that clutched the long white
feather.
"*Bon! My young friend, that is good."
Awkwardly as a child's the short fingers traced
a large "C" at the foot of the letter to Le Brun. For
a second the fingers paused suspended above the pap-
er. Then in irregular letters he traced the word 'Rex'
behind the "C." Once again he inscribed the grotes-
que signature. Then he dipped the quill in the ink.
Only the letter to Nicholas remained.
"'My friend, the king writes!" he commented with
dignity.
Again, and for .the third time he traced the let-
ters. It was signed. With affected leisure Bush fold-
ed the sheets and thrust them in his breast.
"They shall be sent by courier, at once, your
Majesty."
The king had.once more taken his position be-
fore the fire. He nodded assent. With his cheeks
pushed with the success of his coup, Bush bowed and
went through the door-to the courtyard.
The first act of John Bush, after leaving the
apartment of Christophe, was to search out the offi-
cer in charge of the King's couriers and start on their
way the three letters bearing the royal signature.
Then, with a natural curiosity to which his position
granted ready gratification he began an apparently
casual, but, as a matter of fact, intensive examina-
tion of the citadel.
It was noon when he sat down with a dozen of
the officers of the king's bodyguard for the midday
real. In the first few hours he had completed as far
as possible his first survey of the fortress. In size
and in the completeness of its equipment it far exceed-
ed even his most highly coloured expectations. In
the endless galleries and barracks five thousand men
could easily be housed. The magazine contained
casks of powder apparently sufficient to serve the
guns of the fort Indefinitely. In the vaulted rooms
of the armory were innumerable stands of muskets,
bayonets without number, and cases piJed high to the
toof containing flints and spare locks and gun bar-
rels. A system of stone cisterns fed by springs sup-
plied water in quantity and of the greatest purity,
and in the commissary were stored provisions to


serve the garrison for a year at the most conservative
(alculation.
As yet the citadel was incomplete. In the long
galleries which rose in four stories one above another
on three sides, only a few of the great guns were in
place. Slowly these were being hauled from Le Cap,
huge smooth-bore pieces of bronze; guns bought by
Christophe from the French; guns which now from
their stanch carriages were to point their black muzz-
les down at the green valleys from which at any
moment the king might expect to see the armies of
Petion fling themselves against his final refuge. A-
longside the guns that were in place were piled pyra-
mids of round shot and beneath the wooden hatches
in the floor close to the trail of each gun the powder
hoists dropped down to subterranean passages where
the buckets could be loaded directly from the maga-
zines.
It was late afternoon when Bush had completed
his investigation of the interior of the fortress and
found himself in a tower that rose, the apex of the
structure, high above the southern battlements. As
he reached the top and first gazed about him the
magnificence of the scene broke upon him with a
force that almost dazed him.
On every side. from the ramparts of the citadel
the world seemed to drop abruptly into a void. Like
a tremendous tower crowned by the fortress, Le Bon-
net Eveque rose almost perpendicularly three thous-
and teet from the surrounding valley. To the south
and west, across the dark valley far below, the moun-
tains of Santo Domingo blue-green in the slanting
light tumbled like an angry sea of torn earth, forest-
clad. wild and desolate. Clouds drifted among their
summits; far as the eye could see they extended, a
tremendous relief map upon which John Bush gazed
down from his manmade aerie.
Slowly he. walked down the successive stairways
to the broad parapet on a mighty buttress that was
.luilt out from the body of the fortress overhanging
the cliff upon which its foundation rested. For three
hundred feet the wall of masonry rose perpendicular
and below its base the cliff, a face of torn rock, drop-
ped four hundred feet more to the tops of the die-
tnnt palm trees that crowded up against its base.

CHAPTER XI

IZZY from the consciousness of altitude he drew.
back and crouched on his heels. Here on this
giddy height a year before, Christophe had displayed
the subordination of his troops to three horrifed o0.
cers of the French army. Bush could see then in
his imagination crowding back with blanched fates
behind the black king who with bared gums ad flit-,
like eyes gave the harsh order of execution. To'the
beating of drums, in ranks of five, fifty of the kltg'8.
troops in full equipment marched down the pafa pt!
"Squads left." The foremost rank wheeled.
Tramp, tramp, pounded their shod feet. A Fresh.
officer gave a little startled cry. With left feet-lifted
the front rank had dipsggeared over the brink.. The
second followed. The third too was gone.- Four,.
five, six-ten; the parapet was bare!
"Voila mes amis!" There was the smile of .
beast on Christophe's lips. "My troops obey, eh?".:.
He made no mention of the worse than death whlch
would have followed their disobedience!


THE CAYMANAS ESTATES LIMITED.

MANUFACTURERS OF THE FAMOUS BRANDS OF

JAMAICA SUGAR AND RUM.


--S U Gr A R7


C
JE
WV

E
, C
R


White Crystals



Brown Crystals


C
J E


Yellow Crystals


0
J E Brown
2


MuAuscovado


RUM,1


FOR PRICES APPLY TO

R. A. MORRIS
156 Harbour Street., Kingston, Ja., B.W.I.


There was no limitation to sight. Miles away in
the plain John Bush could see the thread of the road
appearing and then disappearing among the trees.
By now the courier should be clattering into Le Cap.
The orders he carried were imperative. No one dared
delay on the command of Christophe As soon as
horses could be saddled Pierre Nicholas would set out
for the citadel. By dawn of to-morrow he should re-
port to the king.
What then? Bush in his imagination construct-
ed the probable sequence of events. It must be he,
Bush, who would first meet Nicholas. After that?
He shrugged his crimson-clad shoulders.
A soldier was approaching him along the para-
pet. Ten feet away he stopped and saluted. Bush
rose and returned the salute.
"Monsieur, a man is held at the guard-house
who wishes to speak with you."
"Lead the way."
Who could the man be? Who was there in all
the world who could desire speech with him? The
guardhouse struck an ominous note. It must be
some one from the outer world. A messenger, per-
haps. Instantly he thought of Virginie. Could It be
from her that this stranger had come? The pos-
sibility quickened his steps.
(Continued on Page 6e7)












Leyland & Harrison



Lines



Operating a Joint Service

Sailins

;: AA h"


'+ .."',::ii: ;:,. ':.: : '' ." .-

.............. FROM


ih:pcool & Glasgow


TO


Kingston, New Orleans


and


Mexican Ports







CARGO ACCEPTED FOR

New Orleans, Mexico & Liverpool




For Rate and Other Partculars,
Please Apply to

ARNOLD L. MALAB l ,




I: .-
agents Llanhe I .I
01.s Apply to
ARNOL L. MA l
Ag0IllS LO i ~


1925-26






PLANTERS'


PUNCH


A JAMAICA SPIRITED FIRM

+ FURTHER WEMBLEY DOINGS OF THE HOUSE OF MYERS

",W ORLD-WIDE"-thc activities of the House of
Myers are limited only by the extent to which
this phrase applies. And in order to bring their busi-
ness in line with the most up-to-the minute methods
available, Messrs. Fred L. Myers and Son this year
spared no effort to make their exhibit at Wembley
second to none.
We are giving a short outline of MeIssrs Myers'
exhibits, as we think that the best %ay of describing
a modern progressive organisation is by observing ou
their latest creative ideas for their development.
The House of Myers' Stand in the 1925 British
Empire Exhibition refletted very cl',Jrly the up-to-
date and goahead nature of the "Hom, Sweet Hom-'I
of Sugar and Rum. the famous firm of "Buyers and
Suppliers "
There are two main features in the exhibit: a
magnilcent set of mahogany panels representing the
Rum, Sugar and Produce trade of Jamaica and a
striking set of rotary model scenes dealing with Ja-
maica Rum and the House of Myers.
The largest of the panels-about ten feet long
and six feet high-shows the island of Jamaica on a
vivid background of blue; the map of the island heing
formed of various grades of sugar-a different grade
for each parish-let into the background to half an
inch, and the name of the firm inlaid in letters of
Muscovado Sugar across the map. The position of
Kingston-and of course "The Sugar Wharf"-is in-
dicated by a small red electric light which can be
turned on by the visitor.
For the description of the Island and perhaps the
most striking panel-a photograph of which we give
on this page-we quote from "'The Wine and Spirit
.'rade Record." one of the most influential trade
papers, in its issue of 13th June, 1925:


"In the West Indies Pavilion Messrs. F. L.
years and Son have dene much to make their
tand attractive. Not the least interesting is the
Li -llustrating the production of Jamaica Rum,
y i.e., from sugar to juice; the clarified juice; the
'mi syrup; the masseruite: after-products of sugar:
molasses; residue of the stills under; the un-
coloured Rum: and, finally, the coloured Jamaica
Rum as most of us know it."
The third panel gives specimens of the different
articles of Jamaica produce arranged in twenty dif-
ferent compartments.




.. .. .. .'' : '
4- "


S.. ,A.BUST DAY AT MYEBS' SUGAR WHABF, HARBOUB STREET, RKNGSTON
~ ~ ~ ~ ~ ~~~~m .., ., ..., ....,.-.T,.


...1:

ONE OF THE MYERS' PANEL? .AT THE WEMBLEY EXHIBITION
The Rotary Model Scenes were built by a famous
"-' "- 7 modelling firm in England.


As you can see in the picture the different kinds
of Rum are shown in specially constructed glass tubes
ard the different products were obtained from Sugar
Estates in the island, and careful shipped to Eng-
land. The pieces of sugar cne in the panel repre-
senting hoops-are REAL cane with the ends sealed
up to prevent drying and the outside well varnished.
We are sure you will agree that this is a most at-
tractive, ingenious and novel display and it appears
t.) have attracted much attention.
There are four scenes, separate from each other,
and which revolve in a stage inside a glass case. The
tableaux represent first two jolly old smugglers
drinking rum on a shady beach of the Spanish Main,
then a model of Myers' Wharf in Jamaica, then a
Sugar Factory in full swing, and last the ingredients
necessary for Rum Punch.
The ingenious mind of Mr. A. R. Cawood, the
firm's representative, who worked out most of the
arrangements for the stand, also conceived that some
further local colour could be obtained if some chairs
and tables were made out of oak-casks and these have
added considerably to the attraction of the Court.
The Myers' exhibit of 1925 certainly shows the
producers as a firm who are willing to seize every
opportunity for bringing themselves up-to-date with
modern requirements, and by their continuous support
of the British Empire Exhibition, they have proved
that they have the interests of Jamaica and the ad-
vertising of all that Jamaica is, at heart.


1925-26







PLANTERS' PUNCH 1925-fl'


The Jamaica mobility

(Continued from Page 46)
to make which had better be made at once. With-
out waiting for any comment, he proceeded.
"My friends, and ladies and gentlemen," he be-
gan, "I have good reason to believe that my admin-
istration as President of the Up and Be Doing Con-
federation of the Oppressed is not considered satis-
factory by some of you." (Murmurs of dissent from
those who had not paid and would never pay sub-
scriptions; grim silence from those who had pe-
cuniary interests at stake.) "I am not aware where-
by I 'ave given cause an' effect to bring about this
feeling against me, but I am not complaining. I
know me own people; I 'ave worked too long for
them not to know them. I haven'tt much to say to-
night, except that I will continue to work just as
hard for you as I have hitherto and formerly done.
But I will no longer be your Permanent President.
I want to be a humble worker, a simple member,
paying me subscription and giving me life to the
cause. I am therefore resigning my position."
A storm of dissent broke from those in the audi-
ence who were on his side. The Opposition was
silent, confused. It had come to attack and was,
instead, in a way, being directly attacked. What it
had determined to accomplish, thereby securing the
distribution of the funds among those who contri-
buted them, was being proposed by the very man
whose downfall had been planned by them. Even
Mr. Proudleigh felt that he was taken unawares.
How could he applaud Mr. Douglass now? That
gentleman might hear him and might conclude that
Mr. Proudleigh did not want him to remain as Fer-
ment President. After that, the speedy advent of
the bloodthirsty gentlemen from Cuba and Hayti
would be certain.
Mr. Douglass continued resolutely.
"My friends. the Confederation Is not going to
die because I am no longer President. I tell you I
am going to continue a member and to work for it;
an' perhaps I can do more that way than t I re-
main as the head of It. What Is the use of me being
President if some of you don't think I should be?
We want unity, we want co-operation, and that is
what you won't 'ave if some people object to me."
He ignored the cries of those who assured him that
they were with him to a man. "Now," he went on,
"the first thing we 'ave to do is to see that all the
money you 'ave contributed is safe an' sound in the
bank, and whether all that has been spent has been
spent right. My friend the Potentate will oblige me
by coming up on the platform an' examining the
bankbook and receipts with me, and I couple with
him Mr. Green, Mr. Sharksey and Mr. Samuel Jones.
Gentlemen, will you please step up this way?"
Those named stepped up in silence. They ex-
amined the little Savings Bank Book. They looked
at the few receipts. Everything was in order. As
Exalted Treasurer Mr. Brimstone announced this
fact to the audience. Even some of those who had
come prepared to overthrow Mr. Douglass now began
to feel that he was a badly treated man. Their
easily excited emotions were being aroused on his
behalf.
The examiners went back to their seats.
"The rules of our Confederation," proclaimed
Mr. Douglass, "says that the retiring President must
'old office until his successor is appointed, and notice
of the nomination of a new President must be given
at least one week in advance. I 'ave therefore, how-
ever reluctantly to continue in office for another
week; but I beg to announce that I nominate Poten-
tate Brimstone for the post of Permanent President
and Minister Plenipotentiary, than which no one
is better fitted to fill it. He is now Exalted Treasurer,
an therefore he ought to be the next President.
At any rate, friends, an' ladies and gentlemen, I am
going to claim me right to put him forward, an' you
can elect or reject him as you please."
This was another bolt from the blue. His lead-
ing rival and opponent was being advanced, boosted,
supported, by Mr. Douglass. Jones was heard by
Mr. Proudleigh to mutter: "That man have brains,
me son!" and it seemed to Mr. Proudleigh that all
the audience was rapidly veering round to Mr. Doug-
lass's side.
"You can nominate anybody you like, you know,"
continued Mr. Douglass. "and so can I. We are all
equal here. So I think Sir Mortimer Slimslam
should be Exalted Treasurer in the Potentate's
place. I don't nominate Sir Mortimer because he is
a friend of mine, one of the people that trust me
an' have confidence in me, an' ask me to be a friend
of his family in times of tribulation. but because
he has suffered oppression like the Potentate, and
has wrongs to grieve over. I think we should show
him appreciation an' sympathy, but I leave the de-
cision to you. ladies and gentlemen."
Another thunderbolt, Mr. Douglass was boldly
claiming Mortimer as a close friend and confidant
of his, was enlisting Mortimer on his side, was fight-
ing as it were, the battles of an absent brother,
though no one had thought of attacking that absent
brother. But here it was that Mrs. Brimstone
thought she was called upon to interfere.


"Why Mr. Slimslam should be Treasurer?" she "Any more nominations?" he asked.
demanded. "Why not somebody else? What is the There were none. And now it dawned upon:
attraction?" some in the audience that at next week's meetinuge
A few persons laughed outright at this question, Mr. Douglass was sure to be re-elected, sinut.]Ur,,,
but Mr. Douglass was quick with his answer. Brimstone and the other man-a mere noneittt y:.
"If you don't want me friend, Sir Mortimer, Lady would have no chance. In the meantime noeeffort-
Brimstone, who lo you nominate? You can nominate could be made to smash the Confederation; MX.
anyone you like. Speak out!" Douglass could not forthwith be compelled to sur-
"I nominate Mr. Jones," cried Mrs. Brimstone render the bankbook to a committee of persons in-
boldly. terested in seeing that the funds were distributed.
"Not me," said Samuel Josiah. "Horse don't Mr. Douglass was still master of the situation; be
'ave business in cow's fight." would urge next meeting that Mr. Brimstone should
"I nominate"-she hesitated-"I nominate Mr. succeed him, knowing that Brimstone could not se-
Green." cure a majority; he had probably made a friend of
"Who seconds?" asked Mr. Douglass. Mortimer by his remarks on that gentleman during
But now a hubbub arose, a discussion among his absence in the country on his legitimate if un-
the several members. Why should the Presidency knightly business of waiting at table. Mr. Douglass's
go to Mrs. Brimstone's husband, and the Treasurer- star was still in the ascendant. His brain had secured
ship to someone nominated by her? Who were the this victory.
chief movers against Mr. Douglass, anyhow? The "Well, it is alright so far," said Matilda to
Brimstones. What was the real reason? Clearly him, as they drove away in a cab.
the reason, now discovered, was to get the Presi- "Yes, but as I told you this evening, it only be-
dency and Treasurership in the hands of the Brim- gins now," said Mr. Douglass. "Mrs. Brimstone don't
stone circle, who would then be able to do with the done with us yet. But I don't done with her either,
funds what they liked. The mere thought of anyone as she and the whole of them will find out soon."
else being able to play with the Confederation's Matilda laughed. "You are a dam' clever man,"
money was maddening to every member of that she said admiringly.
organisation, and not least of all to those who had "It is all for you an' because I love you," gal-
contributed nothing. Suspicion was always rife* lantly replied the Douglass.
amongst them; it now reached fever heat. This was
a conspiracy against Mr. Douglass, who seemed to CHAPTER TEN
have displayed remarkable rectitude in his financial
dealings with the Confederation. Few had really MR. PROUDLEIGH HAS A PLAN
believed that some of the funds had not mysteriously
disappeared. Many now thought that all of them HE next day was Saturday. To many in the
might disappear if the Brimstones had their way. city it represented a strenuous time devoted
Man after man began nominating someone, else for to preparations for Sunday's leisure ant
the post of EXalted. Treasurer. And the names of sumptuous meals; to others it signified a half
all of these MieRDouglass duly wrote down, holiday, for the public offices would close at one
And now Mr. "roulegh saw his opportunity. He o'clock, and some of the business houses also. But
realized that the fletian was going 1. avour of to a few comfortable souls Saturday was a day of
Mr. Douglass,..thatbieiB IS p s Saa ::. steadily rest. and idleness, for they had nothing to do. Like
losing -ground, th'lt',thO 'ti*t-4isl oh.i the lilies of the field, they toiled not, neither did
t'ered by-the astute nsjit2dI r:. wh:as1"" "i. : W they spin, and if some of them were clothed in dingy
slowly rose to his feet. .V:suiut ou l .... iiT,'. garments, unlike those in which Solomon was arrayed,
to forgive him or not latu :.e sn,i~ eh M sl 4 il Fp t: thAt dltot in any way detract from their enjoyment
he had to save himself froi twit .irir s sil a. p-, -OLafa t lived at other people's expense.
livered by Haytians and Cubans. H lituat alL ..l i'a'~aggt- these favouied few was Mr. Proud-
forthwith under the victorious banner. "Pr'tiZea l reL,;. ap old man, he might be considered en-
an' ladies and gen'lemen," he cried, following Mr:.: tlt:i t i andthe remainder of his days free from
Douglass's form of address. "What I want. to a~y~i; 'wcAihd~~-i care, his daughter seeing to it that
is dis. Why should we meek a noble man like Mi.. h'ieshould- not know. want. Saturday was therefore
tor Douglass resign tram amongst us? I nominate to him what Sunday was to others, and every other
'im as President, for nobody fit for it like him." day of the seiula .week was-tol him. like Saturday.
For the first time in many years Mr. Proud- But on this particular n atrfl'f Pagleigh was
leigh had the gratification of hearing a speech of his not happy. It 'a the iwt .M e
greeted with ringing applause. He wanted to rise fore. He had -P.eL ita&etlmi e8'Ws: t
and make another, but already a reaction began to federations. momintous S.eet i S !:
influence him, and he grew afraid of what Mrs. Brim- the heady wins m of mapular saulu8f..i...
stone might say after the meeting. His words, more- bener pure ittedlto oeeupy t~le cetare ott g t stte i :
over, had had an effect which he could not foresee.. for.iat tjihe Ierodoif a minute. YT 1 t. was not
A few of the oppositionists Immediately began to: lUay;-. Ast: 'walked: home on the'l-Srvious night-i
wonder whether the readiness of Mr. Douglass to he : hado grow leass and less contetia W i'th the pros-.
resign, and his support by Mr. Proudleigh. were: pects of the future. On. Saturday he viewed those
not merely parts of a trick to keep Mr. Douglass in prospects with sober and apprehensive eyes.
an all-powerful position. The tide In the latter's He may have pleaded Mr. Douglass. That was
favour began to ebb somewhat. One man rose and quite possible. But he must also have mightily of-
suggested some other member as President. Mr. fended the Brimstones, and the Brimstones were or
Douglass carefully wrote the name down. had been his friends. He may have placated Mr.
N


For Boots and Shoes '


WHOLEESALEI & DETAIL


ALSO

FOR

DRY AND

FANCY

GOODS

AND -

ALL LINES

OF

STAPLES.

..'1

1


R. HA


.NNA & SONS
.


Retail Branches: 31, 33 &79J.King Street.


Wholesale Dept: 46 Port eyal Street.

Country Brancles: Pert Mui & Montego Bay.

'BEST QA4 ..'P

BEST QUA 4;.,LOWEST PRICES.
.* ,1.. .'
S "S._. ,, .. .


R.. HAA .
II


a.s: .&


,Fi~CIC '


PLANTERS'


1926--21r


PUNCH








Kingston Industrial Works,
Marine and Estate Engineers
Iron and Brass Founders
KINGSTON.


Cutting, Brazing & Welding by Oxy Acetylene & Electric Processes.
MACHINISTS: FITTERS: COPPERSMITHS & BLACKSMITHS
SHEET METAL WORKERS

LARGE AND WELL ASSORTED STOCK OF ENGINEERING HARDWARE
AGENTS FOR
Standard of the World /.


Semi-Liquid Asbestos Rooftin

ELECTRIC"
ALL-STEEL
WAGGON WHEELS
4.-



NO UPKEEP '
COST LESS
OUTLAST WOODEN WHEELS SEVERAL TIMES OVER.

G FAIRBANKS--MORSE PRODUCTS
Gas and Oil Engines: Feed Grinders: Pumps for all purposes: Lighting Plants.
LOCOLINE LUBRICANTS--Prepared by BALDWIN LOCOMOTIVE WORKS.

ARMCO RUSTLESS IRON FLUMING

S: HENRIQUES BROS:
Engineers & Contractors Architects & Builders.
*'* '


PLANTERS' PUNCH


1925-26






PLANTERS'


1925-26


PUNCH


fly -BR~~I1BfU


It

I<(S i i ;f1Jbl l-1 lJ ;..-1 1

HONEY GlIRL


SUPPORT


LOCAL INDUSTRY


Insist on Getting


JAMAICA MADE


BISCUITS


CREAM


V 9' *'-*

V V
Mg4J


3 p*.? MAICA

|[ ARROWROOT


ARROWROOT
nARRWROUT


ln lllllIliua-l


CEL-ER-AY





*
..-r,~;lr









1925-26 PLANTERS' PUNCH


SDouglass. But Mr. Proudleigh had lived sufficiently
o-..ng In this world, and had had enough experience
!..f men and their habits, to realise that good deeds
Share too often take as deserved and then ignored,
while injuries real or imagined) are remembered
with peculiar vividness. Gratitude is. temporary, re-
sentment long-lived. And Mr. Douglass was selfish
and ungratef-l. Probably he had planned that some-
one else should insist on his re-election as President.
Therefore be would not be very thankful to Mr.
Proudleigh. On the other hand he might still re-
member that Mr. Proudleigh had said unkindly things
about him and Matilda, and though he might not
nbw proceed to the infliction of injury on AMr. Proud-
lelgh's person, he would scarcelyy regard that gen-
tleman as.hi benefactor.
So Mr. rot4diigSh riefully concluded that he had
lost two valuiblI tet'nMs, or patrons, and had gained
nothing in turn.
S To the other side of the account he put his prob-
able escape from murdering Haytians and Cubans,
a cl8 or persons he detested, chiefly because he
kaie next to nothing about them.
":. here was therefore some gain, but the loss
atgod out colossal and formidable; and actual loss
always seems greater to the mind than misfortune
averted. One is subconsciously inclined to believe
:. that, after all, there had not been so much misfor-
...tune to dread.
Behold Mr. Proudleigh, then, on Saturday, a day
'when he should have been complacently looking for-
ward to the Sunday feast with speculative anticipa-
tinae--behold him on this day filled with sorrows
i'and regrets, bembaning a fate that was almost un-
Sbiarable.
S l- In these circumstances, it was natural, inevit-
t:le,~that Mr. Proudleigh should "teck a thought" to
.'ae e if some means of re-establishing cordial relations
with the Brimstones could not be discovered. He
was not remarkable for thinking out anything clear-
..l yet be was possessed of a kind of cunning that
Shad often stood him in good stead. For instance,
Swke he was only fifty he had induced many people
't obieieve him to be quite sixty; he had used his
pi.: ilmiatism and his grey hair as proof of his claim
d i1d age, and that had won him physical support
f ream, the younger members of his family. He had,
some2 years before the establishment of the Confed-
-t *rptAbn of the Oppressed, succeeded in traansplant-
Klimself from Jamaica to Panama, where his
ter Susan then lived, on the perfectly founda-
N assumption that Susan wanted him there
S even indirectly invited him over. Again and
'e ha d t gine; is petty objects,. his little
,hi.exeroise-of an ingenuity which he re-
-v aulett' to:genlus. And now, once more,
.r.:'tphq yt' to find a way out of his
*' ''a bto ble gained was good.
r. mia'tn : geaeraoua.writh drinks,
TV'lt~~~~~~ni^^ag ffilf til1 l i i iiny.

today-Lard me God! Dawg wouldn't pick up me
bone!"
This speech of Mr. Proudleigh's, the low tones in
which it was spoken, the evident fear of the old man
lest his visit should be reported to-the omnipotent
Douglass, excited the,.aurlojity of Mrs. Brimstone.
Perhaps he had heard some fresh. scandal about
Douglass and Matilda, and who would not delight
to hear that? He was better than any newspaper for
gossip: the newspapers- indeed never retailed gossip
and scandal, which showed that thoy did not appre-
ciate the public's taste.
"You can come in, if y'u want to," she said, but
with no cordiality; "but I mu' tell y'u I have no fur-
der confidence in you.".
"Doan't say dat, Mrs. B.," Mr. Proudleigh pro-
tested, after he had taken himself indoors and seated
himself in a comfortable rocking chair. "Y'u don't
know yet what kine of manl am. I know y'u thinking'
'bout how I get up las' night an' say Mister Douglass
should be President, but.y'r don't know why I do
it."
"I really don't," remarked Mrs. Brimstone
grimly.
"I gwine to .tell.g. y," .proclaimed Mr. Proud-
leigh. "I are not a ipol, Mrs..B.,.an' I saw las' night
dat Douglass gome to de.meeting..,to 'ave him own
way, an' if I didn't get op an' say, 'you must be Pre-
sident again,' somebaSly.else would ha' done it. Dat
is why I do it."
"But you didn't 'ate no call to do it." objected
Mr. Brimstone. "You..could 'ave let Douglass frien's
do what them like.. Why you interfere?"
'Because everybody:know I am your frien', an'
when them an' Douglas hear me talk like dat, them
will think there is no Qa~Bfplrattiddbetween us against
Mister Douglass, an' w rdoan't want them to know
dere is any."
"You don't want Iti to know, y'u meah," said
Mr. Brimstone,,.''thit-*re don't mind what anyone
choose to say. Beatdea, I never hear of any conspira-
t ion between you an' we 'gahint Douglass."
"Dere is gain' to -be one now," unctuously an-
nounced Mr. Praudin I, lowering his voice and as-
suming an air of iayditeou cunning.
"Y'' mean something 'bout Matty?" queried
Mrs. Brimstone, eager for entertaining information.
"Better dean dat'ir' kxs. B. When I was at
di- meeting lWtnigbt* i %e dlat; don'tt matter what
y'u do, Douglas gwine to keep you' twenty poun's.
Derefore I say to meselt.suppose we meek him re-
main President, which el..t gwine. to do whatever
we try, an' suppose 'Preig Fek him think him is all
right, an' then, beTore -ue kiinw where he are, we
could go to de Governmielt ain" tell dem all about his
society, an' de Gtvernment will broke it up an' meek
Douglass give we all our money back!"
"Ah!" exclaimed Mr. Brimstone.
"But stop! Y'u ,kaqw you 'ave sense!" cried


g lecL .. Mrs. Brimstone.
,:. .. .... "Shhh! Doan't talk too loud," counselled Mr.
I. the a iudleigh. "We mus'n't meek Douglass 'ave a sus-
tas, if he had been mrt ght ire gplciton of what we gwine to do.. !ofttlyj softly, ketch
Woen' Mr. Proudleigh' slowly walking toWatrds that : monkey,' me frien'. De onlirway you g*ine get back
gion of the thoroughfare where dwelt t4e ex-High you' money Is de way'I tell ..n, ai' dat ie why I talk
spicuous, who had so recently abdicated his post- like I talk las' night.' Mbnday morning, y'u
in the yet non-existent African Republic. If Ehould teck a walk roun' to de Government an' tell
Douglass had kept his eyes on Mr. Proudleigh, dem how Douglass ~iiok a Chofederatlon to oppress
would have observed that gentleman pause before de Government an' bring people over from Cuba
gate of Mr. Brimstone's little house, hesitate, an' Hayti to cut out Jaiibta' people tongue. Meek
bash it open slowly and disappear inside. But, de Government know dat white people gwine to be
rof fact, if Mr. Douglass had been there kilt if Douglass succeed. Tell dem everything."
is he would not have seen it. For Mr.. "I wouldn't keep back a thing," agreed Mr. Brim-
old rather have perished from lack stone virtuously. "Y-; iit, M; *Proudleigh. This
Shave allowed Mr. Douglass to catch is the only way I ~ci..get~&ck me money. Douglass
oe of Mr. Douglass's enemy that know very well last"night what he was after, an'
.: him work it so that we couldn't take the bankbook
rEi" led Mr. Proudleigh on the from him."
Iaea two-roomed home and "An' even ii you did get get it," his wife re-
STBrimstone! I thoughted minded him, "you couldn't draw a gill.* for every
dai a i .I know Mister Brim- dam' cent is in his name."
stone' d.. afternoon, being as "We mus' go :a'. the Government," repeated
he: is.a mi ^ ''te work all day Sat- Brimstone firmly. "Monday,:as soon as I go down
-urday, I wonild i!e a little talk about to work, I goin' to apek'fr the afternoon, and if be-
n0b t'ing an' ansuot ,i d?", teen two an' five o'clock I don't fix up Douglass, mde
Mrs. BrimstolMe: A~'Wldoor and bulkily name is not Brimstone. Old Massa, 'ave a drink. We
*'Weyed Mr. Proudtlei i* ; critical and hoe- bin doing' yon a .hinjuttji. We say to ourself that
f eyes. She looked ..WiIsfe looked him you was a worthless ole.traitor, but we didn't know
.V and, but that he was a .'nahiardnarrow per- what was in you"a nd"
she certainly would 'hs .1t.. : bl:B across. Mr. "Ah, me son,"'sighed Mr. Proudleigh, "many a
simtone, remaining inside, eit tt *answer-to time I sit down to 'elp me frien's while them cussing
PII roudlelgh's greeting, Hes. 2lita wife to me, but I know dat God read me-l.eart an' see dat
tnake the extinguishing"b o oldM ai'Bdleigh. it is pure. An' so long-ss de Lard Is on me side, I
"Well, you ave a face!" e .xcl t.' Jtly in- don't care who is against' me. Tenck you, me frien',
t lady. "You ave a face to 'db lt'rne I really need a drink after de hot- walk to come
d In'' :iot,- al.in s#i'h&MiSsins 'ere."


but an'
worse tha


old man like you, SP uBie The knowledge that they were in a deadly "con-
in anyone else I .evpiration" against Me. Douglass, a conspiration. that
Wat y'u come roumn'lk 'ricould not but succeed, was vastly delightful to. the
..t:ree conspirators. -This.was something that Doug-
d Mr. Prouleigh meekly, "diio't" ":s' could never have anticipated, and so, in the very
role yard. I are old enouhg:h hour of his most glorious triumph, he would be
san' y'u might really wait fte .struck down. Denoutfie as a dangerous character
jgore you go on like dat. I to tie Government, he would be watched by the police
E will say when I tell y' it not natually arrested; he would be compelled to
"thl$Cit I can't talk out here, hand the bankbook over to those who desired to have
i' f'::tybady ever tell Mister
I lli.Eusort wid you 'Three farthlngs.


FOR


Wholesale Dry Goods


N. G. KALPHAT,

149 Harbour Street. Kingston.








RIGHT GOODS

AT


RIGHT PRICES


To suit the Trade.




their donations and subscriptions restored to them,
and his power to inflict Injury on anyone, even on
Mr. Proudleigh, would disappear forever.
"An' the Lady Matilda will 'awe to get another
sweet'eart," laughed Mrs. Brimstone. "For Morty is
sure to find 'er out, an' Douglass will 'ave more than
he can do to look after himself."
"Old Masa," said Mr. Brimstone to Mr. Proud-
leigh, "you mua' go with me to see the Government.


*******************************e







W. N. MEEKS & CO.,

611 PORT ROYAL STREET,
KINGSTON
AND
SPANISH TOWN.








Commission Agents.


IM PORTERS:

Foodstuffs & Spirits.


EXPORTERS:

Island Produce.





*oooos oeflsomOmbg messesCegOese


1
-7j


1925--26


PLANTERS'


PUNCH


1;1


p.)*" *.






PLANTERS'


PUNCH


on Monday. Y'u can come round here an' we will
walk go together."
Mr. Proudleigh did not like this arrangement.
Like some of the great men of history, he preferred
to wield secret power, leaving it to others to ac-
quire the glory of success or bear the punishment
of failure. But Mr. Brimstone was insistent.
"We'll 'ave to see either de Attorney General or
somebody like that," he explained. "We can't see the
Governor. An' they not goin' to listen to one man
alone as quick as them will listen to two. You will
be my witness, an' I will be your witness, an' we
will substantiate one another."
"I would really like to substantiate y'u, Mister
Brimstone," said Mr. Proudleigh, caught by that
polysyllable and warmed by the generous drink of
rum-and-water he had just swallowed. "Substan-
tiality is what I like meself. But If Mr. Douglass
ever hear dat I go wid you-!"
"Who is to tell him?" asked Mrs. Brimstone.
"We don't want him to know a thing till the Gov-
ernment come right out an' put him where he ought
to be. You will 'ave to go with me husband Mr.
Proudleigh, an' if you keep a silent tongue in you'
'ead, not a soul will be the wiser."
It was extraordinary how many people were con-
tinually urging Mr. Proudleigh to keep a silent


I.


R. W. Taylor & Co.,



General Merchants.


DEALERS IN


Fancy Goods,

Haberdashery,

Hosiery,

Men's Outfitting

Articles,

Ladies' Hats and

Flowers,

Glassware,

Earthenware,

Enamelware,

Tinware,

Chinaware.


38 South Parade,


KINGSTON.


tongue in his head. That unruly member was al-
ways being referred to, and not in the nicest terms
at times. But on this occasion the advice was from
a friend, and Mr. Proudleigh knew that did he neg-
lect it he would probably suffer in all directions. So
he agreed to accompany Mr. Brimstone to the Gov-
ernment offices on the next Monday, and he pro-
mised that not one word of what was afoot should be
breathed to anyone not already in the "conspira-
tion." And he kept his word. Not even his daughter
Susan had a suspicion of what was in her father's
mind when he announced on Monday that he was tak-
ing a walk round to the Brimstones' house.

CHAPTER ELEVEN
A BOMBSHELL
MR. BRIMSTONE'S discreet enquiries on Mon-
day morning had confirmed him In his be-
lief that, in a matter concerning the main-
tenance of His Majesty's peace in the island
of Jamaica, the proper person to interview was His
Majesty's Attorney General. That high and mighty
functionary had his offices in the great block of pub-
lic buildings situated on the east side of Kingston's
principal thoroughfare, looking north. Mr. Brim-
stone was not sure that he would be accorded a hear-
ing; yet he sagely concluded that he could only know
If he tried. So on Monday afternoon, at about half
past two o'clock, he and his friend Mr. Proudleigh
arrived at the public buildings and entered its pre-
cincts at the lower or Tower Street end.
They climbed the stairs to the first floor and be-
gan to walk upwards along the lengthy corridor that
led to the Attorney General's rooms. Mr. Proud-
leigh had never been inside this edifice before;
hence he was impressed by the number of people he
saw moving about, noted with respect the numerous
uniformed policemen that stood outside the court
rooms-two courts being now in session-and gazed
with something like awe on the gowned and be-
wigged barristers of whom he caught a glimpse
through open doors as he and Mr. Brimstone pro-
ceeded on their way. He was a trifle nervous, but
the presence of a friend, and the knowledge that he
was bent upon the noble and disinterested mission of
helping the authorities to crush possible sedition,
sustained him wonderfully. In spite of his nervous-
ness he was conscious of a curious feeling of elation.
This is not always the happiest feeling to ex-
perience. It is so often the prelude to depression
and even disaster!
Thus, stepping along, more than half-way up the
corridor now, Mr. Proudleigh and Mr. Brimstone
found themsleves face to face with a man who stood
out suddenly from the rest of th; people congre-
gated there at that moment. And the man was
Nicodemus Douglass.
Had Mr. Proudleigh's heart been searched for
just then, it would have been found in the region of
his boots. The unexpected was always happening to
him, and here it was-wne- more, in the person of the
very man in all Jamaica whom he did not wish to
see. Even Mr. Brimstone did not feel easy In his
mind, though he had no reason to be afraid of Mr.
Douglass. No one cares to be caught, red-handed as
it were, in an effort not calculated to benefit, but de-
liberately designed to injure, the person who comes
unexpectedly upon the scene. Mr. Brimstone would
have passed on with a curt nod, and even with no
greeting at all, but Mlr. Douglass paused with a
friendly smile and enquiring glance, and Mr. Proud-
leigh's legs gave every indication of refusing to per-
form their normal functions. He experienced an al-
most overwhelming impulse to take a seat forthwith
on the corridor's cemented floor.
"'How is it?" asked Mr. Douglass cordially. "What
you two gentlemen doing here to-day? Come to hear
some cases in the court?"
Blessed question! Mr. Proudleigh, metaphori-
calley. sprang at it. seized it, clung to it, and made
the answer'his own.
"Jus" what I teek a thought to do, Mister Doug-
lass, I never come-into dis big courthouse yet, an'
as Mister Brimstone was coming' dis way I beg him
meek me walk wid him, so as I could come inside."
"But y'u passing the court room." Mr. Douglass
pointed uot. "I will take y'u inside if you like."
He looked enquiringly at both of them.
"I not goin' to hear any case," said Mr. Brim-
stone shortly. 'I come down 'ere to pay some taxes."
"But the tax office is in the building on the other
side of the street," explained Mr. Douglass; "you
come to the wrong place altogether. Well, if Mr.
Proudleigh want to go into the court-room he can
come withlme; I will put him in a seat."
Mr. Proudleigh was willing to be led away. Mr.
Proudleigh was anxious to sever all relations with
Mr. Brimstone just then; the influence of the domtin-
ant Douglass was simply overpowering. But Mr.
Brimstone had no intention of facing the Attorney
General with no one to corroborate his charges, and
he would not allow Mr. Douglass to dislocate his
plans. "The old man can keep me company while
I are at the tax office," he explained briefly, "an' I
can bring him back here if he still want to hear a
case. Good-bye."
This was dismissal, and Mr. Douglass, with a


cheerful "good-bye," went on his way. But Mi'r
Proudleigh, glancing fearfully backwards half ai
minute later, noticed that Mr. Douglass's head w
also turned over his shoulder, and knew that Mr
Douglass was watching their movements. He uttered
a prayer to Mr. Brimstone that they should straight-
way make for home, but Mr. Brimstone would not
hear of that. He consented to a compromise, how-
ever. He and Mr. Proudleigh left this block of
offices to step across the street to the other group of
Government buildings, and while on their way.
thither they saw Mr. Douglass walking downwards.'
at a fairly rapid gait. Douglass had seen them
leave for the tax office, they knew. And, clearly, he
was no longer interested in their movements.
They noticed that he turned into Tower Street,
going east. That was obviously in the direction of
his home. They lingered for a few minutes outside
the buildings in which the official tax gatherers col-
lected the dues of a reluctant people, but no Douglass
reappeared. Even Mr. Proudleigh was satisfied that
Mr. Douglass had finally departed, with, it would
seem, no suspicion of them whatever. He plucked
up heart and accompanied Mr. Brimstone back to
the building from which they had been compelled
to retreat a little yhile before. But Mr. Proudleigh
was not the man he had been but an hour ago. There
was that about his knees which might be described
as weakness.
The Attorney General's clerk was informed that
these two men wished to see the Attorney General.
He asked their business, but they assured him it was
for the Attorney General's ear alone. He decided
that they were not in the least likely to see the At-
torney General that day or any other day on an
errand that they could not or would not state, but
he took their names and went to inform his chief
that two very ordinary-looking visitors wished to
have an interview with him. Thus, judging merely
by appearances, we make strange mistakes at times,
for, after all. Mr. Brimstone was a Potentate.
"What's that?' said the Attorney General. "Two-
men to see me? Well, couldn't you have asked what
it is about, Jerome?"
"They wouldn't say, sir."
"Well, I cannot see them. These people seem
to think I have nothing else to do but see them. Tell .
them I am engaged. What did you say their names
were?"
"Brimstone and Proudleigh, sir."
"Oh! That's very strange, Jerome. I wonder'
what they have come here for. Tell them to come
in at once."
"The Attorney says you can come in," the cle
informed our two friends when. he went ba.k
them, and motioned them towards the Att e*
eral's room.
Seated in front of a desk coveted With
bound together with red tape or lying singly, wit
formidable-looking lawbooks on a table near to thlte-
desk and in a revolving bookcase, sat an elderly'
quiet man, with a calm enquiring countenance, whbo
fixed his eyes intently on Mr. Brimstone and Mr..
Proudleigh as they halted midway in the room. To:
his friends and acquaintances the Attorney General
was a pleasant man of easy, unaffected manners. To
the two men who had come to pour a tale of danger
to the state into his ears he seemed the awful em-

*eeeaeeseeeeeeeeseeseoeueeeeeeSSS@a .

"Clothes Maketh The Mon"

















0 FOR SMART FIT ;
nd.
: GOOD MATERIAL

SConsult
*






An .. n
GOOD MATERIALS

S. -



SF.." ST 4
: The Hamilton Suit C.any

*Merchant 'E ib *


I: 0 Tower Str.. t, fiiisn, Jo. B..I.


1925-26







PLANTERS'


PUNCH


[ bodlment of Justice, a sort of earthly Jupiter wielding
Sthe dread thunderbolts of the law.
And to complete this impression, the Attorney
SGeneral was wearing the wig and gown in which he
: :- would shortly appear before the court.
S He had not much time to spare and this inter-
view must be very brief.
"Your name is Brimstone, yours Proudleigh?"
be rather stated than asked, glancing from the
younger man to the older. "I suppose you have
Come here because you guessed that 1, or the In-
spector General, was going to send for you. You
have saved us that trouble, and it is just as well;
and now I must warn you that you are pursuing
: a very dangerous line of action, and that the Gov-
Sernment is well aware of all that you have been
doing, and of your intentions."
51 "No, sir!" cried Mr. Brimstone aghast at this
speech. "The Government don't know."
"Very likely the Government doesn't know every-
thing," replied the Attorney General coldly; "but
what it doesn't know now the police will very shortly
find out." His voice became stern. "I will have
detectives at every one of your future meetings,
Mr. Brimstone, and I propose to keep you under sur-
Sveillance. I shall also have this old man kept under
surveillance."
This, to Mr. Proudleigh's ears, sounded like a
sentence to some hideous form of torture. Police
surveillance could only be the first long step to jail.
'But how. why wherefore? And be had
"walked his own foot" into this deadly snare!
Brimstone, however, conscious that there was
0P-aome mistake, and knowing that he had broken no
law, stood his ground manfully. He was afraid, but
.,be was not demoralized. He must straighten out
Smatters. He must make this gentleman understand
the true position.
"Please, sir." he began nervously, "it is like
this, what we come to see you about. There is a
society-"
"Yes, the Confederation of the Oppressed, you
call it. Yes."
P "Yes, sir, and we think it is likely to become
dangerous."
"I am glad you think so. That is exactly my
opinion."
"Yes, sir, and that is why we come to tell you
about it. Its President is one Nicodemus Douglass,
and It was he who started it. And he is not going
z. p right. He wants to make trouble, an' we think
you should know about it before it get too far."
The Attorney General looked piercingly into Mr.


Brimstone's eyes. He began to question him in a
sharp, crisp tone, quite unlike his usual easy man-
ner.
"This Douglass is or was the President: which?"
"Well, sir, he Is still the President, but he re-
sign."
"And you are to be the next President?"
"He wants me to be, sir."
"That is because you wanted to be, isn't it? Did
you refuse the nomination on Friday night?"
"No, sir," admitted Mr. Brimstone.
(The Attorney General seemed to know every
thing! Had there been a detective at the meeting?)
"And you want the society to have political aims,
don't you? Douglass was opposed to that, and you
and your friends tried to overthrow him and he
agreed to go. I am telling you all this so that you
may see that the Government is not so much in the
dark as you have been imagining. People like you
two, who try to stir up trouble in this island, believe
that you can continue your dangerous work unde-
tected. Let me disabuse your mind of that idea!
Your coming hers to-day suggests that you are
frightened, and as you do not seem to have done any-
thing yet that renders you liable to prosecution, I
am speaking quite frankly to you, as a warning.
But the next time I hear that you want to strike
what you call the shackles of the Government off
the people of this country, I wilt have you both ar-
rested for sedition. It is good for you that you your-
selves have come here to make an open confession,
and now, if you are sensible, you will leave all this
sort of nonsense alone."
Before he had ended this long speech, Mr. Brim-
stone had grasped just what had happened, and Mr.
Proudleigh's terror-stricken mind began to see light
also. Now it stood revealed why they had met Mr.
Douglass in the corridor a little while before. Evi-
dently that gentleman, to be revenged upon them,
had taken to the Government's chief law officer much
the same tale that they themselves had intended to
tell, but had substituted their names for his own!
Such traitorous conduct they could not have imagined!
Such baseness had been beyond the reach of their
worst suspicions! It did not occur to them that
Douglass might also have considered them traitors
and base. Mr. Prondleigh"felt that he had to pro-
tect himself finally against possible assassins from
Cuba and Haytl, and Mr. Brimstone had his twenty
pounds to recover. They were, then, in a manner of
speaking', acting in mere self-defence. But Mr. Doug-
lass had added aiful treachery to premeditated vio-
lence and robbery. What a scoundrel!


Alas, they did not know that often before the
Attorney General had had men come secretly to him
to denounce their colleagues in the hope of protect-
ing themselves. There have always been traitors in
the camps of patriots. The Attorney General had
long since learnt hoW to deal with these. Some
stern talk, a severe and serious attitude, a terrible
warning, and then peace, perfect peace. There was
never reason after that for prosecutions for sedition,
but there was always possibility of police arrests for
assault and battery among those who once had been
determined to stand and die together for the eleva-
tion of the people.
The stern-looking gentleman made a gesture in-
dicating that the audience was over. He would
short*~ have to be in court. But Mr. Brimstone stood
bis ground.
"You 'ave it all wrong, if y'u please, sir," he
earnestly easervated. "If you would only let me tell
you the truth-"
"But, my good fellow." said the Attorney Gen-
eral impatiently, "you are not going to deny, are
you, that you were made a Potentate or something
of the sort by Garvey, and that you are connected
with him? You are not going to deny that you were
discharged from the Jamaica Railway because you
were making trouble there? And you gave money
to this Confederation of yours for-"
"Yes, sir, I gave them my money, an' it is my
money I want back again."
"You mean you are not allowed now to do what
you like with the funds, and that you wish to get
hold of them, is that it?"
"No, sir; it is only me money that I want back.
I don't ambition to be any President, an' I finish with
the Potentate. It only bring me loss an' bothera-
tion, but I don't see why Mr. Douglass should keep
me twenty pounds, an' then come here an' tell you
lies about me an' this pore ole man, who is as inno-
cent as new-born infant."
"Yes, Mr. Attorney General," pleaded Mr. Proud-
leigh, "I are as innocent as a babe."
The Attorney General rose. He had to go now.
But he had not been an examiner of witnesses for
nothing: he knew sincerity when he saw It; he re-
cognised the authentic accents of truth. There was.
evidently a dispute about money between the man
Douglass and these two, and Brimstone was trying
to get his donation back. There was nothing to be
feared from the Confederation; he would probably
never hear another word about it. So much the
better, but he could spare no more time to his visi-
tors.


* -:. i ':: .; i i



T E S N *.ME ROOF

A


BU.ICK


MOTOR CAR & SUPPLIES
(1923) LTD.


*

It-


101-16 HANOVER STREET.


1925-26


2;8...'* --
'*yI:"

`:;~ :*,: .


I


AGENTS


CHEVROLET











AGENTS MOTOR SALES
LTD.


.. '- .





P L A N T E R.S'.- -P U N C H


6 i


"You will have to go," he said, but not unkindly. talking' to them! He thanked me for coming to till night Matilda, never very proup|::
"If you have given your 'society twenty pounds, I him about them an' the' Confederation, an' when I over-bold in her display of affect
don't well see how you are going tO get it back; your told -him Iwovldhn't- let them -a'vd'Pthe monoy to mus Douglass. This afternoon, t
Confederation isn't a business or .anything of that squander as they like, he said I was quite light." dbor'leadtngi from her little living rog
sort, it seems, so yo( can only resign from it -'I am "But suppose they go an' tell that you went Was not even closed as formerly; andy i.
afraid I can't help you, my good man; it was very to the Attorney and complain about them an' the who cared to look could see her set% j
foolish of you to hand over twenty pounds so freely Confederatin'.", asked Matilda. "Not that it will Mr. D.g* -,:and caressing him o
to anything; you must be very generous. I couldn't matter;. but thiieymay be doin' it now"' :.' hifha,4: ite -of the yard-dwellers di'ie |
afford to do it myself. This will teach you to be "I don't think they so foolish, as alnfl 'tat,"'.saas f : they it'th gieps to pains to do so, and tb.
more careful In the future, I hope; and if you take Danglass, with a shrug of indifference. .'Peelpta iitt shefttw goingtooEar. Without known
my advice you will keep clear of sedition. You might would want to know how they knoWifs S I t, an' they did, they held with~ Hamlet that it was
ask my clerk to come in as you pass out." they couldn't very well. say that t1iy 'went to do decent that a married lIdyship, or a married. lad.
"Jerome,"-said the Attorney General, as, he It trikinelt--BWilde4 the Attorney was.n't"dtg to ani kind, Oshould preteXn to virtue even if shell
banded his clerk some papers, "these people' are call:my name to them. He wouldn't tell themj a word not possess it. Illicit couitship should be condue
very .aausing; they are always quarrelling among alout.me. They can only suspect -becaeweu'they saw decently and in .order: -that is to. say, in seer
themselves over funds and subscriptions. That.:oor me near his office to-day. But if they only hint any-. "She 'ave no shame," they muttered to one another
devil-the younger one-has just lost twenty pounds thing; which is all they can do, people will saay .t.ia "she don't think of 'er good name.": They made
and thought he could get it back by coming to me!" because they want to kick me out. No; I .avirthem their minds to use that fact in.abuse of har at
Then he too left the room and disia ed the soft. But if I could meet that old hypocriteFmrand. time in'the future that she should offend them.
affairs of the Confederation entirely tfrlthhis mind. leigh to-day, L would give him another right .I It is.. And while Matilda and Mr. Douglass were t
_____ fun to see how that old seller shake all ovr when I displaying their affection for one another, and como
CHAPTER FI E look at him an' tell him I will cut his a.garst::t..-R meli ating on -the difficult position in which they
CHAPTER TW VEi think It is out already!" .-l'..I;. laed Mr. 'Brimstone and his supporters, the latt
THE END OF fr -ATTR Both laughed; then Matilda said: Ln W aail his wife, with Mr. Proudleigh and Mr. Green
I what they going i3. do?" : and Mr. Sha1rksey, were discussing the problem o
M-ATILDA. Wai;'laghfing heartily. Mr. Doug- "No; tell me." .the Douglass Presidency.
Ilass wag not at all a bad hand at telling "Them goin' to tell Morty ambut you ian.'me:- Mr. Brimstone, in'spite of Mr. Proudletgh's prOC
a.story; and this one interested them both as soon as him come back from the conoty;.ul: Ti- tests, had taken Mr. Sharksey and Mr. Green into1
personally. Matilda immensely enjoyed it. the next thing them 'ave in mind. I. kw tihlt.' 'his confidence. After an, Mr. Sharksey and Mr
-."You should -have seen their faces," said Mr. They bin hinting, an' throwing words allithB tti ..Gren had five pounds each in the Confederation^
aDuglass chuckling. "They thought I didn't know because they afraid to go too far an' doesn't w .ant a and were office holders in it; they had to be consult-
where they was going, an' yet they were so frighten one to say plain, 'you told me so.' BButtIa..B.lLb. eft But they could suggest nothing, save that a law-
that it was all I could do to keep from laughing at stone going' to forget herselff now an' stalkpIub o. yer should be approached for advice as to what ac-
them. Then when I said to the old man that I would It is she who goln' to tell Morty." "...;. ..*. tion should be taken to compel Mr. Douglass. tq
take him into the court-hoqse, he was ready to come "You- mind?" queried Mr. Douglamn Wit j Afiare .up the custody of the funds even if re-eleeteedij
dent of the society, as he was certain..t....
like a lamb.! An' all the time it was the Attorney less smile.ent o the society, as he was ceUtafn.t:.i.:^
they wanted'to see-about me!" "What am I to mind for now?" consulting a lawyer required. hmBonBgi WtO.
"Ha! ha! ha!" laughed Matilda; "but y'u didn't .'Exaectiy. So let them say what :.J .. l. seemed disposed to make any *fttertr .Il 'M!
think before that them was going to do that?" sides~from one.or two things Morty, say :0 i f e rifice. After what the Attorney Ge. i.
"I am used to those kind of people, Mat, an' they he. leave, for'the country, I think hqh.. a S ... a. lawyer's fees might only mean. iti:: nia
will do anything low: You can never trust them. Yes, or two aboutwus already," : ,, 'li i:i.ood money after bad.
I had a suspicion that some of them would try to get '. I surw of it," said Matilda w.tA)t t Then It was that Matilda's ins.gt nlto .Si
behind me, though I didn't know which of them it "Morty.would be foolish it he tom tf.~ | i|ll ', character was justified.
would be; so, I give a few names to, the Attorney, peerr him- to a man like you." it.:. ::: 'ijdon't matter what you gentlemen meek n
and. especially Brimstone an' aldProtidleigh's. What "You.tlove-me. eh, Mat?" i:.:.;? to-do or nor to do," said Mrs. Brimstone
n .old- feller! ,Ie lp .as coward.a.aa. rat,,yet he al-. ."What.about you'self?"- q ''U ..Jirtimer Slimslam come from the cou-
ways int'ererin'. TWIhen I meet him to-day he near- ....'. u know I love you!:I reiee:a.i teltl him how his wife an' Douglaas
.y tumbled down. Frightened! Why, if I had- aid the.. leple, an' I devote-.me wholAt ii- .
*boo' to him, he would 'ave had a fit." that sl not love Vhat:'yoo call it?" ls, Janey," implored her husband,
"Wish he had,".uhkindly remarked Matilda. "An'. ...W::. al, ope it will last." aldd Mat:;jtf*#t iat there were such things as
slow, what them.going to do next?", ., ate:. "From the first time I hear y'iIr. '.. e
"Soietbiiag," said Mr. Douglass positively. "lThe klnor yeMW are a-great man an' I fall in leo ai.daae .Mrs. Brimstone
yeut so much that now they must do something. 1-: ld-#itant matter now if everybody Mter iaft ;.~pt",. pored MrE
krould like to 'ave bin there wfin the Attorney w ;..- ,... t ..-appeared- that it didn't. Eve.r stce F..rl .:.. : ?. ;
VI -- --nil -*U


F... :

ways, of corse

t now es. ,:pedi

e ... C*.: i, .... ., *-

you should r e mem b r ;
to order the -foLiwag:,
from your..,.grocer..:
accept -o others: -"::""


erris' Famous Hams and


Bacons .

Meux Ale & Stout ;

.Victor Clicquqt Ch
C hau w* ot .. 4: ''
Pear' Soap & t
Requisites -.. .

Blue CrOss. .a

Shepherd Brand MI:i:..
t.


-StL REPRESENTATIVES FOR A i "

CECQIL deCO )R DOV &CO.
48 Port Royal Street'i'' r'


di:.


I' -7-" "'.'":. '


r dua'j hi~asg Jamaica
"tiers' Pbnch,' the great
a favoritee, enjoys an ENVIABLE
NATION I


We have achieved this distinction in Ja-
maica simply through devoting years of earnest.,
work in making a study of the requiremr4tqj.
the Market! .


As a result of this applica
we are able to supply BETTI
LESS Money, and at the samni
ter all round service to our .Va
any other concern in the Isji


Our Warehouse
fountain, .from .
'. team of .Eghis"h-e

.;
/:i ::!.:. fa ......


|.a huge
intinuous
competi-


is replenished
I's best sources


jir own interests should
sit to us, when our hug*
a:t attractive prices.
arces in influencing..


S HARBOUR S
I :. STON,


4'-Hi^


-Ab

bul


F


- .. ._:.. .. l;-. .- i.'


at~


Ei7:..


*;':) i
: i".
.i '







B25-26 PLANTERS' PUNCH


"Me mind is made up,
knaow about libel an slan
for once I teck a gurl
tfd me back, an' she ha
went to prison. But
':what I going' to tell Me
bring me up! I am p
I..::Kaowing his wife, Mr.
',.her. But that did n
r .
.Well, they are praitt
said Mr. Green, af:.;
there will be no"b

=W.,. W. Wb ...ti .Z
"I know fiat I :.*jI

...tola-"f t.",r..


...h ...
by. M
Mortim
and on
Vwreskly meet
lie must suffer
TId.band outvoted
I, and Mr. Dougla
memberss who disda
options. Mr. Green would
other "non-finanrial" membe
.but he had no doubt that
-that they were, and the non-
ote solidly in their own fav
hands. But on the folli
ode her own particular li
not in the presence of w
a to the unblushing intri
las, and endeavour to
ai. At the least, there
wi, Wth Matilda properly
ie:ftteet,;nnd perhaps Mor
ini.e -of Douglass, and v
ltaipired to thrasi
'bttld be a knight
in the land would gre
Thus the sage plans
iter they had been carri
at next to do to bring
of the Douglass and hi
'That Friday night the
Iton of the Oppresse
ent was to be chose
be elected: very mem
aes was urgently re
i for opening preesedin
:the ri :. :;."ft ly t
V,..v .. tft. bt


irprlse upoar I
rimstone bellev.d:
And a surptise ."
ilcipated. After a wait
hr and surprise had cause


asserted Mrs. Brimstone.
der same like everybody
to court who abuse me
at in .. kh iemfne an'


Bournemouth Rejuvenations


hatheawas true, U Bournemouth Bath has increased in popularity
vhat she said wasn't true,
orty is God's truth. Let during the last few months. Mr. G. Lagarde has been
repare for anything," appointed manager of the Bath, and he has made
Brimstone could well be- strenuous and successful efforts to make this fashion-
lot render him any the able bathing resort still more popular with the resi-

opetn with their friend- dent and visiting public.
i what you said is said English visitors to Jamaica declare that they do
g. .SJr them to bring y'u not know of any Swimming Pool in England equal in
size to the Bournemouth Bath, which Is equipped
tO.say," declared Mrs.
say," ea we with all the apparatus necessary for sliding and
t6 or me husband'ss twenty
God! what a thing it is diving, and which gives periodical exhibitions of
another man's money an' aquatic feats delightful both to the professional
government to put him in athlete and to the average man and woman.
rs. BrAn exhibition of such feats given on a recent
[rs. Brimstone. hy adroit
er would be back from the Sunday forenoon was witnessed by hundreds of per-
Friday night (as usual) sons from Kingston and lower St. Andrew, and the
ing of the Confederation applause which greeted the splendid exhibitions of
the humiliation of see- skill and courage in diving testified to the apprecla-
as a candidate for the onlookers.
ss re-elected to that high
gained the payment of sub- The dances in the Dance Hall at Bournemouth
d raise the question whe- Bath continue to attract thousands of pleasure lovers.
rs were entitled to vote, A new feature introduced by Mr. Lagarde is the Sun-
Mr. Douglass would rule day morning musical concert by the excellent orches-
financial, of course, would tra of the Palace Theatre Amusement Company.
vour it it came to a show Bathing begins early on Sunday morning at Bourne-
owing day she would ex- mouth, when the great pool of sparkling health-giv-
Ittle mine. She would- ing water, freshly pumped in from the sea, is filled
itnesses-open Mortimer's with persons of both sexes recuperating their ener-
gue between his wife and gies by swimming and diving exercises. At half-past
force him to take some ten the orchestra begins to play, rendering as a rule
ought to be a disgraceful some beautiful selections from well-known operas.
y beaten and turned into After this concert dance music is rendered, and those
ty, who was nearly twice couples who wish to enjoy themselves by dancing
ery much stronger, could may take the floor.
l Mr. Douglass soundly, Many avail themselves of the opportunity, and the
.ly performance that no dancing is quietly and decorously done, as indeed is
atly condemn. also the bathing. Bournemouth, of course, is a bath-
of Mrs. Brimstone, who, ing and dancing resort ot.the highest standard, and
ed out, would determine only the best conduct isa.permitted within its pre-
about the further down- cints. But as only well-behaved people go to Bourne-
s lady love. mouth there is never any necessity for any reference
meeting room of the Con- to its rules. These are automatically observed, and
ed was crowded. A new so everyone's enjoyment is undisturbed.
n; a new Treasurer was The Sunday morning reunion at Bournemouth
iber felt that his or her has become one of its most popular and entertaining
quired. Long before the features. There Is nothing like It in other parts of
ags, nearly every member the British, West .Indies; only in Havana, indeed,
ed ed the resigning Presi- can one see a similar gathering of strength and youth
en, to make up the full and beauty In this part of the tropics.
When a night dance ig. given at Bournemouth,
tg.W:B corm n.t "last:. ut, too, it is regarded as an event not to be missed by
ai the pleasure lovers of Kingston and St. Andrew, by
-:i.; all those who can come up from the country districts
i,~ t:ttend it, and by vtsitora to the island who know
SA.ht a dance at Bournetuouth.aeans. With the sea
Sobth, and the hills..blue and purple, to the
rt, SBeurneauth is fanned by land and
Sd Er an';.nigah.t. It is always cool,
'th Atlw *4a. i:pjj'leable. It has already done
Of nww i th'reputation of Jamaica as
ed a great huin of audible a Itas '
.: ;~ ..


S ,SAMUEL,

%Aurioneer.
Commission 4genl,
S..Slock ,r,,ker.



81 Vtnpanies
bought lb arge "oW small
quantity, J. ca Gov.
... .
ern ent Debeotitmwi and
local Inscribed .6t loais
Made on approved .

i. For particulars and p
.For particulars and p te ..


. SAMUEL, "'
& Commission AgeS
toC4 Broker.

KINGSTON.


comment to fil t buildingg, Sir Mortimer Slimslam
walked rapidly up the centre aisle.
He looked about hl*t serchingly, all eyes upon
him. Again he scanned the audience, obviously
without finding what ie searched for. Then he
walked up to where Mrs. Samuel Josiah Jones was
sitting, and bending over to her whispered:
"You saw Matty here to-night?"
"No," said Mrs. Jones; "she not bin here. She
don't come yet-she and Mr. Douglass."
The question and the answer had been overheard.
They were rapidly circulated. It was evident that
Mortimer had come to the meeting from his house,
and equally evident that Matilda had not beep at
home. He had supposed her to be at the gathering
of the Oppressed; hence his question. But she was
somewhere else, and Mr. Douglass was probably with
her.
The people now began to talk in groups, loudly,
accusingly. Unpunctuality on Mr. Dauglass's part
had never been known before; what did it mean? "It
means," said someone plainly, "that they not coming'
here to-night, an' we better go on electing another
President." But the general advice was to wait a
little longer, and, as they were enjoying themselves
greatly, the Oppressed readily agreed to abstain from
action for some little while.
It was about five minutes to nine when a mem-
.her, strictly non-financial, was seen to enter the
building by the front entrance and proceed slowly
a i the centre aisle. In his hand he bore a letter. It
was addressed to "The High Conspicuous Potentate,
Permanent President and Minister Plenipotentiary
Brimstone," and the man.explained that it had been
given to him early that morning by Mr. Douglass,
who had asked him to hand it to Mr. Brimstone that
night at the meeting, but not earlier than nine o'-
clock. Mr. Douglae had'brought it to bhiehouse in


a 'bus. Mr. Douglass was a great man, and he, the
bearer, was only too proud to do him a favour.
Mr. Brimstone opened the letter, read it, and,
lifting his voice, announced that Air. Douglass would
not be there that night, nor many nights to come.
Mr. Brimstone was immediately pushed up to the
little platform, and there, in the midst of a great
silence, he read out the letter. It set forth that Mr.
Douglass had, suddenly and unavoidably, been called
away on business, but that while absent he would
devote himself to the affairs of the Confederation
and do his best to obtain funds for it. On this
point he was emphatic; he impressed It upon them
that the affairs of the Confederation would be his
first interest while he was in foreign parts, and that
they- would hear from him later on. In the meantime
he advised them to accept his nomination, and make
Potentate Brimstone President and Sir Mortimer
Slimslam Treasurer.
That was practically all.
Members looked at one another in consternation,
dismay. What did it all mean? Douglass had gone,
and Matilda had evidently gone with him; but, but-
Someone bawled a question to the little man
who had brought Mr. Douglass's letter:
"He give you any books to bring?"
No, Mr. Douglass had sent no books.






Chrysler Alone


GIVES




Chrysler Results



The ideal car for Jamaica,
for the following reasons:-


(1) Economy in running
(20 and more miles to the
gallon of gas)

(2) Freedom from repairs

(5)- Rapid acceleration (5
to 25 miles per hour in
seven seconds)

(4) Marvellous hill climb-
ing ability on high


(5) Exceptional
comfort


(6) 70
hour



Buy a
what you
penses and


riding


and more miles per




Chrysler and bank-
save in running ex-
repair bills.


The Chrysler '6" Phaeton
fully equipped with Spare Tyre.
Bumpers front and rear, and Four
Wheel Brakes 395.

The Chrysler "4" Touring,
fully equipped with Spare Tyre,
Bumpers front and rear, and Four
Wheel Brakes 295.





E. M. MARTIN,

SOLE DISTRIBUTOR,

76 HARBOUR STREET, KINGSTON.


: .. + ..


PLANTERS'


PUNCH


i~
I;%o12e-~6
:'''






PLANTERS'


PUNCH


1925-26
A"i


Then where were the minute book, and the book
containing the Constitution and Rules, which were to
have been printed, but, somehow, had never been?
Where, above all. was the bankbook?
Half a hundred voices took up the question-
"where is the bankbook?"
No one knew exactly to what country Mr. Doug-
lass had gone; but most persons suspected it was
Cuba. He had left in the morning, he may al-
ready have reached Santiago by the big ship that
had sailed from Kingston to that port many hours
ago. And, anyhow, no one could do anything before
to-morrow, supposing that anything could be done.
A committee of twenty persons was instantly form-
ed to wait upon the bank manager in the morning to
ask whether the Confederation's money was still
in the vaults of his august establishment. But
it was not until eleven o'clock that the members be-
gan to stream home, the non-financials protesting
loudly that Mr. Douglass was being very badly treat-
ed.
Mrs. Brimstone had taken charge of Sir Mor-
timer. She felt that byegones should be byegones
in this hour of trial, the trial being hers and her
husband's. Mortimer, she argued, could honestly de-
mand congratulations, he was rid of "a wretch."
But she was wise enough not to say so straightway;
she merely invited him to walk home with her and
some other friends, for thus could she obtain at first-
hand the true story of his marital misfortunes.
Mortimer was affected; first his position had been
lost, and now his wife; and for both had he cared.
But of late he had been more than suspicious of
Matilda, though it had never entered his mind that
she would desert him as she had done.
"You too good for her, Morty," the sympathetic
Mrs. Brimstone assured him. "But leave them both
to God. He will revenge y'u."
Mortimer thought God would, but did not seem
very cheerful because of that.
"I 'ope Mr. Douglass never come back to dis
country," declared Mr. Proudleigh vigorously, "or,
if him come. I 'ope that them will arrest him de mo-
ment he put foot in Jamaica." (But, on the whole,
Mr. Proudleigh hoped that he had seen the last of
the disturbing Mr. Douglass.)
"He can't come back here if he have robbed the
money," said Mr. Brimstone; "he have exiled him-
self."
"But you 'ave to prove he rob anything," Mr.
Samuel Jones pointed out, "an how you goln' to do
that? Where are the books? Y'u haven't a piece of
writing to take into court. However, we will see
to-morrow."


And on the morrow the committee, assembling
hastily at the lunch hour, went hurriedly to the
bank and asked to see the manager. Three of them
were admitted to the manager's presence, and the
first question they asked uas whether the funds of
the Confederation were still in his keeping or not.
He made some enquiries; the deputation was
quickly informed that no account had been opened
in that bank in the name of the Confederation.
Mr. Brimstone agreed that that was so, but
there was an account in the name of Mr. Nicodemus
Douglass, Permanent President of the Confedera-
tion."
"Ah, that is different," said the banker, "but I
am afraid I cannot tell you about somebody else's
business. That is against our rules."
They argued. The money was theirs; it had only
been lodged in the name of Mr. Douglass, and even
he had subscribed himself as President of the Con-
federation.
"Perhaps," remarked the manager dryly, "but
only be is entitled to withdraw the money, clearly,
and I cannot tell you whether he has done so or not.
We cannot disclose the affairs of our clients.
"Look here," he added kindly, guessing correct-
ly what had occurred, if you are in any difficulty
you had better go to a lawyer about it. He might


departure of their President, and what Mortimer
was saying about his wife's desertion of him.
"'It is their own fault," sadly observed Mr.,Doug-
iss. "If they hadn't shown such a low, mean"splrit,
I would be with them still, leading and guiding them,
an' uplifting them. It is almost enough to break me
heart. However, there is plenty of Jamaicans in.
this country, an' I must do me best for them."
"I know you will." said Matilda admiringly.
"What a man y'u are! Y'u must always be trying'
to 'elp and helevate other people. An' they never
thank y'u for it."
'No," agreed her devoted lover, with the air of
one who has habitually made great sacrifices for
hopeless causes. "I don't expect thanks or reward;
but I continue to do me duty. You watch an' see
what I do in this country."
"An' now you 'ave me with y'u. you will succeed
even better than before," said Matilda positively.
"Y'u don't afraid I leave you like y'u leave Mor-
timer?" Mr. Douglass laughingly asked her.
"An' suppose y'u do," was her unexpected reply.
"Do y'u think that a young woman, looking' like me,
here especially, where there is not many handsome
Jamaica gurls, could be long without a frien' to look
after her?"


*I
in


help you, but I cannot. Very sorry. Good morning." "No," said Mr. Douglass truthfully; "and I was
The members of the committee went back to only making fun".
their respective work places, and that night, as pre- "Don't make too much fun like that, Nicky,"
arranged, the Confederation assembled for a special she advised him, "I doesn't like it."
meeting. The position was put before the members, And he decided that he would not again.
there was wild talk, denunciation; even the non-fi- THE END.
nancials loudly abused their former chief who had
done what so many of them would have loved to be
able to do. But no decision was arrived at. No one
had any fertile suggestion to make. There was a The use of luminous paint was suggested as 4
genera fertile suggestitCon to maen. Th pere wsh help in darkened streets during the war. It is sal
general teejlng that the Confederation Lwas. Perlsh-
ing violently, was now in its death-throes, and-all the suggestion was based upon the known efficacy o
that was left to do was to give it vociferous burial. luminous language in other street emergencies.
The burial was as noisy as anyone.could wh, and *
Mr. Proudlelgh nobly added his denuntlatory shout- Shortly before a general election six million eggs
lng to the volume of sound that formed thea obeqlai. were imported into England from China. It was
of that latest great effort of Mr. Dduglass to elevate said they were intended for confectionery purposes,
the working- :aifla .:,:.:i :..., i th statement didn't go down.
.Mortlimer: ~Jt:ib 1htiu t~:. if ,: pp .i *
over; he had indlan fueeo;i; weet a l-htr.,:'.. e '., Ut used to large dinner-parties?" asked
title of Sir Mortinml Mr.l" :NBrtiBt l ik. .iBa-' it: i::.
sled that nothing on earth could'n titre Wi. h~' ". I at serve them both ways, mum," re-
band's twenty pounds. And meanwhile, In a ~it repifW d the a ew cook.m "
room in a hot alley, in that hottest of West ladlan "Both way?" "
towns, Santiago de Cuba, Mr. Douglass-and Matilda "Yes, mum.- S thy' come again or so they'll
were wondering how the Oppressed were taking the stop ai ty."


YOU WAN


THEN '.aET IT-


FROM


WILLIAMSON'S


IF IT IS


Hardware, Provisions, or Groceries



It will be to our mutual advantage if you

get our prices and see our goods.



BEST QUALITY GOODS


Reasonable Prices Courteous Attention.







WILLIAMSON BROS. .,

Hardware & Provision M ants

9, 11, 13 King Stret.


-F
a'


-1


;II \


I


" .


I .:







PLANTERS'


PUNCH


(Continued from Page ,56)
"Ah!" It was Luke, but he dared not call him
S by name.
In the gloom of the small damp room by the en-
S trance he saw the giant negro standing between puny
guards. A broad smile slashed the black face with
a gleam of glistening teeth.
S "Release him. It is a matter that concerns the
:.. king!"
The guards retreated respectfully. At a sign the
negro followed Bush intd the ball outside the door.
S "You'have something for me?" Bush asked.
S Luke humbled .in his breast. Then he slipped
over his head a light cord with a small package at-
tached to it,.and with a guttural sound from his part-
S ed lltp.thrnst t into Bush's hand.
S..:sih nnknotted the cord and untied the pack-
ag-;.':: 2n de the outer wrapping was a sheet of paper
y y folded, and within it was a heavy gold ring
S..:wijth a grayish green scarab. Automatically he
lippedpd the ring over a finger of his right hand and
then unfolded the paper. It contained only a few
Sentences and was signed by Samatan. Bush held
the paper close to his eyes to decipher the words in
the dim light:
hlo MoNsa:
The ring which I send will serve you if a time of
great necessity comes to you I send it by your faith-
f'ul servant, who is accompanied by Thomas Huggett.
'who also desires to aid you in your endeavours. Con-
alder not the ring slightly.
Your obt. servant,
NAPOLEON SAMATAN.
S "Huggett is with you?"
I:n Luke shook his head violently.
ij. "AAh! He is at Millot? Down there?" He point-
ed toward the distant town in the valley.
A smile of assent gave answer.
: "Good! Return to Millot. Do you understand?
There wait with Huggett for me at the cafA. At any
hour of day or night I may come." Bush paused.
"And, if possible, have horses; three horses, where
-you can get them instantly. Do you understand?"
Luke nodded and disappeared through the guard-
Soo door, as silently and as suddenly as he had
qpme. It would be a simple matter, Bush realized,
S tr the negro to await his coming at Millot. Luke's
i mliarity with the country and his understanding
Sthe language enabled him to pass without suspic-
i; and his dumbness in this particular emergency
Additional safeguard. As for Huggert, Bush
ie pacern. Doubtless the sailor had travelled
Itt4f to 'illotf in the guise of a trader. It was
St .,-fpr an occasional 'white man to go in-
to cant liata scaltal; many toreign-
r a earpm time to limne.,. IiWardly he.
thanked Provi en~a fe the loyalty .pt the two.' me,
for their unswerving daiotlnb which was to: serve
lhim far better than he even realized.
SLuke and Huggett must Wiaye received: the iA-
rmation of his transportation to the citadel from
matan; it was doubtless on Samatan's suggestion
tthey had followed him. If there was more to
plan the future would disclose it.
: Again his speculation turned to the ring. There
B nothing particularly remarkable about it: an
ptlan scarab set in a plain gold band. But Santo
Domingo was teeming with superstition. From Africa
:strange and terrible beliefs and practices had been
~.the slaves and handed down from genera-
Mation. Witchcraft was practiced. No
f.trom the taint of superstitious be-
i.:ome mysterious power was attri-
i- nIe now wore.

i ..T'HATa.. i.'hP at again at the round table
T In h*t iplibsli'.*e meant and transcribed let-
ters for thefi regal-,i lture; but it was difficult for
rhim to hold,'. l:thought. on-the work before him,
.for in imagination he was sitting on the stone bench
Sthe moonlit garden of Leroy Mangan with the
tountain's jet like a silver bell sounding in his ear,
r riding through the night with Pierre Nicholas out
m Le Cap along the white road that led to Millot
the citadel.
:.It was late when the king dismissed him. In
room the air was warm and ifeless, and without
Blessing he flung himself down for a few hours of
:6u.bled sleep. Against the ceiling fireflies flashed
'rtselr green light like errant stars and through the
jes. doors bats fluttered In soft-winged light.
T .room had grown cold when Bush awoke.
J .slightly and his hand moved to draw a
Then like a flash occurrences of
e ~ passed before him. It was still
t bt iLE. eould not be far distant, and with
would -co.lilierre Nicholas. Even now Nicho-
ust be spa ti the fresh horse that had await-
at Millot nap'le twisting road to the citadel.
earliest opportagity that morning he would
himself to Chrift"phe and present the falsi-
itnt m.lain his presence. Sometime between
i..necessary that


Bush should encounter him. Within that little brac-
ket of time must occur the drama which Bush had
planned.
He slipped into the crimson coat and with his
bare hauds in lieu of a comb smoothed back his hair
from his forehead. Groping in the darkness he found
his sword where he had hung it on a chair-back, a
lean straight blade of English steel. The world out-
side was bright with starlight and the huge court
seemed like a white square surrounded by the impen-
etrable shadows of the walls.
He hurried across the court and found himself
in the corridor that led down by the wide atone stairs
three stories to the entrance of the citadel. At the
stairhead he paused and listened. From the guard-
room came the muffled sound of voices. He walked
a few feet down the gun gallery and peered out of a
vacant port. It was light, a soft white light that pre-
ceded the dawn. A hundred feet below on the terrace
in front of the entrance two horses cropped the
short grass; they were still saddled and bridled and
their necks and flanks were white with froth. Sounds
from below caused Bush to retrace his steps to the
stairhead. There were two voices that he did not
recognize: then a third voice replied. It was the
voice of Pierre Nicholas.
Already Bush could hear his feet on the stairs
and the clicking of his spurs. Hurriedly he stepped
hack through the door to the courtyard. Undoubted-
ly Nicholas would go immediately to the quarters of
the king's bodyguard and there wait for the morning
to present himself to Christophe. In that case he
must pass through the door where Bush was stand-
ing.
The approaching steps sounded loud on the land-
ing. From his place Bush heard them cross the cor-
ridor. Then a man stepped out from the doorway,
and at the same instant Bush confronted him. It was
Nicholas.
"Sacrd Dien!" Nicholas took a step backward,
startled by the sudden apparition. Then he peeped
into Bush's face.
"It is I, John Bush."
Nicholas instinctively reached for his sword hil'.
In the dim light Rush could read amazement in his
eytL.
"Stop. Pierre Nicholas, there is a matter to be
settled between us. I have awaited your arrival."
"Out of my way. The king has summoned me.
I shall find time for you later." There was an ugly
sneer in Nicholas's voice and as he spoke he started
to pass the man who confronted him.
"Easy, monsieur." Bush spoke with the gentle-
ness that invariably characterized his most violent
emotions. "It was I, Pierre Nicholas, who wrote the
letter which brought you here."
"The king signed it, tool."
"But, monsieur one forgets perhaps that Chris-
tophe reads but poorly and if a letter intended for
General Fournier should "be addressed to Nicholas,
.and the one for Nicholas---"
-A torrent of abuse broke from the lips of Nicho-
laB. With a thrust of his arm he flung Bush back
against the wall. Recoiling from the blow with an
unexpected suddenness, Bush leaped to the side of
his asaliant. An arm in a crimson sleeve shot
through: the talf-light and with a stinging impact the


flat of the bare hand fell full across the face of Nicho-
las.
Half crouching and face to face, the two men
regarded each other.
OW, monsieur, perhaps you will eight The
IN gentle stroking tone was gone from Bush's
voice.
Let it be said to the credit of Pierre Nicholas
that he was not a coward. Treacherous and lying as
he might be when baser actions seemed best to serve
his purposes, the crisis never found him reluctant to
defend his dubious houour in the manner of the
times. Like many of the better class of his country-
men. he had been educated at Paris. And that edu-
cation. equally characteristic of the period, placed
strong emphasis on the defense of honour by the
sword. His training in that art had been thorough,
and a natural aptitude had given him something of
a mastery of the long blade at his belt.
Nicholas drew himself to his full height and
bowed slightly. "I am at your service, Monsieur
Bush; at your convenience."
'There is no better time than the present," Bush
answered. He glanced at the sky. It was already
brilliant with the blue of day. "The parapet yonder."
he suggested. "It is wide and smooth."
From within the fortification a bugle sounded.
Then front another part of the citadel a second took
up the call. From the summit of the battlements
gray feathers of smoke were rising, and within the
grimy gray walls was the sound of awakening life.
In silence they walked across the courtyard and
climbed the steps which led toward the parapet.
"Your sword is one to which you are not accus-
tomed." Nicholas remarked.
"And you are wearied with your night in the sad-
die."
They reached the wide level space which looked
down upon the world. In the east the sun was climb-
ing the horizon and the ocean flamed with golden
light. Far below on the plain white wraiths of mist
filled the lowlands. A cock was crowing in that other
earth below. It was infinitely still.
Without words the two men removed their
coats and rolled back the ruffled sleeves on their
right arms. Nicholas drew his sword and with a
faint gesture presented the hilt to Bush. The other
waved it aside.
"Keep your sword. Monsieur Nicholas. They are
both equally strange to me."
How little Bush knew of swordsmanship Nicho-
las may have suspected, for In his varied experiences
there had been few occasions when Bush had had op-
portunity to profit by the teaching of an experienced
master. Yet he possessed some slight knowledge and
a natural aptitude which slightly offset his disadvan-
tage.
They faced each other with blades raised In
salute. With a click of steel the loWered swords
crossed. Right arms outstretched and bodies turned
on widespread feet. thrust parried thrust.
The large white face of Nicholas was expression-
less except that the lips were tightly set and the black
eyes fixed the American with a look of confidence.
Slowly, under a succession of lunges, Bush was
forced back along the parapet. Then the blue eyes
grew cold; a flush tinged his cheeks. In a frenzy


1925-26


SOLVING THE TRANSPORTATION PROBLEM.



In these days of buslle nud hustle, when time ia money. you need a
miian on whom you can-rely o1 sulve Miour transliirtation problems. Sitch
a man is

HAROLD E. BOLTON

who has been on the job for a number of years and knows what he is
about.

He can supply you with a car, a truck, a buggy or a riding horse at the
shortest notice, and at reasonable rates.


He is Agent for THE BROCKWAY MOTOR LORRIES and Trans-
port Contractor to the GOVERNMENT OF JAMAICA and HIS
MAJESTY'S WAR DEPARTMENT.


BOLTON'S MOTOR SERVICE

(Harold E. Bollon, Proprietor.)


Garage: 34 Duke Street, Kingston.
Transport Stables: "Gardenlhrst," Arnold Road, Kingston.
Military Transport Depot: Gordon Town P.O.
..... ....... ... .....







PLANTERS'


PUNCH


ot thrusts he drove Nicholas back and beyond the
distance he had lost.
"Ah!" The word came with a hissing breath
from the thick pale lips as with a skilful feint Nicho-
las's sword-point pierced the white forearm of the
American.
"Are you satisfied, monsieur?" Nicholas parried
leisurely as he spoke.
"No!" With a rush Bush flung himself forward.
The whirling blades glittered in the sunshine. Steel
clashed against steel. K-
But in that second. Nicholas's eyes had glanced
from the strained face before him to the white ring
hand that grasped the sword hilt. And on the third
finger of that tense hand he had seen something that
caused him momentarily to retreat before the on-
rush. On the third finger of Bush's hand a scarab
beetle was held by a ring of gold.
Bush saw a fleeting look of dismay on the white
face that he did not understand. Only he recogniz-
ed. that for some unknown reason Nicholas was on the
cleensive and retreating before him.
Step by step Bush worked his way forward. Be
hind the retreating Nicholas the edge of the parapet,
unobstructed by even a ledge, barred the way. Again
Bush lunged to pierce the other's defense and again
he bore Nicholas backward.

*' OLD!" The word came like a cry of terror
from Bush's lips. His sword rattled on th3
stones. In that last step the right heel of Nicholas
tad caught on a protruding fragment in the pave-
ment,. His body thrown from its poise, he reeled
backward. His right hand shot out behind him to
break the fall. but the edge of the parapet was be-
neath his heels and the hand clutched wildly at the
empty air. Slowly. it seemed, he turned in the air
and backward fell head foremost from the edge, his
sword still clenched in an extended arm.
A feeling of nausea brought Bush to his knees.
Down in that blue gulf a black object fell, turning
slowly, disappearing into the roof of trees, far down
below the cliff, a thousand feet below.
He glanced behind him at the courtyard. Some
scldlers were already forming, probably to relieve the
guard. There was no time to lose if an escape was
to be effected. At any minute word of Nicholas's
arrival at La Ferriere might be carried to the royal
apartments and search would be made for him. It
was not unlikely that some watchful eye had seen the
two men on the parapet. Quickly the sequence of pos-
sible events passed before him. Thrusting his sword
into its scabbard, he walked hurriedly to the stairs
and ran down them to the courtyard.
A sentry dozed at the entrance of the king's
apartment, but his sleep-filled eyes recognized the
uniform and Bush passed through the doorway with-
out hindrance. On the round table the papers were
still heaped in disordered piles and a few were scat-
tered about the floor where they had been blown by
the storm of the night before. Bush selected at ran-
dom a large document at the top of which were print-
ed the royal arms and the words Le Rol In bold,
black letters. Thrusting the paper in his breast, he
walked through the corridor to his bedchamber and
took from the chair where he had left it the gold-
encrusted hat which had been given to him with his
uniform.
No one spoke to him when he crossed the court-
yard and as he descended the stairs in the half-light
the two soldiers whom he passed flattened against
the wall with an awkward salute and with no ap-
parent surprise in their eyes.
*In the guardroom a dozen men sprawled on wood-
en benches against the stone walls. A candle gutter-
ed in a wine bottle on a table. Through a barred
peep-hole in one of the massive doors the daylight
poured; a palpable bar of light that intensified the
darkness of the room and paled the tongue of flame
at the candle tip.
"Attention!" The men scuffled to their feet.
"I come from the king. Quickly! A horse."
A sous-lieutenant, who evidently was in com-
mand, picked up the candle and thrust it in Bush's
face. Then be saw the uniform and came sharply
to salute.
"Quick there! Open the gate. And you"-he
thrust a black finger at one of the soldiers-"horses
from the stables." He turned again to Bush, "You
wish how many men?"
"None."
"Alone? It is against the orders."
SBush reached in his breast and held the paper
under the startled eyes of the young negro.
"Do you hesitate to carry out my orders? Do
you wish to hinder the business of the king?"
At the door the soldier who had been told to
bring the horses hesitated. The sons-lieutenant turn.
ed on him with an oath.
"Did I not order a horse?" he shouted.
The man fled precipitately. Through the door
which he had left open the daylight streamed into
the room, disclosing walls of huge blocks of hewn
stone and up In the gloom the vaulted roof streaked
with the stains of moisture. Unnoticed, the candle
sputtered and died. The soldiers had again relaxed
and flung themselves on the benches. In an awkward
allence the two men regarded each other.
S"You ride to Le Crap'" The sous-Teutenant in-


quired. It was a casual remark; he was not seeking
information; the white face and the steady blue eyes.
which seemed to study him embarrassed him.
"Perhaps."
There was another period of silence, then Bush
saw hanging against the wall a pair of pistols in
holsters. Except for his sword, be was unarmed.
With apparent unconcern. he walked across the floor
and flung the holsters, ahich were buckled together,
across his shoulder.
"They are loaded?" he asked.
The officer nodded. Evidently he desired to pro-
test but fear restrained him.

CHAPTER XII


W ITH his ears strained to detect a sound Bush regarded Bush's uniform, a question in his eyes.
waited. Had his disappearance been noticed, Bush read the look. "No time to explain now,
any moment might bring the noise of feet on the Huggett. By now they are well after me. I must get
stairs. There could be no escape. He would be trap- to Le Cap, quickly. You say the horses are ready?"
ped. Undoubtedly the officer of the guardroom attri- GGETT held out a restraining hand. "Beter
buted his evident Impatience to the urgency of the at and drink, sir, unless the food I've stowed
business which the document indicated. Minutes in the ddle bags will do ye. Ye look weary
passed. Together they walked to the door and stood its a long way well travel yet before we can it
waiting on the threshold. Outside on the terrace the n a g a a a
black horse that had carried Nicholas to La Far- ont B w a a t d ,
But Bush was already at the door. '"Come," be
riere so short a time before cropped the scant grass;commanded. "Ther's no time now for food or talk."
the smooth flanks still shone with sweat, and the command s tie now for food or tlk.
saddle blanket that lay beside the saddle on the Ia waiting. An expression of joy flashed over
ground was dark with moisture.as waiting. An expression of joy flashed over his
ground was a clatter of hoofs and around the face as Bush and Huggett entered and he flung him-
There was a self on the floor and clasped Bush about the knees
corner at the far end of the terrace the soldier who withhis long arms, overcome by the intensity of his
had been sent for the horse came galloping; a mo- emotion. :,:
ment later he swung from the saddle, the bridle In Bush touched the bowed fig genty
hisBush touched the bowed figure genhatnd
oohis Bush stroked the hhig-arac.. shoulder. "Get up. Luke. There is more yet t*tF
"And youG Bush stroked turnhe highhed nf you shall do for me. I thank you for what you hate
"And you, monsieur"-he turned to the oef-" one. I can never forget it."
do not need Jo warn you that the king desiresl done. I can never forget it."
do not need to wn you that the k desire tThe negro stumbled to his feet and the broad
be no announcement f the departure hiblack face seemed straining for words he could not
ger." utter. Then he smiled broadly with a flash.of gleam-
The aos-eueat drew himself to a alte ing teeth, rolling his eyes upward until only the
"We are not free with words," he answeredcr whites were visible.
With forced slowness .Bush inspected the stl-. Behind the cabin three stunted horses crunched
die. Then he swung himself easily to the horle'si .. lajy a ple of cane. They were saddled and
back. The terrace WaB depled except tor the yona br14ia. and Luke made no attempt to untie the reins
officer and the grazing horse. Ha glanced up at tle frtii.nmtree to which they were tethered. With a
walls. So straight anl so high were they that they rl h i turned'Bush again to the cabin and
seemed to incline above bh i, an illusion heightened ...h might be hisedesire, the two white
by a white wiep of cloud .tat sailed slowly o rr i i .. cpe a pot hung over a bed of
the edge far up.against the.blue. The three anupet .. ith *N 11A tled the lid and pointed to ,
imposed rows .of black ports were deserted; no faces ~he cotental 1%ie&e selected two gourd bowls from;
peered down at him from loophole or battlement. shelfand elis..lie bf rubbish In the corner drew
Once again he glanced back at the citadel. From out a Lr peea bottlH,
the trees the.towering prow hung almost above him. as to ..atl )E:: "L
Then the road turnedd and he gave his attention to ..he I
the winding way which.led down to Millot. h.iwa ia t .gpes sen.%, thata'W it :lr '
The air refreshed .hlm..abd as he turned a cor* i. i lt l t^t teto na s.:
ner a cool breoe from, the. sea. fanned his heated o4. .t 'st w down with.guise t11'1
face. From t4 i citadel to the palace, he estimated. Thrs a.Sik n the hatched & t
was about three holr' .ride. That would be at tb dli thts it tdown to the dt.~ti o z
very best, for b hor a mtnustle saved agaiant a ts-. A. m '3 tt coq te tping
foreseen emergVa V o or' probable pursuit. 'S:* :;p Couldn't be
er or later l" uld 6e noticed. The" iti:ip:bik : :":0 dn't porte A
er or later h cape uld be noticed. The ; ptain. if you're wahing to make port 'tb
room officer ;uld be.brought to Christophe a' std da."
questioned. j'smile played about his lips as he Streted on hisback on the floor, his head ele-
thought of black face of Chritphe when theeted on hisback on the floor, his head ee-
thought of black face of Christophe when the ated on an arm crossed behind it, Bush watched the
news would pe brought to him. chameleons scurry among the thatch, and the bar of
He exanAned the pistols which he had fastened sunshine flood through the torn roof. Finally he
to his saddle. The flints were bright and clean and spoke.
the priming in the pans assured him that they were "We'll be at Le Cap after dark, Huggett. I s
loaded. HA had no ball powder and there would be go at once to Mademoiselle Virginie. You and .
no time to reload if it were necessary to use them. will report to Monsieur Samatan. If thereI ti
At least he had two charges and his sword. sel in the harbour, we must arrange pam :l n I!
For at least three hours, ie estimated, he had board. If there is no ship"-he paused, aettIrD~ tg
ridden, when thrdroi a brejak'ih the trees he saw a indecision, but to emphasize the altetirni -'then
dome against thempitch of.treen. It was the palace we must either get to Mole St. Nicholas. or remain
at Millot. The:.tat stage of the escape was accom- in hiding at Le Cap until some ahip.'aijtIvs. The di-
plished. 1' tails will be difficult, I need not 'iilw~ you of that'*
The broad street was deserted as Bush rode out Nor should I, after the skill wi tlitich you hava
from behind the palace grounds and turned his horse conducted so far." He rocked t.2:attng posture and
toward the thatched building at the roadside which t to his eet "Come, we lEbe off."
must be the inn. In the tropic heat of noon open All afternoon the 1ttl'e cavalcade retraced the
doors and windows seemed gaping to catch a breath road to Le Cap. Occ0aia tlbainds of soldiers, recog-
of cooling air; Ineffectual for shade, the palm trees nizing the uniform otri"~l white man, deferentially
fung their distant clumps o green against a sky of stepped aside to letf'..iiiholkb Peasants scrambled
startling blue. Except for a woman's voice raised in out of their way bhyidly. Sometimes riding but
a thin plaintive song and the metallic strokes of a more often running beide his horse, the great negro
hammer In a smithy behind the inn, it might have kept pace withthe t iders. Once or twice they paused
been reasonable to believe that a plague had swept for a few miuite to water and rest the horses but !i:;i'
the village or that on that morning the entire pn- the main they rceeded steadily. By twilight l>'
lation of Millot had been commandeered by the kfte mountabls already seemed far behind, an omil
to drag his cannons to the citadel. bharri' the horizon. Ahead lay the level ilf
Bush tied his horse to a rail in front of the inn ar tf. ii worn road.
and strode through the open-door. For a second.his :...t fjdM barred to Bush that his unitfrt i
eyes, burned by the outside glare, struggled to e- to Identify him if the pursuers t d
trate the comparative gloom of the long, low room.,' iiS Br ornatives whom be passed, biutni -
Then he saw more clearly, a man sprag tup from a '.lo ht be realized that his identity'A
chair in a tar corner and almost before' he cotliifi ty possible circumstances be impo
recognize the face or the stocky figure, a hand Wi."': ,i ad for the time being the untfor
thrust into his own and a familiar voice was spiaP'it' would serve as a protection,.,
ing, almost incoherent with joy at his delivez1si .: -at least until they should reactiH ,
It was Huggett.-
As though realizing the surprise which tti 'n- HE light was failing w who ro
precedented outburst of emotion must have a. adIln. 1 Slightly in the lead, .ohits horse.
ed, the sailor abruptly relasped into his usual deterf pointed to the right, where j red columnai.
enco. He waved a blunt hand at the chair in w leh a massive ornamental gat aoice opened on t
he had been sitting. driveway to some Freonei ''
"It's.a day and Jght I've set ip:k : iSalr,. "Stopped the~Rie 4?IlsIalb "T M
cap'n," heconimenteda a spring, arn M. sw .'


1925--6


xt-t'...;


"Luke?" .
"'He's here. I see ye have a horse, bui t "
three waiting in a cabin outside the t iowl, -i
tney are."
"How did you know where they had taken. -
Bush sat down in a chair and Huggett perched on the
edge of another beyond the table.
"Samatan. Luke fetched me to his houie
Come ashore, I had, to look for ye So Samatan flxed"i;'i
me up for a trader with a box of jimcracks, the pack-
et Luke took to ye, andgold for our purposes, and ..
gives the sailing directions for Millot." He paused
for a breath. "And here we be, cap'n, waiting for ..
your orders."
"Mademoiselle Virginie?"
"All's well cap'n, as far as I've been told." He





L,.:..A N TERS'


PUNCH 09


& Co., Ltd.,


THE LARGEST MERCHANTS
OF DRY GOODS IN THE


& IMPORTERS
WEST INDIES.


Nathan & Co., Ltd.,
BEE HIVE STORE,
KINGSTON.

Nathan & Co., Ltd.,
MONTEGO BAY.

Nathan & Co., Ltd.,
SAV.LA-MAR.
b~iti;lJi


standardi dA d ro
for
Men and Boys.


ng and Dressmaking
S Short Notice.


:. ::, : i : "
: ,: .: ":
.. .. .


:L-t


, .. y,.:' .
. Y :
'


Nathan & Co., Ltd.,
METROPOLITAN
HOUSE,
KINGSTON.

Nathan & Co., Ltd.,
PORT MARIA.

Nathan & Co., Ltd.,
MAY PEN.


"St. Andrews"
Boots and Shoes
for Men.


The Best House
for all
Local Novelties.


Jamaica's Fashion Centre.
: -R

ITROPOI TAN HOUSE,
CORNER OF KING & BARRY STREETS.


.A.ll Goods Marked in Plain Figu~es and 3d. in each 5s. Cash Discount.


"4!.


1925-26


A1


I


"'


'






PLANTERS'I PUNCH 1925-26~..II~~ll~llll~~ ~lllll..lllI.IIIIYIlll 111~n~11111111111


When all has been said that has to be said about


inexpensive cars, you


still come back to the


FORD as the standard of achievement.
It is indeed the car for Jamaica.

...........................bank the difference.


The

Improved


Ford service throughout the Island.


Kingston Industrial Garage,


Kingston.


.I ...-,. : .
.:. f | '
... "r .'.-


aJ-rrw :..


4


PLANTERS'


PUNCH


1925--26







1925-26 PUNCH


Bush glanced at the horses. The intense heat ot !t WAS not unlikely thit the four officers of Chris-
the long afternoon and the pace at which they h tophe's bodyguard who now. rested their tired
ridden showed in lathered flanks and drooping he.a. horses in front of the ruined villa, undecided how
Delay was dangerous, but, he realized, a time itilt to proceed. might have retraced their steps to the
come a few hours later when the strength-i.. the highway and continued toward. iLe Cap, had not an
horses would be of vital importance. A .jfl-hbur's uuroreseen incident determined their immediate ac-
rest would perhaps forestall disaster. iflodded as- lion. They had ridden long and hafirti:s i Bah's es-
sent and Huggett turned into the dribifWy;- cape and the disappearAeo of Plerre MIid~hk4had not
Through an avenue of tower' royal palms, a been discovered as promptly as Bush had anticipated.
road, now overgrown with gr q and bushes, led In fact, the morning was well advanced befoseOChris-
straight for half a mile to the in* of a large build- tophe. desiring to continue:dictatioln..to hlisa-*w- see-
ing. Picking thtir way, thearses followed the foot- retary, had made Inquiry. Then in rAid m su~eaion
path that wou.ud along t abandoned road. Ahead, came a bewildering mass of information. A soldier
the ruined %illa stood iqeiimtve in the yellow even- had seen two men climb-the parapet and another'
ing light. The root-f -gne and the stone walls soldier had seen Bush return alone. The officer of the
were scorched and-. E ed. Over them a tangle of guardroom, his face ashen with terror, told of the
vinus threw a g :i* .atle from which scarlet blos- arrival of Nicholas and the solitary departure of
soms flamed .i glowing embers. In the fading Bush on horseback.
light, bats dped in and out throu.ht the gaunt The lips of the king had drawn back from his
apertures.;,W eant doors and windows. pink gums with a snarl as he heard the faltering
words, and his eyes grew red and small in the broad,
IN T io0en space before the house the riders stop- black face. Of the officers who crowded the ante
Strete look about them. No'wv a tangle of poin- room, there were four whom he called sharply by
trees and wild coffee crowded almost to the name. They would follow and bring back the fugl-
Ails. On the right the slave quarters were barely tie. With a salute they acknowledged the command
visible through the dense undergrowth, a group of ant in an instant were gone. The face of Christophe
wattled cabins, their thatched roofs fallen between grew more composed; there was even a trace of a
the walls in dilapidated decay. On the left, also smile on the thick, red lips, for these four men whom
half hidden by the foliage, were the walls of what he had dispatched could be relied upon; blood to
must have been at one time a pretentious building, them was less than water, and'their cruelty was a by-
probably a sugar mill, close at hand beneath the word even among men who had grown callous to at-
watchful cye of the proprietor. rocity; they were a product of the terrible school of
Thr.i dismounted and turned the horses loose to Dessalines. The king was thinking of what might
.. _bron ,_- on the lush grass. happen should the white man offer resistance, and the
Then. as Bush paused beside his horse to dis- smile broadened.
engage the holsters and saddle bags, a distant sound These were they who sat in the starlight by the
.caught his ears. It was very still. Tranquil as the crumbling villa, and from the mill door the tense
.;uminous twilight.the air hung soundless about them, eyes of John Bush regarded them-uncanny, inde-
so quiet that Bush sensed the stillness even before finable blotches that merged into the dense shadows
Sthe sound which transfixed him was recorded on his of the night.
senses. Small are the incidents that often turn the di-
bPr of. yet sharp and metallic, the noise of hor- reactions of men's affairs. Even as the four riders
a a' hoots sounded staccato in the evening air. His turned to retrace their way back through the avenue
ears tense to locate the sound, Bush stood immobile, of palms the mount of the rearmost horseman, sens-
a hand raised c-utioining his companions to silence. ing with delicate nostrils the presence of a kindred
On past the ruined villa now thundered the racing spirit, gave a short ringing neigh. And like an echo
hoofbeats. Momentarily he relaxed in relief. Then answering from the roofless mill came the response
cam., sharply the realization that the pursuers were from one of the tethered mares that Huggett had
Snow between him and his necessary destination. The secured at Millot.
thought was short-lived. With uncanny suddenness There was a quick movement of the horsemen.
the sounds ceased. Somewhere beyond the gateposts a scurrying of hoofs on the sod; the sound of bridles
'the riders had reined their horses. Had they noticed and spurs.
the hoof-marks turning from the highway, or had "Les bancas!" A voice spoke excitedly.
thIy stopped to question some travellers along the The horsemen were lost to view in the shadow of
ay? The latter, probably. He recalled the almost the trees as they charged toward the mill. Hoofs
continual flow of pedestrians to and from the city. rattled on loose stones. Then a few yards distant
With a low cry of warning Bush caught his in the darkness they halted.
's bridle and. stumbling through the entwined "You will do well to sutrender." called one of
an toward the wide high doorway of the the four, in French.
suga tgitlls. Huggett and Luke had also heard the "And you, gentlemen will do even better to retire
sndi~tlj'nstant appreciation of their significance. before I fire." The drawl which was so often notice-
SFeel ttot, John crossed the threshold able in Bush's speech was prc ounced, although he
an the hotw :.licking on the stone mil, t1l. replied in the same tongue. "-
lowed. All around i al bhiek walls shft out the world, "It:. the!"
but above, where once the0 roof ha thei,: the Isky A. A .. spurt of flame and a crashing report cut
offered a square of sapphire ia.h-,l*Vth a.;lew Soft ft t stars.shone dim and distant. -ThrOn~irSt d l:or .d; sfi t,*d;airw t.t.iewinc hes from Bush's cheek.
gett and Luke followed, and a minute later the horses k is e' ia u etectiat, him, but his own eyes were
were secured in a corner of the roofless room. n iioti t the flash of the pistol he had
"Better take a look," Huggett suggested in a locate one heaoemen. Almost simultaneously
gruff whisper. his own tl'wrii ered; there was an angry cry of
S "Wait here with Luke. I will look down the pain, a ruetlinin%! thrashing in the bushes, and the
drive." Before Huggett could reply, Bush had dis- sound of a ho1re eting wildly, followed by the di-
Sappeared in the darkness. milshing clatter o it.he6 it ran off down the
ht wai Li. a *fl. rU Li Lll rjLii .9I IIU dri ve.


it was onUy a ew yars llut U m LI ll l UrUI oVo tie
Open space at the end of the drive, but by the time
Bush had reached a point trom which he could look
down through the avenue of palms there had occurred
a:csmething that sent him stumbling back through the
ei s to the two men who waited his return.
Si' almost indistinct in the starlight, he had
Sseee : a.erement at the avenue's end-a movement
that dbutif.bie only the bodies of men and horses ad-
vancing il0wli between the two files of palms.
"They're coming!" His voice was barely raised
above a whisper.
S He felt Huggett's hand on his shoulder and the
touch gave him confidence. In the darkness Luke
loomed monstrous, and that, too, reassured him.
The lock of Huggett's pistol snapped sharply to
cock and with an Inward smile Bush knew that Luke
had drawn the wicked knife he invariably carried
from its shark's skin sheath.
Intently they listened, nerves taut. eyes and ears
straining for an indication of the enemy's approach.
Somewhere among the rubble a cricket chirped shril-
ly. a tiny. sharp, sweet note. At the door Bush wait-
.. ed, his pistols grasped in either hand. Behind his
e heard Huggett's breathing, but Luke had be-
: coI bible, a grim spectre swallowed by the en-

-. From:te'e drive a shadowy shape appeared;
others followed; four men on horseback, spectral and
real. For a few. seconds they stood motionless,
apparently Indecistve of their next step. Then a voice
termined the reality of their presence. A man was
eking in hurried trench. Bush could not hear
.words.
..... r.. ... ..i ..... .. -<.., .--. a ., ..


With a rush.the three who remained charged
the doorway. Thart were curses and a wild thunder
of hoofs, sharp urg tto the horses, and then through
the drifting pistotasmoke Bush saw them above him
In the huge doorway, rad black chests of horses, a
tangle of hoofs thai'efiemdd to strike out at him, and
above, leaning down' vef the straining necks of the
horses, the red-coated bodies of the riders.
What happened in the brief interval that follow-
ed, Bush could never tel. He recalled a succession of
blinding pistol shotsand the crashing bodies of mad-
dened horses as they crowdedd through the door. He
remembered firing his second pistol squarely into a
black face that leaned down toward him and in the
quick glare he had seen Luke, his long knife imbed-
ded in a red-coated breast, dragging down with his
powerful arms his victim from the saddle. Then a
heavy body struck him and carried him backward to
the earth. Terrible hands tore at him and hot breath
beat in his face. Mi arna. strained and his fingers
clutched a thick thrirt :still the hot breath slack-
ened. Something warm and wet flooded his face.
Then the man's strength faded. With a final wrench
Bush shook himself free and staggered to his feet.
Above in the square of sky the stars shone brightly.
.He heard the horses uneasily moving In the blackness
of the enclosure. Somewhere in the dark a man groan-
ed and was still.
"6 APTAIN!" Huggett's voice, even and emotion-
less, broke the spell of the fearful silence with
the single word.
"Here I am. Are you hurt?"
"No, sir, but there's a man apiece for us, and


WISE ASSURANCE


d i
.'.
I" ."


The Imperial Life Assurance Company of Canada,
which Messrs. Manton and Hart's Insurance Depart-
ment represents, is one of the lives and strongest In-
surance Companies to be found anywhere.
Messrs. Manton and Hart's Insurance Department
not only represents Life Insurance, but insures
against Fire. Motor Car Accidents, Personal Acci-
dents. Baggage Loss, Burglary, and is also a Marine
insurance Agency.
Against sudden death or accident you can insure
with Messrs. Manton and Hart. Against theft or an
accident to your motor car, or an accident to your-
self or to a relative, or loss of your baggage or of
goods shipped. or the loss of or injury to a ship it-
self, you can also insure with them. The capital of
the several companies represented by Messrs. Man-
ton and Hart totals up to hundreds of millions of
pounds. They have been long established and they
enjoy a flourishing connection in all parts of the
British world.
Messrs. Manton and Hart's Insurance Depart-
ment. in a word, represents the following companies:
1. The Imperial Life Assurance Company of
Canada, operating Life Insurance.
2. The Commercial Union Assurance Company,
Limited. -
3. The Caledonian Insurance Company.
4. The Queensland Insurance Company, which
operates Life. Fire. Motor Car. Personal Ac-
cidents. Baggage Loss, Burglary and Marine
Insurance.
Here. then. are four Companies which cover the
field of Insurance and which are represented in this
country by one of the ablest and most reliable firms
in the British West Indies.
Associated with Messrs. Manton and Hart In the
care of the interests of the above companies and of the
insuring public of Jamaica are Mr. F. A. McKay and
Messrs. R. B. Harris and R. A. Figueroa. Mr McKay
has over thirty years' experience in Insurance busi-
ness. and is said to be able to smell a fire-bug as soon
as he places his foot on the first tread of the office
stairs. He is responsible for the rating in all bran-
ches of the Insurance, and for the computation of
Loan Values, etc., on Life Insurance.
Messrs. Harris and Figueroa are familiar figures
with the insuring public. They are responsible for
the promoting of the business; they claim that they
are engaged in missionary work amongst the public
of Jamaica, as they persuade men to provide against
rainy days and old-age, and against loss of income to
families by death: and to guard against accidents
and sickness, to safeguard themselves against loss
by fire, hurricane and earthquake, and to take care
to protect their motor cars against the cost of acci-
dents.
The Imperial Life Assurance Company of Canada
invests money in Jamaica through Messrs. Manton
and Hart on first mortgages on real estate in this is-
land, and accepts repayments at short notice. This
lending of money to those who need it is quite sepa-
rate and apart from the ordinary loans on Policies.
Thousands of pounds are thus available for invest-
ment in Jamaica, and those who want to raise loans
on properties cannot do better than make applica-
tion to Meslr: Mlanton and Hart.
Every care is taken by Messrs. Manton and Hart
to give the Jamaica insuring public immediate at-
tention without the delay of reference to Head Offlce.
The second quinquennial bonuses now being declared
on many of the existing Life Polices are more than
twice the amotmt of the first quinquennial bonuses.


two for you, captain, counting the first one you got
out in the bushes."
"Where's Luke?"
There was no answer but Bush saw the head or
the negro against the sky looking down into his face,
and his hand reaching out felt the sinewy forearm.
Then he heard Luke clucking in his throat. All was
well!
With his flint and steel the negro caught a spark
In a bit of flint torn from his ragged shirt; a few dry
leaves, and then a tiny fire shone clear and yellow
in the breathless air. By its light Bush saw the stone
walls and the wide. black doorway. A few yards
away the three riderless horses were cropping at
the grass which thrust up between the stones, and
on the floor, like crumpled bundles of rags, three red-
coated bodies lay limp and motionless.
The moon was lifting, large and yellow, from the
brightened east when Bush, Huggett, and Luke rode
out from the avenue of palms and turned loose their
former horses at the edge of the highway. Then rid-
ing the three horses they had taken from their pris-
oners, they turned to the right along the broad road
to Le Cap.
When the hoofs of their horses clattered on the
stone bridge at the outskirts of the town, not a light
was visible. Wrapped in silence and darkness the
city slept under the flood of moonlight. Riding
abreast, they trotted slowly past the Champ de Mars







-... ... .a:-.c d ; ,., .
X I, ,b .sO.r recently beyon4*.. prison had rched it. Be y heard Luke leading"
ji wB ;ar;t-ideath at. tlhe -wkets roflth6 iia !'the horses
A.,a o a huts .Pao- f thi As thed.-.'ftoil Bs. Quit&Itd f
S.the cluster of t huts at eof tii As.the..dd ushi.. f himself face to
.: ,* ll ":t; htft" tr:b tt -4lthAb t te har' face with.: aBsmatanii. fit a cry of pleasure
' ..iL:hour frwt..'-tW.t.i4iFtmus eyes. e. neted"the-har- the met.~ciI-.#bt his hand in both'his own. Then
heour. .The.i rjn lights of two -as' shone clearly. he bo -. ifinte with sweeping grace. the
u :'te at .aht seemed favourab.ti;t perhaps by one of .friends! It will always be my ("ha
these ships escape would je "Mi: possible. d 'that this long adventure should have the
..- hese ripy escape woutd ee" ::p0 ble. d ed to
A few turns and thgt .in a square away ( my roof" .
Tfrim the house of Mf i a an, had been ,d .table on whiih. were burning brightly
'arranged. Wggett. .. were report to th a.:: a a~~les, H.ugut rose quickly from his lean
: n merchantt; ieto' o h Ni&r r ttem Jnd
rey Ma1S1 i. ; rj.to thiem with L: S;ain`; :The Joy:~, htli message almost, pre- puisl
ini"e bEis 't 'atrbets. .To a; the wq id from ittt hi lips "A.hi, dr
tha: a'w*i 'he. lPettiheK de ou whether theit .tl siria Yankee ship, lies ltiLe "barbour and' her cap-
g '.~qmail-at aled beneath hi roof until a veqBi e: tain sleeps to-night in the Hotel de la Republique." you
thie hartilar, or proceed immediately to thM tlb St. They sat.down around he table .nd Samatan ever
:agicholaa, ~ ~ ildthe glassy ,roim a c-ftal, dtte.. -
Alone on the deerted street, Buh. ui .. his "In thankigiving!" he said simply. dark
S..horse Impatiently as he thought of his': t. At his -Silently they lifted their glasses..
.side trotted a second horse, caught i- ti md by its "And now, my dear friend," Samatan continued, inte
'riddise. In silence Fort Plcolejt (. the sentry "you. will restore to me the talisman."
at the gate unconcerned wiytki. ;rY ho6rseman ROM his finger Bush slipped the searab ring and
who rode so late. Bey' ."I rhO felt the cool "u 1
wbho rode so late. T .fiiowed twhe laid it down on the polished..tabletop. "You will
..reath o thr sea "tif overtpp teest perhaps explain," he queried. "what is this ring that
'n rod thoe hos tle t toong of the bridge you have at so much trouble pl.E. upon my finger?"
",- ad the ho fB. I a ti before, a timeng o thmed soge Samatan smiled grimly. "Desoallnes, the bloody ,
; ag ago, fla: s .' beaf separated, ib:tive, from one, wore it until a month before he died.: Hov it
r around' #' ie whle life now centered. T came to me is a long story that must t be told.
S aroah. g anl he slowed down to a. wak Enough to say that during his life It wai his seal of
,.lprtTO.WT^Sii:ttF g and he slowed down to a. tie, The imprint of that, Krajie Inseec&,.ghofed gnlnn
-.and then o d the bill. Beyond the next turn death. The imprint of that strange inec uthfd din
as the houe o eroy Magan. There awaited the n the death of one or hundreds. as thle cI might tie. this
was the botse':4f"Leroy MarlWan. There awaited the All men grew to fear it one* al~maA ktdalt#:.*V
Saezt vital eptsode; he wondered what might be the All men grew to tear It and ame knot mi. n thi
u o toodeal ; ng. oHad hed eptl t, perhaps .he might k tpra0me on bi
beyond. Would it be a ship now in the harbour, orsh saw himself aga o
must the perilous flight be continued across the nor- In t ae .fo' morning Ught; the earth on i -
tbern end of the island to the Mole? That was too morning twen
far ahead to speculate. SufBcient was the problem at MS3 e;l ota
hand. .Before him stood the white stone..gateposta
lof the entrance to the estate of Leroy Manga. g
S:" Just, inside the gate, in the shade ,of.4hsQq'..q.%q~. .... ...
he tethered the horses. Then pa
S the turf at the edge oft'r
A thlyi to the house. ,er. .
5iN te eves of th.et.tf i.
-splashed the walls 'wth-' e-' a.. .
crossed an open ag.,t''I? l*a:. ::ai: L....
which stood banas.lte!ii:~~.I.'eoght t ht ; ring, mnj utht r:tk'th
she might no&,wq '?U f iSn him- It Icould 'i ti't 'Ang that has re
'.- i.t be; wheo. iild ~'g .::lirhe wistled arisen, the king himself woneadhar
p a b~ pri.. jl .ab.to s.sign. Ag=a. harm the wearer of the. dfath
i :f le. t.h ".t Bn .i... d-wly wit Bush felt the gefle *: a' s- a
h -ty St erW t about his elbow. He tujrnmd and saw, her
..' *^ i" -i I-saw ier;m her" ie ewas ery white tai" and luminous, minted with je n ..
Ss:t.atarlight. Over-.each shoetilder he'' daAr hair 41 SiAmatan.'t he abrauitly tur their, hit P
hIeavy braids. A long, slende' hafd gsted .bfi thi versation, "yod :h.ia eer w ith- ':,,
Se tS Bill. .American ship in titr bariH
"I have come for you. Can you go6WMO1 B now?" The dark ifaest. toe meercl U'Dwglrt ..!
He spoke very low but she caught his words a smile. "It is gpoFd iewe,' tin eed, that Ias
through-the silence. A finger rose to her lips. tell you. She is t privateer brig ( 44si pr
"I shall come. Meet me at the g more, Captain "T`'ii Ba Tbhis, .it ..
drank wine togetelW, and- in me, as?
HERE was no hesitation; no questioning. Impll- Americans, he confided that she. .
citly she put her trust in him. Over Bush for the her home port after a most ehs nat
first. time came a great awe, a-trependous sense prizes have been [ pot
.is responsibility. Into his preeatrio, life this young up from his chair and brsii h ''t ianhe 'agB .. d
--girl was about to fiing herself. What- weald the au- from a window that opened to the arien. Dawn il-
ture .bag? To hir alone, little mattered. But with ed the room with opalescent light
A ,e a*..-things were vital. If the epospe should fail "Come here," he commanded. "We re near the wi
.;- "--the coeoquenoes, appalled him. Mangan aroused warehouse where my boat is waiting. Let us be off
to wrath might be capable of action inconceivable.In before there Is discovery of Madem 'sele's escape, age,
his- great lo-r Virgina,4 qik- h was rempted before'tbe unexpected can mar so glorious an adven- aor
S gain to call her to the window ani-then with. one trite." ..
list lingering memory of her face escape from the is- .Biith put his hands.an the merchant's shoulders. w-
and, alone, forever, Nicholas was dead; her great- There-was a tremble in his e ktiethat none of those
S st danger was averted. ~. bhrai.n seemed itcapable present had ever before heard. -,
to decide. Then out of. the 'tjezy ,t-his thoughts "Monsieur Samatan," he- said. "there are many Jim
came the recollection of her lingering lips; her voice things so d'ep-that' words can .i-ier do',them justice ovel
again thrilled him, again he felt ble'arms around her -,sudh.-iA yqgr friendship aad.ltiEasatstance you have He
yieldi..ng body. Stealthily he retraced his steps to given to us.".,He paused, apparently unable to pro- a g
the entrance to await her coming. .ld, Then: "You will incur danger? Will not kno
i The horses munched the .gnass. '-Above the miaforine lie the reward t4f-your friendship to us?" sha:
q nopy of trees.theb sky seemed-almost as bright as ~kitan picked up tfe ring from the table and cau
day. He leaned. agatint ,the trunk of the mango. slipped -it' on his finger. "I am a good citizen," he decl
S Ten,'restless, he paced back. and.forth in the gloom, said dryly.' "I supply the king with money, and" locb
S His ears seeded the silence towring.from it the sllgh~ ---rke stteeched out a black finger to one of the can- I d
test sound that might tell 'o the discovery of her Mles Until they'could plainly see the scarab gleaming ven
flight. A mile -away a dog-bayed mournfully.
A faint grating-of her .feet as she crossed thea. ... ,..-.-


gravelled way, told him of her presence before he saw -TEEPIHOhE, 894..
' m,: .--neeath the sheltering tree they met. He could ZETT "
, tr.se.,her face, for the long blqc'k mantle she wrote 4
completely covered her; but he felt it pressed against : (DSag
his .own, bw.:r asas- encircling his shoulders. For a :' -"
:long times they-stood unable to break the spell that S'OH
"held them, th'lbWi gently'disengagft' her.
'. '1Wn'must"go, beloved," he whispered. "No onei"
'nIttld have heard you?" : CONSUL
'"No one!" .' Difjptriciadof the
S'.Slowly thee Iiies retraced the long waLdnng..road- i. ~iio Assoaostwn.
f t*fhe town. Then t"tegh back streets'they follow- :.. (B a.) -.
e-az deire-ritous way- till they stopped before t. JAi A 3URS
house of Monsleur already the. street w :.i',..
.. ..tle wh airn. Hr 4 ly- ltey stopped befor .. .TO
e stepped.out tod ll wa".. Opteful- y eeluee s.'. i ." 'al Calde (
flush lmfed Virgile fr.i Wlii i tter ./'
-..tere i the. door W '. ..' s.,t
S', 4.. ....Y.......... ,;:
.. .. ...: .,. :: .


the


seat I
reen ix
the unb
WO the ,
ed again
sink int
ve mowel
shoulders
'Virginie
regret?
mine!"
Her face


light-"I wear the *si,:jiensa- I

eease was cuttiniibt$~ l'." ,
t snowy foam; wtiteaG4*-. a
night. Under full sail thg'prlip e: "
l fast behind her stnuousq'wae ..:
Bof anto Domingo, her bdw pi~nt-;.
t on of the Atlantic.
i ~~L and Virginie Ooutle r .,
at Jwt. and watched the is- .
o the cr .tance. With an 14 I ,
meat Bush arm, around the' len'
I of the girl .tte.r to nim. '
e," he whisper ..ris nothing that.
You are leaving"kver, to. be for-'

was raised to his, ast that.the


eyes were wet with tears. "' "
'John, dearest"-her voice was str
isity of her emotion-"I love you!".
And again he felt her warm lips against .
The End.



4AST LAUGHS-

A-
'WE doctors," raid the pompous surgeon at a
er party, "have, I am afraid, many enemies inJt
world." '.
'Ob, but far more in theaeaxt," anaw the g
Is left. ..
."
A man tells of a printer WBa't
ty years ago and has just retired with i
ble fortune of $50,000. This money was acquir-
brough industry, economy, conscientious efforts
lv full value, indomitable perseverance, and -the
i-of. an uncle who left him $49,999.70.
:.,.:,.
st wa showing a friend round his stutilo,
| how much he hoped to get for some of


.a," he said, "that
OWS if1good picture

afor some
=.. :== .


only about-4=aqi
from a bad One'

of you fellows
Sa.


Little Jahny went to church and sat jtst
tt' o"~tAe. pulpWit.
The -clergymab took as his text, "I shall.co -e
'n and dwell amongst you." ,
He had repeated the words several times whe,
bout any warning, the pulpit collapsed.
The clergyman rescued Johnny from the.
and remarked sympathetically, "I
ry. I hope you are not hurt."
"It can't be helped," replied
1ed. me oft' enough!"


;
rLn-
~
-I: I
r, :;E:8+
j~Mcr~r~.F





AC


PLANTERS'


PUNCH


~t1-. -


00
9r__ ___ -------------------------------


ESTABLISHED


Nephew

D 1825.


S :,Ti he aIndermentioned Brands are



GUARANrEED


AGED RUMS


SEAL


APPLEMONY
ONE DAGGER
THREE DAGGER


WHITE OLD
BLACK SEAL
TWO DAGGER


V. S. O.


SPECIAL RESERVE


Also GOLDEN


STAG


(Light Coloured)


"WE : SOLICIT : ENOUIRIES.


J. TVRAY


& NEPHEW.


,,,_. ..__ .......... .-


1825-1925.
In 1925 1 100 Years
100 years experience in
We Celebrate Selecting, Blending and in the
Maturing various brands
of Rum atnd in Manufac- r
outr Centenary. luring Native Wines and Trade.
Cordials.


W M


GREEN


I


~- -


''"'
F
r


~Fi~j
a,
R.
.~:.
r
+.











." ..**

*" ... .. ..
J.


4
". % .** ,
" ",a :.
*., :0


-MW


-. -; .*a- 3
* -: ..:. .. -: .
: ,
i.. _


'a'


.c3Ij~'>


y.3"4


'"-t rca


`;*t~~A
.r~k


4* 'S.^^ GE ^^^:' -
'-..: ;'; ^lhey^-^- ^^^y *.. ,. ,". :; ..r
Moet & Ondltdon
' 1.- Munmr & GO. *' -' pag : ,
Henness. .
Du'bonnet Ape -V-
Ny .Garle ..~ eer
I R r e & S:tot-
S..ng-Powder .
S. o.i Washing Po ..
'-.- J. Golm an ..
S'VulGan" Safety Matchs .:
Si OTHsI- LEADINtG LINS .4
*.2hburn Grosby's Flour
... eold Medal ..... Monarch,
Sovereign r Can
Rie
Paper


14.:-
ts


L-

.. t.. ,

&.. ."
." .-* .M



*cs


-re


MYER$' SUGAR
SWhite Albion
Grocery Crystals
SI ning stovad alo

MYERS' -UM .
is the Pure Sugar e
in wood in--t he
Warehouse -
evenUV.


PRODUCE


"T-- IiERS'
S Annatto
Cooaa
Coffee
Divi-Divi
Ginger
Honey


Kola Nut
Lime Juice
Lime Oil -
Orange Oil
Pimento
Sarsapitilla
.3


~~nl ~ ~ n-&e; -:3 -Y s~'l


A---g-r wnaBr a service

In 18i,;td L. Myas & Son was established. From that time it has baen their consta
'Service and Satisfaction to patrons. With'this end in vi iq Fred. L Myars & Son have seao
leading :Frns @road, a.d tso handle ,thebeet of other Meri4Aise Tnese products they j
that the pfflicihould secure the best articles, of the 'fne.t ..1, in he easiest way. The
connected with the Tsland RailWay, .produois carried-dir'b~Lf om the Planter,.:"o the Hauei
spacious and airy Warehouses, tee praisee is stored a( ':s : pardd ftr shipment on
load from the Sugar Wharf for all parts of the World. ;.-: -

..-j. Bside&the services and satisfaction fromanthe ual goods, the large staff-of tlhfirm
of the pa~i s, to facilitate the satisfactory devel pTient afbtgger and better business. :


4:


Ft I
1~4's~


Vt.a


:."- .*"y t ". -

' .._ "" ..- "
-4$

I- ^4
414


I "


" `


-9


:;,,i" '1;*



'-;~ ;,


~T-~"=~


*.~
;f-
r~


......,"*


;*r;


.-..Cs




Full Text

PAGE 1

, ..'PRICE:ONESHILLINGJli25-1926 A. JAMAICA PUBLICATIOK VOL.I.No.6fromtheCoolCityand always CustoftheEntirelyfreeJAMAICA THEMOTORCAR, a !.vely andamu.;ingsketch. T-HE SIX BROTHER::, "Astoryofsomeofmyfriends",CHARACTEKSKETCHESOFNOTEDPERSONS,Etc.KINGSTON PRI"CIPAL CO "TENTS SceneryWINDWARDROADTHECIADELafull-lengthnovelofHaiti,byJosephHusband,thecelebratedAmericanNovelist.JAMA leA NOBILITY, acompleteNovel,veryHumorous,byHerbert G.deLisser.THEFAIR DAUGHTERSOFJAMAICA-twoprofusdyillustratedBeautyPages.A HUNDRED YEARSAGOANDTODAY -revealingtheKingslonof1825, PH ICES: BathingIs.B.:.ngdL:.d DancingSundayMorning 2s ;ChildrenHalfPrice.DANCING.SplendidDancingHalloverlooking thePoolwith a sweeping vie" 01the Harbour.Openon all sides, this DanceHallisconsidereaH.t:Coolest in Jamaica.TheverylatestDanceMusicissupplied.TheSundaymorningmusicisa mostattrac-tive feature. INLAND SWIMMINGPOOL150 feet long, 65fp,'-.Ide. Up to-date withWaterChu.tes, High and Low etc., etc. Individual Dressing Rooms, FreshW;;howers andSanitary Conveniencu. Powerful Electric Lights Illuminating thePoolfor Night Bathing.

PAGE 2

-PUNCH 5'"LASCEUES,-DEMERCADO&CO.,LTD.,14& 14t PortRoyalStreet,KINGSTON,JAMAICA.COMMISSION MERCHANTS, STEAMSHIP AGENTS,ANDEXPORTERS OFSUGAR,RUMANDISLANDPRODUCEII.'"""""""!!it!!!!ihti!if!li"'IfI.'Iit!"",,,m6th!MWespecializeinroastingCHOICEBLUEMOUNTAIN COFFEEANDCOFFEE COCOA PIMENTO GINGER GOATSKINS HONEY BEES-WAX SARSAPARILLA ORANGE-OILetc.etc.,....---Bect PricesPaidFor-RIGELARGE STOCKS OFdeMercado&CO.,Ltd.,'ommodiousWharf PremiSE's wecanhnndlecargodespatch,andarelocal representatives of JAMESNOURSELTD.5.5.CO.ROYALDurCHMAILS.s.CO.COLOMBIANSTEAMSHIPCO.,INC.il!iiil!!fi!"d"i!!iiilliitiliiliiiii!iit!tlirilit!liiili!!!Iii!lilll""'"i!m"wm""",mm''1:!Iiii!t!'k'iiil""hlil!jpn'''HI14& 14t PortRoyalStreet,Kingston.Jamaica.'!dIta".'"p,ttI!tiWi!!!jfflllilii"M"Lascelles,WeareindirecttouchwitheveryparftheIslandbymeansofourownPostandTelegraph Offices. Itwillbetoyouradvantagetocommunicatewithusforour rices {orProduceandBestQualityMerchandise,HUMPHREY TAYLOR&CO., LTD. WELCH GRAPE'{UICE CO, OHN KNIGHT LTD.SoapsGRIENDTBROS.,LTD.,Margarine"BETTY"CONDENSEDMILK"HOLLANDlA" UNSWEETENEDMILKMACONOCHIE BROS., LTD,ProvisionsandConfectioneryMi'OII"ilIiiNOurAgenciesinclude ------. JOHN JEFFREY&CO.MaltedLiquors

PAGE 3

CH01111111111111111111111111I1111I1Hisdressingcompleted.heputoutthecandleswhichswungfrombrassgimbalsagainstthepanelsandclimbedthecompanionwaytothedeck."Luke!"he called.Fromtheforecastlehatchagreatnegroappearedand C3.me towardhimwithaquicklithestridethatseemedalmostanimal,asuggestionheightenedbythesoftlJat-)Jatofhisbarefeetonthedeck."Theboat. Iamgoingashore."Themanswungoverthebulwarkandloweredhimselftothechains.Thenhereappeared,apainterinhishand,anddrewtheboatforwardtothegangway.Bushseatedhimselfinthesternsheets."Huggett!"he called. Aman'sheadappearedabovetherailandlooked down,peeringintothedarkness."Iamgoingtothetown.I shaa returnintwohours.You know theorders if anythinghappens."Theheadnoddedviolently,thetarredcue bobbingathisneck."Aye.aye, sir." OverhisshoulderBushwatchedthe Lucy witha curiOUSemotionthatcameoverhimeverytimehelefther. Tile moonwasupandinthesoftwhite lighf thebrigstoodsharplydefined, aclean cut hullwithtwotalltapering risingincrediblyhighabovehernarrowdeck.Shehadservedhimwell,bethought.Thesmallfortunethathepossessedwasduetoher.Ifthisvoyageprospered...Theboatbumpedagainstthelanding."Twohours,Luke.Wait!"Thegreatnegronoddedandmadea chucklingsoundinhisthroat.Hewasamute,for ilis tonguehadbeencutoffbyanofficer ofDessalinesaspunishmentforhisrefusalto disclosethehiding-placeofhisFrenchmasterwhen,theFrenchhavingbeenfinally expelledfromtheislandin1804,ageneralmassacrewasorderedofallthosewhoweresuspectedofhavingconnivedintheactsoftheexpelledarmy.ButBushhaddiscountI'dhisdisabilityinthelightofhispersonaldevotion,andforyearsthenegro,afreeman,hadservedhimlikea slave.Thelandingwasdark,andexceptforthemoonthetownwaspracticallyunlighted.Butonlythreesquaresfromthewater-fronttherewasa yellow glow ofcandlesthroughglasslesswindowsandthepersistentstrummingofa guitarindicatedthelocationoftheHoteldelaRepublique.FromthedoorBushsurveyedtheroomanditsoccupants.Atanear-bytableagroupof officers oftheKingsatclustered,theirblackfaces,heavylipsandflattenednosesinstrangecontrasttothegorgeousbrillianceoftheir red coats, bullion-encrusted,andwhitetrousers.CasuallyhelookedaboutforMonsieurSamatan,butSarnatanwasnotthere.Hewasrelieved;therewasnow nobusinessobligationtodetainhim.On a prev.,iousvoyagetoLeCap, a couple ofyearspast,Bushhadmet,atthehouseofLeroy Mangan. oneofthewhiteresidents,hisward,a dark-eyed, slendergirlwhoseappealingbeautyandgentlenesshadmadestrongimpressonhisimagination.Inthemonthsthatfollowed,histhoughtshadoftenrevert I'd tothosefewhoursthey had hadtogether.Vividlyhecouldrecall a ridetheyhadtakenalonga "1ountain roadtotheruinedplantationofMarchegolfromwhichtheyhadlooked downoverthetownandthebayandtheplainstothedIstantmountains.Outherememberedlessthebeautyoftheviewthanthelow voice ofVirginieGoutierasshehadsaterectUDonherhorseandtoldhiminliquidFrenchwordsthetragicstoryofthecountry'spast.Thlnovel,whichdealswithHaitianUfe.loneofthe motpowerfUle\'er w-ritten by .lIr. Josel)1tHusband, aeelebrated noellt. Hll1ti isJamaica'snextdoorneighbour. bid few per on here probablyknowthat after the Haitianre volted qaln ttheFrench,an,l drove themout,the ClOUDtrJ' was dIvidedin two.In the north a HaitianKingdomwas Bet UI',Hnd in theBOuth a 'Republic."TheCitadel"Is a movingRnd .-trumatlcWry whose seene islnidinthenorth;the10rldent. related took plnce inthereignofthesecondHaitian hu\t-rt"lgn."purl I.Ittnayberemu.rkedherethataftertbedethofHenrithewholeofHaitiwasreunitedlU.der a Republic. Readers of Planters' Punchwillbegratefulthatwe havesecurN1this plendldtaleof an Important'Vest Imlian;.Iaml forthepreent lmpre 810n.PUhaps,orDartmoor.AtalleventsitwouldbetheendoftheYankeebrigLucy,anditwouldterminatewith emb:ur:lssing abruptnessthecareerofJohnBush, captain andmerchant,andalsothelibertyofthetwelveAmericanswhoconstitutedhiscrew. Altogether consideJ ed,FrenchSantoDomingowasnotsosafeastheopen sea.Againhestudiedthehorizon.Thelong.blacklineoftheseastretchedunbroken.Withsuddenresolutionhewalkedtothecompanionwayandranlightlydownthesteepstairstohiscabin.Itwasalargeroomoccupyingtheentirestern.A heav yTurkeycarpetcoveredtheneckandthewoodworkwasof yellow mahogany.Damaskcurtainsweredrawnacrossthefoursternwindowsandintheirmiddlerosetheruddercase,carvedandgildedlikeaCorinthiancolumn. A velvetclothcoveredthetable,andbehindtheglassinalargecabinetontheportbulkheadwererowsof securedinracks.Itwas aluxuriouscabin.morelikethequartersoftheofficer of agreatmerchantm3.n;asurprisingcabinto be foundinabrigof160tons.F R:JM a lockerBushselected a p:lir ofwhiteKer seymere trousersandalightbluecOJ.t,doublebreasted,withbrassbuttons.Ataglassinsetinthepanelofthelockerheadjustedhisneckpieceandbrushedtheheavymassof yellowhairbackfromhisforehead. Unconsciously heregardedhimself,a well-built, thin-hipped,broad-shoulderedyoung m:ln ofperhapsfive-and-twenty,witha finehead,firm-set on aneckthatinclinedalittletoo m\lchtoheaviness; th:lt wastheonlyfault.Hiseyeswereblue. wide.alertandrestless;hissmooth-shavenfacegaveprominencetoamouthlargeandhumorous,andIntbecornersoftheeyesweretinywrinklesthatalso denoted humour.TERS'THEFIGHT OS THE RAMPART OFTHECITADEL BETWEESCAPTAINJOHN BUSH,THE AMERICAS.AND PIERRE.-ICHOLAS,THE ORTHERINGOFDESSALINESCHAPTERI11I111111111111111111111111111111111111111111111111111111111111111101111I11111111I1111I11I11111111111111111111111111111111111111111IIIteshouldsuddenly appear? Hehada.ction.Itwouldbe acaseof slipping Ing arunfor it.Atallevents he attendtohisbusinesswithprompam1tanhadurgedit.Thelean DOdesire toseea profitablebyBritishmen-of-war.What Hehadshruggedhisshoul h IlUIbUity to becomeconcerned: Bush's problem. Somerottinghulk,per-BvJOSEPHHUSBAND,authorof''High Hurdles.""AYearintheNavy,"Etc. We CITADEL IIXED BY HERBERTG.DELISSER.C.M.G.FortheYear1925-26111I111111111111111111111111111111111I11II11111111111111111111111m1111111111111I11I11111111111111 EFRO"I thehighbulwarkinthewaistofthebrigJohnBushwatchedtheboatofMonsieurSarna ran pull steadilytowardtheshore.Dayhadendedin a flare of golden flamebehindthetoweringblacksilhouette of Le MorneduCap,andwithtropicsuddennessthenighthadfallen, acleartransparentnigbtbrightwithstarshine.Underthedarkfoot 01t!w mountaina fewlightsinCapFrancaisI'shoue yellow anddistant.The wasblackandsmoothandtheairsostillthatfaintsoundsinthetown wert' JlllW and thenaudiblealthoughthebrigswungathercable a mile offshore.In tile unbroken silence ofthenightBush heard thecreakandclump oftheboat's oars growfaintanddistant;withhisforearms onthebulwarkandhissquareresting onhishandshewatcheditppear intheshadowsoftheshore.rward in the galleythecook begantosing a droningnegromelody. Hut quiteatvariancewiththepeace of thepleasanteveningwerethethoughtsthatweretroublingthebrainofJohnBushattheclose ofthisse Tenthdayof Decemberintheyear1814.Tobesurehewasatanchor,andbeneathhisfeetwasthecargowhichal weeks before hehadtaken 'attheice-encrustedwharfbe uncle'sPhlladelphiawarehouse er.yld. LeCapinFrenchHai Domingo. Likesoftyellow belilll,Ql,.:the mountainwerethe 1IU1fil1IIaUon. To-morrow, if allwnt eu.. e0dlie in closetothetownandfrom openedhaelleacU& rgehiscargo. fivehundredbarrelB flour.anequalnumberof battelaof ,herringsIIIcoarsesalt,lard.barreland h,lDIS. nd,ifallwenthe wouldloadwithhogsheadso[ cs ("thick,red Hlld of good nahisunclehat! specified),rawI'("coarse,paleredgrainsay")andaslllanybarrelsof e couldobtain.PerhapsheUPsome soapandifthereitbalancehe wouldtakerds. ell,"headded. acrossthedeck hor:zontowardaheadlandlifteda b1I.,. behinditwasa :'r.'.!\W:hft:enl1aCthat toldhimthewere noriding vrfiDg eyes[rom t themoon dIsclose him;herqretted thathehadnot anchoredcloser to the toOuttheretothenorth, lI08lewher be'ondthee 1mrizon, wasthefrigatehadeluded.Tha &8fOurdllYS agoandpereven now she mightbeat anchor intheharbouryal.Itwasmore thaalikely. Hesmiledhtofherswelling and theEnglishspurtofhunting tJlat snappedoutnhehadhoisted his colours.The'nher he cis.andnotashotfired;no die thepresenceofher IUns aslongheld.

PAGE 4

2 PLATTER S'PUCH1925-26Itwasshewhofilledhisthoughtsduringthepresentvoyage,andaseachmileof foamingwakeranfrombeneaththeLucy'ssternhefeltincreaseinhimthethrillofanewadventure,athrillhehadneverbeforeexperienced,thethrillof amanwhogoestomeetthewomanwhomheloves.Itwasforthisreasonhehaddressedsocarefullyandcomeashorethatevening,justifyingtohimselfhisimpatiencebytheexcusethathehopedagaintoseeMonsieurSamatan,whichwasneithertruenornecessary.Heglancedattheclock.ItwastooearlytopresenthimselfatthehouseofMademoiselleGoutier'sguardian.Hestrodebetweencrowdingtablestothefarsideoftheroom.Atone of thesmalltablessattwonegroes.TheyworethewhitelinenoftheFrenchplantersandexhibitedflashingjewelsonblackthickfingersandglitteringgold fobsandchainsattheirwaists."Ah,MonsieurBush!"Theelderofthetwohadspiedhimapproachingandsprangfromhisseattoextenda welcome."AndtheLucy,shehascarriedy.ouhere?Ah,itisindeedgoodtosee you,MonsieurIeCapitaine."MonsieurIeCapitaineshookhandssolemnlywithhisblackacquaintanceandasgravelyreceivedanintroductiontotheother.Thenhetippedbackinhischairandlittlewrinklesof asmilebegantotwitchthecornersofhismouth."FORTUNEseems tohavesmiledonyou,MonsieurEgalite.PerhapsitmeansthattheKingrecognizestheworthof a loyal subject."Hewavedasummonstothewaiter."AbottleofFrenchwineandglasses,"hecommanded."AndFortunehasnotdesertedyou,MonsieurBush,"Egaliteanswered."ThereismuchmoneytobehadbythosewhocarrydesiredmerchandisepasttheguardoftheEnglishships."Heraisedhisglass tf) Bushanddranktheclearyellowwine."TheKingwillmakethisfaircountryrichagain.Greatworksareinprogress.Butitwillbewealthfortheblackmen."HegaveBushaquickglancefromsmallred -eyes. "Therewillbenomorewhiterulehere;noholdingoflandsbythewhitemen."Bushnoddedgravely."Perhaps,MonsieurEgalite,"hesaid,"thismillenniumofwhichyouspeakwillmakedifficulttradingbusinessas1.wouldwishtoestablishhere;perhapsyouhaveinmindtohaveyourownshipsandyourownmerchants?" \ Thenegroshookhishead. "We mustdobusi ..;ress withyou,inyourway."Heraisedagreatblackhand,diamondsglitteringwithfleetingglintsinthecandlelight."Andwewillbefriends-butthatisall!""HisMajesty iil well?"BushchangEdthetopicabruptly."Ah,yes,andthegreatfortressofLa Fromtheharbouryoucanseeitonthemountaintop.Inalltheworldthereisnoplacemoresecurefromanenemy.Itisamonumenttothegenius of theKing."BUSH lifted hisglass."TotheKing,Christophe!"Thethreeglassesmetabovethetable."AndhowareMonsieurManganandhisward?"ThesmilestilllurkedinthecornersofBush'smouth,butnow asingularintensityseemedtopassacrosshiseyes, a fleetingexpression,athoughtmoreserioustohimthanhecaredto disclose.Thesuggestion,however,ofadeepersignificancetothesimplequestiondidnotaltogetherescapethenegroandhehesitated,asiffromembarrassment,fortheanswer."My goodfriend,MonsieurLoup"-henoddedtohiscompanionacrossthetable-"cantellyoumorerecentnewsofyourfriends.IhavemyselfnotseenMonsieurManganforseveralweeks,andMademoiselleVirginie,itismonthssince1haveseenhersogreatbeauty.""MonsieurManganis well."MonsieurLouptookuptheconversation."Heismuchoccupiedwiththegreat affairs theKinghasplacedonhisshoulders.ItissaidthatMademoiselleisbetrothedtoCaptainNicholas."TheglasshalfliftedinBush'shandclinkedsharplyonthetable;hismouthsetsuddenly, athinstraightlineabovethesquarejaw."AndwhomaybeCaptainNicholas?"heasked l)luntly. ThebroadchestofMonsieurLoupexpandedandasmiledisclosedhishugewhiteteethand:fleshy gums."CaptainNicholasisamanofmucheducation,MonsieurBush;for fiveyearsinParisheenjoy edthebestadvantagesofthatcentreofcivilization.HereheisanhonouredofficerattachedtothebodyguardoftheKing.Heisrich,fortheKinghasconferredonhimmuchland-"Hepaused,uncertainhowtocontinue,butsomethingmorewasstrainingathislips. "He is-"Bushspokeasifthewordslayharduponhistongue. "He isamanof colour? Ah,oui!""Letushaveanotherbottleofthismostcharmingwine,"Egalitehurriedlybrokein."ItissoseldomthatthedaringCaptainBushcomestous."Hebabbledalongconfusedly,theFrenchwordspouringfromhismouthlikewaterfroma glass. "Of courseyouwillunderstand,mydearCaptain.thatthisisperhapsnot.1wouldsay,definitelyarranged,butMonsieurManganenjoysmuchwealthandsecurityfromtheKing,andanalliancebetweenALEADINGHOSTESS MRS.IlORAC V. MYERS Noonehaseverseen Mrs.HoraceMyersconfused.Whethersheis ell'tertaining a couple ofguestsora couple ofhundredseemsallthesametoher.Shefrequentlydoes both.Sheisone of leadinghostesses,takinghersocial duqes verycalm ly,performingthemefficiently. doingherbesttomakeothershappyandfindinginthata gooddealofquiethappiness.Thelife of ahostessonalargescaleisofnecess;tyasomewhattryingone.Therearepeopletobemet,people tomaketo feelathome,andtheladyofthefamilyhastomeetthemandputthementirelyattheirease. Aman'ssocialgreetingisneverregardedasquitethe lJ:>me thingasthatofthemistressofthehousebythemajorityof people.Iftheladydoesnotmakeherappearance,orlooksnotcheerfulandsmiling,onefeelswithsomethingof asinkingoftheheartthatoneisnotquitewelcome:oneisnowinherspecialdomain,andsheitiswhomustbestowtheaccolade of welcome.ThisMrs. Myers does inthatplacid,genuinemannerofherswhichherfriends know sowellandstrangersinstinctivelyappreciate. Yo'..! feelthatshewill bedistressed if youdonotEnjoyyourselfatoneofherreunions.Herthoughtappearstobeforyouindividually,andthisisnosmalltaxupon a woman'sresourcesofthoughtfulnessandtactwhentheremightbeasmanyastwoorthreehundredpersonspresentatapartylastingnearlyallthe nig:.t. Mrs.MyershadthehonourofentertainingthePrinceofWalesatagardenpartygivenatWembleyinthesummerof1924 byherhusbandandherself.AtthatgardenpartynotonlyJamaicabuttheBritishWestIndieswererepresentedbyalargenumbel' ofWestIndians;butitwasdistinctivelyaJamaicafunction,presidedoverbyaJamaicaladywho,allJamaicansfeel,representedthebesttraditionsofourJamaicahospitalityandwhatisbestintheJamaicacharacter.ItissomethingforJamaicanstorememberandbeproud of. ThosewhoknowMrs. Myers wellareagreedthatoneworddescribesherfundamentalqualities:good ness.Thereisanaturalkindlinessofdisposition \Yhich ishersandwhichfindsconstantexpressioninherappreciationofothers.Inaworldofspiteandbitter'gossipsheisonewhowouldrather "ayunice thananunkindthing,whoprefersfo hear what is goodthanwhatisdistastefulaboutotherpeople.Thisisnotsotrivialaqualityinahostessasthoughtlesspersonsmaybeinclinedto believe.Forhowoftenhasonenothearditsaidthat"rfeel Ihadhardly huned mybackbefore 1wasbeingtorntoshreds."Nothingmorepainfulcanbeconceivedthansucha feeling,butyoudonothaveitwithsome persons.Sincerepeople donotteartheirfriendsandacquaintances.topiecesassoonastheirbacksareturned,andamongstthesincerethisleadinghostessofJamaicastands.thetwofamiliescouldnotbutbe fortunate.""IhavenevermetCaptainNicholas:'Bushinterrupted."Heisindeedtobecongratulated."Thesarcasminhisvoicepassedunnoticed."IhaveknownMademoiselleVirginiebutslightly."Herosefromhischair."MonsieurEgal1te,ithasbeenapleasuretohaveseenyou;wemustmeetagainbefore1 sail."Heheldouthishandto Loup."Andtoyouralsoownmygratitudeforthismostinterestinginformation. May Iaskyouasinglequestionbeforergo?WhatsortofmanisthisCaptainNicholas?"Loupdroppedhisgazebeforethesteadystareoftheblue eyesthatregardedhim."Ah.a fine fellowand,asIhavesaid,a scholar."Thenthesuggestionofmalevolenceagainhardenedhisfaceandheliftedhiseyes boldly."Agreatswordsmanandamanoftheworld;agaydog, .wouldYOU'notagree,MonsieurEgalite?"Bushbowed. "Goodnight.mes amis.I regret thatIcannotremainlongerwithyou."Andwithhiscuriousswingingstridehethreadedhiswaybetweenchairsandtablestothedoor.ForfiveminutesatleastBushstoodinanangleof awalltryingtobringtoorderthewildthoughts teat seethedinhisbrain.Itwasverystill,abreathlesstropicnight.Theworldseemedbrightasday,butyetilluminedbyalightthatdisclosedonlyitssadbeauty.Acrossthedirtroadwhitewalls,crumbledandscorched by flames,werehalfhiddenbyvinesandflowers.Throughthemassiveirongrilleofabrokengatewasacourtyard,andbeyondwereotherwalls,ruinedandblackenedbeneaththeirdressofcl:J.mberinggreen.Eventhewallinwhoseanglehestood showedthemarksof fireandviolence.SQitwaswiththewholetown,herecollected. Acity\ofruinedmagnificence,buriednowinluxurianttropicverdure;atownofflimsyhouses,offilthandbarbaricmagnificence, atownofblackcitizensruledby.ablackdespot.CHAPTERIIACROSSthestreetwastheruinedmansionwherebuta dozenyearsbeforehadlivedPau sister of NapoleonBonaparteandwifeofCaptam-GeneralLeClerc,whowiththirtythousandtroopshadcometorestoretheislandtoFrance.ButtheyellowfeverandtheblacksoldiersofthepatriotsVirtuallyannihilatedthepickedtroops of apoleon.andtheshatteredremnantofthearmybesiegedinLaCaphadfinallysurrenderedtotheEnglishfleetintheharbour.Allthetragic'historyoftheislandseemedpicturedinthesemoonlitruins:theearlydaysofSpanishruleintheyearsfollowingColumbus;theeraoftheFrench,thateraofvastplantationsandstonevillasamongthepalmtrees;andthentheuprisingsofthenegroesandthevainexpedition of theFrenchandEnglishtosubduetheliberatedslaves.Andintherecentyearsthesewallsrecallednamesnewtohistory,theslavewholedtherevolt;Dessalines,thenegroEmperorwhofollowedhim.andnowHenriChristophe,theKing.Inthepeace ofthenightherecalledthestorieshehadsooftenheardofthatterribleyearof 1793whentheslavesofSantoDomingo.risingagainsttheirmasters,hadmadedesolatethegreatplain.burnedthevillasoftheFrench.plantersandleftLeCap amassofblackenedruins.InthegeneralmassacreofthewhiteshadperishedVirginie'sfather,CharlesGoutier.andtheyoungEnglishbridewhomhehadbuttwoyearsbeforebroughthomewithhimfromherfather'sstationatJamaica.WhathadbeentheassociationbetweenGoutierandLeroy Manganthatcausedthelattertoassumecharge oftheinfantchild,Bushhadneverknown.Sparedforsomereasonbytheblacks, ManganhadformanyyearsfollOWingtherevoltheld asingularposition.Hewasrich;hewasamanofeducation,aFrenchman,somesaidarenegade-memberof a. noblefamily;andhewasafriendof Christophe,theKingHenri.ThatheandhiswifehadfaithfullyrearedthechUrlthroughhergirlhoodandprovidedforhereverythingthatMangan'sgreatwealthcouldobtainnl)onecould deny. Then,whenMadamehaddied,Virginiehadbeensentawayfortwoyears'studyinFrance.Andshehad been broughtbacktoconductthehousehold ofherbenefactor,tobeflnallybartered, abrideto amanofcolour, ahelpless pawn in t!r<' intrigueoftheblackempireofChristophe.Ashestoodinthedarkangleofthewallthefullhorrorofthesituationbeganfullytoappearto him.ThewordsofMonsieurLouphadcomewithanabruptnessthathadstunnedhim.Nowhewasthinkingmoreclearly.Hesawthetremendousdifficultiesandhesawtoothealmostcompletehelplessnessofthegirl.Hergravedarkeyesandhersensitiveredmouthseemedtosummonhim.A newemotion.overwhelminginitsintensity,sweptoverhim.Ashestrodedownthestreet,hecaughthereandtherethroughthebrokenwallsglimpsesoftheharbour,brilliantinthemoonlight.Theroadlednorthalongtheshore;then,turningsharplytotheleft,itclimbedinagentlegradeupwardtowardthelowfoothillsofLaMorne.Itsruttedsurfacewasuncleanwithscatteredrefusethatattimestainted th& airandmingleditsacrid smellswiththeodourofflowersalongthewayandthehumidnightsmellofthedensevegetation.Twogatepostsofwhitestone:lI.ankedtheentrancetothegroundsofLeroyMangan.Within,theenclosurewasblackwithshade.butthewhitetwistofthedrivedirectedhim.Thehouse,whichhecouldbarelysee betweensome giant mangoes,wasa two storybuildingandthe balconies whichsurroundeditweredrapedheavilywithvines.Theblackservantannouncedhimandalmost1m-(

PAGE 5

3lR. "lCTOR 31.Cl:'l'TElt JOHNBUSHwentashorethefollowingmorning.shortlyaftersunrise,butevenatthatearlyhourtheheatwasbeginningtoquiveroverthemarshessouthofthetownandtheairinthestreetswashotandlifeless.AsLukerowedhiminfromthebrighehadnoticedwithinterest the squarestructurethat cappen oneofthehighpeaksofthemountainrangethatlifteditsserratewallbeyondtheflatsweepoftheplain,perhapsthirtymilesaway.ItwasthegreatfortressoftheKingofwhichEgalitehadspoken, atremendousstrongholdperchedonthepeak of amountainthreethousandfeetabovethesurroundingvalleys.InthestrongmorninglightthetownofLeCapdiscloseditssqualoranddesolation.Everywhereruinedstonewalls,smokedandscorched,recalledtheone-timesplendouroftheFrenchcity.The Hotel delaRepubliquewasdesertedandthedarklow roomwascoolandodorousoflastnight'shospitality.Bushtookaseatbythedooranda fewminuteslaterMonsieurSamatancrossedthethreshold.Themerchantwasatall,well-builtmulattowithregularfeaturesandstraightblackhair.Hiseventeethofglitteringwhitenessemphasizedthefrequentsmilethathoveredbeneathhiswaxedmustaches,andasmallgoateegavetohisfinethinfaceanairofdistinction.MonsieurSamatanwasperhapsfiftyyearsold, amanofculture,ofimmensepowerinthecommunity,duetohiswealthandthehighregardwhichwaseverywhereaccordedhim.Heworeastripedblueandwhitesuitof finelinen,andashesatdownacrossthetablefromBushheremovedthehugestrawhatwhichalmostconcealedhisfacebeneath itr:. voluminousdroopingbrim.ForanhourtheydiscussedthenegotiationoftheLucy'scargoand,arrivingattermsmutuallyagreeable,sealeditwithpalerumandwater.FivedayslaterJohnBushagainfoundhimself the Hotel delaRepublique.Duringthosefive n"ys hehadlabouredrelentlessly,andnotonlywastheLucy'scargonowsafeintheamplewarehouseofMonsieurSamatanbutalreadyasmallpartofthecoffeehehadpurchasedwasbetweenthedecks. .InthesefivebusydaysBushhadnotagainseenVirginieGoutier;butthethoughtofherwasneverlongfromhismind.TimedidnothealthesmartofMonsieurMangan'sdiscourtesy.HehadrestrainedhimselfthateveningwhenManganhadshownhimtothedoor,withtherealizationthatonlyevilcould comefromviolenceandthatVirginie'shappinessandsafetywouldbejeopardizedbyanopenbreakbetweenhimselfandherguardian..Itwassevenintheeveningwhenheleftthe w'trehouse ofMonsieurSamatanwiththeintentionof goingimmediatelyonboardtheLucy.whichwas PTIrhorpn nomore thnnhalf mile from thelanding.Butasheturneddownthelongstraightstreet th'lt ran oarflllel withthewater-fronthesawblack r10urls nlled hil!hagainst thedistantmountainandtheflicker oflightningwarnedhimthatwithinper-(OontinuedonPage 14.) CHAPTERIII3withanarrowfacebeneathhislonggreyhair.Themouthwasthestrikingfeature,asmallmouthwitha loose,sensuouslowerlip.Hisblackclothesweresevereandunrelievedbyornamentexceptatthethroat,whereasingleemeraldinaheavyfoldsettinggleamedlikeaneyeagainstthewhitenessofhisfluted stock.JohnBushrecalledthesinisterface,butnow,inthelightofhisrecentinformation,itassumedanevilaspectthathehadnotpreviouslyattachedtoit.HerememberedMangan,notsograyorlean,asanaustere,coldmanoffaultlessformalcourtesy.IntheawkwardpauseVirginiefeltasituationdevp.loping;withanapparentlyunconsciousmovementsheputherhandonMangan'sshoulder."Maywenotinvitethecaptaintostaywithusalittlelonger?Hehadhopedtofind you. Iamsurehemusthaveinterestingnews ofthewarandofAmericJ."Mangantookasteptotheside of thedoorway."Iregret,"hesaid,"thatthehourissolate.CaptainBushrealizesthatconditionsatLeCapare far fromdesirableforthosewhowalkitsstreetsaftersunset.I amsurehewillfindhisshipamoredesirableplaceinwhichtospendhisevenings."A flare ofheatburnedinBush'scheeks;hefelthisnecktightenandhishandstremblewith angei'. Fora flashingsecondhisonedesil-ewastostriketheexpressionlessfacethatcalmlyregardedhim.Butallhedidwasto bowandthentosendfromhissteadyblue eyes onepenetratinglook ida theeyes Ot!\langan.If hehadexpectedthemtodropbeforethatlook ofdisgustandhatehewasmistaken.TheimpertUlhable facewasmasklike.Forthesakeofthegirlwhosedelicatehandrestedonthis cre3.ture's armheresistedhisimpulse. hesaidslowly,withthequaint.drawlofhispeople,"Ishallaccepttheadviceof:\IonsieurMangan.Itisperhapsbestthatso pleasantaneveningshouldnotlasttoolong."Asheturnedtocrosstheroom their eyesforapassingmomentmet,andinthatquickglanceBushreadherappealofentreatyandfear.Itwasthel
PAGE 6

4PLATERS'PUCH1925-26 r'fhe Fair Daughters ofIAnd nature swears, the lovely dears Hernoblest work she classes, 0;Her. prentice hand shetriedonman,An'then she made the 1_O-Burm. lIltSS II1IS nURI{E THEBeautyPagesof "Planters'Punch" con tain this year picturesofasmall groupofJamaica belles, a few selected from the manywll 0alsomightwell have been chosen as1'epresentativesofour island's grace andbeauty. 1l'1I ere there aretentheremighteasily have been f1nnty or forty>' namesandfaces throng to themind as one 1'apidly reviews the fieldofbeauty, with a pangof1'egret til atcompellin.q exigencies ofspace made itimperative to exclude,thisyear,S(lmany lclio havesoexcellent a right tobe the finestandfai1'est daughtersofJa 1IIatca. ThepeopleofJamaica have often been repre sented as peasants merely, the women shown pic torially havemostlybeenwomenofthe working classes. Sturdydames tmdging itdown to a mar ket tOWIl,balancing great loadsofprovisionson their heads; laughing damsels washing clothesbythe riverside>' giggling SM'vant girls saying eternal ly that "theheatmentis greatment"-thesehave been shown againandagain,andthe outsider who hilS never been to Jamaicamaywellbe excused for belie'ring thatthe colony hasnoother women tf) show, can boastofno daughterstocomparewiththoseof north ern countries.Thepictorial repre sentationofJamaica. lifeinthe past has been lrrrqelyin th e directionofburlesque.Theoth er sideof til e picture has h artily ever been seen. "Planters'Punch"inthefuturewill emphasiseit.Olher picl11res offrrirladies will appear fromtimetotimein "Planters' Punch."There willbe oih erBeautyPages.Butwemayclaim to have begun well,andwe are proudofour selection."YOUcouldn'tfind aprettierorbetterdressedcol-lectionofgirlsanywhere,"saidanAmericanvisitortoJamaicaafterwitnessingabigdanceattheLiguaneaClub.Othershave said thesamethingagainandagainwhentheyhaveseentheJamaicabellesassembleinalltheirgloryatsomeballattheMyrtleBankHotelorothersocialcentreofthecolony's life.Numerousand !,!vidently sincerearethecomplimentsthusshowereduponthewomen ofJamaica;theirtasteindressingisextolled;theirgraceofformandattractivenessoffeaturewintheadmiration or thevisitorfromotherlands.YetJamaicahasnevertakenherselfseriously ror thebeautyofherwomenorpridedherselfupontheirtasteinpersonaladornment.Shehasbeenmodestwhere sbe mighthavebeenpardonablyvain.AmongsttheCaribbeancountries Costa Ricaitiswhichisspokenofastheland or fairwomen. Constantly'onehearsoftheprettygirls or thatlittlerepublic,andthepalmwhichCostaRicahasclaim ed foritself has beenaccorded toitwithoutamurmur.AndCubapreensitselfuponthedressingofitssenorasandsenoritas;Cubawithitswealth,itslatest rash ionsfromParis,itsprofusionofjewels,itsstudiedendeavourtobethecentreofpleasure,gaietyandbeautyamongtheCaribbeancountries.HowcouldJamaicacompetewithCostaRica,howwithCuba?Thathasbeentheunspokenquestion or Jamaicans.ButmenfromtheNorth,AmericansandEnglish,takequiteanotherview.TheyseethebeautyoftheJamaicawomen;theyperceivetheir grace andstyle.Theysaythatthesegirls or acountryneverrenownedforwealthdressexquisitely.Andsome ofthemhavebeento Costa RicaandhavevisitedCuba'sworld-renownedcapital.THEJamaicagirl,orthegirllongresidentinJamaica,hasamanner all herown.Sheisatriflelanguorous,herlanguorbeingborn or thesunandofthenecessityfor slowandevenmovement;sheseemsratherto be fioatingthanenergeticallypushingherwaythrough lire; sheisbrightbutnotstrenuous;activetoo,whenthereisreasonforactivity,butneverperfervid.Fromtheearliestdaysitwassaid of herthatheronepassionwasdancing,andtothismomentitremainstruethatshewillsometimesdancefromsundowntosunrise,andwillbereadyatsundownto begindancingagain.Butthetimeshavechangedandshehaschangedwiththem.Nolongerdoesshelollinbedalldaytorestandrecuperatefortherealbusinessofthe'night,acontinuousmovingtoseductivemusic.Lifeinthetwentiethcentury,eveninJamaica,willnotpermitofthat.A fewtheremaybewhocan afford toletthehourswingtheirwayunheeded;themostofthemmustworkatsomeoccupation.Andthewonderofitisthattheywilldancenightafternight,thoughnottillsunrise,andwakebetimesthenextmorningtoundertaketheirdailytasks.Thustheymaywell evoke admiration,andnotmerelyfortheirlooks.Thereisthesterling stuff ofsoundwomanhoodintheJamaicamaiden.THE"bestpeople"arenotnecessarilytherichest;theymaybelongtofamiliesthatarepoororofmoderatemeans,aswellaswealthy.Butbytheirmannersandappearanceyoushallknowthem;bytheoutwardbutunconsciousexpression or breedingaretheyto be recognized.SomeofthegirlsofJamaica,thegirls"insociety,"maybethedaughtersofmenwithincomes or thousandsofpoundsayear.Othersmaybethedaughtersofmenwithsalariescomputedonlybyhundreds.Butnolinecanbedrawnbetweenthose better-off and'thosenotso well-off; thefootrule or wealthisnotappliedhere:thatwouldberidiculous.Inthisrespectatleastthereisatruedemocracy;butitisaveryhighlevel ofdemocracy.OrperhapsItwouldbemorecorrecttosaythatinthisconnectionthereisarightconceptionofaristocracy,aconceptionwhichjudgesbystand:udsunconnectedwithmeremoney,butinsistenton refinementandolipersonalworth.Wealthyorofbutmoderatemeans,thegentlerolkofJamaicahave a feeling or personalworth, :md itisamongthegirlsthatwe seeitsfinestexpression.Insomeitis,perhaps,alittletoodominant.Thereisasuggestionofarroganceinthese;butofthemajoritythisisnottrue.Theremaybevanityinall.Butwhowouldblameabeautyforbeingsomewhatvain? MISS DOROTHYJOYCEMORRISON MISSVIVIE:'i:SEWEST1\IORLA:SD1\1188 KATHLEENDOUGALL

PAGE 7

1925-26PLANTER S'PUNCH5Jamaica: Characteristics IMISSSYDNEYRANBYSMITH lInssWINIFREDTALBOT-lIIAISOh fairest of Creation I last and best Of allGod'i worksl Creatwe inwhomexceU'dWhatever un to "ht or thoughtbeform'dHoly,divine, good. amiable,orIweet.-ll1ilton.gaily.Andwhynot,sinceyouthquicklypassesandtheresponsibilitiesofmatronhoodwillcomeapace?ADMIRATION,courtship.loveallthesethingsarethebirthrightandtheheritageofthedaughters of Eve,andthegirlsofJamaicahavetheirfullshareofthem.TheyareasfreeastheirsistersInEnglandorAmerica;somesaytheyaremorefree.Herethereisnot,asinneighbouringCubaorPanama,anystanding of themaidenatherwindowtolistentotheserenadeof a possible lover,ortoexchangeawordortwowithhimwhile somewatchfulparenthoversinthebackground.visible,likeaspectreata feast.Hereisnopromenadingin I1ublic tothemusicof aband,thegirlsalltogether,themenbythemselves,eachsexmovingroundandroundinanoppositedirection,alwaysfacingoneanotherbutexchangingnevera word.Hereyoungmenandwomenmeetandminglefreely, gobathingatBournemouthBath-delightfulplace ofrecreation-anddancingat My-rtle BankHoteloratoneoftheclubs formenandwomen;theygotogethertoseethepictureshows,motorlongdistancestocountryplaces,andoftenandoftenwithnevera chaperon."Thetimeforthatispast:'saidaladycausticallynotlongago,anditwouldseemso.Therearestillparentswhothinkthatwheretteirdaughtersaretherealsoshouldtheybe,butthesearesteadilybecominga speciesextinct.Theybelongtotheranks of thosewho,notsolongago,shudderedatthethoughtthattheirdaughtersmightgooutto work.Butthedaughtershavegoneouttowork;theylillpositionsbecomingtothemandwhichtheyhavedigniliedbytheircompetenceandrelinement.Andgirlswhocanmeetmendailyandtakenoharm,whocanholdtheirownwiththesternersexandwintheirrespect. who losenothingthatisfinelyandsweetlyfemininebyembarking,howevertemporarily,on acareerofindependenceandusefulnesssuchgirlsneednothaveguardianangelsattheirsideeveryhourofthetimetheygivetopleasure:theyalreadyhavesuchguardianangelswithinthem.THEItaliansofthefifteenthcentury,theItalians of theRenaissance,heldthatbeautywasone of thesupremevirtues,perhapsthesupremevirtue.Thatwasapurelypaganbelief.Butitexpressedafeelingpermanentintheheartsofallmen;beautywillwinitswaywhentheappealofotherqualities,moralormental,will be slowanddiflicult.Andbeautyhasalwayssoughttoadornitselfappropriately,andmen have willinglytoiled sothattheirwomen folkmaybe clothed Inthesplendoursoftherainbowanddrawhomagefromdazzled eyes.ButJamaicaisacountryonwhichMammonhasnotsmiledindulgently;soifherdaughtersdresssoastoearnthelaudation of manywhoteethem,thatisnotbecausetheyspendlavishlyon clothesbutbecause of theirtasteandtheskillofthelocaldressmakers.Because.also,andprincipally,theythemselvescarryoffso finelywhattheywear.SoletCubaboast of ItsjewelledsenoritasandCostaRicaandothercountriesplumethemselvesupontheirprettywomen.Jamaicamayrestcontent.Prideof place sheyieldstonone,forshetoomaysay,withagestureof ineffablesatisfaction,asshepointstohergirls of graceandbeauty."thesearemydaughters."MONEY. however,andothercircumstancesplaytheirpartinJamaicaSociety.ThisIsreallydividedintomanysocieties,buttherearenounpassablebarriersbetweenthese;thebarriersindeedareImpalpableandeasilycrossed.Withbutordinarymeans youcannothaveahostoffriends.You cann'ot affordtohaveahost of friends.Youmustconiineyourselftoafairlylimitedcircle,havingbuta bOWingacquaintanceshipwithothersof muchthesamesocialthoughofdifferent iinancial status.Thustherecomesintoexistencewhatisknownassocialsets.oreven cliques,thoughthewordcliqueisharshandunjustwhenusedinthisconnection.A cliquesuggestsahardandexclusivenumberofmenandwomen,arigidandoffensive socialsectarianism.ThatisnotverycommoninJamaica,itisnottherule;thereisenoughgoodhumourandgood sense totemperthesnobbishnesswhichisinevitablewhereclassdistinctionshavebeen longestablishedandexist.Inacountrywherea fewhundredpersonsareabsolutelythesocial roofandcrownofthings,thosenotofthisenchantedcirclesimply donotcount-intheopinionofthosewhoarewithinthecircle.Butinasmallcountry,wherethefortunesofmenarecontinuallychanging,andwhereyoumustmeetoneanotherinsome relationshipatsometime.suchexclusivenessisoutofthequestion.Smallsocieties.InsteadofonebigSociety,isanecessitycreatedbycircumstances.AllthesesmallsocietiesmayberegardedasformingtheJamaicaSociety.andwhentheyoungerfemalerepresentativesofthemgathertogetheratsomegreat social functiontheymakea spectacle uponwhichonemay lookwithgenuinepleasure,a spectacle ofyouthandgraceandbrightness,ofalluringwitcheryandthejoyoflife.THEREisa softnessabouttheappearanceofthegirloftheJamaicabetterclasseswhichperhapswouldnotbetheredidshepassmorestrenuousdaysinphysical exercises.Itisthe'softnessofthebalmyairsandgoldenwarmthoftheWestIndianspring. It isnotthatsheneglectshealthgivingpastimes:thereisalwaystennis.Inthecountrytherearehorseriding,swimmingattheseaside,otherrecreations.ButcomparethelongstrideoftheEnglishgirl,orthequickdecisivestepoftheAmericangirl,withtheslowsinuousmovementoftheJamaicagirl,andthedifferenceleapstothemind.Itisa differ E'nce engenderedbyclimate,whichinthelongrunlargelydeterminescharacteristics.InformerdaystheJamaicagirlspokewitha de cideddrawl,heraccentwasbroad,flat,unpleasanttotheear.Amongstthebettereducatedclassesitisnotso to-day. Ofcourse.thereisaJamaicaaccent.Jamaicansthemselvesmaynotnoticeit.butstrangersdo.EducationinEnglandorCanada,however,orfrequentvisitsabroad.andassociationwiththosefromothercountries.havedonemuchtomodifythisaccent;whatIsunpleasantInithasbeeneliminated;itis, onthewhole. freefromstrained affections, itIsnatural.Andthevoices ofthesegirlsareusuallysoft,theirlaughterspontaneousandeasilyprovoked.Thereisinthem,too.aneagernessto enjoy life. a upofexuberantspirits.a vividcontentmentwiththesatisfactionsofthehour.ThedesireoftheJamaicamaidenistoliveeverymomentofherlife MISS DORIS MADELINEGUNTERMISSJOYWENTWORTH-MALABREMISSCHARLOTTE LOISROBINSON

PAGE 8

6PLATERS'PUNCH1925-26THE CORONATIOX BUILDINGS,KI_-a A.DTOWER STREETS AKU G TO. BACK STREETIN PROCESSOF RECONSTRUCTION ittoSir WlIliam Beeston.Thereareto-day a BarryStreetandaBeestonStreetinKingstonwhichperpetuatethenamesbutnotthememories of'.hose ;,wo oldJamaicaworthies.Kingstonwasinwood and grass,withbutahandfulofhousessomewheredownhytheseashore,thattimePortRoyalwasa flourishingCaribbeancity,withopulentinhabitantswhoseungodliness,wickedness,wastefulnessandthievishnesshaveeversincemadethemtheenvyandadmiration of allsucceedinggenerationsofJamaicans.Thehistoricaldescriptions of oldPortRoyal(strIct ly inaccurate)pictureitasfull of stone-builthousesandfinechurches,butifwecould seeitnowas it wasweshouldformaverydifferentviewofitsappearance.However,wearenottospeak ofthedead.PortRoyaldiedofearthquakeandfirein1692, apartofthelanddisappearedunderthewaves, alargenumberofpersonsperished.Andnow,ingreatfearandtrembling,thesurvivorsturnedtheirthoughtstoprayerandtoKingston;theyenactedthattheanniversaryoftheEarthquakeshouldbeobservedwithsolemnserviceseverafter,andthatKingstonshouldbeconvertedintoa city.Aftera while,whenterrorhadsubsided,theyforgottopray,and if a firehadnotreducedtheremainsofPortRoyaltoashesin1703,mostoftheoldPortRoyalistswouldhavecontinuedto livethere ami thegrowth of Kingstonwould in consequencehavebeenslowerthanitactuallywasintheeighteenthcentury.ButfirewasagainthefriendofKingston.ItfinishedPortRoyalasacityfor good.ButevenwhenPortRoyalwasflnallydesertedthecolony didnotmakeKingstonitscapital.Oh no!Itwasnotgoodenoughorsomething;itrepresentedmeretrade,oritwasunhealthy-therewasenoughunreasonintheminds of thepeopletoform a-' strongprejudiceagainsttheplace.Itwastotheold Spanishcitythattheyturnedtheireyes;Spanish Town be came capitalandme tropolis,andtheretheyerectedpublicbuildingswhichhavestoodforthproud-lyasmasterpiecesofugliness,andtheretheGovernorresid-edandtheParliamentmet,andtheCourtssat,andthegentlemengotdrunk.But,togivethemtheirdue,thegentlemen got drunkevery-here.They never carriedtheirprejudicessofarastokeepsoberinKingston.Butmanyofthemrefusedtolive HARBOl:R STREET,KI.-G TON, LOOKl.-G EAST, 100 YEA.RS AGOKingstonwasnothinginthosedays.Itwasonlytheproperty of one ColonelSamuelBarry,who pro bablyhadgotitasagrant,andwhoafterwardssold a peopleandGovernmentthatregardedplantingandcattlebreedingasanavocationandpiracyastherealbusinessofameritoriouslife.Kingstonhassufferedfromthejealousyanddisllkeofeveryotherpart of thecolony.ItwasoriginallymarkedoutbyProvidencetobethechieftownandcapitaloftheisland:itssituation,thesizeoftheplainonwhichitstands,showthatconclusively.ButProvidenceproposesandManopposes-aslongashecan.TheoriginalSpanishowners of theislandpreferredSeville,inwhatisnowtheparishofSt.Ann,onthenorthsideoftheisland.Something{rovethemfromSeville:somesayitwasaplagueofants,whichispossible;otherscontendthatthesitewasunhealthy,whichisquiteprobable.Anyway,theyremoved,buttheydidnotthinkofKingston.ItwastoinlandSpanishTownthattheymigrated,buildingonthegroundnow occupiedbythepresentSpanishTowntheonesubstantialcitytheyeverconstructedinJamaica:andnotvery subst8Jltial itwas,evenatthat.TheycalledtheplaceSt:Jagode Is Vega,St.JamesofthePlain,St.JamesbeingthepatronsaintofSpainwhooftenwouldappear,lanceInhandandonhorseback,tosuccourtheSpaniardswhentheyweresoredistressedinbattle.ButtheEnglishlandedin1655andmarchedonSpanishTown, .\nd St.Jamesfailedtoputinamuch-requiredap pearance. Nolegendrelatesthatonthatoccasionhemadetheslightest effort tomanifesthimself:perhapshehadapooropinionofJamaicaandfelt tUM hisspecialprotegeswouldbeverymuchbetter off outof it. SotheSpaniardsweredispossesedandtheEnglishsettleddowntomakewhattheycould ofthecountry.And fortheirchiefcitytheychosePortBoyal,thatbeingamuchmoreconvenientplace for "T HEgreatestblessingthateverhappenedtoKingston,"saidMr. GeorgeBernardShaw,"wastheearthquake."Itwasevidentthatthegreathumouristexpectedhimtowhomthesewordswereaddressedtoexclaim,startled,"Oh, Mr.Shaw!"But,instead,theothermanreplied:"Quitetrue.Weallthinkso.Andnowwearehopingfor another."PerhapsitwasMr.Shawwhowassurprisedatthisentirelyunexpectedremark,whichwas,however,quiteuntrue,fortheprospectofanothergreatearthquakeandfirelikethatofJanuary,1907,woulddrivethepeopleofKingstonhalffrantic.YetitisindisputablethatitisbyitscatastrophiesthatKingston has mainlybenefitedinthepast;ittakes an earthquakeora fire,orlongyears of violentagitation,tobringaboutanychangeinthecity'sappearance,forwheneverKingstonhasstartedrebuildingandimprovingapartofitselfithasdonesowiththefeelingthatwhatisnowaccomplishedwillenduretotheendoftime.Anythinglikeacompletefuturealterationinformandstyleisnotimagined;whatiswillbegoodenough forall c0ing generationsandiscertainlygood encmgh fortheexistinggeneration;sowhythinktherecanbeanythingdifferent?ThustheKingstonthatexistedbeforeJanuary1907wouldperhapshavecontinueddowntothepresentdayhadtherenotcome, onthe14thofthatmonth,aroarlikethatof athousandchariotsdrivenfullspeed along arockyroad,aroarimmediatelyfollowedbysuchaviolentconvulsion oftheearththatbuildingsswayedlikeahouseofcardsshakenbythewind,thensuddenlycollapsed,thedustoftheirruinrisingtoformanopaquecanopyoverthetownuntilitwasrivenbytheshafts of flamessoaringupwardsanduntilthewholelowerseetionofKingstonwasenvelopedinfire.Neverhadsuchwholesaledestructionbeenknownbefore. And becauseofthisearthquakeandfireitcameforciblytothemindsoftheinhabitantsthattheymustbuildbetterinthefuture if theywouldescapeanotherawfullossofpropertyandlife.AndsothenewKingstonbegantoariseandcontinuestogrow, aKingstonwhich,insomeofitsprincipalthoroughfares,isentirely different fromthecityofJanuary13th,1907.As it hasbeensincetheYearoftheEarthquake(whichconstitutesanewpointofdepartureinlocal history),soitwasinthedecadespriortothatyear.Kingston'shistoryiswritteninfire.

PAGE 9

1925-26PLATERS'PUNCH I'ART OFTHE FROSTAGE OF THEBA.-"iK(BARCLAY'S RANK)bourStreetsstoodtheoldTownHallandPost Office, andnexttothattheold Courthouse. Youwillobservethatinthepicturetheseplaceswearashabbyappearance.Theywereshabby-lookingevenin1825.Theyscrupulouslymaintainedthatappearanceeverafter.Theywerepatchedand re pairedandpaintedatintervals,butthedustandsunofthecityhadtheir way withthem,andtheyalwaysdidlookrusty.Theybeganbylookingrusty,andourlastimpressionofthemwasofbuildingsinacontentedconditionofdecay.Theywouldprobablyhavebeenstandingthereto-day,stillutilisedaspublicandprivatestructuresforthetransactionofbusiness,butfortheearthquake.NowonderthatMr.BernardShawsawthehandoftheLordinthatcalamity.WewilllookagainatthepictureofKingStreet a'S itwasahundredyearsago.HowentirelydifferentitisfromtheKingStreetofourowntimes!Youwillnoticethatinone of thepicturesdepictingthisthoroughfarethereisawaterpumpatthecorner.ForgenerationsKingstondrewitswatersupplyfromwells,andifpeoplediedoftyphoidtheywereatleasthappyinnotknowingtheoriginoftheirailment.Therewerepumpsallaboutthetown,andintheyardstherewerewells.ThesewellswerefedbytheundergroundstreamsofKingston,andalsobyrain;theyweresupposedtobeprovidedwithhugewooden coversandtobekeptcoveredwhenwaterwasnotbeingdrawn.Butthatwould,ofcourse,notpreventsomeenterprisingurchinfromsurreptitiouslythrowingintothem,whenopportunityoffered, a fewmangoseeds, somebananapeel,andevenadeadcatortwo;consequentlythewaterwasnotalwaysofthepurest.Butourancestorstookthesethingsphilosophically,andperhapswerehappierthanwe.Whentheycaughttheerringchildtheyhalfmurderedhim.Moreoftenthannottheydidnotcatchhim,andhalfmurderedsomesuspectedbutentirelyinnocentslavegirlinstead.LookagainatthepicturesofoldKingston, of thiscityahundredyearsago.Pigsandgoatsanddogsandchickenswanderedaboutattheirsweetwillandpleasure,huntingfor foodandmakingofthemselvesthechiefscavangers;light,opencarriagesdashedupanddownthestreets,gentlemenrodetoandfromtheirwork,andwouldstandatthestreetcornersandonthesidewalksdiscussingbusiness,clothedinhighhatsandlongcoatswhichwoulddrivemaduswhohavebecomeaccustomedtopalmbeachandothersuch-likesuitings.YouwillalsohavenoticedthatinthepictureshowingtheTownHallandtheCourthouseinHarbourStreetthereisalargecrowdshown.ThecrowdisparticularlythickinthatpartofthestreetwhichtheCourthouse faces.Thereasonissimple:importantcasesarebeingtriedto-day; nice,interestingcasesofarson,burglaryandmurder,preferablymurder.Thatsort of thingalwaysbroughtouttheKingstoncrowd.Inthesedayswestilltakeahealthyinterestinthecrimesandmisfortunesofourfellowmen,wishinggoodlucktotheguiltyon the principlethatafellOWfeelingmakes uB wondrouskind.ButwedonotcongregateinsuchlargenumbersnowwhensomeoneisAGOdawn.AndKingStreet,fromTowerStreetrightup totheCentralPark,retainedmostofitsbuildingsandallofitsarchitecturalpeculiaritiesuntil1907. Some new houseswerebuiltinKingStreetintheinterval,buttheywereonthesameplanastheold. OnJanuary14th, 1907,thegreaterpartofKingStreetwasasithadbeeninJanuary1807.OnJanuary15th, 1907,therewasnotasinglestructureleftintact.Ourfirstillustrationshows,onthelefthandlookingeastward,fourconspicuousstructures.Onthesidewalksof thesearestandinggroupsof people.ThestreetisHarbourStreet,andthereisnoKingstanianofforty yeus ofagewhodoesnotrememberthese J.:-.Jildings distinctly.Thefirstwasusedforbusinessandlivingpurposes,the next containedtheoffices of Messrs.HarveyandBourke,thewellknownsclicitors.DividingthesefromtheothertwoedificeswasDukeStreet.AtthecornerofDukeandHarKC\G STREET, LOOKISG NORTH,100 YEAR inKingston;theyhelditunworthyoftheresi.vere livinginthebuildingsinHarbourStreetwhichdencesofgentlemen;theyonlytransactedbusiness f'ln fromKingtoChurchStreets,andevenbefore there.Itwas,intheirview, a placechieflyofshopsthentherehadbeen a definiteintroductionof a new and folkoftheshopkeepingclass;ontheirownpro:ype of all-businessbuilding.Thisgoodworkwaspertiesinthecountrywouldmostofthemreside,hastenedbythefire of 1882.ButevenafterthatandinSpanishTownwouldtheystaywhenpolitics fireHarbourStreet,fromChurchStreettoEastorotherhighandmightymattersbroughtthem3treet,remainedwhatithadbeensincethecentury'sintotown. Andthusitcontinuedforalongwhile,tothemanifestinconvenience of everyone.Kingstonwasgrowingandgrowing;clearlyitshouldbetheseatofGovernmentasitwasalreadythecentreoftrade.Butno,andagainno!Thussaidthosewhohadadominantvoiceinsuchmatters.Andthus,for a longtimedidunreasontriumphovercom monsense.Inthemeantimefirewasdoingitsbeneficent workinKingston.There are severelawsagainstarson,andwhen,inthesedays,aChinaman'sshop ia burntdown(anaccidentwhichsometimesoccurs)the Celestialsareregardedwithamostunfavourableeyeandabittercryisraisedagainstthem.Yetper haps theCelestialknowswhatfirehasdoneintheway of Kingston'simprovement,andwhoistosaythatthe Celestial,ifany,whoburnsdownhisshopisnot Wholly moved by adesiretobringaboutarchitecturalandotherimprovementsinthiscityofhis adoption?Weshouldbe slowbeforecomingtoadverse conclusions,especiallywhenwerememberwhatfireshavedoneforKingstoninthepast.Informerdayseverynowandthentherewasa conflagration,andsome oftheflimsystructuresperished in it, to bereplacedbysomewhatbetterones. In1780andagainin1782thishappened;aboutfifty yearsafterthelatteryear,theeastsectionof HarbourStreetandtheupperportions of thetown runningnorthbywestwereburntdown.Butthislast fire,asitsweptalongHarbourStreet,seemedto have pausedataboutHanoverStreet,andthento have pursueditswaydiagonallyupwards.CertainitisthatthebuildingswhichhadbeenstandinginHarbour andEastStreetsin1825andbeforeweresUllstandingwhentheearthquakeof 1907cametodo its partinthereconstructionofthecity.Inotherwords, buildingswhichhadservedforpublicandprivate purposesinKingstonatthebeginning of thenineteenthcenturywerefulfillingthesamefunctionsin1907,andaglanceatthepictureofHarbourStreetin1825will givethereadersomeideaof howthatthoroughfarelookedinthefirsttwoweeksofJanuary,1907.Lookatthepictureof KingStreetahundredyearsago. Youaresupposed to bestandinginthemiddleofKingStreetandlookingnorth-inthedirectionoftheParishChurch. Toyourrightandleftarebuildingswithopenverandahsonthegroundfloorandrailedverandahsontheupperfloor.Thelowerstoryofthesebuildingswereofbrick,theupperonesofwood;inthelowerstoriesbusinesswascarriedon,intheupperstoriesthemerchantsormanagerslived.Theroofsoftheseplaceswereshingled;theverandahsroundthemwerefromeight to tenfeetwide;theseverandahsweresupportedbywooden plllars,andonthem,whenthesunwentdown,thefamilywouldsitandtakethebreezes oftheevening,andcommentonthesuccessful cbeat'ngs of theday.Butnotalltheseupperstorieswere used forliVingpurposes.Theyhadbeenbuiltforthat,butprosperousmercbantsutilisedthemasstorehousesandretiredtotheirpens,orcountryresidences,amUeortwooutofKingston,aftertheday'sworkwasdone. About 1862, for example,notmanypeople

PAGE 10

PLANTER5'PUNCH1925-26 BUILDIXGOJ,' THE ROYAL)JAILSTEAM PACliET CO)IPAXY. PORTROYALSTREETthereareBuildingAuthoritiesnow,andnoonecandojustwhathepleases,asinthegoodolddays.Kingstonnolongerbuildsitsbusinesshouses,itsbanks,itsofficeswithwood,orevenwithbrick.Ferro-concreteisthematerialnowemployed;concretereinforcedwithiron;anearthquake-proofmaterial.TheKingStreetof to-day,forexample,isentirelydifferentfromthethoroughfareof ahundredoreventwentyyearsago.FromtheseatoCentralParkthereisnotaresidenceinit,andeverybuildingis of moderntype.Partsoftheoldstreetwerewidenedbyagreatandbeauty-lovingGovernorofJamaica,SirSydney(nowLord)Olivier,and,beforethetwoblocksofPublicOffices,whichhedecided should replacethescattereddilapidatededificesdestroyedbyearthquakeandfire,opengardens,greenandyellow,arenowlaidoutandtherearewalksbetween.Incentralportionsofthestreets,insteadoftheforagingpigthereisthedominatingpoliceman.Withdirectingarmhehaltsorguidesthetrafficasitflows:motorcars,cabs,cartsandthunderingtrucksobeyhisslightestgesture.Heisproudofhisposition,beinguniformedandactingwithauthority.HesymbolisesthenewKingston,forthetrafficpolicemanofKingstonishimselfaninnovation.Informerdaysourhotelswereonlylargelodg ing houses.TherewasabigoneinKingStreet,andtwosimilaronesinEastStreet,andthefarewasheavyandplentifulandtheservicebad,andthemosquitoesfiendish. Nowtherearehotelswhichneedfearcomparisonwithnoneinanypart of thetropics,andthebetterlodging-housesareexcellentintheirappointmentsandtheirfood.Kingstonisnowbeingpaved,everystreet,everylane,withasphalt, and..., completelysewered;soonItsdustwillbelargelyathingofthepastanditsthoroughfareswillbe apleasuretopedestrianandmotoristalike.Asfortheresidencesofthebetter-offclasses,thosewhohaveseenthemknowsomethingabouttheirspaciousair comfort,theirwell-rolledlawns,theirfinegardensofgreenandscarlet,gravelledwalks,and airy, healthyrooms.AnewKingstoniscomingintobeing.Itiscomingintobeingrapidly. Morechanges l1'lve takenplaceInthelasttwentyyearsthanintheprevioustwohundred.Thisistheage of the:ntomoblle,thecable,thetelephone,and of ahundredothermechanicalcontrivancesto eX{ledite workandfacilitateendeavour.TheyareallhavingaD effect uponourminds.Itrequiredanearthquaketoshakethecitydownandtoshakeintoactivitythepeople ofit,buttheinfluence of thatshockstillendures.Ittookagreatfiretosweepawayalot of therubbishthatwascumberingtheground,but firealsosuppliedKingston,metaphoricallyspeaking,withanenergywhichhasnotdieddown.Lifenowistunedto asharperandahigherkey;even customs havechangedforthebetter.Onecustomonlyhasnotchanged.stlndotheKlngstonlansofto-daymaintaintheoldtraditionsofthecity'shospitality,thathospitalitysohighlypraisedbyWilliamHickey,Michael l:>cott, anda dozenotherwriters."METROPOLITANHOUSE,"OFMESSRS. NATHAN&; CO.,HABERDAHERShangtogetheritispatchedandrepaired.Thencomes a fire,andtheinevitableis acceptedwiththebestgracepossible,exceptbytheinsurancecompanies. Thenanewstructurerisesonthesiteoftheold,inaccordancewithplanssubmittedandapprovedbythecity'sBuildingAuthorities;forBUILDINGOFlIIESSRS.E.A.ISSA &; CO.,HARBOUBSTREETbeingtriedfor aheinousoffence. Wehavenowthecinemato keepusentertained;wehavecricketandtennis,andBournemouthBathandtheHoteldances,andpigeonshootingandmotorcarjoyrides,andotherdiversions.Forev.eryclassthereissomething,andmorethanonething.Itwasnotsowithourancestors.Itwasnotsoeventwentyyearsago.HencetheCourthouse,ealledevennow"thepoorman'stheatre,"wasonce agreatattractiontoallclassesofthepeople,andwhensomethrillingcasewasbeingtriedthebuildingitselfandthespaceinfrontofItwouldbedenselypacked.Thecrowdthatweseeinourillustrationwasprobablywaitingtoheartheverdicton amanwhohadkilledhiswife,or,worsestill,stolenagoat.(Forthestealingof agoat,oranyothervaluablepossession,wasaveryseriousthing.)Ifforeitheroffencetheprisonerwasfoundguiltyhewouldbesentencedtodeath,andthepunishmentwouldbeinflictedinanopenspaceinthemiddleof .thecity,thespacewhichnowformsthewidesidewalkfacingtheJubileeorUpperMarketofKingston.Itwastherethatthegallowswaserected.TherewasnoCentralParkin these days,butmerelyanopen,arid,uglywasteof landcalledtheParade,andonitthetroopsweredrilled.TheopenspaceoftheParadecouldaccommodateavastthrongofsight-seers,andtheseneverfailedtoattendahanging.Inthesedaysthepublicisnotallowedtoattendahanging.Sothereissomething,afterall,tobesaidforthegood oldtimes.AndthestreetsofKingston?Sand.Sandanddirt,fortherewasnopavingandpreciouslittlecleaningofthecity.Whentherainscamethestreetsweretrans[ormedintoragingwatercourses;whenthesunshonebrighttheybecamestretchesofsandanddust,variedbyheapsofmalodorous,decayingmatter,therefuseofyardsandkitchens;andtherewasalwaysasprinklingofdeadcatsanddogstokeeptheJohnCrowsbusy,andtheairreminiscentof somethingnotatallliketheperfumes of Arabia.Anoldwriter,commentingonourcityofthosebygonedays,speaksof"streetswithoutaplan,houseswithoutthesemblance of architecture,lanesandalleyswithoutcleanlinessandconvenience."YetKingstonwastheprincipaltownoftheislandahundredyearsago,andnothingcouldeternallykeepitfrombecomingthecapitalandtheseatofGovernment.Thisitwasmadein1872,andtenyearsafterthata fireoccurredincelebrationoftheevent-or,atleast,onemaybepermitteddevoutlytobelieveso.Seriouslyspeaking,itisstillfiresthatarethepotentagencyinchangingtheappearanceofthelowerpartofKingston.Innearlyeverystreetweseetypesofstructuresthatflourishedahundredyearsago:buildings,thelowerstoryofbrick,theupperofwood;thelowerstoryusedforbusiness,theupperstoryutilizedasa residence.Frommanypointsofviewitisdesirablethatsomeoftheseshouldbepreserved,butanabundanceofthemisneitherbeautifulnorconvenient.YetnooneinJamaicaeverthinksofpullingdownabuildingtoerectsomethingbetter.Solongasthethingcan

PAGE 11

1925-26PLANTER5'PUCH9 TheJamaicaNobility : OR"THESTORY OFSIRMORTIMER ANDLADYMAT":ByHERBERTG.deUSSER. Author of.. JANE'S CAREER." .. TRIUMPHANT SQUALITONE:'Etc. CHAPTERONETHENOBLESCREATED.WHENMr.MarcusGarveyconstitutedhimselfPresidentoftheAfricanRepublic,whichitselfhadnotyetbeenconstituted,hebethoughthimofformingacourtandofcreatinganobilitytoadornthatcourt.Inrepublicshonorifictitlesaresupposed tobeeschewed. Sim pledemocraticandrepublicanstyledemandsonlysomethingliketheMisterbeforethename.ThusWilliamBaileyinarepublicismerelyMr.WilliamBailey,andisoftendesignatedbyhisfriendsasBill.Butthehungerfordistinctiondefeatsevendemocraticcanons,andsoinmanyarepublicaman,notbeingabletopurchaseorinheritthetitle of Earl,Lord,orKnight,becomes aDoctorofLaws,a Colonel,oraProfessor,asisthecaseintheRepublicsofSouthAmericaandtheUnitedStates,evenuntothisday. Mr.MarcusGarvey,however,wastroubledwlthDOscruplesaboutconsistency.Hewasamanoflargeandsweepingideas.Hehadmadehimselftheheadofanationnotyetinexistence,andhecouldseeno goodreasonwhy,asheadofthatnation,heshouldnotcombinetheadvantagesofmonarchywithrepublicanism.HehimselfwouldnotbeEmperororKing;hewouldmerelybePresident,withthechairmanshipofcertainCO-Ol?erativebusinessassociationsthrownin.Fromthefirstheobtainedhisdignityandprestige,fromtheresthederivedthatrevenuewhichevenaRepublicanPresidentmustcommand.Buttheredemocraticsimplicityended.InhisrepublictherewouldbeDukes,LordsandKnights.Orrather,thesetitledpersonswouldbeofhisrepublic,andnotinit,forMr.Garvey'smostfervent followershadnodesiretovisitAfrica.Theyfearedthatthenativesofthatcountrymightproveinhospitable. Mr. Garvey,then,proceededtocreateacertainnumberofnewnobility,and,thinkingkindlyofhisnativeland,selectedfromamongsthisowncountrymena fewtobeelevatedabovetheirwildestambitions.ThesepersonshadtakensharesintheBlackStarLineorhadotherwisecontributed,tothemeasureoftheirmeans,tothevariousfundsfortheliberationofAfricaandthereturnthitherofitsIcattereddescendants;theymightalsobeexpectedtocontributemore. Hence,whenthepatentsofnobilitywerepublishedtotheworld,itwasfoundthatMortimerSlimslam,anearnestandhardworkingyoungwaiterinoneofthelargerhotelsinKingston,hadbeenmadeaKnightoftheNile,andthatNicholasBrimstone,whoworkedattheJamaicaRailwayand was acompetentartisan,hadbeenappointedHighConspicuousPotentate,thoughofwhathewaspotentate,andwhy,wasnotveryadequatelyexplained.TheannouncementcausedconsiderableexcitementinBarnettStreet,thelittlesuburbanthor.oughfareinwhichbothMr.SlimslamandMr.Brimstonelived.BarnettStreetwasoneofthebetterlivinglocalitiesofthesuburb,or"town,"asthelocaltermbasit,inwhichweretheresidencesofthesegentlemen:most personsinKingstonhadheardofJ8arnettStreetinMitchellTown,thoughcomparatively few mayactuallyhavevisitedit.Certainlyno one would everhavethoughtofitaslikely -to become famous;butonthedaywhentheAfricanWorl(larrivedinKingston,andproclaimedinhugeblacktypethat of thesixmembersoftheAfricanRepublic'snobilityinJamaica,nofewerthantwoI'esidedinBarnettStreet.thatthoroughfareawoketo asense of itssupremeimportanceinthescheme of thingsJamaican,andnotunnaturallyfeltthatitrankedwiththefinestandrichestresidentiallocali tiesofJamaica'scapitalfromcertainpointsofview.BarnettStreetwassomethinglessthanaquarterof amileinlength,andno houseinitcontainedmorethanfiverooms.Thebetter-classresidenceswere forthemostpartsinglestorybuildings, of twoorthreerooms,whichoverlookedthestreet.Ineveryyardinwhichtheselittlehousesstoodwasarow of rooms,eachthehomeofaseparate family. Thusinoneyardmorethanhalfa dozenfamiliesmightexistintemporarypeaceandpotentialdisquiet,but"nthewholeonfairlyfriendlyterms.Thestreetitselfwaspavedwithmacadamandcleanlykept;itboastedofconcreteguttersandcurbs,butitssidewalkswereunpaved.Asthe traffic b.erewaslight,grassgrewupontheseside walksandgavetothematouchofseemliness.There iVas theinevitableChinaman'sgroceryinthisstreet,andarumshopalso,andattheupperendofthe.treetstood alittleAnglicanchurch,builtallofwood within afairlyspaciousplot of land.Outside of thischurchtheinhabitantsofBarnettStreet,andoftheneighbourhoodgenerally,wouldsometimesassembletodiscussanyreallyimportantquestionoftheday.Thishadbecomesomethingof acustom,sowhenthenewsgotbruitedaboutthattwoofthecitizens MitchellTownhadbeenelevatedaboveallpossibleexpectationbythePresidentoftheAfricanRepublic,itwasnaturalthatthosewhoknewthesegentlemen
PAGE 12

]0PLANTER S'PUNCH1925-26Thespeaker,Mr. Nicodemus Douglass,wasastrangertomostpeopleintheneighbourhood,thoughto a few ofthemhewasknownbysight.HelivedattheotherendofKingstonandhadnothithertofounditnecessarytobe afrequentvisitortoBarnettStreet.ButthenewswhichhadbeenconveyedtohimthatdaybytheAfrican Wot'Zd hadbroughthimposthasteto MitchellTown;hewantedtobepresentattheverbalcelebrationoftheglorioustidings.Hewasinpolitics ofsorts;thatis to say,hewasa follower of Mr. Garvey,thoughhehadnevercontributedapennytoanyof that leader'sfundsorcauses,andhefiguredprominentlyinlocal politicalmovementsof aminordescription.Hewasfiery fortheinstantreturntoAfricaofallpeople ofAfricandescent,though,strangetosay,heapparentlyhadnotperceivedthattheforce ofpersonalexamplemightbeinfinitelygreaterthanallthepersuasionintheworld.Hewassharpandrapidof speech, cleveratinfluencingothers,andundoubtedlypossessedsomeabilityfororganisation.Thoughhewasasmallmanandalmostebonyinhue,hisgood featuresandthecarehetook to bealwayswellattired,madehimpopularwithwomen.Hehadawaywiththemaswellaswithmen,andhislively eyeswere alwa)'s quicktoperceivethegoodpointsof aladyandtosignalappreciationthereof.Hehadnowput'inhiswordatthisimpromptugathering,andheexpected to beapplauded.Buthisremarkswereregardedbytheprudentasdistinctlydangerous,whiletheloyalwerenotsuretheyweren'tseditious.As for Mr. Proudleigh,whoneverwillinglycourteddangerinthefleldsofsedition,audwhoinmatterspoliticalwastoo old-fashioned to beanythingbutinstinctivelyloyal,hestronglydeprecatedanysuggestionthattheKing'sviewsshouldbetreatedasof no consequence."DeKingis a goodman,mefriend,"herepliedtothetruculentlittlegentleman."Himwishusallwell,andasweisbornunderhisfiag webetternottalktoostrongagainsthim.P'rhapsMr.Garveycommunicatewidhimbeforehimdoanything;weoutheredon'tknowallthatistakin'placeinacountrylikeAmerica.IonlywishdateitherdeKingorMr.Garveywouldmeekme son-in-law,Jones,aknight,forthenmedarterwould beLadySusanandcouldtakeahigherplaceinsacietythanshe'aveatpresent.An'now Iwantstoknowwhatwe will 'avetocall Mrs.Brimstone,forwecan'tgooncallin'herso-so Mrs.Brimstone,orJaney,likesomeofusdo.Itwouldn'tbe respectful,an'itisnotlikewhatwhitepeople do." Mrs.Brimstoneheardandwasdelighted,andherhusbandalsoexperiencedaquickthrillofelation.Hereatlasttheyweregettingdowntosolid,practicalmatters,forwhatwastheuseofatitleifitwerenottobeindailyuse?"Whatisyourtitleagain,Nick?'"demandedMr.Proudleigh."IamHighConspicuousPotentate,"announcedMr.Brimstonewithrelish."Denyourwifemustbe ConspicuousPotentatess,"saidMr.Proudleigh,"butIneverhearof atitlelikedatyet.""Itdon'tnecessarytocallmethat,"observed Mrs.Brimstone,"forifapotentateisthesamethinglikeamarquis,whichitare,wecanusethefeminineofmarquis.Thefeminineofmaniswoman,"shecontinued,withanobviousprideinherlearning."Thefeminineofgentlemanislady.Thefeminineofdukeisduchess,an'thefeminineofmarquis-well,Idon'tknowwhatitis,butwecanfindout.""Itismarchioness,"explainedMr. Douglass,Whohadsome knowledgeofthesethings,"an'thewife ofa marquisisaddressedas"melady,"samelikethewife of aknight.""ThenIam"meladyship,"agreedMrs.Brimstonecomplacently,"andeverybodyherewill'avetocall me so." Adeathlysilence ensued.Herewasaclimaxwhich,thoughitshouldhavebeen obvious toall of them,hadnotbeenclearlyforeseen.EveryonewasreadytoadmitthatJaneyBrimstone,byvirtueofbeingmarried,hadarighttothetitleof Mrs.andshouldnotbecarelesslyaddressedonimportantocca sions.Butthatallandsundrywerenowtospeaktoherandofheras"meladyship,"wasa differentmattel'altogether.Themendidnotminditsomuch,buttheverythoughtofitwasgallandwormwoodtothewomen. To seeoneoftheirownsetsosupremelyelevated abovethem,andtheycompelledtoacknow ledgehersocialsuperiorityeveryhouroftheday,wasenoughtodrivethem half frantic.Onegirl,distinctlygood looking,andthereforeconscious of anaturaldistinction,gave voicetothefeelings oftherecalcitrant. "I don'tseeasitisnecessarythatweshould'avea change,"sheremarked,"aswearenotstrangeran'weallbinsofriendlyto oneanotherthislongtimepast.Whenwe'aveaparticularfunctionlikeadanceorafuneralwecanadopt the formalitywhichisproper,butotherwisewecangoonjustaswebingoin'onallthistime.""Thatisjustlikeourpeople,"rappedoutMrs.Brimstone,whowasaverystoutbutnotverysweettemperedperson. "Youwouldn'thearwhitepeoplesayin'that.Itwouldbe'marchioness'here,an''melady'there,and'marquispotentate'alldetime.Butbecausemehusban'isablackmanan'gottoworkforhislivin',andIarealso black, younoneofyouwantto givehiman'meourtitle.Butwegotitallthesame,an'youcan'ttakeitawayfromus."Here Matihla thoughtitwastimetosayaword.RememberingthatMortimerSlimslamwasnow aknight,shefeltthatshemuststandupfortitulardistinctions.ButitwasnotatalltoherwayofthinkingthatJaneyBrimstone havethetitleof"Lady.""Wewill'avetogivethegentlementheirpropertitle,"sheputin,decisively;"an'theladies also.ButaPostulateisnota Marquis,orMr. Garveywouldcallhimso.Therefore,sofar,Mrs.Brimstonecan'tbeTHEIDEALDEMOCRAT MR.HUMPHREYCRUMEWING SomeonerecentlyalludedtoMr.HumphreyCrum-Ewingas"anaristocrat."Heisthat,of course,butusuallyyoutakethatfactforgranted,notasamattertobe speciallyreferredto. Amanofveryold family, a Scotch,EnglishandWestIndianlandedproprietor,anEtonPublicSchool boyandagraduateofCambridgeUniversity,heiswhattheSpanishwould callanhidalgo,whichmeansthe"sonofsomeone,"whichmeansalsothatsuch a oneissome bodyinhisownrightandperson.Thatisthekindofmanwe callanaristocratinEnglish,formannersandpersonalityhecanhardlyever lack.ButwehavealsoheardMr.Crum-Ewingalludedtoas"ademocrat,"andthatisastrueofhimasistheotherdesignation.Thebestaristocratisinthesedaysofgenuinedemocraticmanner.Thatistosay,hemaybereservedbutisneverarrogant,hewillbe wellbredandnevershow atouchofpersonalinsolence.Itisthenewrich,thepurse-proud,themanuncertainofhimsef,whocannotaffordtobesimpleandunostentatious.Becauseheislikelytobeserviletothosewhomhefeelstobehissuperiors,heishaughtyorinclined to behaughtytothosehebelievesbeneathhim.Heisneversureabouthisownstanding.Hisviewofsocietyisdistorted;hedoesnotfindsatisfactioninhimself.Tobereallyademocraticsortofperson,inthefinersenseofthatword, one,itwouldappear,mustbeanaristocrat.Thusapparentcontradictionsarereconciled.ItisnotwithoutsignificancethatthosewhoworkforandunderMr. CrUll-Ewingaredevotedtohimandspeakenthusiasticallyabouthim.TotheheadsofhisbusinessintheWestIndies,aswellastothehumblecaneandbananacuttersonhisestates,heis one whocommandsbothrespectandlove.HighIyappreciativeof good service, hebringsoutthebestthereisinthemenwhoservehim;quicktonoticeloyalty,heishimselfprofoundly loyaltothoseconnectedwithhim.Heis a generousman.HispeopleatCaymanassaysoandtheyoughttoknow.Heis a Scotsman.Thushisnaturalcanninesswouldpreventhimfromwastinghissubstanceonthehope lesslyundeserving.Wecanimaginehimdispleasedatbeingcheatedoutofashilling:hisScotchprudence wouldrevoltatthethought.Buthewouldgladlybestow apoundonadeservingobject,andno onesavehimselfandhisbeneficiarywouldbelikelytoknowof it.HisbenefactionsinJamaica,indeed,aresubstantial,butoftheseyou donothearfromhimself. Quiet,genial,friendly,kindly,andaculturedman,thereare,itistobe feared,notmanyWestIndianproprietorslikehim.Whichisapity.Caymanashasbeeninhisfamily for ahundredandfiftyyears.Ithasalwaysbeencelebratedasapayingpropositionandalsoasapropertywheretheworkersaretreatedwell. Goodbusinessinstinct,justiceandgenerosityseemtobequalitiesinherentintheCrum-Ewingfamily,andthepresenthead of thatfamilylivesuptoitsbesttraditions.called'melady,'an'asthereis nofeminineforPostulate,orwhateveritis,shewill'avetoremainMrs.Brimstone.""Oh, isthatso?"queriedMrs.Brimstone,withuminouscalm."Isthatthewayyoumakeitout! Well,letmeinformyouthatatanyrateIamMrs.Brimstone,an'noonecantakethatawayfromme. But ifMr. Garveydidmakethemanyou'aveadukeeven, you wouldstillbe so-soMattyLashmore,fory'u'avenoclaimtotheverynameofMortimer,much less to Slimslam. Iamamarriedwoman,widaringonmefinger,an'everybodyknowI gotochurchan' getmarried. Idon'tmeantosay,"shecontinuedhastily,realisingthatshewashurtingotherfeelingsbesidesMatilda's,"Idon'tmeantosaythatmanywhodon'tmarriedyetarenotasgoodasmeself,butsomearenot,an'thosewhodon'twanttocallmemarquis,ormeladyshipcandowhatthemlike. Only,whentheyareharduptheyneedn'tcome tometoborrowa sixpance, for Iwon'avenonetolendthem."SixpenceswerefrequentlyborrowedfromMrs.Brimstoneinthatneighbourhood.Thereweresomepresentwhohadformedthehabit.Herthreat,therefore,haditsintendedeffect.Atleasthalfa dozen ofthecompanyralliedtohersupport-allwomen."Iwillcally'u'melady:foritisyourproperdestination,"saidone,andtheothersechoedthatrighteouscry. Mr.ProudleighsawhischanceofmakingfriendswiththeMammonofunrighteousness.Heneverneglectedanyopportunityofdoingso.Heturnednow to Mrs.Brimstonewithhisgrandestair."Youarede Marchioness Brimstone,"heannouncedwithfinality,asthoughhewerethewholeCollege ofHeralds,"an'you'husbandisamostConspicuousPostulate.An'Isaydatweshoulddolikedewhitefolksesan'maintaindedignityan'decorumofyourposition. I willsetde goodexample,SisterJaney;youcandependsupon me." Aspeechforwhichhewasrewardedwitha smile.ThenMr.Brimstone,who,despitehisname,wasreallyamanof Pilei fiedisposition,remindedhiswifethattheyhadsomethingtotalkaboutintheprivacy of theirownhome,andsheconsentedtobe ledaway.ButbeforegoingsheannouncedthatsheandtheHighConspicuousPotentatewouldshortlybegiving"alittlefun,"towhichhertruefriendswouldbeIn vited.ThisconsiderablyheartenedMr.Proudleigh,whowaswonderingifnothingwastobedonetocelebratethebestowaloftitlesupontwoeminentcitizensofBarnettStreet.Mr.Proudleighknewhehadearnedaninvitation,anddepartedhomewiththefeelingof amanwhohadnotthoughtandworkedinvain.CHAPTER TWOMATILDABEOOMES ALADY MATILDA,"engaged"ladyofSirMortimerSlimslam,wasnotahappywoman. I:'he hadbeendefeatedinaverbalencounterwithJaney,MarchionessofBrimstone,orHighConspicuousPotentatess,asthatladymightotherWise be called.ShehadbeenremindedbytheMarchionessthatshewasnotevenmarriedandso couldnot,byanystretchoftheimagination,considerherselfentitledtobe called"mylady."ForthefirsttimesinceshehadheardofMortimer'selevation,sheregrettedthatMr. Garvey,inhisloveforhispossiblefutureSUbjects,hadmadeMortimerandotherJamaica-nsmembersofhisnewNobility,orOrdersofKnighthood,orwhateveritwasthatMr.Garveycall edhiscourt.ButMatildawasayoungwomanofmuchspirit,andshefeltsheowedittoherselftomakelifeasunpleasantaspossibleforMrs.Brimstone. Sofarasshewasconcerned,shewouldneverbestowanytitleupon Mrs.Brimstone.Arrivedatherresidence,Matildasetaboutthecongenialtaskofdenigration.IfMrs.Brimstonewasapersonof consequenceintheyardwhereshelived sowasMatildainherownyard.LikeMrs.Brim:stone,sheinhabiteda two-roomed house, not amere"yardroom,"andshehadasmallservantor"schoolgirl"toassistherinthehousehold work.Soshewassomethingofapersonage;shewascomfortablyoff;shedressedwell;shecould go tothePalacePictureTheatrewheneversheliked, andsheneverattendedafuneralsaveinahiredmotorcar,the ex pensesbeingsharedbyothermourners.Inheryard,ofcourse,thereweremanypersonsofaninferiorpecuniaryandsocialposition.Theseinvariablyaddressedheras "Miss Matty,"whilesheaddressedthemfamiliarlybytheirChristiannames.Totheseshenow madepersonalappeal,forsheneededtheirimmoralsupport.Sheexplainedto some ofthemtheposition:howherMortimerhadbeenmadeaknight,andthereforeclearlywas entitledtobeaddressedasSirMortimer;how Mr.BrimstonehadbeencreatedahighConspicuousPotentateonly,andtherefore,obviously, couldnotbe addressedasSir,orMy Lord.Hersycophanticaudienceagreedwithher,andweremightilywrothwhenshewentontoexplain,withscorninvoiceandgestures,thatMrs.Brimstoneinsisted up onbeingknownas"meladyship.""Whatsortofashipisdat?"astoutfemale de mandedtoknow."Ihearaboutsteamshipbut not

PAGE 13

SIMPLEANDSINCERE11Thus,inoneday,theneighbourhoodwaselectri tiec.l withtwodistinctyetrelateditemsofthrillinginformation.Firsttherewerethehonoursbestowed upon Mr. f:ilimslam andMr.Brimstone;nextcamethenewsthatinadayortwoSirMortimerand :vlatilda weretobemarriedbyspecial license.Mrs.Brfmstonewasmuchscandalised.Thislastwasone thethingsthatneveroughttohavehappened. ::lhe wasallthemorebitteraboutitbecausesherealisedthatitwasherownsneerattheirregularmaritalconditionofMatildathathadbroughtitabout.Mrs.Brimstone,too,withherthirtyyearso intheworld,waswellawarethat,splend1dthoughherhusband'stitlesounded,itwouldnothavethesameeffectuponthemindsofmenasdidthecustomarySirorLord.Itwasanewthing,1twasavaguething,andshefeltthatifpeople be gantocontendthatshecouldnotrightlybecalled"mylady"itwouldbedifficulttoconvincethemotherwise.True,shecouldinsistuponPotentatess;noonewoalddenyherarighttothat.Butthenitdidnotsoundquite'right.Shehadneverheardof a Poten tutess before.Shehadbeento school;sheoccasion. ally readthepapers,andevencheapnovels;shewasby nomeansilliterate.Indeed,among.theworkingordersofthecityshewasaneducatedwoman.And she hadneverheardof aPotentatessanddidnotbelievethattherecould,ordinarily,beone.Shecurs ed Mr.MarcusGarvey.Whycouldhenothavebeencontentwithmakingherhusbandasimplelord?ThenindeedherprecedenceofMatilda,howevermuchmarried,would beunquestioned.Asitwas,shefearedforthefuture.HeronlysolacewasinthehopethatMatildaandMortimerwouldnothititoff wellasmarriedpeople,andwouldshortlysepa.rate,Matildabeingcompelled tolivealifeofwantanddrudgery,forwhichshewasobviouslyunfitted,andso comebyslowdegreestoadishonourablegrave.CHAPTERTHREESIRMORTIMER'SDOWNFALL. S ) SirMortimermarriedMatilda,andinBarnettStreetthereweretwoladiesclaimingtherightto beaddressedas"mylady,"Neitherspoketotheother,neitherwouldenterahouse theotherhappenedtobe;andthepityof Itwasthat,beforethis'dlgnityhadcometothem,theyhadbeen,ifnotfriends,atleastonamicableterms.Therewereotherregrettablecomplications.Mr.Proudleigh's daughter, towit,Mrs.SamuelJosiahJones,andseveralotherladiesoftheneighbourhood.begantoobjecttotitlesonenvious,democratic,andalsoaristocraticprinciples. They arguedthattheonlytitleswhichtheycouldrecognizewerethosebestowedbyHisMajestyofEngland,whowoulnnever,theyaverred,havesofarforgottenwhat waR rightandproperastobestowthemupontheinhabitantsofBarnettStreet.TheyopenlyscoffedatthenewKnightandPotentat.e,andthisdidnottenntopreservecordiality.ItistobefearedthatMr.MarcusGarveyhadbroughttomanyofthoseWhohadneverharmedhimnotpeacebuta sword.LadyMatildaandthePotentatess,orMarchionessBrimstone,wouldnot,however,abandononejotortittle of theirrights.TheycontendedthatifMr.Garveycouldcreatearepublic,withhimselfaschief,hecouldsurelycreatea nobility.Andthosewhoaccepted Mr.Garveywouldhave,perforce,toaccepthisknightsandnobles.ThiscausedmanyaGarveyitetodesertthefoldandreturntohisoriginalloyalties.Therewereevenoneortwoboldandenterprisingspiritswho,nothavingbeenennobled,werethinkingofliftingopenlythebannerofrevoltagainsttheBacktoAfricaidea.LadyMatty,however,andLadyJaney,urgedthattheirhusbandsshouldmorestrenuouslythaneverpreachandmaintainGarveyismandInsistinandoutofseasononbeingproperlyaddressed."Don'tletanyoneforgetthemselveswithyou,"wastheburdenoftheiradmonition."Makethemcallyouasyou'avearighttobecalled;intimetheywon'ttrynottodoit."Matildawasthemoreinsistentofthetwo,andtheirhusbandspromisedtoobey.AtthehotelSirMortimerwashavingahardtime of itendeavouringtoinducethewaitersandotherstospeaktohimwithduereverenceandrespect.Hedidnotsuggestthistotheheadwaiter,forthatfunctionaryhadthepowerofhigh,lowandmiddlejusticeoverhim;thatistosay,theheadwaitercoulddispensewithhisservicesatanytime.Buthewouldarguewithhisfellow-workerstoshowthemtheerroroftheirwaysinregardtohim,and RO, frombeingpopularandliked,itcameaboutthat hebee;an tobedetested.TheywouldnotcallhimSirMortimer,andhewouldnotanswer,unlessheabsolutelymust,eithertosimpleMortimerortoSlImslam.HencedisagreementRandcontroversies.And soitwasalsowiththeHighConspicuous. "'he menamongwhomheworkedforhislivingattheRailwaylaughedathispretensions.Nowandthenoneofthemwouldaddresshimas"YourDukeship,"butthiswasunderstoodtobebywayofridicule.He(OontinuedonPage21.)PUNCHP :A N,TERS' HOX. CHAS.HOPE LEVY TheHon.CharlesHopeLevyisoneofthemostlikeablemeninJamaica,andoneofthemostliked.Familiarlyknowntomembers of hisfamilyandtointimatefriendsas"Pops,"hisgenialdispositionendearshimtoallwhoknowhimwellandwinsforhimtheappreciationof evencasualacquaintances.WhenhewasappointedCustosofSt.Thomasa fewyearsago,thegeneralfeelingwasthatamost selectionhadbeenmadeandthatMr.Levywouldperformthefunctionsoftheoffice fittingly.Hehadneverfilledanypositionofdistinctionbefore.Hehadbeenaretiringmanandsomethingof avaletudinarian.Yetth('sewhoknewhimbestwerewellawareofhissenseofduty.Theyfeltcertainthattheywerenotmistakenintheirconfidentexpectationsofhim;andasamatteroffactthoseexpectationshavebeenmorethanful filled, for nodutypertainingtotheCustosshipof aJamaicaparishisneglectedbyMr. Levy,andthe traditional andsocialobligationsoftheofficehavebeencarefullycarriedoutbyhim.Mr.CharlesHopeLevy'sisessentiallyasimpleandsincerepersonality.You couldnotassociatehJmwithanythingmeanorunworthy.Asson anrl nephewoftwomenwhostoodamongsttheveryfirst ofJamaicansintheirday,thelateMr.Charles Levy, merchantandplanterofJamaica,andthelateMr. GeorgeW.Levy,chiefeditorandproprietorofthe"Colonial Standard," Mr.HopeLevyhas inherit'!d notonlyanhonourednamebuta code ofconductinpublicrelationshipsexactinginitsdemandsandworthyofadmirationinitsfulfilment.Thatcodehemaintains;hencetotheaffectionwhichhewins trom hisfriendsthereisaddedatrueandenduringrespect.didmarryher?Ashehadtoldher,heceuldcutthenuptualcordinfactifnotinlawifsheprovedinsupportable.Meanwhile,likea goodandworthyknight,hewould dohisdutyandhope forthebest."Namethe dar!" hesaiddramatically."Assoonaspossible, Morty,"shecried,excited,forshehadwon."Andleteverybodyknowatonce."Shewhirledoutof doors. "Miss Susan,"shecalled, "Mrs.Henry!Mortyan'meareto bemarriedshortlybyspeciallicense.MortysayImus'beLadyMortywithoutdelay!"Thespecial licensepartofthe storywas her own inventionandhadcomeintoherheadwithoutpre-meditation. YElt, whynot?Itwouldbeexpensive,andtherecould be noweddingfeast.Butwithaspeciallicenseshecouldbemarriedwithinadayortwo.Shehurriedbackintotheroom."Aspeciallicense, Morty,"sheinsisted,"forIdon'twanttogoonehourlongerthannecessarybeforeImakeJaneyBrimstoneknowwhoiswhoandwhatiswhat.Everybodyunderstandwhatisaknight,fordeGovernorisone,butaHighwhat-you-call-itPopulatesoundlikestupidnesstome:it'avenomeaningatall.""That'swhatIsaymeself,"agreedMortimer."ItisnotatitletheyuseinEngland,for IneverhearItdownatde hotel,an'thereisno goodhavin'atitlethatnobodydon'tunderstand.Itisonlylikea Lodgetitle;youcan'tmakeanyproperemploymentof it. And that,"headdedemphatically,"iswhatwe'avegottomakeBrimstonean'hiswifetorecognize"; forhewashurtatthethoughtofMr.Brimstone'sclaimingamarquisatewhilehe,MortimerSlImslam,wasonlyaknight.1925-26aboutladyship,an'Inotcallin'heranyt'ingmorethan Mrs.Brimstone,whichishertrulytitle."Unwittingly,thiswomanplantedafresharrow In tbe alreaQ.y bleedingheartofMatilda.Yes,what ever happened, Mrs.BrimstonewasMrs.Brimstone,andhad atitlewhicheventheGovernorofthelandcouldnotcontest.Whileshe,Matilda-!Surelyallwasnot wellwiththeworld. Mortimercamehomeataboutfive o'clockthatafternoon foranhour.Hewasapleasantlookingfellowofaboutthirty,notparticularlybrightbutvery willingandenergetic.Hewouldbeondutyatthe hotellateron,buthehadhurriedhomewardtolearn howthestreetandtheneighbourhoodhadtakenthetidingsofhisknighthood.Itwasonly tbatmorningthataletterfromsomehighdignitaryoftheAfricanRepublicinNew York,alongwithacopyoftheAj1'icanWorld,hadinformedhimofwhathad happened tohim,forMr.Garveyhadnotthoughtitnecessary toaskMortimerbeforehandifhewouldbewillingtobecome aknight.Mr.Garveyhadas sumedthatnomaninhissenseswouldhesitatefor a momentaboutacceptingatitle;andnowMortimerwanted toknowwhathisfriendsandneighboursthoughtaboutthematter."Themisenvious,"statedMatildawithluminousfrankness, forshehadsomeinsightintohumanna ture."Theyareenviousbuttheytrytodisguiseit.OnlyMr.Proudleighan'oneortwoothersspeakwellaboutit,andoldProudleighisalwaystryin'togetwhathimcanout0'people, sohedon'tcount.Butnowyouareaknight,Morty,whatyougoin'todoabout me?"SirMortimerlookedatherinsurprise.Hewasnotawarethathehaditinmindtodoanythingatall abouther.Herequestedenlightenment."Well,don'tyousee,Mortimer,thatnowyouareso highhup,wecan'tgoonlikewegoingonatpresent?Weloveoneanotheran'wegetonwellwith oneanother,butwenotmarried.Ididn'tmindthatbefore,butnowyounotasimplemananylong er;whereveryougotheymustcallyou'SirMorti mer,'an'whenI gowithyou,whatthemtocallme?LookattheGovernor?Heismarried.Hehavetobe,or people wouldtalkabouthim.Itisthesamewaytheywilltalkaboutyou,forhiman'you'avethe sametitle.Therefore,sofar,youwill'avetogetmarried, forthereisnootherwayoutofit.""Gal,"exclaimedMortimer,"WhatfoolishnessitIsyoutalkin'?""No fOOlishnessatall,"repliedMatildadecisive ly, andthenshetoldhimofthescenethathadtakenplace alittlewhilebefore.Mortimerbecamethoughtful."Yousee, Mat," he said,"itislikethis.Youandmegetonverywelltogether,forwearenotmarried.Iknowyou can leave meifyou like,thoughyoubetternotat tempt itIfyouknowwhatisgoodforyou,andyouknowthatIcanleave youifIwant,thoughIdon'thavenoIntentionsthatway.An'thereasonwegetonaswellaswedoisbecauseweknowwhatwecando.ButIfyouan'mebecomes alawfullyweddedhusbandan'wifeitmightbe different.Themomentyougettheringonyou' fingeryoumightbeginto be stupid,andthoughI couldstillabandony'u,youwouldhavemenamean'thering,an'Imight'avetosupportyou.""Thatisonepartofit,"returnedMatilda,"butthereisanother.Whataboutrespectability?An' if afteralltheseyearsyouan'megetonsowell,whatyou'avetofear?""Well, yes,that'strueenough,"agreedthegentleMortimer."Butawomanisafunnything,youknow,an'youmaychangelateron." "So far,per'aps,youareright,"repliedMatildacalmly,"butyou will'avetomakeupyourmindtolosemeormarrymenow, for Iamnotstoppin'with you assimple MissMatty.Thatsuityesterday,buttdon'tsuit to-day. ItisnotthatIwantanybodyo call me your ladyship,'butIwon'tstand'ereand Ilear themcallJaneyBrimstone'yourmarchioness'whileIamnothingatall.Ifyouwasn'taknight,itwouldbe different, butyou'aveatitlean'ifIamattachedtoyouImus'shareit.Soyoucanmakeupyou'mindwhatyougoin'todo."Thisaspectof the situationshookMortimernotalittle.HehadnottheslightestdesiretobepartedfromMatilda.Butshewasself-willed,vainandambitious,andhefearedthatmarriagewithherwouldcausethesedefectstodevelopalarmingly.Therewouldthen,ashehadjustsuggested,belessnecessityforrestraintonherpart.Butheknewherwellenoughtobeawarethat,hervanitybeingcruellywounded,shewoulddeserthimnowifhedidnotmakeherhiswife.Herealisedvaguelythatenvyandjealousywerebusyatwork,notonlyintheneighbourhood,butintheplaceswherethenewlycreatedpotentates,knights,andotherdignitariesworked.Forinstance,hehadalreadyannounced that day,atthehotel,thatMr.Garveyhadknightedbim,andone ofhisfellow-waiters, ausuallymildand inoffensive man,hadnearlymurderedhim-atleast,hehadlookedlikemurder.SoheunderstoodhowdifficultitwouldbeforMatilda,attachedasshewasto aknight,toremainwithhimanywherewithouta legalrighttoanytitlewhatever,whilethewivesof other dignitariessailedaboutandinsisteduponbe IDI properlyaddressed. After all,what difference woulditmakeifhe

PAGE 14

PLATTER S'PUNCH1925-26,IiiiiilIii!!iii!meanshewasexcusedforbeingbornintheisland.andmuchmightpublicly besaidinpraiseofhim.Butitwasnothethatwasreallybeingpraised,itwasthemeansthathepossessed.ConsequentlytheJamaicanwithoutmoneyhadtobeginprettylowdownontheladder of success.andtherewasatremendoussuccession ofrungstobeclimbedbeforehegotanywherenearthetop,andplentyofdiscouragementtomeethimonthe up wardpath.Itissomewhatdifferentandverymuchbetterto-day.JustasstrikinglyastheappearanceoftheprincipalcentresofKingstonisaltered,sothatnoonewouldrecognisetheKingandHarbourStreetsandtheresidentialsuburbsofthirtyyearsagoasthesameplacesatthepresenttime,sohaveconditionsinotherrespectsalteredalmostbeyondrecognition.Themiddle-agedmanknowsthis;and.isanillustrationofhowmuchabilityandperseverancemusthavegonetothebuildingupofwhatisforJamaicabigbusinessbyagroupof boyswhohadnothingtobeginuponbuttheirowncharacter.intelligenceanddetermination.andaplanfromwhichtheyneveral lowedthemselvestodepart.IREMEMBERtheHenriquesbrotherswhentheywereyoungandcontemporariesofmine.SomeofcourseweremuchyoungerthanI,buttherewasnotone ofthemthathadnottogoouttoworkwhennotmorethansixteenyears of age.Thetwoelderones,EmanuelandVernon,startedataboutfourteenyearsof age,andEmanuelhastoldmethatveryshortlyafterhecommencedworkhehadinmindthefutureclose co-operation ofhimselfandhisbrothersinsome effort toestablishanindependentbusiness.Theboyswenttovariousschools. IrememberEmanuelattheKingstonCollegiate.AtthattimeO.K.Henriquesmusthavebeenearnestlyengagedinplayingwithemptybottlesandpretendingtheyweredolls.ForO.K.andFabianwerethenkidsathomeanduntroubledbythoughtsofthefuture.YetItisinterestingtonotehow.asalltheseboysgrewtoanagewhentheymustdecideupontheircallinginlife,theyselected.occupationsthatwouldenablethemtoestablishapracticalworkingpartnershipbetweenthem,sothatasagrouptheyshouldbeself-suMcientandstrong. Of course,theywerefollowingonthelineslaiddownforthembytheirfather,andhisowncall ing. Mr.SamuelC.Henriques,whoisnowinhisseventy-firstyear,is byprofession a CivilEngineer.Hetoobeganattheage offourteenandwasinhisyouthandprimeassociatedwithseverallargeengineeringundertakingsInthecolony. Aworkingengineer,however. doesnotaccumulateagreat,fil,,! iiiiitii!"'71' -WhenEnterprise WaitsonSkillASTORYOFSOMEOFMYFRIENDS,"Ii!!!iByHERBERTG.DELISSER,C.M.G.TWENTY-FIVEorthirtyyearsagoinJamaicathequestionastowhatto dowiththefamilywasabitof aproblemwhenthefamilywaslargeandmoneytosetitupinbusinessorintheprofessionswasnotavailable.Whentheboyswerestillundertheageoftenitexaltedyoursoulandgratifiedyourmindtospeculateaboutwhattheyeachshouldbecome. Onewouldbealawyer,theothera doctor.andsoforthandso on,until the ageoffourteenorsixteenwasreachedbytheeldestandtheneedof decision upon acareerbecameimperative.Then in
PAGE 15

1925-26PLANTER S'PUNCH13investigatethesituation;Iputthissuggestion be. foretheGleaner'sBoardofDirectorsandwithina week IwasonmywaytoPanama.ThereIfoundtheHenriquesbrothers,andIhavealreadytold else wherehowduringmystayinthatlandEmanuel.withoneortwo ofhisAmericanfriends,wouldcome over tospendtheeveningwithmeatmyhousein Zone,totalkover affairs inthehomecountry.andtoentertainmewithsong. Ienquiredabout the boys whom Ihadnotseen,andlearntthattheyweredoing well. Iheardthat,thoughtheywerecomfortableandprospering,theyyetlongedtoreturntoJamaica:thenaturallongingofmenwhowereborninthecountryandwhoseambitionwastoachievesuccessintheirownterritory.Then,asIhavementioned, cameJanuary,1907.andthedestructionofKingston,andtheboys cama back.Theystartedatonce onworkofreconstruction.O.K.tookcharge of thebusiness affairsof "Henriques Bros.,BuildersandContractors."Theworkoforganisation was his.Theyweregood contractors.Thewholeofthenorth-easternblockofKingandHarbourStreets,theblockcomprisingthebuildingsnow occupiedbytheBeeHive,CanadianBankof CommerceandtheMontpelierCigarStorewasputup bythem;soweretheCoronationBuildingsand"TheSports,"whichisone of themosttastefullookingstructuresinthebusinesscentreofthiscity.AlargenumberofthenewbuildingsinKingstonwaserectedbythem,andwhenthebulkofthisworkwascompletedtowardstheend of 1912,thedreamofmanyyearsmaterialised.TheKingstonIndustrialWorks,theKingstonIndustrialGarage,andHenriquesBrothers,BuildersandContractors,were organi!l'ed ona firm basis,withthesixbrotherscooperating;andeversincethensuccesshasattendedupon successinalltheirundertakings.BUTwhenthisorganisationtookplacethebusinesseswere,naturally,bynomeanswhattheyareto-day.Itwaswhilethecarryingoutoftheirbuildingcontractswasgoingonthattheotherenterpriseswerestarted,andstartedinsuchasmallandunspectacular f"lIshion thattheyattractednoparticularattention.Whenonevisits the KingstonIndustrialWorksto-day, ami gazesdownahugeworkshopresonantwiththedinofactivityandcarryingonallsorts of operationsinsteelandironandwood,itrequiresan effort ofone'smindtogobacktothebeginnings ofthis largestundertakingofitskindinJamaica.ButIcanrecallthestarting Of theKingstonIndustrialWorksin1908.TheworkshopwasthensituatedinLongRoad,wasabouttwentyfeetsquare,andwasmade of packingcases.Itcontainedananvilanda forge,andasmalldrillpresswhichVernonHenriquesinformedmehadbeenboughtfromtheJamaicaTobaccoCompanyforabouttwopounds.Vernonwaschiefof staff, andhis staff waslimitedto one boy! After sixmonthsheboughtasmallworkshopinWestStreet,and nlTERIOR VIEW, KUTGSTON INDUSTRIAL WORKSN/Jqt'fJZfromthattheregrewupthepresent1KingstonIndustrialWorks,with one hundredandthirtyskilledmeninitspermanentem ployment, andsometimeswithovertwohundredmenengaged.InthisfoundryiscollectedeveryvarietyofmachineryforthemakingandrepairingofironworkusedinJamaica.Attheentranceyouareshownacranecapableofhoistingandswitchingtoanypartofthefoundryaweightofanythinguptofivetons;youareshownanoxy-acetylinewelderwhichisputinoperationasyou look,andwhilethesteel-blueflamespurtsfromitona piece of steel,you see the steelslicedanddividedasthoughbyaknife,althoughsparksflyinginyourdirectionandfallinguponyourbodyleavenotrace.Herearemenskilfullymakingwoodenpatternsforsteelbandsandpostsandspiralsaridwhatnot;hereareswitchesbeingmadefortheJamaicaRailway;hereisamachinethatcanatanymomentbesenttoanysugarestateinthecountryforthepurposeofeffecting re pairs,thusenablingthework of thesugarestatet() proceedalmostunimpeded,andrendering unneces sarythelabourandcost of transferringhugemassesofestatemachinerytoKingston.Here,inshort, is everytoolandinstrumentknowninthefounder'strade.. Once upon atimepracticallynoneofthisworkwasdoneinJamaica.Itusedtobesentabroad,es pecially toScotland;therewasbutlittleskilledlabouravailableintheisland,andtherewasevenlessconfidenceinthelabourthattherewas.Norwasitaneasymattertocreatea staff ofskilledworkersandtoinspirethemwiththenecessaryesprit de corps.Evento-day,asisobvious,thesupplyotskilledaudreliablelabourinthis,asinallhighlytechnicalcallings,islimited.ButintheyearsthathaveelapsedsincetheanvilandthedrillweresetupinLongRoad,asplendidandefficientorganisationhasbeenestablished,andveryshortlyone piece ofworkwhichtheKingstonIndustrialWorksis madeSecretarytotheAuditorofthesamecompany,whichpositionheheldforthreeyears.Thatwasaneducationinitself. Amanofnaturalfinancialability,witha power of visionandorganisation,nobetterstrokeoffortunethanthiscouldhavehappenedtohim.AsSecretarytotheAuditoroftheRailroadCompanyhecameintoclosetouchwithimportantfinancialquestionsdaily;hehadtobequickandresourceful,accurateandpainstaking;thosefiveyearsinPanama,indeed,laidthefoundationsofhissubsequentfinancial success.Fabian,thenextbrother,didnotgotoPanama.Bythet.imeheleftschoolhiselderbrothershadreturnedtoJamaica,for now a newopportunityhadopened beforethem.Theearthquake of January,1907,hadoccurred,andtheHenriquesboysrealisedthatagreatdeal ofconstructionworkwouldhavetobe doneinthiscity.Thegroupofthem-thesolidsix-representedpracticalengineers,contractors,architectsandfinancial men.DuringtheirtimeinPanamafive ofthemhadbeenwellpaidandtheyallhadsavedsomething.Poolingtheirresources,theyfoundthatthesewerenotinconsiderable;abovealltheyhadyouth,energyandenthusiasmastheirnaturalassets.Theycamebacktotheirnativeland,andFabianthrewinhislotwiththeothers.Hetoowasto followthe professj.onof anengineerwithstructuralsteelworkashisspecialdepartment.HORACEhadbegunbusinesslifeintheemploymentof Messrs.NathanandCompany.Hewasintheirofficeaddingandsubtractingfigures,makingentriesinledgers,learningtobeanaccountant.With them heremainedanumber of years,thenhetoowenttoPanama.ThefactisthatEmanuelhadbeenadvisinghisbrothersto come over.Panamawasnotexactlyalandoverflowingwithmilkandhoney,aswasthePromisedLandoftheBiblicalstory,butitwasacountryoverflowingwithworkandmoney,whichafterallisthepracticalequivalentofmilkandhoney. SoEmanuel,havingsurveyedthelandandfounditgood,exhortedhisbrotherstoemigrateandshareintheprosperitywhichabounded;andwe findHoraceasayoungfellowmovingovertoPanamatojointheothers,andtherehewasatonceemployedintheAuditOfficeofthePanamaRailroadCompanyasanaccountant.InthemeantimeOwen K.Henriques,betterknownthroughoutJamaicaas"0.K.,"had,immediatelyafterleavingschool, emigratedtoPanama,wherehejoinedtheoffice staff ofthePanamaRailroadCompany.O.K.wasnotmorethanseventeenyears of ageatthetime,butalreadyhismindwas fixed upondevelopingtheideaofEmanuelandtheothers-theideaofformmgintoonegroup of partnerstheHenriquesBrothers,andtheorganisingoftheenterprisesthatshouldbe undertakenbythemonasoundfinancial basls. After workingontheoffice staffof thePanamaRailroadCompany for some twoyears,O.K.wasIT wasnotlongaftertheboyshadleftJamaicaforPanamathatI came .acrossoneortwooftheminthatcountry.Iwasnowajournalist.TherewasmuchdisputeinJamaicain1905astowhetherJamaicalabourersshouldbepermittedtogotoPanamatowork,whethertheconditionstherewouldbefavourabletothem,andwhethertheywouldmakemoremoneytherethaninJamaica.InthemidstofthisconfusionofopinionIthoughtthatthebestthingwouldbe for some onetogotoPanamaandCompany,remamlDgconnectedwiththatbranchoftheCanalConstructionWorksuntilAugust,1907.ThusthreebrothershadgonetoPanamaatatimewhenthegoingwasexcellentforthosewho couldworkstrenuously,andwhoweredeterminedtolearnallthatthebuildingoftheCanalhadtoteachto keen-minded peopledeterminedtosucceed. volume of pencethoughhemayacquirelargeandmostvariedexperience.Ifyouworkforothers,thoseotherswillgetthepoundsandyouwillbe welcome to alltheexperienceyoumayobtain.Yettheoldman,althoughhemaynothaveknownitatthetime,hadreally agreatdealofcapitalinhissixboys,andhisexperience was goingto be of servicetothem.Whilehewaswonderingwhatwouldbetheirfuture,thatfuturewasalreadybeingdeterminedby theircharacter,bytheoccupationsintowhichtheywent,andbytheopportunitiesthat,unknowntothem,werecomingtheirway.MR.HENRIQUESwas,asIhavesaid,a CivilEngineer.WeseehishandinthecircumstancethatEmanuelandRudolphbegantowork,thefirstattheEngineer'sOfficeatUp-ParkCamp,thesecond with a firm of builderswell-knowninKingstonasLang,LothianandDunbar.LateronRudolphwenttoPurdonandCox,whereEmanuelalsofoundhim self:PurdonandCoxwereEngineersandContractorswithaverywidefield ofoperationsinthiscountry.ThenRudolphleft th<: islan
PAGE 16

..... 14PLANTER 5'PUNCH1925-26THEKINGSTONINDUSTRIAL GARAGE, CHURCHSTREETSHOW ROOM,INDTRIALGARAGE engagedupon,andispatenting,willbeknownnotonlyinJamaica,notonlyintheBritishEmpire,butthroughouttheworld.ItwouldnotbefairtotheHenriquesBrothersformetospecifywhatthisis.ButIcanatleastsaythatitisaninventionwhichwillbewelcomedinJamaicaandbyhundredsandthousandsofagriculturistselsewhere.THEoriginoftheKingstonIndustrialGarageisoneofinterest.Veryoftenlargeenterpriseshavesmallbeginnings;indeed,mostofthoseofwhichwereadbeganinahumbleandinconspicuoussortofway.Theygrew,theywerenotsuddenlycreated; 80 itwaswiththeKingstonIndustrialGarage.Theboys,aftertheirreturnin1907,requiredsomemeansofquicktransportation.Theywantedtotravelovertheislandinconnectionwiththeirbuildingcontracts,andtheywantedthesortofmotorcarthatwouldenablethemtodothistravellingcheaply.TheydecideduponaFord.TheyusedthisFordforsometime,weresatisfiedwiththeresults,andthenHoracedeterminedtoapplyfortheJamaicaagencyoftheFordmotorcars.Heobtainedit,andthegaragewasestablishedinWestStreetnextdoortotheFoundry,inabuildingofaboutthirtyfeetbyeighty.HereHenryFordtookuphislocalresidenceandherefor atimedidHenryfiourish.FordcarswerepushedinJamaicaandFordcarswerepurchased;thetriumphofHenryFordinotherpartsoftheworldwasbeingrepeatedinJamaica.ThenHoracetookovertheofficemanagementoftheKingstonIndustrialWorks,whichhistrainingand expenience asanaccountantinthePanamaRailroadCompanyandelsewherefullyqualifiedhimfor,andO.K.assumedentirelythemanagementoftheKingstonIndustrialGarage,whileremainingidentifiedwiththeWorksandwiththeHenriquesBrothers.Forallthreebusinessesarefundamentallyone. Allthebrothers are interestedinthem;theyaredove-tailed, sotospeak;theyarepartsofonewhole;theyaretheconcretemanifestationsofearlyideas,loyalco-partnershipandofanambitionrealised.To-daytheKingstonIndustrialGarageisoneofthemostup-to-dategaragesto be foundanywhere,andthesaleandpopularityofFordcarsinJamaicasteadilyincrease.Also,whilethesetwobusinesses,theGarageandtheIndustrialWorks,weregrowing,theconstructionpartoftheHenriques'sundertakingswasnotneglected,astheKingstonTheatre,designedanderectedbytheHenriquesBrothers,andthenewMayPenbridge,oneofthelargestandfinestworksofitstypeinJamaica(tomentionbuttwoinstances)mostamplytestify.Buildingandconstructionin deed,demandto-day agreatdealofthetime"andenergyoftheHenriquesBrothers.Herethenisa record ofwhichanygroupofmenmightwell beproud.Tohaveanaim anl! topursueit.aworthyaimandbringittosuccess,andthiswhilestillyoungandabletolookforwardto furthEj)' achievements,cannotbutbeasourceofprideandsatisfactiontoanymanornumberofmen.InJamaicanoonecanacquireanimmensefortune;thefieldisrestricted,theopportunitiesfew.Thesameamountofbrainsandenergyputintoasuccessfulbusinessherewouldbringgreaterrewardsinalargercountry.Butwhensomethingmorethana competencehasbeenacquired,one'schiefrewardmustsurelylieintherealisationofachievement.Tohavedonethebestthatonecouldintheexistingconditionsandcircumstancesaffordsgratificationofthehighest,whetherinJamaicaorelsewhere.SoI,lookingaroundforillustrationsof success,andofaccomplishmentnoteworthy,confinemyinvestigationstoJamaicaandmyeulogytothepersonsIknow,feelingthat if incentivesareneededandareofvalue,and if appreciationisdue,myexamplescanaswellbedrawnfromJamaicaasfromanycountrybeyondourshores.THECITADEL(Continued,fTomPage3)hapshalfanhouratropicalstormwouldbreakoverthetown.Suchstormswerealwaysofshortdurationbutofextremeviolence.Heglancedathisfinebluecoatwithitsgleamingbuttons;itwouldnotbewelltoletthis,hisbestapparel,sufferfromthedownpour.ThreesquaresawaytheHoteldelaRepubliquesuggestedfriendlyrefuge.Therehecoulddineuntiltherainwasover.THElonglowroomwascrowdedandtheairwaspungentwithtobaccosmokeandthesmellsofcooking.Officers ofChristophefilledthetables,gayuniformscontrastingwiththestripedsuitsof cottonorlinenofthecivilians.Frenchwastheirspeech, ahumof Gallicwordslikethesoundofswarmingbees.AtthetablenexttoBushfivemenweredining,andhewatchedthemwithidleinterest.Thebottleswereopenedwithincreasingfrequencyandtheirvoicesgrewproportionatelylouderastheydrank. -rhey wereinuniform,officers all,andfromtheheavybullionontheirgreencoatsheidentifiedthemasprobablyattachedtosomecrackregimentof Chris tophEL TheywerediscussingtheKing'sgreatfortressandtheirignorantboastingamusedhim.ThenthetalkturnedtotheKing'scourtatthePalaceofSansSouciandthecoarsestoriesoflicentiousness tilled himwithadisgustthatmighthavebeenreadinhisface. One ofthefive, ashorteffeminate-lookingmulatto.roseunsteadilytohisfeet.WithamusementBushwatchedhisswayingflgureandthefilledglassinhisunsteadyhandslopitscontentsonthemanathisright.Hebegantoaddressacompanionacrossthetable."MoncherNicholas-"saidthelittleman.LikeaslapacrossthefacethenamegalvanizedBushintorigidattention.Themulattobabbled ondrunkenly,andthensatsuddenlydown.FromhischairNicholasroseheavilyandliftedabrimmingglass.Hewasaffectedbythewinethathehadbeendrinking,buthewasstillincommand of himself.Leaningacrossthetable,Bushstrainedhis ears forthewords. Nich(llas wasrespondingtothetoast.Inthemost po"lished Frenchherecountedacoarsestory.Theveryrefinementofhisvoiceandmannermagnifieditsgrossness.Hiscomradeswerelaughingimmoderately.Hewasstilltalking.Suddenlyfromhislipsfell asentencethatfor amomentmadeBushsitrigidinhischair.ClearabovethetumultoftheroomheheardthenameofVirginie.Thevileboast of thiseducatedhalf-breedaboutthewhitegirlwhomhewastowedburnedlikefireacrossthebrainofthePhiladelphian.WithasinglemovementBushleapedfromhischair.Therewasacrashofshatteredchinaandthesmalltablerolledacrossthefloor.Nicholasturnedtowardhimaheavywhiteface,andBetweenthestartledeyesBush'sfistsmashedlikeahammerandhesawNicholasdropattheimpactacrossthetable top.Therewasmomentarysilence,thentumultfill edtheroom.Everyonewasstanding,jostlingtocatchabetterview.Thelittlemulattowasscreamingvilewordsinahigh,shrillvoice.Anominousnotegrewstrongerintheroar oE voices.FromthetableNicholaswasbeingliftedtohisfeet,hisfacesmearedwithbrightredblood. Athinswordbladeglitteredatthesideofthemulatto,andBushsawaknifeinthehandoftheofficerwhohadsatatthelefthandof Nicholas.Themulattowasedginghiswayaroundthetable,thethinbladegleaminginthecandlelight.Bushcouldnothaverecountedcoherentlywhathappenedinthethreeorfourminuteswhichimmediatelyfollowed. As awhiteman,hewasatbestbarelytoleratedatLeCap;itrequiredonlysomeactsuchashehadjustcommittedtoturneverythingagainsthim.Therewasarushtowardhim.A pistolroaredlikeacannon:abulletgrazedhisear,anda pall ofpowdersmokestifled him.Withhisbacktothewallheswungthechairinwhichheh3dbeensittingandsawtheface ofthemulattosinksuddenlybeneathit.Itwasachairsolidlybuiltandagainheswungitina half-circlethatclearedanopen placebeforehim.Hewasnownearthedoor. Ablackhandreachedforhisthroat.Hesnatchedatableknifeandstabbedblindly.Therewasthedoor!Thecrowdwaspressingforward.Withhislefthandhegropedforhispistol;hisfingers foundit;heleveleditatthecrowd."ThefirstmanwhocrossesthatdoorI'llkill,"heshouted.Thenheslippedaroundthedoorframetothestreet. rainwas fallin!!: ina deluge.theroadwasaquagmire.Fromtheskythelightningquiver-ed recurrentgreen-whiteflashes.Howlongwouldtheywaitbeforesomeonefollowedhimthroughthedoor?Aminuteatthemost.Thatwouldbehisstart.Heranashehadneverrunbefore,fordeathfollowed.Therewerenopassersonthestreet,buthereandtherealightshoneina house.Therainbeatagainsthisface;intheglareofthelightninghesawtheroadasthroughasilvercurtainoffallingwater,black-gleamingwithmuddypools.Thepistolwasstillclutchedinhishandbuttheprimingwaswetanditwasworthless.Heglancedoverhisshoulder.Inaquiveringflashhesawacrowd ofblackiguresaboutthedoor oftheinn.Hedodgedaroundacorner.Therewasthelanding!"Luke!"heshouted.Themutesteppedoutfrom thl' shelterof a shed.Withthenegrohescrambleddowntothelandingstageandflung freethepainter.AlreadyLukehadtheoarsinthewater.Theboatshotforwardandthedockdisappearedintheblackness.Inthe f3r distanceBushheardcriesandthesoundofpistolshots.Forthetimebeinghewassafe.THEmorningwasglorious.Coolandsteady,theoffshorewinddrovetheLucynorthwardacrossaseaofunbelievableblue,beneathanazuresky. Onthepoop-deckJohnBushwatchedwithhalfshuteyestheretreatingcoastlineoftheisland.WiththevestigeofasmileinhisblueeyesBushrecollectedtheincidentsofthatcrowdedeveningofyesterday.Huggetthadbeenwaitingatthetop oftheladderwhenBushclimbed onboard.Inthefaintgleamoftheanchorlighthisblacktarpaulinglistenedlikeglassinthedownpour, avarniEhedstrawhatthrewhisfaceintocompleteshadowanadrippedwaterlikeagutter.Bushhadcome tothepointhurriedly.Therainwasstopping.Ontheshoremorelightsweremovingabout.Beforelongaboatwouldunquestionably be putoff. If he refused toletthemonboardtheymighttrytotaketheLucyby force."Getthemenon deckandmakesaiL"Hemeasuredwithhiseyethedistancetotheshoreandstudiedthedirection of thewind.Itwasblowingstronganddirectlyouttosea.Notimetoweighanchor.Thewindwouldkeepheroffshore;they('ouldputsailonherwhileshedrifted.Hepicked aboardingaxeoutoftherackandwentforward.Asheran,theboatswain'spipewastrillinganda found of voicescamefromtheforecastlescuttle,voices of menawakenedfromheavysleep. There was

PAGE 17

1925-26 P-LA TERS'PUNCH15muchswearing;thenheheardthemcominguptheladder tothedeck.Withactroke of theaxeheseveredthestarboardcableatthehawse-pipe,andthe Lvey wasfree.Someonehadfired agunastheydriftedpastthe town.The stll'rS wereoutagainandshoneonthegreatgray foresail thatwasalreadyswellinginthebreeze.Theywereinplainviewnow,theghostota shipslidingfasterandfasterover ablackseainthestarlight.Thenfrombehindthefiying cloudscamethemoon.Farasternalongboatlaywithidleoars inthesoftlight.Hewasoutofitnonetoo800n.Bush cameoutofhisreveriewithastart;itwasHuggett's voiceathisshoulder."We'reallclear of the land, sir.HowshallIsteer?"Foranhour,whilehewatchedtherecedinghills,thatquestionhadbeenuppermostinhismind."Layher wellnorth of TortugaandthenmakefortheMole,"heanswered.Then,squaringhimselfuntilhefacedthestolidcountenance of Huggett,hecon tinuedina lowertone:"Idon'tknowwhatthementhink,butletitbeastheywill.Theyknowwellenoughaboutwhathappened.Iwantyoutoknowthe wholeyarnthough,Mr.Huggett,butnotnow.WearegoingtotheMole formorecotIee.Thatsoundsreasonable,andtheremaybe somethere.PerhapsI'llhaveyoutakethebrighomewithoutme."Hegavea swift glanceatthedistantshore."I'mdeepinsomethingserious,Mr.Huggett.I'llaskyoutoservemeinyourbeststyle."Huggett'sredhandhitchedathiswaistband."Captain,youain'tfoundTomHuggettlackingyet."Outofthecornerofhiseyehecaughtthemanatthewheel."Keepherawaythere,"heroared,asthoughrepeatinganorderreceivedfromthecaptain."Setthetopsail,yelubbers.Livelynow, loosethetop gallant sail."TheLucyspedawaybeforethewind,butintheCaribbeanwereEnglishmen-of-war,andsoon oneofthemwasbentinchaseofher,forEnglandandAmericawereatwar.TheEnglishfrigate'sguns carr:ed far;theysetthe l/ucy onfire,butshegot -away, thanksto the swiftnesswithwhichshesailed.Herday, however,wasdone;Bushandhismenwerecompelledtotaketothelongboat,andtheywatchedhcrtillshesank.Thentheyheadedforthelittleisland of Tortuga.INtheearlymorningfollowingthatnightonwhichJohnBushhadsohurriedlyputtosea, VirginieGoutierawakenedfromherquietsleepwithapresentiment of evil.Cheerfulsunshinefioodedtheroomandshonelikea goldenhazethroughthewhitegauzecurtain of herbed. T)1e airwasstill,butlittlehouseholdsoundscamefaintlytoherears.PeaceseemedtobroodovertheroofofLeroyMangan.Thentoherawakenedbraincamesharpasdaggerthruststheterrifyingthoughts-wouldPierreNicholasattempttoconsummatetheweddingwhichherguardianhad saI!ctioned beforeshecould etIectherescape,andhadsomemisfortunefallenuponJohnBush,inwhomsherecognizedheronlypos sibledeliverer?Fourdayshadpassedsinceshehadseenthehatedface of Nicholas,butitwasalmostaslongsincethateveningwhenBushhadbeenrequestedbyLeroyMangantoleavehishouse.Whatcould bethesignificance of thissilence?HadthearousedantagonismofherguardianfollowedtheyoungAmericanbeyondthegate?SheknewonlytoowellhowcheapwasdeathandhowsilentlyitcouldappearintheHaitiancity.Shefiungherfaceagainstthepillow, dry-eyedin the terrorofherthoughts.ToVirginieGoutierthePhiladelphiancaptainhadcome clothedinalltheromance of herdreams.Neverhad sheforgottenhisstalwartfigureandsmilingface sincethefirstdaythattheyhadmet.Inthemonthsthatintervenedshehadbuiltaroundhismemorytheattributesofalltheloversofhistory.Inthesecludedgarden of herlifehehadbecomeherconstantcompanion;hewastheembodimentofallthatearthheld of braveryandgentlenessandpassion.Butlongdayshadgonebysincethatnight,andstillnowordfrom him.Hadsomethinghappenedtohim,orwashesecretlyplanningsomedaringmoveforherrescue?Torelieveheranxietysheplayedwiththelatterthought,butthroughthefascinatingromancewhichherfancy wove cameagainandagaintheproddingfear:lifewasso cheapinLeCap.Shebreakfastedearlyandalone.ItwascustomaryforLeroyMangantodrinkhischocolateinbedandtoariselateinthemorning.Inobediencetoherorderher'carriagewaswaitingbeforethedoor.Shegavethecoachmanherinstructionsandleanedbackamongthecushions.ThehorsescametoastopbeforethewarehouseofMonsieurSamatan.Fromthestepsshecouldseealloftheharbour.Novesselrodeatanchoronthesmoothwaterorrestedagainstthewharves.SomewhereandforsomereasonthebrigofJohnBushwasgone.NapoleonSamatangreetedherwithaprofoundcourtesywhichgavenoindicationofthesurprisewhichherearly-morningcalloccasioned.Gallantly he bowedhertoachair,andflungbacktheshuttersofawindowthatthebreezemightcooltheroom."MonsieurSamatan,"she began abruptly,"eversinceIwasalittlegirlyouhavebeenverykindto me. Youknewmyfatherandmymother.CanItrustyouwithmyconfidence?" "Mademoiselle,itwouldbemygreatesthappinesstoserveyou."Shelookedintentlyatthedarklevel eyes of themerchantandtheirhonestandfriendlygazeconfirmedherconfidence."CaptainBush-he,too,isyourfriend?"shecontinued."Oui, mademoiselle,thereisnomanwhomI regardwithdeeper atl'ection,""Whathashappenedtohim?"Sheleanedforward,herlong fingers laceduponherknees,herdeep eyesimploring.MonsieurSamatanmadeanexpressivegestureofdespairwithhishands."Itisastrangestory,made moiselle.HehasleftLeCap;quickly,forhissafety.ButIshalltellyou."Thenwithdramaticinterpretationherecountedthestory,ashehadheardit,ofBush'sencounterwithPierreNicholas,and of hisescapefromtheharbourontheeveningprevious,Whenhehadfinished,Virginiegotup fTl mthechairandlaidherhandsinhisashestoodbeforeher."MonsieurSamatan,hewillreturn.Formysake,hehasdonethesethings.Youaloneknowofthis. My secretisinyourkeeping. Ashisfriend,andasthefriend of myparents,Iappealtoyoutoaidusiftheneedarises!"MonsieurSamatanwasdeeply atIected."Iwillpromisethat,"hesaid,simply.EVERsincetheLucyhadbeenabandonedBushhadkeptasharpwatchonthehorizon.AlthoughasailmightmeanadesirablerescuehewasawarethatthechanceswereslightthatitmightbeanAmericanoraneutralvessel,andanythingwaspreferable to capturebyanEnglishman,merchantshiporman-of-war.TherewasalargenumberofYankeeprivateersatsea, however,andifone of theseshouldchanceupontheopenboatnothingcould bemorefortunate,forsucha rescue wouldinsuretheirultimatelandingatanAmericanportor, forthatmatter,ataneutralport,fromwhencehecouldmorereadilycarryouthisplanfor areturntoLeCap.Itwasaccordinglywithnosmallemotionthatshortlybefore noonontheseconddaythetopsails o{ asmallbrigweresightedonthehorizon,apparentlyholdinga coursethatwithina fewhourswouldbringherwithinhailoftheopen boat.ForalongtimeBushhadbeenplaningacourseofaction,buthehadnotyetdisclosedhisplanstoHuggettorthecrew. Now, however,hedeterminedtosoundtheirinclinations,fortheschemewhichhisactiveimaginationhadengenderedrequiredtheimplicitsupportof all. "If yonbrigisofourpeople,"heexplained,whiletherowerstrailedtheiroarsandtheotherssatwithbeardedfacesturnedtohim,"alliswell.ButIdoubtgreatlyifasmalltradingbrig-forsuchsheappearstobe-wouldbeinthesewatersunlessshe i!l Englishorofanothercountry.YouwillrememberhowmuchalonetheLucyhasbeen,theseyearsofthewar. If wearetakenupbyanEnglishship,theconsequencesarewellknowntoyou.Escapeisimpossible.Butthereisanalternativewhich, if you'rethebreedofmenthatI believeyoutobe,canbeattempted.AreyouofamindtofollOWme?"Alanksailorwithsun-bleachedhairbrokethemoment of silencethatensued. "Aye,captain,we'rewithyeoButwhatmaybetheplan?"Theothersnoddedinassent."Therearenow eleven ofusinall,"Bushcon tinued. "Wehavecutlassesandtomahawksandtherearesixpistolsinthestorechest.Iwouldhaveallbutthreehidebeneaththecanvas,whiletheotherswiththesailwillholdacoursealongthewind. If wemakeherouttobeAmericanora neutral,wellandgood,butifEnglish,wewillsignalourdistress;and if oncewecangetalongsideofherwithouttheirsuspicionthatothersarehidbeneaththesails,there'saslimchance,butouronlychance, wecantakeherby force."Therewasamurmurofapprovalfromthemen.Theblackfaceofthenegro,Luke,brokeintoabroadsmileandhewaggedhisheadvigorously."And if wetakethebrigandsheproveswellladen,willtherebe adivisionoftheprizemoney?"askedone of themen."Therewillbetheusualdivision,"Bushanswered. "If shecarriesavaluablecargotherewillbe arichreward."Ahalf-hourpassedandthebrigwasnownotmorethanamileaway.TwiceHuggetthadstoodinthesternandwavedhisshirtabovehishead,buttherehadbeennoapparentsignofrecognitionfromtheship. Onceagainhesteadiedhimselfonspreadlegsandshookthetorn,whitegarmentintheair.Slowlythebrigswungapoint oft hercourseandasthetwowatchesrecognizedthisevidencethattheyweresighted,theredensignwasrapidlyhoistedtothepeakandagainloweredtothedeck.Bushpassedtheinformationontothecrew."She'sEnglish!Tenminutes,lads,andshe'llbe alongside.NotasoundthereuntilIgivetheword;thenfollow me. Asurpriseisouronlychance."THEbrigheadedtowardthem,thebluewaternowandthenwhiteningbeneathher blutI bow.Shewasheavilyladenandinthelightbreezelabouredalmostastboughwater-logged.Bushhadconcealedhisglassbeneathathwart,for nowhecouldclearlyscanherdeckwithhisnakedeye. Asailorinthebow wastheonlysignoflifethatwasVisible. Apparentlytheirappearancehadcreatednoparticularinterest.InanundertoneHuggettcalledattentiontothegunportspiercedinthelowbulwark.Peace ableaswasherappearance,thebrig,liketheLucy,waseVidentlyarmedtotakecareofherself.Anothersailornow joinedthewatcherinthebow.Bushwavedhisarmtothemandoneofthemenlifteda coil oflineabovehishead. So slowlywasthebrigmovingthroughthewaterthatitwasevidentthatthesailorintendedtocastalinetothelongboatandbringitalongsidewithoutstoppinghisownprogress.Huggettgaveaquicklook ofsatisfactionatthecaptain.To be pickedupinthisfashionwouldnotnecessitatethepresenceof officersormenondeck.,Itmaybequestionedhow aman of theintegrityandcourageofJohnBushcouldpurposetotakeby force a peacefulmerchantmanthusprotIeringaserviceofmercytotwocastawaysinasmallboatinanemptysea.Butitmustbeconstantyrememberedthatawarofsingularbitternesswasthenin pro gressbetweenEnglandandtheUnitedStatesandthattheimpressment of YankeesailorsbyBritishmen-of-warhadplayednosmallpartamongthecausesofthatstruggle.Accordingly,intheeyes or JohnBush,thisslow-ploddingEnglishmerchantmanwasfairgametobag if hewereable todosobytheingeniousstrategythathehaddeterminedtoex ecute.Inanotherminutethehigh,bluntbowof the brigloomed abovethem.Anorderwasbawled aft bythesailortothesteersman,thecoil of rope came singingthroughtheairandHuggett,catchingitoverhisarm,madefastwithahitcharounda forwardthwart.Thegunwaleofthelongboattouchedthebrig'8plankingandashefelttheslightshockBushwhipped apistolfrombeneathhiscoatandsprangfor tha channel,hishandsgraspingthechainsthatsecuredthedeadeyesoftheshrouds.Asheleapedhegavea shout."Nowthen!"Butthemenneedednowordofaction.Thesailswerethrustbackandfromthebottomof the boattheyfollowedtheircaptainwitharushintothechains.Sosuddenandsounexpectedwastheattackthatnotoneoftheship'screwforafewvitalsecondsresistedtheironset.WithaleapBushclearedthebulwarkandhisfeetstruckthedeck.AlreadyHuggettwasathisside.Fromthepoopcametheroarof apistolandabulletsangpasthishead. He sawthemanwhofiredandtheroarofhisownpistolwastheinstantanswer.Witharushoneofthebrig'screw flunghimselfagainstthem,along pike inhishandsthatburieditslance-likeheadinthechestofthelastmantoleavethelongboatjustashisbodyappearedabovethegunwale.Cutlasseswereclashing.Two,three,fourmorepistolshotsroaredviciously. AmandroppedatBush'sfeetandrolled(.creamingintothescupper,hisheadclovenwitha cutlass. Twootherswerecrumpledonthe white planking.Ofthebrig'screwwhohadbeenondeckbutoneremained,andhewasclimbingnowforlifetothemaintop.Thebrigwastaken.DuringthenexthourBushinspectedhisnewcommandandinterviewedtheprisoners."Hercules"washername;abrigaboutthesamesizeas the Lucy,butdesignedalongthebroad, blutI linesofanIndiamanratherthanaccordingtothesharp, tine mold ofthelittlePhiladelphiablockaderunner. She wasEnglishbuiltandEnglish-mannedandhadsall('dfourweekspreviousfromPortsmouthforPortRoyal with amixedcargo of merchandize.ThearmamentoftheHerculeswasamatterofnosmallimportanceandBushobservedwithsatisfactionthatfivecarronadescomprisedhermainbattery.inadditiontotwosmallbrasscannononthepoop. Obviouslynomatchforaprivateer,shewasstillbynomeansdefenceless,andfortheplanwhichBushnowdeliberatedherarmamentwasallthathe re quired.CHAPTERIVRISINGsharplyfromaseaofglitteringblue, the islandofTortugafiungitsgreenshadowagainstthepalebandofthehorizon.Earlyinthemorningthelookoutintheforetophadannouncedthelandfalltothedeck,anda fewminuteslaterLukehadrousedhismasterfromtheheavysleepinwhichhehadsunk,wrappedinagreatcoatinanangleofthepoopbulwark,toseethebearingofthenowclearlyvisible lano. Hiseyeswerestillheavywithsleepandforamomenthestoodinstupefiedbewilderment,u"ncertainwhethertobelievethemadprocessionordreamsfromwhichhehadbeenawakenedortoaccepttherealityoftheday.Hehadpreferredtostayondeckduringthenightandinthehoursbetweenm1l1nightand the dawnhehadagainwalkedinthegarden of MonsieurManganwithVirginie'swhiteshoulderbesidehimgleaminginthemoonlight.Theywerehappy dreama(Continuedon Page 1"1)

PAGE 18

16PLANTER S'PUNCH1925-26VEHICULAR PSYCHOLOGY MOTOR.CARTHETHUShasthemotorcarshattered,orbidsfairtoshatter,thestructureof awell-organisedso ciety.Theoutwardandvisiblesignsofsocialdistinctionaredisappearing.Theverythingthattwentyyearsago wasthoughttomakethemoststrikingdifference betweentheclassesisnowhelpingtoobliteratethatdifference. Goanywhere,standanywhere,andyouwillseethatthisisso. Comes asplendidseven-seaterautomobile,anditsoccupantslollbackintheirseatslikegodsandgoddesses of ancientreligions. CdmesimmediatelyafteraDodgeoraBuickthathasseenbetterdaysbutisstillserviceable.Itiscrowdedtoitsutmostcapacity whiGh_ istosaythat if isovercrowded;itcarrieseightpersonsinsteadofthefiveitwasbuilttoaccommodate;itwasboughtsecond-hand,ithasbeentinkeredagainandagain,itisrackety,itisnoisy,butitmovesandmakesadust,andthosewhoareinit,enjoythemselvesquiteasmuchasthosein th9 precedingnewmotor.Theylovetheircarasmuchasyou do,sirormadam,whopaidathousandpoundsforyours.Theydriveitthemselves-alltheboyscandrive,andthegirlsarelearningalso.Theycangoanywhereinit,andtheymakesacrificestoobtain'thenecessaryoilandgasto supplythepower.Thereadsareallopentothem,andtheyopentheir"cutouts"toyouwhentheyrushpastyouontheroad.Theysignalyou to givethemtheway,theyraceyou,theyenjoyleavingyou behind.Andperhapsyouask,astonishedandindignant,"howdotheydoit?"Well,howdo weanyof us doanything?Bywanting sufficiently muchto doit,forwherethereisawillthereisa way.ThemotorcarhasevokedmorewillpowerthananyotherfactorinJamaica.Themotorcar,whichwasatfirsttheexclusiveappanageofthebetter-off classes,andthesymbolofsocialsuperiority,hasnow becomethetokenandmanifestationof atriumphingdemocracy.Thehorseis going.Thedonkeywill followsuit.Intimeeveryonewillrideinmotorcar,taxiormotortrUCk.ITislikethis.Afterhavingusedacarforthreeorfouryears,agentleman'sfamilyfindsthatitisnolongerfit to be seen.Whichmeansthattheynolongercareto beseenin it, Ithasbecomeshabby-looking,itmakesmorethantheusualamountofnoisethatisexpectedfromanydecently-conductedmotorcar.Itisnotasnice-lookingasMrs.Richly'ssix-cylinderBuick,orMrs.Showem'sballoon-tyreDodge,oreven Mr.Desplay'sFordSedan.ThiscausestheRichlysandtheShowemstolookdownonaman'sfamily,andthatisthesortofthingthatnoman'sfamilycanstand.So anewcarhastobegotfor loveorcredit,andaslove doesnotgoveryfarinthebusinessworldthesystemofpurchaseontheinstalmentplanhastobeevoked.Butin Uie somereadycashisdesirable.Indeed,itISabsolutelynecessary.Sotheoldcaris alllWunc edasfor sale,andpeoplewhooncewouldhavebeenconsideredascondemnedirrevocablyandforevertothecabandtramwayclasscomeforwardwithpracticaloffers.Thuscarsthatwereoriginallypurchasedforthreehundredpoundsmightchangehandsforfiftyorso.ThepopularBuick,theappreciatedDodge,canbehadsecond-hand.Fordsthatoriginallyfetched ahundredandtwentypoundshavebeenknowntopassintonewownershipforabaretwenty.Mr.Jenkinsbuysone.Hehassavedwithjustthisendinview.Hecannotdriveacarhimselfandneverwill:itwouldbesuicideforhimtoattempttodoso.Buthissoncan:Roberthaslearnt;more,RobertcantakeacartopiecesanySundayand 1!.x. -up afterwards,and that isoftenRobert'soccupationonaSundayafternoon.SoalltheJenkinsofthiscityandislandhavetheireyesonmotorcars,andnottheyalone. Allclassesthinkintermsofmotorcars."Myoneambition,"saysamanwhousesthetramhabitually,"istohaveamotorcar."Heisgoingtorealisehisambition.Itisa compellingambition,anutterlyabsorbingone,andnomanwhosetshisminduponanobjectnotimpossiblewillfailtoattainhisend.perforcehadtodrivetheirowncarsorkeepthemonexhibitioninthedrawingroomsathome.Butarevolutionwasstillto come,therevolutionwhichisnowinprogressamongusandbe-sidewhichthatfomentedbyLeninandTrostkyinRussiaismerechild'splay.InJamaicawe usedtobesticklersfortheproperthingonthesocialsideoflife.Westillare,to.acertainextent.Butwhenthehighestclasseschange,andtheclassesjustbelowthehighestfollowsuit,thentheclassesjustbelowtheclassesthatarejust below thehighestdeemthattheycanchangealso-whichistruedemocracy.Thisneveroccurredtothemenwhofirstsettheexampleof"everymanhisownchauffeur."Thesedidnotseethatyoungmenwhocouldneverhavebecomecoachmenandgroomswouldconsenttobecometheirownchauffeurs.Yetsoithasbeen,andthischangehasbeenfaciliated, e\'en broughtabout,bytheappearanceof a phenomenonknownasthesecond-handmotorcar.toreadjustthesorely-disturbedbalancesofsocialjustice.ANDsomethingwasdone.Thebuggiesbegantodisappear.Thecostofacar,andofitsyearlymaintenance,wasmuchhigherthanthatof a buggyorevenacarriage;yetitwasmet.Morecarsappearedthantherehadbeenbuggies;garagesbegantospringupallovertheisland,horsesdied of abrokenheart,thefourclassesofsocietywereagainreducedtothree.Itseemedas thOugh the balance'" ofsocialjusticeand prvilnety werebeingnicelyadjustedonceagain,and tie outwardandvisiblesigns of superioritywere aLJ0ut to becomeevenmoreimmutablyfixedthanbefOre.ltmightbethatsomewhohadnorighttoownmotorcarsdidhavethem.Itmightbethatmenandwomen who,quiteobviously,shouldrideinthetramsorinthecabshadactuallybeenabletopurchasemotorcars,andtopaycashforthem too--which wassettingabadexample. Allthiswasdeplorable,yetonthewholetherewasa differenceestablished,a differencewhichwentaboutsplendidlyuponwheelsandspatteredmudaboutduringandafterrain."Theyaremotorcarpeople now,"saidMarthatoMaryintonesof awe.Thebuggypeoplehadbecome completelytransformedintohigherandmorecelestialbeings.Butnoonecanforetellthefuture.Whenwesavthat"thisisademocraticage," weusewordsthefull forceandsignificance ofwhichwedonotunderstand.Democracyreallymeansthateverybodywantsto dojustwhateverybodyelse, of thebestclass,isdoing,anddoesnotseewhyeverybodywhoisnotdoingitshouldnotdo it.Thuswhenalabourerstrikesandatthesametimeprotestsagainsttheidlerich,whathemeansisthathewantstobeidlehimself.Andofcoursehewantsto berichbutsimplyisnot sufficiently intelligentto so.WhenMarthaceasestoregardwithawethosewhoownmotorcars,shebegins,andthatquickly,tofeelthatsheandMaryshouldhaveacaralso:atthisstageshedenouncespeoplewhohavemotorcarsa.nd loudly"howtheydoit."Thesugges tIOnISthatthey. doiton abasisofcreditandthehopeindubitablyisthatbankruptcywilishortlysupervene.Twentyortwenty-fiveyearsagoMarthaandMarywouldnothavethoughtitpossibletobe buggy folk,but hadnotthenmadeItSappearanceinJamaica.Ithassincethen.Andthatisjustwhattheorthodoxbuggypeople,transformedintomotorcarpeople,nevertookintoconsideration.Thisclasshas'neverbeenabletofore seethefuture.Inthedays of buggiesinJamaicaaboutwhichsomeeruditescholarwilloneday anunreadable book, coachmenhadto be employed,andnogentlemanwouldhavedreamedofbeinghisowncoachman.Hemightdrivehisowntrapoccasionally'buthiscoachmanwouldalwaysbeseatedathis'side.Thenthereusuallyhadto be agroomforthehorses,unlessthecoachmancould bebribedby"feeding"inadditiontowages,toperformthe'functionsofa groom.Forhorsesonerequiredstables,andforthebuggyorbuggiestherehadtobe coach-houses.Thenthecoachmanandthegroomsleptasaruleonthepremises,andforthesetherehadtobe houses. Allthisrequiredalotof space,andtheexpenseofmaintaininga couple of buggieswasnotinconsiderable;whichpartlyexplainswhytherichestofthebuggypeoplewereableatthebeginningtotransformthemselvesintomotorcarpeople.Butwhenthosenotoftherichestclassdeterminedthat,cost itmight,theywouldhavemotorcarsorper Ish lD theattempt,itdawnedupon some ofthemthat.theywouldhavetoperishdidtheyinsistuponhavmgchauffeurs,whoweretheequivalentoftheoriginalcoachmanandgroom.Thenitwasthatthespiritofdemocracybegantotouchthem.Whynotdrivetheircarsthemselves?Andasanoldstablewouldmakeasuitable garage', andasouthousesoncegivenovertotheservice ofcoachmanandgroom could behiredouttothelower classesandso become asourceofirregularrevenue(thelowerclasseshavingalwaysastrongdisinclinationtothepayingofrent),amotorcarmightbemaintainedandsocialstandardsupheldintheveryteethofadversefinancialcircumstances.To gr?om ahorseandwasha buggy, todrivethatvehiclealso,wasamenialoccupation.Buttodriveacarrequiredskillandmightberegardedasagentlemanlyoccupation."Everymanhisownchauffeur"thereforebecametheunuttered matto ofmany;theboldestledtheway;theothersfollowed;andasevenmenwithchauffeursoftendrovetheirowncarsanddelightedindoingso, nosocialstigmaresteduponthosewhohadno'chauffeursandsoTHEyearspassed,thebuggyslowlybegantogiveplacetothemotorcar,andinsomecountries it wassaidthatanewgulfhadopenedbetweentherichandthepoor,betweenthepeopleinsocietyandthosenotinsociety;thiswassaidespeciallyinEngland,forinAmericaMr.HenryFordhadmadeitimpossiblefortherichtomonopolisethemotorcar.ItwassaidinJamaicaalso.Thosewhoownedcarriages(whichwasanotherandgrandernameforthelarger-sizedbuggies)butwho couldnotaffordamotorcar,spokebitterlyofthehorselessconveyanceanddeclaredloudlythattheywouldnevertrustthem .selves inone. More,they affirmed thattheymuchpreferredacarriageto amotorcar(whichwasjustaswell,seeingthattheyhadnotthelatter),andtheypointedoutthesuperiorityofthehorsetoameremachine.All ofwhichdidnotpreventmotor cars fromsteadilybecomingmorefashionable.It -did notpreventthe.gulfbetweenLazarusandDivesfromwideninganddeepening.Thebuggieshadtogiveplacetothemotorcarupontheroadwhenthecarsoundeditshaughtywarninganddemandedrighto(way,anditwasmosthumiliatingtohavetoletthecarrushpast,especiallyasitalwaysleftthebuggypeopleina cloudofdustthoughtfullystirredupbythedeliberateopeningofwhatisknownasthemotorcar's"cutout.".TheworldofJamaicathenbecamedividedintofourmainclasses:motorcarpeople,buggypeople,tramandcabpeople,andwalkingpeople.Thewalkingpeoplewereforthemostpartdisregarded.Theybeingonlythemajoritywhogrewfoodandperform ed foratriflingremunerationthemostnecessaryoperationsof acountry'slife,didnotneedtobeconsidered.Theywouldalwayswalkanyhow,andwalkingwasnodoubtgoodforthem,whereasitwashigh'lydetrimentaltopersonsof a finerandmoreexqui-sitephysicalandmentalorganisation.Thefolkofthisfinerandmoredelicateorganisationneededexercise,itistrue,buttheycouldgetitfrom Clricket, tennis,golf;andasgolfcourseswerefewin ..Jamaica, andwouldalwaysbe so,themotorcarfolktooktogolfingastheirchiefformofrecreationalexercise.Thisfurtherservedtomarkthem off fromotherclassesofthepopulation.Andiftheywere Clompelled towalk,theydiditunderprotest,orrather,withanexcuse,andneverformorethanahundredyardsatonce.Thetramandcabpeopleweremostlythebetterclasswageearners,whoalwaysspokeoftheirpayas"salary."Theytoohadthehighestsocialaspirationsandanyamountofpride,buttheyhadnot,andthoughtthenthattheyneverwouldhave,thepurseWhich,withpride,wouldhavelandedthemamongthebuggyfolkorthemotorcarhierarchy.Theywatchedthesefromtheoutside,sotospeak,withanenvythatwasalmostsocialistic.Why,theyaskedthemselves,whyshouldsome peoplehavebuggies,andothersmotorcars,othersquiteasgoodhadperforcetocontentthemselveswiththeordinarystreetcarandanoccasional cab;andtothisquestionneitherheavennorearthreturnedananswer.Buttheirbitternesswasnothingtothebitternessofbuggyfolkwhenthesesawpersonsofmoreorlessthesamesocialsphere,orlower,rollingalongthestreetsandroadsinmotorcars.ItseemedthentothebuggypeoplethatProvidencehadfallenasleepor had forgottenitsduties.Itwasclearthatsomethinghadto bedonetorighttheexistingwrongand"THEYarebuggypeo ple,"saidMarthatoMaryintonesofrespect.Shewasreferringtothefolkwholivednotahundredyardsfromthemandwhowerevisitedby-friendsinsingleanddoublebuggies,drawnbysingleorpairsofhorses,andwho,of course,alsohadabuggyortwooftheirown.MarthaandMary,'likeLilianandLucy,oranyothertwoormore yoWlS ladiesofthisquitemodestclass,neitherowneda buggynorboastedofrelativeswhodidso.Theyweremainlytram-carpeople,whooccasionallyhireda'busorcab,andtothemthepossessionofabuggyindicatedadefinitesocialstatus,andacquaintanceshiporfriendshipwith"buggypeople"wasaprivi-legenottobedespised.Thiswasabouttwentyyearsago.Theexternalsof socialsuperioritythenwere,asnow, a fineresidence,manyservants,andfreedom -to attendthedancesatthebestclubsandhotels.Butthechiefexternalorobvioushallmarkof such superioritywasa buggy,preferablyonewhichcouldaccommodatethreeorfourpersonsbesidesthedriver and whichwasdrawnbyapairofhigh-steppinghorsesthatchampedthebitandseemedotherwiseconsciousthattheyweresymbolsof agreatandmightystate. Bven thentherewerepersonswithbuggieswhowerenotinsocietyornotonthewayto that sphere;neverthelessthetwo-horsevehicleremainedtheoutwardandvisiblesignofinwardsocialgraceandhappmess,andtherewasagulffixedbetweenthosewhohadbuggiesandthosewhohadthemnot,aboutasimpassableasthatwhichdividedLazarusfromDives.

PAGE 19

1925-26PLAN,TERS'PUNCH17THECITADEL (Contimtedfrom, Page15)andrealitycamewithadullshockasheblinkedhiseyesinthesunlight.BushatethebreadandcoffeethatLukebroughttohimonthepoop deck,andbythetimehehadfinished,theloftymountainsofTortugaweresharplydefinedagainstthesky.Themenwereallondeckexceptthewatchwhichhadjustbeenrelievedandhadgonebelow.Forward,aguardwassittingonabittneartheforecastehatch,a cockedandloadedpistolacrosshisknees;therewasnootherindicationthatthe Hercules wasnotthepeacefulmerchantmanthatshehadseemeduntiltherecentoccurrences."Mr.Huggett!"hecalled.Thefirstmatehurriedaft."Mustertheprisonersondeck."Onebyonetheyappearedfromtheforecastle,asullenlittlegroupthatstaredboldlyintothefaces oftheircaptorsandslouchednonchalantlyagainstthebulwark.Bushwalkedforwardandfacedthem."Byafternoon,"hesaid,"weshallbe offTortuga.AtthattimeIshallfreeyouandplaceyouinthelongboatwiththenecessaryarmsandprovisionsforyoursustenance.Ishallinstructyourcaptaintoproceedimmediatelytotheshoreandshallsuggestthatyoumakeyourwaytotheharbouronthesouthsideoftheislandwhereyoucanobtainshelterand,ultimately,passage."LATEintheafternoonBushgavetheordertothesteersmantobringthe Hercules intothewind.Alldaythebreezehadsteadilyfreshenedandatfour o'cloc;;: thesuddenrendingoftheforeroyalintoafringeofflyingribbonstoldBushthathemustshortensailifhewouldsavetheoldandrottencanvas. Slowly duringthedaythegreenmountainsofTortugahadrisenhigherandhigherabovethetornblueofthesea,alongrollingrangethatstretchedawaytotheeastwardfromtheloftyroundedpeakonthewesternendoftheisland.Notmorethanamileofwaternowintervenedbetweenthebrigandtheshore.Itwasrough btit theseas wer& notbreaking,andastheywerenowintheleewardofthelandaboatcouldmakethepassagewithsafety."Lowerawaythelongboat,Mr.Huggett,"Slow ly,thefallswereletgothroughthecreakingsheavesandthesternoftheheavyboatdippedinawavethatslidbeneathher.Thenextmomentshewasridingalongsidethebrig,risingandfallingonthepassingseas.FromthepoopBushwatchedtheoperationandsilentlyenumeratedthevariOUSstoresthatwerepiledhighinherbowandstern."Haveyoueverythingnecessaryintheboat?"heinguired."Thenmustertheprisoners!"Onebyone they emergedfromtheforecastleandstoodwhistlingandtalkinginalittlegroupatthehatchway..HuggetglancedatBushandsawhimnodinanswer."Overyougo,lads!"heshouted.Thelinewasletgoandfellwithaslapacrossthebowofthelongboat.Ridinglowinthewater,theboatslidslowlypastthepoop.InsilencethemenondecksawthelongboatgrowsmallinthedistanceuntilHuggett'sordertomanthebracesbroughtthemtotheirstations.SlowlythesailsfilledastheH eTcules' headfell off be torethewindandwithhermastagainstaggeringunderthecrowdingsailssheresumedhercoursetothesoutheast,herbowpointingdefiantlytowardLeCapFrancaise.Aboutmid-afternoonBushcalledHuggetttothepoopandledhimafttothesternrailwheretheycouldconverseoutofhearingofthesteersman.TheHerculeswassailingwithconsiderablemovementandthesternroseandfellinlongupwardrushesandabruptdescentsthatcausedthemtosteadythemselvesbya firmholdontherail.Beneaththecounterthewakechurnedoutinawide' "path of pale greenandsoapywhitewater,alongtrailthatextendedinsinuouscurvesfarbehindthemintheultramarineoftheheavingsea.Theairwasstrongandcool, heavywithitsburdenofmoistureandoceanfragrance.B RIEFL YBushagainoutlinedhisplantoHuggett,wholistenedwithtacitacceptance;butinhisruggedfaceandhonesteyesBushsawadisapprovaloftheproposedventure.Hewastemptedforatimeto argue, butherealisedthatthemate'sconvictions ".. ere spldom opentocompromiseandthealternative ot: hisownretractionquitenaturallycouldnotoccurtohim.Thenforthefirsttimetherewasatingeof emotion inhisvoice."Youwillinstructthemen,Mr.Huggett,toshotcarronadesandthesesmallones"-hekickedthecarriageofoneofthetwobrassgunsthatsweptthesternashespoke-"withgrape.Havethreechargesofpowderondeckandbreakoutthemagazine.Alsoserveoutcutlassestoallhandsandhavepikesandaxesreadytorepelboarders.Iwantthisdonebeforewecrossthebar.Youwillwaitformeuntilnoonto-morrow.Atthattime,ifIdonotreturn,youwillsailimmediatelyforPhiladelphia,whereyouwillreporttheshipandhercargotomyuncle,Mr.Gilder sleave.Inthedeskinmycabinyouwillfindthenecessarypaperstoauthorizeyourcommand.Serveadoublegrogtoallhandsbeforeweenter.Ishallrelyonyoutoseethatthemenconductthemselvesproperly."ThefirstmateregardedthesailoverthehorizonandthenthenowprominentlandfallofLeMorne,buthisthoughtswerequiteevidentlynotconcernedwitheither."Haveyouanythingyouwishtosay?"Bushconcluded.Huggetthitchedath'sbelt,hisusualpreparatorymovementbeforespeaking."Well,sir,"hefinallymuttered,"it'snotfurmetosay,butItellye,CaptainBush,thisIsbadbusiness.I'veseengoodheadsturnedaforebyaprettyface.Thedevilstheybe,andtheinnocentertheybe,theworsetheybe.It'syourselfI'mthinkingof,CaptainBush.There'sgalsineveryport;finegalsandyoursforthechoosing.Yeaskedmeformysay;I'vesaidit."Hespatoverthesternwiththeemphasisofaperiodtohiswords.ItwasalongspeechforThomasHuggett,the1.lngestthatBushhadeverheardhimmake."Mr.Huggett,Ithankyouforwhatyou'vesaid,"hefinallyanswered.Yourwordsbespeakyourloyalty.AsforwhatIpurpose,thatIshallcarryoutasIhavedescribedtoyou. Youcanshowyourloyaltybycarryingoutmyorderstotheletter.""ThatI'lldo,captain."Theafternoonwaswearingtoagloriousclose.Higharoundthehorizonthegreatcreamycumuluscloudspiledoneuponanotheruptothebluevaultabove.Beneaththemwasthesea, amoving,livingsurfaceofdeepestblue.AndontherightlaythehighshoresofHaiti,brightgreeninthemellowlight.Thewesterncloudswereflamingwithunbelievablecolour.Sunsetwasbutashorttimeaway.ThesunwaslowastheHerculescrossedthebar,itsslantingraysstrikingforabriefminutetheredflag ofEnglandthatwhippedoutstraightfromthehalyardsatthepeak.Ina finalconflagrationthesundippedbeyondthehorizon.Intheeastthesmoothwhiteclouds glowedpinkinthereflectedlight.Thenthedayended. Twomilesawaya fewlightsalreadygleamedlikefirefliesamongthetrees of LeCap.Therewasthewarmfragrantsmelloflandintheair.AmileoffshoretheHerculescameaboutandwithtopsailsabackranslowlyuntilthesplashoftheanchortoldBushthatthenextchapterInhisadventurouscareerwasathand.AsSOONashehadassuredhimselfthatthebrigwasinreadinesstosailonamoment'snoticeBushwentdowntohiscabin. OnthetableLukehadplacedbreadandmeatandabottleofbrandy.Heatequicklyandsparinglyandwasheddownthedrycrumbswithagulpofsmartingliquor.Hedressedcarefullyandwithaquizzicalsmileonhislipssurveyedinthesmallmirrorthefit ofhiscoatandtheeffect oftheblackmilitaryhatthathehadtakenfromtheEnglishman'scabin.Fromhischesthetooka flatleathercaseandopenedthecover. Apair of finelychasedduelingpistolslaygleamingagainsttheleather.Carefullyheloadedandprimedthemandsecuredtheminhisbeltbeneaththefold ofthegreatcoat.Nextfromthelockeroftheformercaptainofthe Hel'cules hcprovidedhimselfwithaslimdaggerthathehadnoticedtherewhenhe had rummagedthecabinthedayprevious."Tomorrowmorning,"hemutteredtohimself,"weshallbeagainatsea-'weI"Hespokethewordillowly.Thenheadded,"Ifallgoeswell."AshecameondeckBushglancedatthesky.Overheadthestarswereshining,buttheeastwasbankedwithclouds.Themoonwouldriselate,andifthecloudsremaineditwouldbelaterstillbeforeitclimbedintotheclear.Thedarknesswouldproveafriendlyaid.Anumberofthemenwere.loafingaboutthedeck,andhefelttheireyesfixedonhim.Somehowtheirunabashedgazegavehimanunaccustomedsensationofselfconsciousnessandembarrassment.AlanternhadbeenswungnearthegangwayandhesawHuggett'sfacestolidinthelightand be hindhimtheblackfeaturesofthemute,hiseyeswhiteandstaringagainsthisebonface."Youhavemyorders,Mr.Huggett,"hesaidsimply."Ayesir,"themateanswered.Bushlandedatasmallwharfnorthofthemainlanding-stage,aroughunfrequentedstructureusedchieflybythenativefishermen.Alreadyhecouldfeelthewarmbreathoftheheatedlandinhisface,andInthestillnessfaintindefinablesoundscreptoutoverthewater."Luke,youwillwaithereuntilitislight.Then,ifI donotcome,gobacktotheship."Thesmallwavesslappedandchuckedamongthepilesofthewharfanda fishysmellimpregnatedthedampair.QuietlyBushswunghimselfuptothetop ofthewharf.BeneathitalreadyLukewastyingthesmallboat.Unconcerned,Bushrealizedthenegrowouldsleepthereunseenuntildawn.Thelittlewharfwasdeserted,aswasalsothenarrowbeachoneithersideofit.Behindthebeachwasanemptyfield.Beyondwasablackrowofpalmtrees,andthentheroad.Cautiouslyhecross edthestripof openlandandgainedthetrees.Theywereloftycocopalmsandfrombehindahugebulbousbolehepeeredupanddownthewhiteroad.Itwasempty.Noonehadseen.hissolitarylanding.FirestoneTyres UMost Milesper dollar." EACHTHEBESTINITSCLASSCHURCH&BARRYSTREETS.KINGSTON.

PAGE 20

18 PLANTER S'PUNCH1925-26Whya Cigar? millions,theworldover,findina good cigarajoyandsatisfactionwhichnothingelsecan give. Andeveryday,moreandmoresmokersineverycorneroftheglobeare joining theranksofthosewhofindthatsatisfactionin"Golofina"or"LaTropical"Cigars.Cultivation, curing, selection,andmanufactureoftheleafbyexperts mal\:e "Golofina"and"LaTropical"cigarsallthat goodcigars shouldbe.l\ladeinmanyshapesandsizesandoneofthemistheidealsmokeforyou.Ifit'sa "Golofina"ora"LaTropical"itMustbe Good.MaoufaeturPd byB.&J. n. MACHADO TOBACCOCO.LTD.Kioptou. Jamaica, B.W.J.

PAGE 21

1925-26PLANTERS'PUNCH19 ofGRACEBUII ... DING,64HarbourStreet.KINGSTON.ShippingCo.,LIMI''l'ED. a -..,/, .-.JamaicaFruitAND IIA \Vet>kly Steamship Service ismaintained betw'en KingstonandNewYork,a Three-WeeklyFreight and Service between Kingston,Belize,Nassau,Bermuda,Halifax,and lIontreal. anda Ten-Day ServicewithBluefilds, Nic.,and Orleans.CargoacceptedonthroughBillsoflad ing tointeriorpointsinCanadaandfortranshipmenttoLondon,Antwerp,Car diffandSwanseaaswellasAustralia,NewZealandandtheBritishWestIndia Islands. TicketsissuedtoprincipalportsinUnitedKingdomandtheContinent. For particularsasto arrivalsandsailingsofsteamers,pleasecummunicatewiththemanagement.Bananas, Cocoanuts, Citrus andotherTropical Fruits.UepresentingMessrs.DIGIORGIOFRUITCORPORATION, NEW YORK.Messrs. CANADIAN GOVERNMENT MERCHANT MARINE,Ltd"MONTREAL, CANADA. Messrs.ORRFRUIT & STEAISIDPCO.Inc., NEWORLEANS. whichhecouldnotanalyze.HedistrustedhimnoW'morethoroughly than ever;'theman'sstrangesmoothnessrepelledhim.NotlesshadVirginie'sdisplayofspirittakenhimaback.Inherhotflareofangerandintheburningindignationinhereyeshehadcaughtaglimpseofastrongandpassionatenaturewhich,likehisown,woulddarealldangerinthegreatemergency.Fromthenextroomcame the clinkofglassesandthroughtheopendoorhecouldseethehighwhitereom.AtthefarsideMangan wll"s bendingoverthesideboard,ahugemahoghanypieceonthetopofwhichBush'seyecaughttheglintofglassandsilver.Virginiereturnedtohisthoughtsandhewonderedhowhecouldreachherifachancetoescapeshouldcome.Hishandwanderedbeneaththecoatandfastenedonthehiltoftheslimknife.Thatwasoneway.Aquickstab;thereneedbenosound,andthentotheboatand awa)T beforethemurder was discovered.Thethought s\Iocked him.Extremeaswasthesituation,therewasnojustificationforthat.PerhapshecouldantagonizeMangantoapoint.wherehewouldattackhim;thenthehomiCidewouldbejustifiableinthelightofself-defense.Againherecoiledatthethought.Afterall,that,too,wouldbcmurder.Therewasalsoa flawintheplan.Manganwasdifficulttoantagonize;itwashe,Bush.Fromanadjoiningroomafootfallsounded.ThenthetapestryacrossthedoorwasflungbackandLeroyMangansteppedintothecandlelight.CHAPTERV'TOWHAT,mayIask"-MonsieurManganspokeslowlyandwithcolddistinctnessineveryword-"doI owethehonourofthisvisit?"SounexpectedhadbeenMangan'scomingthathecouldnotfailtoreadthestartledlookonBush'sfaceashestaredathim.WithasuperbeffortVirginieturnedtowardtheintruder,herchinuplifted,hereyesfearlessintheirlevelgaze.Herlipsmovedslightlyasifsheweretryingtospeak,butthe ":ords didnotcome.TheninstinctivelyhereyesturnedtowardBush.Therewasdesperationinherglance,acombinationofresolutionandHupea).Imperturbableandalmostcasualinhismanner,BushstoodbesidethegreatmahoghallYtable,thefingersofonehanddrumminglightlyonitsshiningsurface.Therewereeventhewrinklesofasmileabouthislips.Onlytheblueeyes,halfshut,werehardandcold."MonsieurMangan,"hesaidinapleasanttone,"deniedbyyouWith, Imaysay,scantcourtesy,theprivilegeofcallingonyourward,Ihave,Iadmit,somewhatinformallycomewithoutinvitationforthatsamepurpose."Thetwomenstaredfixedlyintoeachother'seyesasthoughtryingtowinthemastery."Iwillevensay,"Bushcontinued,"thatanaffairoftheheartshouldrequirenoexplanation.Iwoulddesire,monsieur,toaskofyouthehandofMademoiselleVirginieinmarriage."AslightcolourforafleetingmomentstainedthewhitecheeksofManganandhiseyesstrayedfromthoseofthecaptaintotheslendergirl."Youareaware,CaptainBush,"hesaidcoldly,"thatmywardisaffiancedtoanother?""Iam."Thesmilewitheredonthecaptain'slips.1."Andyou,sir,amereAmericanpeddlerofmerchandize,presumetointriguebehindmybackandtamper with theaffectionsofthisyounggirlwhomIconsiderasIwould were sheof my ownfleshandblood."Before thE' eyesofJohnBushthetallwhite-facedmanacrossthetableappearedsuddenlyasthoughseenthroughablurofflashinglight.Hefeltthebloodpoundingfuriouslythroughhisveins.Hewastrembling.Amadfuryoverwhelmedhim.Withaquickmovementhishandfeltforapistolathiswaist.ButashesnatchedatthepistolgripthewhitearmsofVirginiaenfoldedhimandheheardherentreatfromlipshalfburiedinhISbreastthathewouldsparethelifeofherguardian.NotonceduringthescenehadLeroyManganevidencedthevariOUSemotionsthatmusthavepossessedhim;notevenwhenCaptainBushsoughtthepistolandManganreadthedesiretokillinthetenseblueeyes,didthepalefacechangeitscynicalexpression;nordidthefingersoftheleanhandbetrayhimbyaninvoluntarymovement.Rather,likeadistinguishedandslightlysuperciliousspectatorheregardedthedramathatwasactedbeforehim."Come,"hesaidfinally."Theseheroics,althoughexcellentexamplesoftheemotionalismofyouth,canaccomplishnothing."HewalkedslowlyaroundthetabletowardthemandinstinctivelyJohnBushtightenedhisarmaroundthewhiteshouldersofthegirl.Mangantouchedherlightlyonthearm."Thiscannotbe,Virginie.Itislate.Itwouldbebestperhapsforyoutoretiretoyourroom.Hardwordshavepassed.PerhapsCaptainBushwilljoinmeinaglassofwine.Alone,wecandiscussthisweightymattertosomepurpose."ReluctantlythegirlallowedBush'sarmtoreleaseher,andwithherfacehalfhiddeninherhandssheturnedtowardthedoor.Then,unexpectedly,sheliftedherheadsharplyandregardedwithpassionatescornthecoldfeaturesofLeroyMangan."MONSIEURMANGAN, Ihateyou!"Hervoicewashigh-pitchedbutcalm."Inspiteofallthatyouhavedoneforme,Idespiseyou!Itis pos siblethatyoumayseparateus"-shegaveBushafleetingglance-'butIshallseekdeathratherthanbecomethebrideofPierreNicholas!"Withherheadhighshewalkedacrossthefloor.Bushsawherarmverywhiteagainstthetapestryasshedrewitaside;thenthehangingfellbackintoplace.Shewasgone."Andnow,"saidMangan,"willyoubeseated,monsieur?Perhapscalmlywecandiscussthismatterthatsodeeplyconcernsyou. Coldreasonisanexcellentantidoteforpassionandtherehasbeentonightapreponderanceofthelatter."Hewavedhishandtowardalowdeepchairbesidethetableanddrewanotherchairuptofaceit."Butbeforewebegintotalk,ifyouwillexcuseme, IwillgetabottleofBordeauxwinefromashipmentthathasbeenrecentlysenttome."Hemovedtowardadoorintheendoftheroomashespoke."Itislate,"headded; "mf servantsretireearly.Iwillgetthebottleandglassesmyself."Bushdidnotreply.ThisunexpectedturninMangan'sattitudeconfoundedhim.Inthesuave hos pitalityofthemanhesensedanunpleasantreactionBoldlyhepushedthroughtheundergrowthandstruckoutnorthalongtheroad.Hehadcomeashorenorthofthemainpartofthetown;thehousesherewere fewerandmorewidelyseparated.Aheadontheleft ahighwhitewallroseamongthepalms;theruinof aFrenchresidence.Theentrancetothegroundsedgedtheroad,aloftyarchonmassivepil lars.Suddenlyhisheartbegantopoundviolentlyforintheshadowofthearchhesawthedarkfigureof aman.Resolutelyhewalkedon.Throughtheruinedgatealightshonedimly;anativehut,doubtless,inthegroundsofthedevastatedmansion.Fromthecornerofhiseyesashepassedhewatchedthemaninthegateway.Therewasnomovement or indicationofinterest.Againhefeltadistinctre lief;hispresenceontheroadatleastexcitednocom ment. FOR fifteenminutesBushwalkedsteadily.ThenaheadhesawthewhitegatepostsattheentrancetothegroundsofMonsieurLeroyMangan.Beyondtheentranceallwasdarkness.Hehadnotexpectedtosee alight,fortheinterveningbarrierofthegiantmangoesconcealedthehousefromtheroad,butthesilenceandblacknessoftheplacedisconcerted him; andhesteppedintotheshelterofthetreestodeterminehisnextstep.Thewarm,stillairwasfragrantalmosttosuffocationwiththeperfumeofaguavatreesomewherenearbyinthedarkness.Itwasverystill.Asfarashecouldseeineitherdirectiontheroadwasdeserted.Hesteppedoutagain,andnowwalkingmoreslowlyandwithconsciouscaution,turnedintothedrive,hisshoescrunchingnoisilyonthegravel.Thesoundofhisfootstepsalarmedhimandhealmostprecipitatelysoughttheenvelopingdarknessofthetrees.Heretherewasnobetrayingsound,hisfeetfellnoiselessontheheavyturf.Outofthenightcameasound,soclearandsonearthathestoppedabruptly.Someonewasplayingonapianoforte;sweetandsharpthenotes SQund ed, afragileoverture.Then,plaintiveawoman'svoiceroseabovethetinklingaccompanimentoftheinstrument.ItwasaFrenchlove song.Clearanddistinctthewordsfellonhisears.ItwasVirginie.ThroughthebushesBushcouldnowseethehouseclearly.Onthesidealightshoneoutagainstthetrees.Noiselesslyhecreptaroundthecorner.ThreewideFrenchdoorsopenedonthelawnandthroughthemtheyellowglowofmanycandlescame.ThewholeinterioroftheroomwasVisible.Then,againstthewallontheright,hesawher,herdarkhaircoiledaboutthesmallhead;herbareshouldersverywhiteinthecandlelight.Shewassittingonachairbeforethepianofortewithherbacktowardhim.Unseenbyherhewasabletoscantheroom.Deliberatelyhiseyessearchedit.Eachdetailvividlyimpressedhim;thedarkportraitsagainstthegraywalls;themassiveescritoirewithpanelsofcrotchmahoghany,andleadedglassdoorsinthehighbookcaseabove;thetablewithclawfeetofbrass;thegildedchairs,thevasesofflowers,andtheyellowtonguesofthecandlesbehindthescreensof Withimpetuousdeterminationhestrodeto ,the centredoorway.Shedidnothearhim,forhisfeetmadenosoundonthegrass,andashestoodhesitatingherfingersranagainalongthekeys.Fascinated,hewaited,butthelittlerundiedawayinsilence."Virginie!"Hebarelybreathedthewordbutatthesound ahe turned,risingfromherchairwithalittlestartled cry thatendedwithaquickintakeofherbreathashereyes foundhim."John!"Asthoughtowarnhimfromher,sheheldoutahand,palmtowardhim.Heignoreahergestureand cameacrossthefloor,hisstepssoundinglightlyonthepolishedboards."Ihave come,"hesaid."IhaveromeasIpromised.Youmustgowithme, now,thisverymoment,oritmaybe toolate!""00withyou?"Hergreateyessoughthisface. He hadtakenherhandsinhisandshewassonearthathecouldhearherquickenedbreathingandseeherbreastriseandfallbeneaththewhitebodiceofherdress."Gowithyou, now?"sherepeated."Ihaveashipintheharbour;aboatiswaiting.Ishalltakeyouaway,whereyouwillbesafe.Youtrustme?"Heknewhedidnotneedthequestion;hecouldreadtheanswerinherface,inthepressureofherfingerscaughtabouthisown.Stilldazedbytheshockofhiscoming,sheregardedhim,unabletograsptherealityofhispresence."Virginie!"Thesoundofthenameonhislipsbroughthertoherself.WithasobshereleasedhishandsandBushfelthisarmseneirclethesmoothwhiteshoulders;thefragranceofherhairwasinhisface;herwarmbodyclungtohim.Thenslowlysheliftedherface.Inanintoxicationofemotionhebentoverher;theirlipsmet.Hefeltherheadsinkforwarduponhisbreast;thenwithasuddenmovementsheslippedfromhisarmsandthrusthimfromher."MonDieu,"shebreathed,"Iloveyou!ItisyouofwhomIhavedreamed;thatyouwouldcome;thatyouwouldtakemewithyou;thatImightbeyoursalways."Hisarmsreachedforherbutsheeludedhimwithahalf-stepbackward.."Andyouhavecome,"shecontinued."Yes, Ishallgo.Oh-"Hervoicetrailed off inalittlecry.

PAGE 22

20PLANTER 5'PUNCH1925-26added: "It isindeedunfortunatethatthereshouldbesuchdisagreementbetweenyou.FirstI,unhappily.amthecauseofyourquarrel,andnow aglass of wine.Bien!Giveittome;perhapsbothcauses of disagreementcanberemovedby sosimpleanact.Ishalldrinkitgladly."MANGANheldtheglassfromherhand.HislipsweretWitchingandtherewasanuglylookinthehalf-closed eyes. "Youshallnotdrinkit,"hecried.HeturnedtoBush."Leavemyhouse,sir,andthankyourGodthatIhavesparedyourlife.""Easy,easy,monsieur.Anhouragoyourorderwouldhaveperhapsbeenjustified. NowhoweverI untilthislittlematteris settled:" 'Manganlaidtheglassonthetableandtookastep to,,:ard Bush;butthelatteragainleanedagainstthechaIr-back, th.eirritatingsmilestlllbending the cornerofhismouth.WhatLeroyManganpurposedcanneverbeknown. But atthatmomenthehearda.movementbehindhim. Like astartledcatheflung towardthetable.AcrossitstoodVirginie III herupliftedhandtheglasssparkledinthelight."So!"An oddsmile,sneeringandmaleVOlentsearedhisface."So!"Mangancontinued. "You def;me.Drink,mademoiselle,beitforloveorfordeath'Ishallnotrestrainyou." Slowly,hereyesonthefacesofthetwomenwho shouldertoshoulderacrossthetable,Virginie :alsed theglass.InBush'sbraintherewasaseeth th?t forthesecondlefthimPowerless.WouldVir III desperationdrinkthepoisonedWine?WasIt.afterall,poisoned?Thenhesawthesmoothround theglass,andaboveit tl!-e great dark eyesWIththetragicappealthathehadonce before fathomedintheirdepths.Withascreamofwarninghedashedaroundthetallle;hisoutstretchedhandsclutchedhers.With a tinklingcrashtheglassshiveredonthetabletop.InhisarmsBushfeltherbodytenseandcold.Herheadwasthrownbackagainsthisshoulder.He d.ownintoherface;thelipswereparted,and III awhIsperthatsoundedloudinthestillroomheheardherspeaking. "It wastrue,"shesaidwearily."FromthedoorIsawhimstirthepowderintheglass.Thenhebroughtittoyou. 1warnedyou."Manganwasfumblingwithonehandbeneath the table.Hepulledoutthedrawerandhisfingerssoughtforsomethingamongtheloosepapersthatfilled it."Quick!"shegaveafrightenedcryandtoreherselffromBush'sarm."ThepistOl,there!"Itwasnonetoo soonthatBushreceivedthewarning.There was notimeeventoreachforhisOwn weapon.EvenwhileManganstill groped amongthepapershewasuponhim.TheninMangan'shandhesawtheglintot sU>t'l. Hehad found it.ThetableshonkasthetwomencrashedviolentlyagainstIt.Withhislefthandstrugglingwiththeright w:ist ofMangan,Bushsoughthisadversary'sthroatWIthhisright.Hislefthandhadslippeddownuntilhe, too,heldthepistol.Oncehefeltitpressedagainsthissidebuthethrustitfromhim.Lockedintheirstruggle,theyreeledagainstachairwhich beneaththem.Litheasananimal,Manganwnthedandtwisted.InBushwasthestrengthoryouth,butintheleanbody ofhisadversaryhefeltapower,theexistenceofwhichhehadneverdreamed;asinuous,baffling powerthatequalizedtheirstrength.OnceBushwrenchedhishandupward;almostwithinhistouchwas tae corded,pantingthroat. His fingerstoreatitbutManganforcedbackhishand.InhisfacehefeltthehotbreathofMangan.Thesweatpouredfromhisbody;witharendingsound.hiscoatrippedfromhisshoulder.Backandforthinthedimroomthey struggled. Manganwasnowhalfnakedtothewaisthislean ----whitebodyglistenedinthesoftlight.'Backwardhereeledagainstthetable.Hisstrengthwasyield ing.Youth,thatunconquerableally,stoodattheshoulderoftheyoungerman.Slowlythelongbodybentforward.Abovehimtheface ofBushseemedasthefaceofanavengingangel.Therewasatremendousroar,anda flameleapedfromthelockedhandsbeneaththetablerim.Acridsmokefilledtheair.Manganhadfired,butstillthesupplebodypresseddownon hisnowyieldingstrength.WithatwistBushtoreloosehisrighthandfromtheother'sgrasp;thefingersseizedaleadeninkwellandraiseditabovetheWhite,drawnfacethatwasnowgazingupathimfromthedarkgleamingmahogany.Andthenstraightbetween the eyesdowncrashedthemassivemetalblock.WithaquiverMangan'smusclesrelaxed,hisarmsdroppeduseless.Swayingunsteadily,Bushliftedhimselfupright.Mangan'sfacewasbrightwithscarletblood;withoutasoundhislimpbodyslidfromthetabletothefloor."Virginie!"Shestood besidehim."Idarednottrytoaidyou."Shedroppedtoherkneesbesidethebodywhichlayinthetable'sshadow."Heisnotdead?"shecried.Herfingerssensedtheheartbeatofthebarehotbreast."No,helives!"(Oontinuedon Page 30) 8a-8cEAST STREET, KINGSTON.BONTONTheHomeofFashionableDressMakingandMillineryglassbyitsstembetweenhisstrong,thinfingers.Bushrosefromthechairandglanceddownatthetraywithhishandextended.Agabstthesilvertheyellowwineandsparklingcrystalmadeabrightflash of colour.Thenbesidethebaseoftheglasshisquickeyedetectedatinyfleck ofpowder;yellow,itwas,likeabitofpollenfallenfroma flower.His.eyecaughtit,buttherewasnoreactioninhistroublEid brain.Heliftedtheglass..AsBush'sgazerosetomeetthatofMangan,his'glassupheld,hiseyesfellacrossMangan'sshouldertowardthemantleddoor. SlowlythetapestrypartedandintheopeninghesawVirginie.Theireyesmet.Ashelooked,sheraisedherhandtoherlipsasthoughtodrink,thenshookherheadandseemedtodash fromher'ha'nd 'an'imaginaryglasstothefloor.Itwasoverina flash,andashelookedBush saw againthefleck ofyellowpowderonthetray.Herewastheanswertothisstudiedhospitality,to l\.1:angan's longabsencefromtheroom."MonsieurMangan,"hesaidwithspontaneousgaietythat cgme withtherealizationofdangersonarrowlyaverted, "may Inotexchangeglasseswith you?' I beg' tha.t youwillgrantsosmalla concession tomycuriousdesiretodrinkfromyourglassratherthanfrommyown?"ThespeechwasbluntandtherewasnoopportunityforMangantoescapethesignificance ofBush'swords."CaptainBush,Ihesitatetoremindyouthatyouforgetyourself.InyourwordsthereisanimplicationthatI holdasaninsulttomyhospitality,animplicationthatIcanscarcelyallowtopassunnoticed.Drink,sir,andlettheactexcuseyourwords."Heraisedthewinetohislips,butBushsethisownglassfirmlyonthetable."MonsieurMangan,Ibelievethatglassofwinetobe poisoned. Iaccuseyouoftheattempttoklllme. Idareyoutodrinkthewinethatyouhavepouredforme.""Yourimpudence,CaptainBush,demandsmorethananapology."Forthefirsttimethecolourflush Mangan'scheeks;hiseyesclosed tonarrowslitsofgray,whilehishandnervously ,fingered theruffledneck-piece."Drink,damnyou!" h2 snarled.InthesamemeasurethatMangan'sformercalmnesshadtantalizedBushintoadisplayofpassion,sonow'thebreakdownoftheelderman'scontrolestablishedBushthemoresecurelyinhiseasydefianceandirritatinggoodhumour."Perhaps,"hesaidwithapleasantsmile, "you wouldpermitMademoiselleVirginietosipfromtheglasswhichIdistrust?""Virginieisnothere." Manganwasplainlystartled.Therewasarustlebehindthetapestry;theheavyhangingwasbrushedasideandfromthedarknesssofthehallVirginiesteppedintothecandlelight.Shewasverypale,buthersmallchinwasupliftedandherlargeeyessurveyedtheroomwithanexpressionofinfinitedisdain.ForamomenthergazerestedonManganandherlipspartedasthoughshehadintendedtospeak;buttherewasnosound.Thenshewalkedtothetable. "How longhaveyoubeenthere?"Mangandemanded,confusionandangerinhisvoice.Shegavehimascornfullook,andthen,withhereyesturnedfromhim:"Eversinceyourequestedmetoretiretomyroom."Afteraslightpausedshe who doubtlesswouldflare first.Thathadbeenthe c:ase before.Acrosstheroomamarbleclockstrucktwelvewithsweetlingeringstrokes.WhatcouldkeepMangansolong?Hehadapparentlyleftthedining-roomforJohncouldnolongerseehimnorhearhimfussingwiththeglasses.Heexaminedtheroominwhichhesatwithrovingeyes.The !i0or attheotherendledtothedining-room.Onhisrightwastheentrancetothegardenandoppositeithungthe piece oftapestrywhichconcealedthedoorwaytothe naIl..As heregardedthegreenandbrownweave,itseem ed toflutterslightlyasthoughshakenbythebreeze.Instinctivelyheleanedforwardthathemightglancealongthefloor,tosee, if possiblebeneathitsfolds.Bya fewinches.thehangingclearedthefloorandinthatscantaperturehesawinthefaintcandlelightawoman'sfootshodinawhitesatinslipper.Thefootwas witpdrawn noiselessly.ItwasVirginie's.WhywasVirginehidingbehindthecur.tain?The answer, wasobvious.Wasnotsheasmuch as heab Ilorbed inthemysteryofMangan'ssuddenaffability?ToherevenmorethantoBushtheoutcomeofthisawaitedconversationwasofvitalimport.Hisfirstinclinationwastostealquietlytothedoorandwarn ner to.caution,butthatwouldprobablyonlydiscloseher prellence, for .be .nowheardMangancrossingthedining-room.Withasmiletheothermanlaidthesilvertrayonthetable.Thereweretwoglassesonit,finethinglasseswithflutedstemsbandedwithdullgold. Besidethemabottleofyeliowwinereflectedthelightlikemoltensunshineandthrewdancinggleamsofamberonthebright'surfaceofthetray.Bothglasseswerefilled. ."Iamglad,",Mangansaid,"thatyouwillreasonably withmetheproblemwhichyourpresence and yourpersonalityhavecreated."Hiscoldeyesrested on Bush'as'hetalked,andalthoughhislipsmovedhisfeatureswereimmobileasthough c:ast inplaster.Only the leanrighthandgavemovement;thelongfingerscarelesslytoyingwiththe:tIuted ruffle of hisstock."PierreNicholasismyfriend,"hecontinued,"whichIrealizeforbidsinyouaremarkwhichcouldnotfailtooffendme. ijut, ah, monsi!lur, permitmetoanticipatewhatyouwould say: thatinmyfriendNicholasthereis touchofcolourwhichoffendsyourcold,northerncode.Itistrue.Yes,butisitnotpossiblethatwemaydifferently thesethingshereinthis far country?"NOTWITHSTANDINGtheobviouscourtesyofMangan'andthepatienttoneofhisvoicetheyoungerman reaJized thattherewassomethingwhichhecouldnotfathombehindhissmoothspeechandmanner."MonsieurMangan,"hesaidatlast,"Iamfranklypuzzledbythis'suddengraciousness.Canitbethatyouwilldiscusscoollywithmethatquestionwhichisuppermostinmy mi,nd? Willyoufairly consider thequalificationswhichIcanofferandcomparethemwiththoseofthisNicholas,whosepretensionstothehandofyourwardcannotbethinkabletoagentleman,theguardianof a defencelesswoman?"Mangan,whowasstillstanding,pointedtothetray."Perhaps,CaptainBush,youwillhonourmebydrinkingaglassof awine,ofwhich,Iamproudtosay,thereisnonebettertobehad."Helifteda A Corner01BonTon'.Workroom, : Mme. Irene\Vheatlehasopenedattheabove address anup-to-date establi!;hrnent ::forSellingROBES,LINGERIE, AXDDRESSMA.TERIAL. : Dreils-Making, Millinery,Pleating,Hemstitching,andCovering Buttons done. TheTeaRoomattachedtothisEstablishmentisbright,coolandcommodious. :It isvvorth your vvhile tovisit: : BONTON, : :8a-8e EAST STREET, KINGSTON,JAMAICA.: : :

PAGE 23

1925-26PLANTER S'PUNCH 21 "THE FIREFLIES" JAMAICA'S MOST DRAMATIC TROUP MRS.LI:SDSAYDOWNER, llIR.L.A HENHEDI,MISSJOYCE DAVIS,llIR.CLL ....TONHART, llIR. NA H,llIRS. BlX:SEY,MIl. CHARLIE BRANDON, CHARLIE ISAACS,MRS. THOMSON EVANS,MR. REGGIE TI'[)IAS, W. MAIS,BINNEY,l\lRS. ISAACS, l\1B. H. LYNCH,)IJSS LOIS ROBI:SSON,)IB. A.E. :1\ORCROSS, MISS GWENBURKE,l\lR. FOSTER,llIRS.SILVERA. l\IR. R.B.LONGE. l\USS HO-mALL,LT. S.-\:SKEY,MRS. Theaboveisapictureof ascenefromoneoftheperformanceoftheFireflies,thewell-knownJamaica 'c:>mpany ofamateurswhohavedonesomuchtobrightenthecolony's life.Foundedby Mr.LindsayDownersomeyearsago,theFireflieshave develoJed muchartisticabilityandtheirentertainmentsaregreatlylookedforwardtobythousandsof perso:J.s. Singinganddancingformthemajorpartof th3 exhibitionsoftheFireflies,interspersedWithlittleone-actfarcesandcomedies.ItishopedthatilterontheywillundertaketoproduceontheKings;onstagemoreambitiousprogrammes,theirpreviousachievementshavingbeenofsuchanorder of excellenceastoleadtheiradmirerstobelievethattheycanwingreatersuccessesiftheychoose.(Continuedfl'omPage11) GJrered to compromise onthetitleofSirNicholas,buttheywould have none of it.HetoldthembitterlYthatJamaicanswouldneversucceedbecauseoftheirenvyandhatredofaUthosewhoweredistinguishedamongthem,andtheywantedtoknowwhyheshouldthink himself moredistinguishedthanthey.Thusthebattleraged,andthepoorHighConspicuousPotentatealmostbegantowishthatMr.Garveyhadnotmarkedhimoutforsuchhighandremarkablehonours.OnenightMortimercommunedwithhiswifeonthefuture."Mat,"saidhedejectedly,"Idon'tknowwhattodo.Thoseboysdownatthehotelmakemelifeaburdentome,tillI feellikeleavingthejob.Butitis a good job,an'Idon'tknowwhere1 would goifI giveitup. Iam just sickan'tiredof metitle,an'I wouldliketodropit.Whatyousaytothat?""Isayyouwouldbe acowardifyoudidanyt'ingofthesort,"repliedMatildafirmly."Afterall,youhaveonlytoshowperseverancean'youwillsucceed.Try, try, tryagain,Morty.Ifyougiveupnow,youcanneverbeSirMortimeragain,an'thenyouwilllookfoolish.Don'tyouthinkMr.GarveyhadhisowntroublesbeforehebecomePresident?""ButIdon'tseeheisreallyPresidentofanything,"saidMortimerdejectedly,atlastshowingagleamofcommonsense. "Yes,heis,"asseveratedMatilda."Heisgettingupalotofmoney,andassoonashehaveenoughhewillgobacktoAfrica,an'then,ifyoustill'aveyou'title,himmaymakeyousomethingthere.ButifThe Jamaica :J\[obility youshowyou'selfacowardinJamaicayouwill'avetostayheretillyoudead,foracowardmancan'tdo wellinAfrica.""I'avenowishtogotoAfrica,"replied'Mortimertruthfully."Hereisgoodenoughforme.Butifthingsdon'tchangeatthehotel,Igoin'todropthetitle,foritnotdoingmeanygoodthatIcansee."Andinthishewasprophetic.Hedidnotknow,ashespoke,thatthatveryeveningtherehadregisteredatthehotelaSirMortimerandLadyCranbourne,justarrivedonthelastboatfromEngland,andcometostaya fewweeksintheisland.Evenhadheknownit,heprobablywouldstillhaveinsisted,thefollowingday,tohiscolleaguesatthehotel,thathisproperdesignationwasSirMortimer.Howeverthatmaybe,ithappenedthatwhenhewasmovingaboutthehotel'sdiningroomacoupleofdayslater,heheard,atlast,andforthefirsttimeinthoseprecincts,themagicwords"SirMortimer"pronounced,andbelievedthatitwasabrother-waiter thus addressinghim.Somethingsgototheheadlikewine.Whodoesnotthrillwith pride toknowthat,atlast,successhasattendedone'sstrenuouseffortsandthattheworldistobeatone'sfeet?Swiftly,withoutevenwaitingtohearwhospoke,Mortimerloudlyanswered"yes!"Hissurprisecausedhimtospeakfarmoreaudiblythanhewouldordinarilyhavedone,hencehisreplyreachedtheearsofthoseforwhomitwasneverintended.Thenhedidalsowhathewouldneverhavedoneunderordinaryconditions:heturnedabruptlytoseewhoItwasthathadthusproperlyaddressedhim,and,turning,bumpedintoanotherwaiterhurryingforwardwithatrayfilledtoitsutmostcapacitywithdishes.Mortimer,too,hadbeenbearingasimilartray.Theencounter walia shock.Bothmenslipped,bothtrayswerehurledwithahideousclangandclattertothefloor ofthediningroom,andone'dishwithsomegravystuff, flying offata'tangent,emptieditscontentsfullintheface oftheauthenticSirMortimer.SuchacatastropheCOUldnotbutcreateconfusioneveninthebestregulateddiningroom.Alltheguests-andtheroomwasfull-turnedroundtostare;allthechief-overseeingwaitershurrieduptothesceneofthedisaster;themanagerhimself,whowasintheroomwhentheaccidenthappened,seeingthatnolessapersonthanSirMortimerCranbourne,a ,g3J:onet ofgreatwealth,wasengagedintheunusualoccupationofremovinggravyoutofhiseyes,spedtothebaronet'stablewithsolicitudeandconsternationexpressedineveryfeatureofhisface.Wordsfailedhim,indeed;hecouldfindnothingtosayaboutsuchacalamity.ButSirMortimerCranbournewasvocalenough.Hehadheardhisnamedistinctlymentioned.Hehaddistinctlyheardawaiteranswertothename.ButwhythemanshouldhavefanciedhimselfspokentoasSirMortimer,andshouldhaveturnedinthedirectionofthesoundwithsuchimbecileabruptness.SirMortimerCranbournecouldnotunderstand,exceptononehypothesis.Thewaiterwasdrunk.Heexplainedtothemanager."Someonecalledme,andthatassof awaiteranswered.IshisnameSirMortimer?"Andthenanotherwaiterstandingby,frightenedperhaps,andwithoutevilintent, r& pliedhastily,"yes,sir.""Goouttheroomanddon'tmakea foolofyourself,"commandedthemanager;andthenhehimselfassistedtheill-usedbaronettoleavethetable.Usually,anaccident,evensoseriousanaccident.wouldhavebeendealtwithby the headwaiter.Butonthisoccasionagreatman-hadbeenalmostin-

PAGE 24

22PLANTER S'PUNCH1925-26jured,andtheemployeeresponsibleforthemisfortunehadbeenallegedtobeSirMortimer.Clearly,therefore,thiswasacaseforinvestigationbythehighestauthorityinthehotel. 'l'he investigationtookplacethatsameafternoon,whentherewerepresent:(1) The Manager,(2) The Headwaiter,(3)Mortimer,KnightoftheAfricanRepublic,(4) The manintowhomhehadbounced,(5)Themanwhohadvolunteeredinformationastohisname.Itwasacourtwithonemanasjudgeandjury.Defendantwasnotallowedtoberepresentedbycounsel.ThemanagereyedSirMortimeroftheRepubliccalmlyandasked:"Whatwasthemeaningofyourpeculiarconductto-day?""Themeaning,sir?""Yes,themeaning.Myquestionisplainenough,isn'tit'I""Itdidn'thavenomeaning,sir,"stammeredtheknight,whohadbeenvainlyrackinghisbrainforsomeadequateexcuseorexplanationtooffertothejustlyincensedheadandchiefoftheinstitution;indeed,poorMortimerfeltthat if hehadneverbeheldaPotentatehewasnowinthepresenceof one."IunderstandthatyouansweredtothenameofSirMortimerwhenyouhearditinthediningroom,"saidthemanager;"isthattrue?"Mortimerwouldhavedeniedithadhedared.Buthewassurroundedby acloudofwitnesses.ThereweretoomanymeninthehotelwhohadheardhiminsistuponbeingSirMortimerforhimtodeclarevehementlythattheideaofbeingSir :Mortimer hadneveronceenteredhismind.Hesawhimselfreducedtothemiserableexpedientoftellingthetruth,whichisthelastthingthatadefendantoroneofhiswitnesseseverdreamsofwantingtodo. "Well,sir,"headmitted;"Idid;butitwaswith g ualifications.""Whatqualifications?"Mortimerremainedsilent.Hesawthehopelessnessofattemptingtoexplainthesituationtoagentlemanwhomightnotevenunderstandhisclaimstoknighthood,andwhowouldcertainlyhavenosym pathy withtheGarveyanNobility.Themanagerturnedtothe'headwaiter."Whatdoyouknowaboutthis?"heasked.Theheadwaiterhadasenseofhumour.HehadjustbeenenquiringintothestrangeandpeculiarconductofMortimerandhadelicitedfullanddamageinginformation.Ofcourse,hehadheardsomethingabouttheknighthoodbusinessbefore,buthadregardeditasmerelya.joke. owheknewthatMortimerhadtakenitseriously.Questionedthusdirectlybythemanager,hetoldwithbriefdryness,thoughwithasmileinhiseyes,thestorythathehadheard.whilethemanagerlistenedinasortofstupefactionwhichmergedintoangerasthetalewenton."Mygoodman,"hedemanded,lookingfullatMortimer,"isthistrue?""Well,sir,itislike"this,"stutteredthemiserableMortimer."AsMr.Garveymakemeaknight,IJustmentioneditsotospeaktoa few fellowshereandelsewhere,andbeingasIwasbusyto-dayan'becameconfusedinmethoughts,themomentIhearmenamecalledIturnsortof quick-like,andthisothermanbounceintome.But if Ihadthoughtforthemoment-""Areyousureyouarequitesane?"interruptedthemanagersharply. UNo, sir.""Youdon'tthinkyouare,do you?" UNo, sir.""YouhavebeensendingmoneytoAmericatosupportthispropaganda,perhaps?" uYes, sir.""Thenitisclearyouarenotsane." "Yes,sir," "Well,itisquiteimpossibleforustohaveinthishotelamanwhocallshimselfaknight,whothrowsdowntraysandinjuresguests,andwhoadmitsthatheisnotsane.Iamsorryfor you, Slimslam,butitisout of thequestionthatyoucanremainhere.Everybodywilldoubtlesshearthatyouareaknight,andthisisahotel,notacomedian'shalL"Hemadeaslightgestureofdismissal,andMortimerknewthathisminutesinthathostelrywerenumbered.Attheback of hisheadhewasawarethathebadbeengivenahearingwhichhemightnothavehadandcouldnothavedemanded,butthatbroughttohimnosolace.Hewasdismissed.Forclaiminghistitularrightshehadlosta goodsituation-thatwashowheputittohimself,foratthemomenthehadforgottenthedamagetoSirMortimerCranbourne'seyesandthesensationinthediningroom.Hecouldfindnowordstoutter,noargumenttourgeonhis own behalf;heknewthatinanotherfewhoursitwouldbeknownthathe, aknight,hadbeensentabouthisbusinessforansweringtoaformofaddresswhichhecouldclaim,ifnotbyrightdivine,atleastbyGarveyancreation.Withoutanotherwordheturnedandwent,withthedazedfeelingthatsomehowjusticewasbeingdefeatedinthisworld.Thenewsflewrapidlyamongthosewhohadobjectedtohisknighthood.Butnowtherewasnolongeranyillfeelingfeltorexpressedtowardshim.Allhiscolleaguesweresympathetic;twoevenspoketohimas"SirMort,"givinghim,forthefirsttimeintheirlives,thetitlewhich,buta fewhoursbe fore,wouldhavesoundedsosweetlyinhisears.Buthegavenoindicationthathenoticedit;hemerelybade thllm farewell,andturnedhisfeetinthedirectionofhishome.HiswondernowwashowtheLadyMatwouldtakehisdownfall.Hewasinclinedtoattributeitlargelytoherindirectinfluence."Thereisnojusticeintheworldforus!"exclaimedMatildawhenhetoldherhissorrowfulstory."My God!youdidn'tdoanythingatall,an'themsendyouawaylikethat.IfIwasyouIwouldwriteto Mr.Garveyaboutit!""Whatgoodisthatgoin'todo?"Mortimerwantedtoknow."Well,Iwouldwriteallthesame,sofar.Andperhapsyoucouldtakeoutawarrantforunlawfuldismission.""Thatwouldn'thelpme,forIamlawfullydismissed,"confessedMortimer."Themcouldalwaysgetridof me,butitisunjustallthesame.""Thenwhatyougoingtodo?""Getanotherjob,ifIcan;ifIcan'tIwill'avetogoaway,andthatisall.""An'inthemeantimethatfoolattheRailwayisaHighPostulateandallthatsortoffoolishness,"commentedMatildabitterly."My God,thisisnotajustworld!"ButevenasshespokethustheHighConspicuouswashavinghisowntroubles.ItwasnotsafetobetooconspicuousinaJamaicaGovernmentDepartment.CHAPTERFOURMR.DOUGLASSMOVESTHEREhadforsometimebeenrumoursof ap proachingstrifeattheJamaicaGovernmentRailway.Alloverthecivilisedworldmenwerestrikingforhigherwages,andtheem ployeesattheRailwayperceivednogoodreasonwhytheyshouldnotdothesame.Asamatteroffact,theirmerethreatstostrike,onpreviousoccasions,hadbroughttheauthoritiesdownto busi1'.ess; theirdemandshadbeengranted;but,astheappetitegrowswitheating,sodidthedesiresoftheworkersincreasewiththeprospectof success.Theywerenow:;'1111111111111111111111111111111111111111111111111111I1111111111111111111111111111111111111111111111111111111111"11111111111111111111111111111111111111111111I111111I1111111111111111111111111111111111111111111111111I IlIIn:= --------------PROTECTIONANDINVESTMENT"! ---------------WITH MAXIMUMBENEFITSATMINIMUMCOST -------=HASALWAYSBEENTHEAIMOF :: TheJamaicaMutualLifeAssuranceSociety.1927isthenextTriennialBonusA ward.ForRatesEtc.,Applyto: .... SPENCERTHOMSON,TRAYELLING AGENT.ERNESTORw.D.SOUTAR,ASST.TRAVELLING AGENT.Secretary.

PAGE 25

depen's.Marriagegoodforsomepeople,butitdon'tgoodforall.IfIwasMortyIwouldnevermarried.Matilda,forIcanseethemwillsoondivort.NowdatMortylosehimjob,andevenadawgwouldn'tcallMatilda'melady,'Mattywillsoongetdisgustan'leave'erhusband,whichiswhatIbinexpectin'alldetime.""Yet, old massa,"saidhisson-in-law good-humouredly,"youwasthefirsttocallthem'meladythis,'and'meduchessthat.'AndonlylastnightIhearyouaddressMortyas'menobleprince.'''"Thatistrue,"agreed Mr. Proudleigh,innowaydisturbed. "If y'Ufindthatfoolishnesspleaseaman,givehimfoolishness.Itdoan'tdoyounoharm,an'asMortyoffermeadrinkofanisoulas'night,whichIdidreallyneed,an' 1I01t wasn'tgwinetogiveme,himwasreallyanobleprince.Buthenotgoin'to bcl a nobleprinceno more,forhewon'thaveapennjforbread,letaloneawarmin'drink.""Andwillnotthatbe adisgrace?"passionatelydemandeda voice.ThespeakerwasMr.Douglass,theturbulent,themanwhohadoriginallyhailedthebestowal of GarveyantitlesinJamaicaasmarkinganewera.HehadsincebecomeacquaintedwiththeBrimstones,buthadnotyetbeenabletogetonfriendlytermswiththeSlimslams.Hehadmadeuphismindtodo so,however,forhehadformedaveryhighopinionofMatilda."Isn'tita disgrace,"hecontinued,"that :J. manwhohathbeensingledoutforhighdistinctic'nbytheheadoftheAfricanRepublicshouldnowbereducedtopenuryandwantmerelybecauseheanswerstohisindubitabletitle?Do youthinkanyotherpeo plebutwewouldstandthat?We seeoppressionandwecringeunderit;wouldtheHaytiandothat,ortheCuban?""Butwhatwouldthemdo?"queriedanotheroftheguests."Whatcany'udowhenanadvantageistakenofyou?""Oh,"criedMr.Douglass,"youadmitthatanadvantageistakenofMortimerandNicholas,doyou T' "Itseemso,upona second t'ought,"agreedMr.Proudleigh,whoalwaysbelie\'edthatnothingcouldbelostbybeinguponwhatseemedtobethepopularside."NowthatIteckanothert'ought,Iseedatadistinctadvantagehasbeentook of Mortimer,ao'nodoubtitisdesamewidLordBrimstone.""Butwhatcananybodydo?"persistedthemanwhohadfirstansweredMr.Douglass,"whatwouldthemdoinCuba?"Douglassglancedroundtheroomcarefully,andreadhostilityintheeyes of Mrs.Jones,Mr.Proudleigh'sfierydaughter.Heknewfromexperiencethatwhatshethoughtherhusbandwaslikelytothinkalso;whileherfathersimplydidnotcount.Heconcludedthatitwouldnotbesafetosaythenjustwhathehadinhismind.Theymightnotbeexactlyinimicaltohim,buttheymightnotbefriendlytohisideas.Herose."WhatIthinkweoughttodo,"hesaid,"istobringaboutareconcilementbetweenSlimslamandBrimstone,whichquarrelbecausetheirwivescouldn'tgetontogather.Butnowthattheyarebothinthesameboat,theywill'avetobefriends.Letusgoan'playthepart of peacemakers,foritiswrittenthatweshallbecalledthechildrenof God."AnyonelookinglesslikeachildofGodthanMr.Douglass,itwouldhavebeenimpossibletoimagine.Butthemenintheroomwerereadytobecomethechildren of anyonesolongasthatgavethemtheopportunityofdiscussingthemartyrdom of MortimerandNicholaswiththetwomartyrsthemselves.Mr.Douglass,however,didnotincludeMr.SamuelJosiahJonesinhisinvitation,andacquiescedWithalacritywhenMrs.JonesremarkedtoherSamuel,"yoUbetterremainwherey'uare,Sam." Mr.Proudleigh, of course,rosehastilytoaccompanythedepartingvisitorstotherespectivehomesofSirMortimerandtheHighConspicuous,soastobeabletoreportunfaithfullylateronuponallthathemightseeandhear.But,knOWingquitewellhisintention,Mr.Douglassassuredhimearnestlythatthenightairwould bebadforhisconstitutionandrefusedtoagreethathewasasstrongasanox.Onlyfive men,therefore,lefttheJonesesontheproposedpeacemaker'smission.AndaftertheyhadgoneMr.Proudleighconsumedanhourinexpressingthemostuncomplimentaryopinionsontheircharactersandlives.NicholasBrimstone'shousewasthefirstvisited.Mr.DouglassandhisfriendsfoundMr.andMrs.Brimstone,or,tospeakmorecorrectly,thePotentateandtheMarchionessBrimstone,alone.TheMarchionesswasinastate of highanger;shewasblazingwithwrathagainsttheGovernmentgenerallyandtheRailwayadministrationparticularly.Brimstonewassilentlyangry,butshewasshrillyvocal.Forsomefiveminuteshervisitorshadtolisteninsilence,butwithapproval,totheflood of invectivewhichshepouredout.Then,becauseshewastemporarilyexhausted,shepaused,andthatgaveMr.Douglasshisopportunity."Wehavecome,HighPotentate,"hebeganwithsolemnity-forhewasinthehabit of addressingpub licmeetings-"wehavecometoofferyouourcon dolencean'toassureyouthatyou'avethesympathyoftheentirepeople.Thewhitemenmaythinknothing of you,andweallseehowtheyhavespite-23 AREANDLanterns@IemanQuick-LiteDaylightMakersgive 500 candlepowerofpurewhitelightthatisassoftasSunshine!ColemanLampsD..HENDERSON&CO.,KINGSTON.Coleman'sQuick-liteLamps I PUNCHPLANTERS' Tbr('('bnlf-Il"Dce 1925-26consideringanotherstrike,andasapreludetoitwere displayinganunwillingandsomewhatsurlyattitude.Naturally,newsofwhatwaspendingsoon came to theearsoftheRailway'sDirector,whoal mOllt had a fitwhenthesituationwasexplainedto hUn. Hewas amanofcholerictemper.Hebelievedin action firstandreflectionafterwards,suchreftec tlon taking, if hedidindulgeinit,theformof com mendatoryjnstificationofhisacts.Thisthreatenedstrike, hedetermined,shouldnotoccur,notifhehadtodischargeeverymanattheRailwayandstop the running of everytrain.Hehimselfwoulddotheatrlking firstandthusprovethathewasnottobe trifled with.Inthemeantimehedemandedfromhisleadingsubordinatesthenames of thosetheythought likely to beattheheadofthetrouble,and,uturally,NicholasBrimstonewasmentioned.NotthatNicholaswasinanywayresponsiblefortheagitationgoingon. As amatteroffact,hehadnothingwhatevertodowithit.Hewasjustthenunpopular, and sohadnotbeenconsulted;butvarIousspiesandtalebearersknewthathewasoneofthe Garveyan nobles,andtheyhadsuggestedtothosehigherupintheRailwayhierarchythata mansointimatelyconnectedwithMr.MarcusGar vey must or necessitybeattheroot of anyannoyanceordisorder,past,presentortocome.Thissounded plausible,reasonable,andthereforewhenIt was laid beforetheDirectorthattherewasintheemployment of theJamaicaRailwayamanwhowasnothing lessthanaHighConspicuousPotentateof the African Republic,theDirectorforthwithdecidedthatthatmanshouldseekalivelihoodinAfrica, orelr.ewhereif heliked,butcertainlyshouldnotcon tlr:ue toobtainitattheRailway."I,"saidtheDirector,inanexplosiveburst of anger,"amgoing to betheonlyPotentatehere,andyoucan tellthatd-dmischievousfool so. Givehimtwo weeks' notice!Andwatchwhathedoes,forIamcertainthatheistheringleader of allthisnon sense you have beentellingmeabout."The noticewashandedtoNicholasindueformand withsomething of ceremony.Itwastobeginfrom the firstdayofthesucceedingweek,butitwas handed tohimontheverydaythattheDirectorpronouncedhisfate.Thiswasintendedasasolemnwarning to allothermalcontents;itwasannouncedthatnotice would begiventoeverymanwhowantedto leave,orwhohadItinhismindtostrike.ItwasreportedthattheDirectorwasanxious.eager,todiscover morediscontentedpersonstowhom,without a moment's de1ay, hecouldhandanotice of dis mlasal.Thisenergeticandevensavageway of attackingwithoutwaitingtobeattackedhadits effect; noIn tending strikerbutsuddenlyfoundthatheforone Dever hadanyintentionof followingtheevil advice of trouble-makers. Ascapegoathadbeenfound, let himbearthesins of theRailwaypeople.Hewasa ConspicuousPotentate,anyhow,andexaltedposition connoted self-sacrificeforthegood of others. Nicholas tookquiteanotherviewofthematter;hefeit, and rightly,that if anymancouldpleadnotguiltyto a charge of strivingtodislocatetheworkingof a GovernmentInstitution,itwashe.Butwhothatcounted wouldhavebelievedsucha plea'! Clearlytherewasnothing to dobuttosubmittothe lentence passed upon him,whichsentencehadbeenuttered twodays after thatwhichsawSirMortimerreduced to a jobless condition,throughbeinga knight. So InBarnettStreetthatevening,andinthevicinityofthatresidentialthoroughfare,therewas &pinexcitement. Thedeclineandfall ofSlimslam and Brimstonewasdiscussedatlengthinmany 01ll88. andthendiscussedsomemore,andthemis fortunes of these twopersonagesformedthetextfor eome118 observations,suchasthatpridegoethbe fore destructionandahaughtyspiritbeforea fall,andthat..hentroublecatchbUlldog,monkey's breechee fit him."Itwasold Mr.Proudleighwhogavechief utterance totheseobservations.TherewereBornefriend pthered In his son-In-law'shousethatnight.andIt sesmed toMr.Proudleighthatnowwasthetimetolaytheworldunderanobligationtohimforfurtherwisdom. "I neverdid t'ink much of alldislordanddukebusiness,"hedeclaredwithemphasis."Howcould amanlikeGarveymeekanyone a duke?HereamI,a'umblepheasant,andthereIs Mortimer,who to-day11'1 notmuchbetterthanmeseU,an'yet Mortytellmehimisaknight!Don'ty'u ses de foolishness ofit?An'nowthat ;\Iorty losehimjob,an'Nicholaswill soonbekickin'stoneIn destreet,whocarewhetherthemislordorgod?Man poor,hisword poor. If youdoan't'avequattietoyou'name,youmightaswellbedead,even if you call you 'self a prince.MortyandNickwasgoodfrIendsbeforetheycometobenobility,an'nowthemdoan'tspeaktooneanother.WhatistheuseoftitleifIt onlymeekyou enemies?" "Well,"remarkedhisdaughter,Mrs.SamuelJosiahJones,judicially,"atanyratethetitlemakeMatildaamarriedwomanto-day,andthatissome thing," "Medeardarter,"replied Mr.Proudleigh,"itall

PAGE 26

1925-26PLANTER S'PUNCHTheLatest andthe.Best Picturesfromall the First Run ITheatresofthe W orIdEveryEveningtwoShowsfrom7.30. lMI(Q)VITIEZlrIHIlEA ST.ANDREW.TheResortofall Picture Fans. Nothing but the Best Shown.GoodMusic BIGSUPERSPECIALSASSHOWNINLONDON. III TwoShowsfrom7.30EveryEvening. II==I.

PAGE 27

1925-26PLANTER,S' 25 The Pacific SteamNavigationCompany(ROYALCHARTERDATED1840.)I ITHE ROYALMAILSTEAM PACKET COMPANY, Local servicesWestCoast,CentralandSouthAmerica.Tours DeLuxe :During"Wintermonthsfrom New YorktoJamaica,andotherbeautifulspotsintheCaribbeanbythepalatialtriplescrewliner"OHIO"19,000tonsRegister, 27,180tonsDisplacement.Forfull particulars applyRegularCoastwiseFreightSenice:Between Kingsti)llandOutports'of Jamaicabythe Motor Ship'ARNO'aboutevery10days. Regular Frequent FreightSenice :BetweenJamaica,UnitedKingdomandContinent.BETWEENNew Yark, Chcrbourg,SouthamptonandHamburg.LondonandLiverpoolandBrazilandtheRiverPlate. Liverpoolandthe 'Vest CoastofNorthandSouthAmerica(viaPanamaCanalandvia Magellan) withcallsatJamaicaasoccasionrequires.New York,Havana,PanamaCanal,andWestCoastofSouthAmerica .. Canada-andBermuda,TheBritishWestIndianIslandsandDemerara.UnitedKingdomandContinentofEuropetotheWestIndies,CentralAmerica;alsotoChina,Japanetc.PASSENGERANDFREIGHTSERVICESIK'NGSTON, JAMAICA, tIB.W.I:1t.._-----------------------------------------------------:greatersocietyinAmerica,and the freeingofJa-maicafromallshackles." .Whatdidthoselastwordsmean?Mr.Douglasshadenunciatedthemwithasortofsinisteremphasis.'withabitterintonation,whichhadfrightenedthetimid,shockedtheloyal,andthrilledthefoolhardy.Buthehadneverexplicitlyexplainedthem.Hewasabitterman;toacertaindegreehewasaboldman;buthewouldnotventuresofarastomakecrystalclearhismeaning,forfundamentallyhewasa coward.Leteveryonereadintothemhisownimplications:thatwouldbeenough.Butsometook the shacklestomeantheholdoftheBritishGovernmentuponthecountry,andwhenthesesaidsoopenlyMr.Douglassdidnotcontradictthem. He simplytalkedonsomeothersubject,smiling the whilesignificantly.TheConfederationhadbeenformed.Atthismeetingtheywerediscussingamatterwhichhehaddiscreetlyleftoverforalateroccasion.The first thinghehadhadtosecurewereacoupleofmenwitharealgrievance,menwhohadbeenexaltedbyoneofthegreatleadersoftheneo-Africanmovement,namely,Mr.MarcusGarvey,andwho'hadbeenignominiouslyhurledoutoftheirsituationsbecause.notbeingofthedominantrace,theyhaddaredtoaccepttitleswhichmadethemsuperiorto theTheRoyalMailSteamPacketCompany (IWYAL CHARTERDATED1839.)deepinjustice.ThereforeheagreedwithMr. Douglass."Whatyousayisquitetrue,Mr.D.,an'theymeantodousworse,"hesaid."Itwillgoontillwewon'tbeabletobreatheaswelikein thiS' country.""Thenweoughttostopthemfrombreathingfirs'!"volleyedhiswife."Ifthiswasanothercountry-""JustwhatIsay,"criedDouglasstriumphantly;"butitwon'tbeanothercountrysolongasourchiefpeop1einitwon'tevenspeaktoeachotherthroughalittledisagreementwhichtheyoughttoobliviateandburyinoblivion.".This,sotospeak,broughttheMarchionessupagainstit.Mr.Douglasshadmadeitapparenttoher,bysuggestion,thatJamaicamightbemadeanothercountryifonlyshewouldconsenttoholdoutthehandofamitytotheLadyMatty.Douglasssawherfacechangeandinstantlypursuedtheadvantagehehadwon.."IaminvitingyoutocomewithmetopayacalltoSirMortimerandLadySlimslamto-night,"heinsisted,"beforethesungoesdownuponyourwrath.Letnotthesungodownuponyourwrath.Itisgonedownalready,butIamspeakingmetaphorically,so tospeak,for,yousee,MarchionessPotentate,thatasyouandyou'husbandarereallyinahigherpositionthanMortyandhiswife,inthatyou'aveabiggertitle,itisinyourplacetoholdouttheholivebranch.Theycan'tdoit,butyoucan.Willyoucomewithus?"Thisadmissionofhersuperiorposition,coupledwithcuriositytoknowwhatplanMr.DouglasshadinhismindtobringaboutadifferentJamaica, de cidedMrs.Brimstone."Ifyousayso,andasI am aChristianwoman,Mr.Douglass,"sheanswered,"Iwillgowithyoutomakepeace,althoughImusttellyoutrulythatI'avenosortof goodfeelingforthatMatildaSlimslamatalL Me'usbandwillhavetoanswerforhimself.""Iwillgoifyougo,"saidNicholas,perceivingthatshehadalreadydecided."Well,thatissignedandsealed,"saidMr. Douglassheartily."SolongasAfricaandherdecendantsstandtogether,weneedfearnofoe. Aman'senemiesareofhisown'ousehold.LetusgotoseeSirMortimerandLadySlimslamwithoutdelay."CHAPTER A OONFEDERATION FORMED "ASHILLINGamonthisnottoomuchtopay,"insistedMr.Douglass;"butfemalescanbes,ixpence,""Iwillpayasixpenceamonth,thoughme'usbandisnotworkingregularnow,"saidMatilda,"an'ifthesubscriptionwasmore,Iwouldn'tsayawordagainst.it.""Butyou'aveatitle,an'youwillgetmoreoutofanythingwedothantherestofus,"objectedanotherlady."Howsoever,Iwillgivesixpenceamonth,for,afterall,wepayasixpencetogoan'seeapictureshow,an'wecandothesamefortheabsolutionofoppression.""Abolition,"correctedMr.Douglass,butwithin.finitetact,forhedidnotwanttooffendanyonewithsixpenceamonthtodonatetowardsthefundsofhisnewly-formed sOCiety, eventhoughhewaswellawarethatmanyof the memberswouldbeshortlyinarrears.Sixpencepermonth,paidirregularly,andwithmuchgrumbling,andonlyafterrepeatedsolicitation,wasneverthelessasumofmoneynottobedespisedintheallegedinterestsof racial propaganda,anditwasfornothinglessthatMr.DouglasshadhurriedlyorganizedhisUpandBeDoingConfederationoftheOppressed,ofwhichhehadhadhimselfelectedPerpetualPresidentandMinisterPlenipotentiary.Mr.DouglasshadbeensuccessfulineffectingareconciliationbetweentheBrimstonesandtheSlimslams six weeksbefore.Brothersinmisfortune,MortimerandNicholashadrecognizedthesilliness of remainingenemiesinthefaceofadisastercommontobothofthem.Theirwiveshadtacitlyagreed to admittherightofoneanothertoformaltitular Ilistinction, andnowaddressedeachotherpunctiliouslyasLadyBrimstoneandLadySlimslam.Thishadseta goodexampletoothers,andeventhe woman inMatilda'syard,whohad-vehementlyproclaimedagainstanysortof"ship"saveasteamShip,hadconsentedtosay"yourladyship"tobothladies Cjm learningthatamysteriousmovementwason foot wherebytheseladiesmightbecomeverygreatandprosperouspersonagesindeed. : Whatwasthatmovement?1Nooneknewexactly.Douglasswasaclever 1llan inhisway;herealizedthatanelementofmysterymadeforsuccess,especiallywhenonewasdeal ing withapeoplethatrevelledinthemysterious.Heinstinctively'understoodthepsychologyofhis NosoonerhadhebroughtMortimerandNicholasand thMr wives thanhepro-_ tothemascheme.Thiswastoinstitutea kociety orConfederationoftheOppressed,theaim whichwastobetheupliftingoftheworking 41asses ofJamaica,theputtingofthemintouchwith.tamarcansresidentinCubaandinCentralAmerica, the affiliationoftheConfederationwithMr.Garvey'sfullyused you, Youaretobenothingan'theyaretobeeverything;butnevermind.Adaywillcome!Itiscomingnow.Andwhatwesayisthatwemuststandbyoneanotherandworkforthatday.Wemustbefriendsan'brothersinprosperityandadver llity; whereforeIsayuntoyouthatwemustreconcileourdifferencesan'jointogether.""IamnoHigh Potent:1te, BrotherD.,"sighedpoor Mr.Brimstone."IfIwasaHighPotentatetheycouldn'tkickmeout'ofmejoblike'theydoing,fornothingatalL""Idon'tagreewithyou,Potentate,"answered Mr. Douglassfirmly. "Look around,an'whatdoyousee?Everywherecrownsaretotteringandthehighbroughtlowandthelowoneshigh.Lookat Gel' many,lookatRussia!LookatAfrica!GarveyismakingaRepublicthere,andifwe'elphimhere"hepausedsignificantly."Yes,ifwe'elphimhere?"repeatedoneofhisfriendsinterrogatively."Thenwewillseewhatwesee,"repliedMr.Douglasswithashortlaugh.."Buthow wiiI thathelpmetogetbackmejob?"demandedNicholas,whocouldnotperceivethedriftoftheseremarks."Youwon'twantajoblikethat,"Mr. Douglass assuredhim."Youwill'aveapositionbefittingyourPotency.Allwewantistotrustoneanother,toworktogather,andtokeepsilent.Itiscock'sownmouththatkillcock.Ifwedon'ttalk,no one willknowwhatwedoing,Inthemeantime,letusalljoininfriendlycommunionan'breakthebreadoffellowshiptcgather."Foramoment,Mrs.BrimstonedidMr.Douglasstheinjusticeofsupposinghewassuggestingalittlesupperatherhusband'sexpense.This,atsucha time,sheconsideredmostunreasonable;indeed,monstrous.Buthisnextwordsreassuredher."Iamaskingyouboth,"hecontinued,"toburypastandfutureanimositiesandtomakepeacewithSirMortimerandLadySlimslam."Itwasnotsupperhehadinmind.ThatwasnowcleartotheMarchioness.Buthewasproposingsomethingevenworse.Shegazedathimasatonewhouttersrankblasphemy."Doy'umeanstotellme,Mr. Douglass" saidshe,"thatyouteckthetrouble to walkallthiswaytome'ousetotellmetomakepeacewiththatforwardwomanthatsayshe'aveatitlean'Idon'thavenone?Letmetellyou,mefriends,thatthoughpoorNickwillshortlybeoutof a job,yetIamgladthatMatildaSlimslam's'usbandiskickedout,forthatwaswhatIbinprayingfor.Brimstonecangetanotherjobeasy;hearea goodmechanic,an'Iamnotafraid.Itisnotthework,itistheinjusticethatboilmeood,an'ifIcouldlaymehan'sontheRailwayDirector,an'thelawwouldn'tdome:lothing,hisownmotherwouldn'tknowhimwhenIdonewidhim.ButIhopetoGodthatMatildaSlimslamwillwalkherfoottocomean'borrowasixpencefromme,an'thenIwillthrowitatheran'curse'eraboutit.Youmarkmewords.""'Vengeanceismine,saiththeLord;Iwillre pay,''' quotedMr.Douglassunctuously."Iagreewithallyousay,LadyBrimstone,butthereisatimeforallthings.Thisisatimefortheleadingmembersofourracetocometogather,andifyouandthePotentatearenotleaders,whoare?""NotMortimerSlimslam,"saidtheMarchionessemphatically.."'Well,buthehasbinselected,youknow,"object e1 Mr.Douglasssoothingly."Hehasbeentakenandanotherleft.Wemustputasidepersonalfeelings.Haveyounotnoticedwhatwhitepeople dowhentheywantanything,LadyBrimstone?""Whatthemdo, Mr.Douglass?""They join togatherandfightforoneanothertilltheygainwhattheywant;afterthattheyfightagainstoneanother.Thatishistory,Mrs.-Imean,MeLady-an'y'uknowthatIamamanreadplentyofhistory.Buttheyneverfightforblackpeople:theymorereadyto join togathertorobus,whichtheydoingallthetime.Whydon'twedolike them'f Nowistheacceptedtime,nowisthedayofsalvation.Youareatitledperson,forGarveyisstillalive,an'ifyouwenttoAmericato-morrowalltheAfricanfolkstherewouldcallyou'lady.'Nobodycantakethatawayfromyou.Butdon'tyouseehowfoolishitlookthatyouandMrs. SHmslamshouldbefightingoneanotherwhenyououghttojoinupyourforcesagainsttheoppressor?""It'sreallyfoolish,"commentedoneofthemenwithhim.""Onlywedo it," saidanother,"but if wewereunited,beingweareinthemajorityherewewouldbeinadifferentposition.""Ah! exclaimedMr.Douglass;"nowyoutalking! NowyousayingwhatIbinwantingtosay!Unitedwestand;dividedtheywillkickus, outot: every job wehaveiftheycangetawhiteman. tofill it." Threemonthsbefore,NicholasBrimstone,thoughhemightnothavecontradictedsucha wouldnothaveidentifiedhimselfwithit.But a maninasituationandamanwhohaslostone,takeverydifferentviewsofthesamequestion,andNicholaswasnotnowthemanhehadbeen.Besidesthenaturalfeelingconsonantwithhisnewhonoursanddignities,hewassufferingto-nightfromasenseof

PAGE 28

26 PLANTER S'PUNCH1925-26THEGOVERNMENTSAVINGSBANK highest intheland.Next,withtheiractive co-op eration,hehadhadtodrawtogetheranumber ot menandwomen,animatedwithasense ot grievanceorfilledwithvagueambitions,whowouldconsenttosupportpersonallyandfinanciallyapropagandawhichcouldbe developedastimeandcircumstancespermitted.Douglassleftunexplainedtheendhehadinview.Buttherewassomethinginhismindthateverynowandthenbetrayeditselfinwords,andwhenheletslipsomeremarkaboutthesixtythousandJamaicansinCubawhomusthavelearnthowtheCubansfought,andabouttheancientsuccessfulstruggleoftheHaytians tor complete!reedom,therewerenota fewtofeelthathelooked torward totheday,notdistant,whenagreatcrowdofJamaicansinneighbouringlandswouldcomefiockingbacktoJamaica,allsecretlyarmed,tosetupintheislandapartofthat AtricanRepub licaboutwhichsomuchhadbeenheardinrecentdays.Mostofthosewhotookthisviewdeterminedtoallowtheirattitudeandactionatthattimetobedeterminedbyconditions.Atmomentsofemergencytheycouldalwaysfallillandbe forcedtoremainathome.Theywouldgladlyleaveotherstofightactivelythebattle ot theoppressed.Inthemeantimetheywereenjoyingthesensationofheroism.LIST OF BRANCHES:noindigentJamaicanhadeverbeenrepatriated.Mr.Douglassregardedhimselfasa sufficientlyindigentJamaicantoneedalltheassistancethathiscountrymencouldpossiblyaffordhim,andhehadnothesitatedtoappealtoJamaicansinColon fornecessarydonations.Thesehadcomeinliberallyenoughtoroverayear,andthen,asinallthesesocietiestheinteresthaddiedout.ButDouglasswasan Inde fatigableman,andshrewdalso;hehadstudiedtheprogressoftheGarveymovementinAmericaandhadrecognisedthattheheadofthatmovementwasnevercontentwithastaticposition.Alwayshewasmovingforward.Alwayshewasdoingsomethingnew.Alwayshewasgeneratingenthusiasmbysomemoredaringschemethanbeforesomestrikingproposal.Ifhe,whynotothers? waspossibleinthesedays. ANicodemusDouglass,conscious ofhisdesiretoupliftthepeople-forMr.Douglassneverdoubtedhisownmotives-mighteffectwondersifonlyheobtainedsufficientsupport.Hewashappythisevening.HeandhishelpershadsummonedameetingofthoseinterestedintheAbolitionofOppression,andnofewerthantwohundredpersonshadattended.SirMortimerhadnotbeenabletoputinanappearance;hehadobtainedemploymentfortheeveningatasmallhotelwhereadinnerwasbeinggiven,andhehadconcludedthathewould beoppressinghimselfdidheneglecttotakethisopportunityofearninga fewshillings.ButMr.DouglasshadinsistedthatLadySlimslamshouldbepresent,andhadtakenhertothemeetinginacab;andtheHighConspicuouswastherewithhisWife,andmanyotherpersonsofimportanceandeloquence.TheHighConspicuoushadasLadyBrimstonehadpredicted,foundanother'jobwhichwasalmostaswellremuneratedasthatwhichhehadrecentlylost.Buthissenseofgrievanceremained,andhewasone oftheforemostmembersoftheConfederationanditsbestfinancialsupporter. "Oneshillingamonthfrommales,sixpenceamonth trom females-thatisdecided,"announcedthePermanentPresident;"andnow,ladiesandgentlemen,Ihavesomethingelsetotellyou.OurHighConspicuousPotentate,who,aseverybodyknow,isamanwithmeans,inspiteofwhattheRailwaydotohim,hasdecidedtocontributetoourFightingFundno'lessthantwentypounds-twentypounds,ladlesandgentlemen-andMr.SharkseyandMr.Greenhavegivenfivepoundsapiece,and,thougha poorman,I willgivetenpounds;thuswewill'aveafundamentalFightingFundoffortypoundstobeginwith."Whentheapplausehaddiedaway,Mr.Douglassagainrose,asthoughstrucksuddenlybyahappy __ thought."Ladiesan'gentlemen,"he said. "Iknowthatmostofyouwould beashamedtoleavetheheatandburdenofthedayuponjusta tew ofus. IamthereforeproposingthateachmaninthisaudienceshallcontributeadollarasasortofcounterblasttothebigsumsIhavementioned,justtoshowthateverymember ot usIsindependentInmindandpocket. I willappointLadyBrimstone,LadySlimslamandsixotherladiestogoroundatoncean'collectthisamount,andthosewho'aven'tthereadymoney-thoughIamsuresuchgentlemenasI seearoundmeto-nightarenotpoverty-strickencangiveafaithful prQmise to senditinto-morrow:ill fact, Iwillcallandcollectitmesel!."Theapplauseatthiswasnotquiteso Emthusias ticasithadbeen before.Indeed,animpartialobserverwouldhavesaiditwasremarkablyfeeble.Yetnomanintheaudience wanted toappearmeanorpoor, so,inspiteofthegeneral teellng thatsomethingofanadvantagewasbeingtakenofthesituation,atleastfiftypersonscontributedadollareachonthespot,andaboutfiftyothersmadepromiseswhichtheyhopedtobeabletobreak.Thewomenwereaskedtogivenothingbywayofinitialcontribution.Mr.Douglasswastoowisetoventuretoo far.Whenthiscollectionhadbeentakenup,LadyBrimstone,withoutwaitingforanyfurtherannouncementfromthePermanentPresident,remindedhimthatatreasurerhadtobeelectedandhintedthatthismatterhadbeenprivatelydiscussedbefore."Why.yes,"heagreedinstantly,"andnoonebetterfittedforthatmostexaltedpostcanbefoundthanthePotentate.Amanwho gives soliberallycanbeentrusted,withalldueandpropersafeguards,withthefundsofthisConfederation.Gentlemenandladles,InominatetheHighConspicuousPotentatetobeourMostExaltedTreasurer."Thisnominationwasimmediatelyaccepted,andthenBrimstone,actingonhiswife'ssuggestion,remarkedthatitshould'bedecidedatthatmeetingwhoshoulddrawmoneyoutofthebankforthepurposesoftheConfederation."Quiteright,"agreedthePresident."You,MostExaltedTreasurer,willhavetherighttodoso,on being presentedwithacertificateofauthorisationfrommetothateffect.Thiscertificatewillbedulyhandedto youwhenevertheCommitteeofManagementexpressestheirdesirethatmoneyshouldbedrawn.ThuB youandmewillactinunisonatthedictatesoftheConfederation."Thisseemedquitepropertotheaudience.ButLadyBrimstone,whosefamiliaritywithindigent TEWCASTLE HECTOR'S RIVER ITYVILLE MAN CHIONEAL lIONEAGUE FRANKFIELD DARLISTONPETERSFIELDLAWRENCE TAVERN HA}IPDEN TROJA MONTPELIER MAGGOTTYADELPHI DUNCANS ULSTERSPRINGGAYLE CHRISTIANAOCHORIOS ORACABESSA CROOKED RIVER STEWART TOWN CRUZHOPEBAY RIVERSIDE CAlIBRIDGE BETHELTOWN PORT :MORANT MILE GULLY SPALDINGS POINTHILLNEWPORT PRIESTMAN'S RIVER ELIMNEWMARKETButeventhemostnobleanddistinguishedcauseneedsmoneyinthesematerialisticdays,andMr.Douglasswastoopracticalamannottorecognisethis.Indeed,thecollectionofmoneyhadbeenhisimmediateprincipalaimin torming theContederation.Mr.NicodemusDouglassloved toworkhardwithhistongue.Manuallabourdidnotappealtohim.Hepreacheditsvirtues,foritisnecessarythatthereshouldbemanualworkersifmen ot themoutharetolive;heinsistedalwaysuponthedignity ot labour.Buthewaswillingthatotherpeopleshouldhaveallthedignityofactuallabour,andnothingmovedhimtogreaterconcernthanthepossibilityofany ot hisnumerousfriendsandacquaintancesbeingoutof asituation.Healwayssawoppressioninthat,oppressionofhimselfincidentally, forhefeltthat,indirectly,hewasboundtobeasufferer.Hehad!ormedseveralsocieties betore. ForsomesixmonthsTheAwakeandBeAlive Associationhadbeenaveryflourishingconcern,butthememberswenttosleepagainandsubscriptions tail ed.HisschemefortheRepatriationofIndigentJamaicansinPanamahadworkedverywell,though MORAX'T BAY PORT ST. ANN'S BAY FAI,)!OUTH MONTEGO BAY LUCEA SAV-LA-MAR BLACKRIVERMANDEVILLE MAYPE.r SPANISHTOWN PORT MARIA HALF-WAY-TREE CHAPELTON ALLEYLINSTEADBUFFBAY PORT ROYAL GUY'SHILLCROSS ROADS GORDON EWARTON GREEN I HIGHGATEGOLDEN GROVE TOWN BALACLAVA STONYHILLRICHMOND PORUS ANNOTTO BAY CATADUPA OLD HARBOUR SlUTH'S VILLAGERemittances may be made FreeofPostage and Reg istration. Interest of 3 per cent, per annum, compounded half yearly.Itbrings the facilities of the Savings Departmentofa Bank to the principal T owns and Districtsofthe Island. F umishes G0Vernment Guaranteed Security to its Depositors.

PAGE 29

EveryMailBrings usThevery LatestandNewestofFashion' s Fanciesinthe Dry Goods World.21houseopenedintotheyard,whosegateformed th& principalportalofallthosedwellinginthistypicalKingstontenement.Mortimer'shouse,indeed, was themostconsiderablesinglebuildinginthatyardoftenements,whichcircumstancehadalwaysplacedMortimerandMatildasociallyabove.theotherpeopleintheyard,andhadhelpedtorenderthem the equalsofsuchpersonsastheBrimstones,theJonese3,andthoseothersin"MitchellTownwhomfortuneandasuperiorabilityhadassistedto success.Thefoundations of thelittlebuildingstoodhighabovethelevel ofthethoroughfareitoverlooked.Decadesoferosionhadworndownthesurface of thestreetsomefeetbelowitsoriginallevel; there foreanyonestandinginitandendeavouringtogazeintotheinteriorofourknight'slittledomicile,wascompelledtolookupwardsandmustneedsstandontheoppositesidewalkto dothiswithanydegreeof convenience.Evenso,therangeofhisvisioninhis etrort todiscernwhatwasafootwithin placewhichpiquedhiscuriosity,wasrestricted;andasit hll;ppened thatcurtainsshadedthetwosashwindows of thehouse,afurtherbarwaserectedagainstone'snaturalanxietytolearnwhattheoccupantsofthatdiscreethomemightdesiretoconcealfromtheouterworld..ItseemedtoMr.ProudleighthathisworstsuspicionsofMatildawereconfirmedashestoodoutsidethelittledomicileandstroveinvaintocatch a glimpseof Mr.DouglassandtheLadyMat.Hesawabsolutelynothingofthem;thereforeheconcludedthattheywerehidingfromhim,orfromothers,andhewasjustlyscandalisedbysuchanendeavouronthepartofthesuspectedpersonstocheathim ofthe evidencewhichhissenseofsightdesired.WhydidMatildaliveina placeintowhichyoucouldnoteasilypeer?Whywerethosecurtainssoarrangedthattheyobscuredtheview?WhywasthelargekerosenetablelampsoplacedthatitdidnotilluminejustthosecornerswhichMr.Proudleighwouldhavelovedtoexplore?Whyweretherenostepsleadinguptoafrontdoor,atwhicharighteousseekerafterinformationmighthavesilentlyandcautiouslyplacedhimself,inthehopeofhearingsomethingofanincriminatingnature,beforeloudlyknockinganddemandingadmissionlikeanordinaryfamiliarvisitor?ItistruethatMatildahadnotbuiltthehouse,andthatitwasMortimerwhohadrentedit;butatthismomentMr.Proudleighwasnotdisposedtobeimpartialandjust.Afterall,inspiteofhisrheumatism,hehad'walkedsomedistancequicklyinthehopeofbeingabletogatherdataof acharacterdamagingtothereputation of LadySlimslam,anditwasmostunfairtohimtofindthathehadtakenallthistroublefornothing.Afeelingofvirtuousindignationfilledhisbreast.Heknewthathewasbeingbadlytreated.Hedidhisbestonthisunpromisingfield of operations.Hecreptupagainstthesideofthehouseandlistened.Heheardamurmurof voicesbutnodistinctwords.Hewentovertotheoppositesideofthestreet,balancedhimselfdangerouslyon the topof alargestonelyingthere,andstrainedhiseyesinthe etrort todiscernevenashadowfromwhichhemightbeabletodrawsomepositiveconclusionsasto lover-likeembracesproceedingat the moment.Butnosilhouette,howeverfaint,appear-(Oontinued on Page 42) Gents' Hosiers Tailors, Outfitters, etc.KINGSTREET,KINGSTON.PUNCHLargestStock01 inJamaica.Kingston'sLowestPrices---Always.Ready-to-Wear Clothing Largest VarietyofDRYGOODSintheIsland.inSPECIALISTSPLAN,TERS'Wholesale&RetailDryGoodsMerchantsCHAPTERSIXHINTSTOSIRMORTIMERMORTIMER'Sresidence,whichconsistedoftwofairlylarge-sizedroomslookedoutuponthestreet,itsfrontagebeingfiushwiththepremises'boundary.Toenterityouhadtogothroughtheyard,forbothroomsofthe if youhadtakenmeadVice,Sam,youwouldhaveyou'dollarinyou'pocketnow.""Ididn'thearyougivin'menoadviceOld Mas" t sa,reurnedJonesdryly;"youmustbedreaming.Well,Icanspareadollar,an'Iratherloseitthanlookmean.ButI didn't sayDouglasswasgoin'torobthepeople;Ionlysayhecandrawthemoneywhenhelike.IneverhearanyonecallDouglassathiefyet;heonlylivebyhisbrains.Iguessthecashisallright.""IwonderwhatMatildasayabout it," putinSusan;"shelookslikesheagreewitheverywordDouglassspeak.""Didyounoticedat,Sue?"demandedherfather "ItiswhatIbinnoticingmeself.Scandalan'medoan'twalktogather,an'nobodyeverhearmesayoneword'gainstanybody'scharacter.But if IwasMortimerIwouldteckat'oughtan'watchthemtwonightan'day.MisterDouglassisroundatMortimerhouseveryoftennow,especially whell Mortygoneout.Whyhimgoin'theresofrequent?ItookawalktowardsMorty'splaceonlyyesterday,'boutdehourIknowMisterDouglasswaslikelytobedere,an'Ihangaboutoutsidetosee if God 'elpmetohearanyt'ing,butthemwasso qUietfnside-nomousecouldha'beatdem-thatI'aveasuspicionwhich,howsoever,Ikeepstome self.ButIdoan'tlikeit.It'snotmybusiness,an'fromIwasa boyIlarntomindmeownbusinesseversinceamannearlybrokemebackbecause i followhimonenightto !lee wherehimgoing.But-""Mindhow youtalk,pupa!"warnedSusanbutimmediatelymadeuphermindtorepeatfaithfullytohernumerousfriendsallthatherfatherhadjustsaidandhinted."Mindtrouble!Mr.Douglassisapowerfulman,an'hesopopularnowthat if yousayawordabouthim,themmaymakeyousorryforit.ItisMorty'sbusiness,after all, an' if hedon't mind ifMr.Douglassisalwaysroundatthe'ousewhenheisnotthere,whyshouldwemind?Nomaniscomin'allthetimetoseemewhenSamisgoneout,an'thatisenoughfor me.Don'tletussayanythingmoreaboutit.Iwonder if whenDouglasstakeMatildahometonighthimwentin side,oronlyteck'ertothegate?Iwouldreallyliketofindout,""P'rhapsIcouldteckasteproun'todeplace,an'enquire'boutsomet'ingasasort of excuse,an'findout?"suggestedMr.Proudleighhopefully."Whaty'ut'inkofdat?""Iamnottellingy'uto go," saidSusan,"an'Ican'ttellyounotto go,foryouareafullgrownman.Butify'ugo, becareful."Mr.Proudleighnotunnaturallyinterpretedthisspeechasimplyingconsent,andimmediatelydepartedfromthecompanyofhissonin-Iawanddaughter."Iwi'seeyoulater,"heremarkedhurriedly,andproceededinthedirectionofMortimer'shouse.1925-26penonsborrowing sixpenceshadrenderedher som& batsuspicious of humannature,wasnotsosatis led. "Willthemoneybelodgedinme'usband's .me?" sheenqUired."Iamafraidthatthatwouldnotbeconstitutional, LadyBrimstone,"repliedMr.Douglasswith pnUe deprecation, "You see, youhavealldonemethe honour to electmeasPermanentPresidentandInlsterPlenipotentiary,andImusthavesomefunction, otherwise Iambecomeasamerefigure 'ead andassoundingbrassandtinklingcymbals.Iam responsibletoeachandeveryone of you,andifthe ExaltedTreasurercouldbothlodgean'withdraw the funds,wherewouldmyresponsibilitybe?The moneymustbe lodgedinmyname.ButIcan't withdraw it-notevenmeowntenpounds.Onlythe1reasurercandothatonbeingauthorisedbyme. Those who agree willpleaseholdhuptheir'ands."Most of thosepresenthelduptheirhands.Mr.Douglass'sreasoningappearedquitesoundtothem, andinanycasetheyhadnotmuchtolose. Matilda, Indeed,shouted"hear,hear,"enthusiasti eally; Ihe hadstronglysupportedMr.Douglass throughout themeeting,andthishadnottendedto make LadyBrimstoneanythemoresatisfiedwiththe proceedings.Butthatladyfelttheinfluence o! the enthusiasmthatprevailed.Mr.Douglasswasregardedasa newLeader,a second Mr. Garvey,andItwouldnot have beenwisetoquestiontooclosely the plansthatheproposed.Buttherewasherhusband's twenty pounds,whichcouldnotnow,with decency, bewithdrawnfromthegeneralfund.Lady Brimstone began to feelthattheliberationof the oppressedmightbepurchasedattoohigha price. Douglasssawthatshewasdissatisfied,andadopted the bestmeansavailabletodiverttheattention of the audiencefromher.HelaunchedoutIntoanImpassioned speechontheiniquitiesof op preulon, upontheglory oftitlesbestowedbyMr. Garvey, andthenhemadeanannouncementhehadbeen keeping back fortheproperdramaticmoment."I, though a poorman,throughworkingfortheCIuse, am determinedtomakefurthersacrificesforthe uplifting ofmypeople.Ladiesandgentlemen,ItIs'myIntention to go,atmyownexpense,toCuba 'YBry shortly, to getmembersforourConfederation,to preachthevirtuesofunity,andtoraisemoneyfor ourFightingFund.AtmeownexpenseIwilldothis; I refuse to allow asinglepennytobevotedforthe purpose."Hepausedtogive someoneanop portunlty ofcontendingthatthegeneralfund should payatleastpartofhisexpenses,butitwas clear thateveryonetherewaswilling,nay,anxious, that he shouldwearundiminishedthehaloof lal sacrifice. Not asinglevoicewasupliftedtothathe shouldnotcarryouthiscampaignat hieown expense. Matildadidopenherlipsto say something,butshecaughtthetoneofthe audience intime, andrefrained.So :Mr. Douglass proceeded. "0;don't ask me totakeanyofyourmoney,"he vociferated, "for I will not. Memindismadeup.WhenIgo, IwantourHighPotentateBrimstonetoactIn my place, and as Iamgoingshortly,anymoney received in me absencewillbelodgedinhisDIme. To-morrow, ladiesandgentlemen,allthecashIcollected herethisevening,an'whatwegetbe,IIIbeinthebank,andIwantyoutoselectadozen people now whowillgowithmeand safely putitinthebank."men were deputed toperformthisimporon, and then,after some furtherdesultorymeeting broke up. Old Mr.Proudleigh,his,.Tones, andhisdaughter,Mrs.Jones, wal totheirhouseinMitchellTown...r. Deq1asa ila man whocantalk!"exclaim man intones ofadmiration."An'thede more Matilda look'ponhimas able prince, whichistosaydatheis,torh poun'lto-nlght as if itwasnottenatall""Hum," obIerncl hispracticaldaughter,Susan,"but'hatIdon't nndentand Isthathimaloneistolodgallthemoney: why himalone?""But Brlll18tonl Is to teekItout of debankue," hrfatherreminded her."Datisafairar:rangem nt." "Isupposso," saidBnean,who didnotunder mnd mattersofhigh finance. Joneslaughd."Itsoundallright,perhaps," heremarked,"andasthemonly get a dollarout of me, which Ididn'toriginallyIntend to givean'don't mean topayanythingmore, Ididn'tsay'anythingto-night.Butdon'tyou see, SUI, thatthereIsnothingtopreventDouglassfrom draWing money 10dpd inhisname?Whoistopreventhim?Theon'tknowanythingaboutE alted Treasurer tr'lDUatoDle, oryou,orme.ThemwilltakethecaBhDouglasswantittheywillbebound Ittohim.Hehavethewholethingsoft!" Llahtbroke in upon Mr.Proudleigh."Den,"he uclalmecl, later Douglassisnottenbutadam!I as(hlnkln' soallthetimemeselfbut u't ntto say It, forIfamandidBayone'word Donglass to-night atdatmeeting,dose pe0 pleouldha'beathimtodeath.Lord,Jamaica folUeetooll8h! ButI dldD't glehimaquattie,an'

PAGE 30

28PLATER S' PUNCHDODGEBROTHERS MOTOR CARSThecarhasa substantial kindofbeautythatgrows on you the longer you contemplateit.This is due, in part, to the unusualgraceandsymmetryofthe body lines. It is also due to the factthatquality materials always and unmistakably reveal themselves in the finished product.1925-26JOHNCROOK,DEALER.KINGSTONJAMAICA.,._,

PAGE 31

1925-26POLANTER S' PUNCH29 t II INITIATIVE,+INDUSTRY-SUCCESSTHE STORY OF 'fUE LINDO iiiji'jiii"i'iiiiijiiiji II iiiiiEiijll TheLindobrothers,eightinall,emigratedfromJamaicawhenmereboysto theirfortune ina foreignandundevelopedcountry.Theycameofa family in Jamaicaandintimatelycon nectedwiththeisland'shistoryandfortunes.ThefatherofthesubjectsofthissketchwasforyearsamerchantofKingston,coiningoriginallyfromthenorthsideoftheislandwheretheLindoshadbeensettledforgenerations.One unclewasMr.AbrahamLindo,theheadof a largebusinessinFalmouth,whichatthattime,asthechieftownofthatsectionoftheislandinwhichthesugarandrumindustryflourished,wasthecommercialrivalofKingston.To-dayFalmouthismuchdecayed,butalargenumberofits <;losed andruinedhousesandbusinessestablishmentsattesttoaformerprosperity.WiththecreationofthatprosperitytheLindofamilyhada gooddealtodo,andprominentamongthemwasMr.AbrahamLindo,theintimatefriendandadviserofsugarplanters,andtheproprietorofwhatwasinitstimethecolony'sleadingjournalof influence.AbrahamLindowashimselfawriterofmarkedability.Hewasamanofliberalandcultivatedmind,greatmoralcourage,andofawideandsustainedphilanthropy.Anotherbrother,Mr.DavidLindo,wasevenmoredistinguished.DavidLindohadthetastesandapti-tudesof ascientistandowedhis scientific traininglargelytohisownendeavours.Businesswashisvocation,butchemistrywashisavocationandthelove hisheart;unaidedhemadeimportantchemicaldiscoverieswhichwere welcomedinEnglishscien tific qircles.Hisportraitshowshimtohavebeenaman bf deeply reflective min<;l. a browsuggestingldveofapursuitof knowledge, whichwasindeedhis dpminant characteristic. :aut sugarfell upon evil days,TrelawnyandSt, decayed,andmostoftheablestmenof tile werecompelled'toleave' their ancient home: Somewenttootherpartsoftheisland;a few mem'bers oftheyoungergenerationdeterminedtotry fortunesoverseas.AmongsttheseweretheLindoswhowenttoCostaRica.Theretheydevotedbrainsandenergytothetasksthatcametotheirhands,acquiredwealth,andin1916returned-manyofthem-tosettleintheirnativelandonce more.Atthetime oftheirreturntoJamaicaeveryoneintheisland wastalkingabouttheprospectsoftheisland'ssugardevelopmentandthenecessityof adoptingmodern methods ofsugarmanufacture.ThecrywasthattheGovernmentshouldestablishoneortwocentralfactoriesasanexampleandencourage1 This year is the Centenary ofJ.Wray&Nephew.TheFirm was Establi,hedin1825.Itnow starts to workforits next century. menttopossibleinvestors.TheLindoBrothers,however,withoutwaiting,forGovernmentexample01'encouragement,andprobablywiththeideain RERXARD LODGECENTRALFACTORYtheirmindsthatanybusinessenterprisewhichhadtodependuponGovernmentinitiativefora beginning would nevermaterialise,wentstraightaheadand est.3.blished, inco-operationwithMr.A.L. Keel ing,thefirstsugarcentralfact'oryinJamaica,nowknownasBernardLodge,ontheSt.George'sPlainof St.Catherine. The estatesofthelateColonelWardwerethenuponthemarket.ColonelWard,andhisuncleMr.John hadbU,iltupaflourishingrumbusiness,andhaddonemuehto'makethe alrElady famous,name'of Rumstillmore fa'mousfor highandreliablequality.TheLindoBrothersenteredinto negoU",tions fortheseestatesandbusiness,acquiredall of themandcontinuedoperationsundertheoldname of J.WrayandNephew.Itwasalldoneill a'Very littlewhileanddonewiththatenergyandthoroughnesswhichtheyhadshowninalltheirbusinessactivities.Theywentinto,businesslargelyinJamaicaastheyhaddonewheneverpracticableinCosta Rica.Theyarebelieversinconsiderableventuresandtheyneverallowthemselvestobede pI essed byadverseconditions. .Thefirm ofLindoBrothersconsistsof Mr. CecilLindo,whoseheadquartersareinCostaRica,andwhotravelsconstantlybetween'thatcountry,Ja.maica,NewYorkandLondonintheinterestsofthefirm; Mr.Percy Lindo,whoisthegeneralresidentmanagerofthebusinessinJamaica,andMr.StanleyLindo, who istheresidentmanageroftheCostaRicanbranchoftheLindoBrothers.TwootherbrothersinJamaica,RupertLindoandRobertLindoareconnectedwiththefirmofJ.WrayandNephew,andoneMr.AugustLin.do,hasretiredandnowlivesintheUnitedStates.Mr.A ..L.KeelingistheonlymannotofthefamilyassociatedwiththeLindoBrothers,beingapartnerintheBernardLodgeCentralSugarFactory.Mr.KeelingisalsoaJamaican.ThusasmallgroupofJamaicagentlemenareentirelyresponsiblefortheinitiation of theSugarCentralFactorymovementinJamaica,andforthecarryingonofalargeJamaicabusinesswithlongandhonourabletraditions.BernardLodgeisequippedwithmodernsugarmakingmachinery, theoutputofrumonthisandontheotherestatesoftheLindoBrothersissogreatyearbyyearthata speci:ll RumStoretothewestendofthecityhasbeenallocatedtotheirusebytheGovernment.One oftheillustrationsappearingonthispageshowsapartofthisRumStore;buta consider ableportionofotherGovernmentRumStoresisalso occupiedbytheproductoftheLindodistilleries.Herearestoredrumsmadebutyesterdayandrumsthathavebeenmaturingforoverthirtyyears.ThecarewhichJ.WrayandNephewdisplayedinkeepingupthereputationoftheirfirmformaturedspiritsisassiduouslyobserved bytheLindoBrothers,whoaredeterminedthatJamaicarumshallneverlos.eitsname,iftheycanconserveit,inanycountryinwhichithas won a deservedreputation.InJamaicaitselftheseal 'of J.WrayandNephewonanybottleofliquorisaguar }anteeof thatliquor{s theambitionoftheLindoBrothersbeingtoupholdand,ifpossiblej BurpassthestandardstheyinheritedintakingoverthebusinessattheheadofwhichthelateColonel Ward stoodforsomanyyears. : NomorehardworkingJamaicansaretobefoundthanMr. CecilLindoand-Mr.PercyUndo.ItistheuniversalfeelinginJamaicathattheydeservethesuccesswhichhascometothemasthereowardofhardworkandstrikingforethought.Beginninglifewithbutanexcellentnameand knowledge ofwhattheirancestorshadstoodforinJamaica,theyhaveplacedthefamilyfortunesashighasevertheystoodinthiscountry;theyhaveshownthemselvesinnowayunworthyofthosewho'boretheirnamebeforethem,andJamaicafeelsthattheirreturnhomefromCostaRicawasa goodthingfor country. AXIXTERIOR VIEWOFTHE LINDO'SRtnI STORESPECIAL RUM STOREFORSTORINGTHE LL"DO'SRUll

PAGE 32

30PLANTERS'PUNCH1925-26THECITADEL (Continued fromPage 20) Bushliftedhertoherfeet. "Come!Thereisnotimetolose."Evenashespoketherewasthesoundofrunningfeetinthehall,thetapestrypartedandablackfacepeeredwithstaringwhiteeyesintotheroom."Back!"Bushshouted.Bending,hesnatchedtheemptypistolfromthefioorandlevelleditatthedoor.Thefacedisappearedandtheopeningclosed."Wemustgo now,"hewhispered,"whilethereisyettime."Withthepistolbuttheshiveredtheglassglobethatsurroundedthecandles,andextinguishedthem.Calmandwhitethemoonlightfellinwidebarsoflightacrosstheroom.Manganlayintheshadowofthetable,withhisfeetprotrudingintothelight,twosmall,black-shodfeetmotionlessasindeath.THEYturnedtotheopendoorthatledtothegarden,butalreadyatinylightbobbedamongthetrees.Fromtheservants'quartersintherearsomeonewascomingwithalight.Bushrantothedoorthroughwhichhehadentered.Themoonlightbathedthedarkmangoeswithsilver;beneaththemsleptthenight.HalfsupportingVlrginie,heranacrossthestripofsilentturf. They werenowintheshadeofthetrees,butherdressshowedverywhiteagainstthedarkness.Theirfeetcrunchedsharplyonthegravelleddrive.Ahead,betweenthegateposts,wastheroad,brightinthemoonlight.Behindtheminthehouse,awildcryofterrorstartledthestillness;lightsfiashedinthedarkenedwindows;therewasthesoundofexcitedvoices. Aclusterofbananatreesleanedlong,broadfrondsacrosstheroad,andintheirshadowBush;stoppedanddrewthegirlintohisarms."Beloved,'hewhispered,"Lukewaitsforus.The brig Isreadytoputtosea."Heburiedhisfacein ber hairandbreatheditsfragrance."Willyougowithme?Willyoubemine,forever?"Shedidnotanswer,buthefeltherheadsinkback;hesawherfacewhiteinthedimlight;hefeltthesweetnessofherlips.Hisarmscrushedhertohimandherheartbeatpalpablyagainsthisbarebreastwherethecoathadbeentornfromhim.Thenhefeltherwarmbodygrowsuddenlylimpandyielding,andheliftedhisheadasthoughindefianceoftheworld."Come,wemustnotlinger;alreadyperhapstheyare(ollowing." He caughtanarmaboutherwaistandhalfrunning,halfwalking,theyhurrieddowntheroadinthemoonlight.Fromthetreesbeyond abrokenwalladogbarkedsharplyandranyappingtothegate.Thenfar be hindthemBushheardfaintbutclearinthesilencea voice.Thesoundinspiredanewvigor,andhe be gantorun.AthissideheheardVirginiebreathingheavilyandhisownbreathwasraspinginhisthroat.Theroadbentslowlytotherightandcrossed astoneculvert.Fromtheseaa coolnessstrucktheirheated"faces.Bushhadmarkedtheplacementally;itwashalfwaybetweenthehouseandthewaitingboat.Hestoppedandlistened,pantingforbreath.Ahead,clinkingonthemetalled road justbeyondtheturn,wasthesoundofhorses'hoofs.Thesoundgrewsuddenlyloudandclear,andthentwohorsementurnedthecorner,ridingabreast,blackfiguresinthenight.BushseizedVirginieinhisarmsandturnedtowardtheshadowofthetreesalongtheroad,buthewastoolate.Herwhitedressshonelikealightinthemoonshine."Stop,there!" a voicecalledinFrench.InthemadimpulseoffiightBushkeptontowardthecoveroftheroadside;againthevoice called,andtheclatterofhoofsfollowingtoldhimthatthehorseshadbeenspurredforward.Attheedgeoftheroadhepaused.A boldfrontmightcarry of( thesituation."Whoareyou," hedemandedinthesametongue,"thatyoushouldstopamanwhowalksinthemoonlightwithhissweetheart?"Themanonthehorselaughed."Comeintothemoonlight,"hedemanded."Itislatefor lovemakingonthehighway."InthecircleofhisarmBushfeltVirginietrembling.Thenshefiunghisarmfromhershoulderandwalkedtowardthehorsemen.Hervoicestruggledtosteadyitselfintoaneventone."Ifyoumustknow,IamVirginieGoutier,thewardofMonsieurLeroyMangan.IsitnecessarythatImustreportmyselftoanymanwhomImeetonthehighwaybeforethedoorofthehouseofmyguardian?"Therewasamomentarysilence. "Perhaps,"saidtheotherman,whohadnotyetspoken,"wehavebeeninerrortohavehaltedyoubut,made moiselle, tb<> roadsofLeCapatthishourareatbestunsafe.YouwoulddowelltoreturntothevillaofMonsieurMangan.Youarefarinyourwalkfromthegate."Bushsilentlyregardedthetwohorsemenastheysatmotionlessinthemoonlight.Theywereinuniform,forthecoldlightglitteredontheepauletsandcaughtglintsof firefrompolishedbuttonsandswordhilts.Nowandthentheirfacesliftedastheyspokeandhesawthattheyweremenof color,omcersoftheEmperor,returningdoubtlessfromsomelatecelebrationinthetown."Bien!Let'son!Pardon,mademoiselle.Our re gardstoMonsieurMangan!"Hetouchedhishorsewiththespurandtheanimalsidledtowardtheroadside."Eh,what?"Therewasanothertonetohisvoice."Monsieur,there,outintothelightwithyou."StolidlyBushstoodhisground.Themanwhohadspokenreinedhishorsenearer."Philippe!"hecalled."Thisfellowhere,havea lookathim."Thetwomenrodenearer.AsTHEYinspectedBush,puzzledbythetorncoatandthesignsofhisrecentencounter,therewasasoundofrunningfeetcomingdowntheroad.Bushheardit,buttherewasnoindicationofhisconsciousnessofthisnewdanger.Escapewasyetpossible;aquickdashintothedarkcoverofthetreesandthenacautiousretreattothewaitingboat. If hewerealonethatwouldbeachanceatwhichhewouldnothesitate,buthegavenoconsiderationtothethought.WithVirginieitwouldbeimpossible;Therewasaloadedpistolinhisbelt,butthetwohorsemenhadalreadysensedthesituationandtheonewhomhiscompanionhadcalledPhilippealreadyhadBushcovered."Run!Theservantsarecoming."Heheardhervoiceinhisear,butalreadythepursuerswereinview,twodarkfigurescomingswiftlyalongthemoonlitroad."Itistoolate,"heanswered.Protectinglyhedrewhertohim,hisarmabouthershoulders."Don'tbeafraid;therewillbe awayout,somehow."Sheclungtohim.Inspiteofthehopelessnessofthesituationtherewassomethinginhiscalmandquietassurancethatgaveherconfidence.Itwasperhapsthatcuriouscombination,theQuakerimperturbabilltyandtheromanticdaring;theblendingof coolsagacityandimpassionedaction.Astheyapproached,thetwoservantsappearedtohesitate.ThentheysawVirginie'swhitedressandtheuniformsofthetwohorsemen.Inaninstantatorrentofexplanationburstfromtheirlips.Manganhadbeenmurdered.InpassionateFrenchsentencestheynarratedthedetails,andthestorysoundedblackenoughevenwithoutembellishments.ForFire,MotorCar,PersonalAccident,Baggage,Burglary,andMarineInsurance. OBTAIN PARTICULARS FROMTheCommercialUnionAssurance CompanY9 Ltd.TheCaledonianInsuranceCompany.TheQueensland InsuranceCompany,Limited.BranchManagers 1. Jamaica JTravelling }RepresentatiyesMANTON&HARTR. BRAHAM HARRISR.A. FIGUEROA.SUB-AGENTSINALLTOWNS.

PAGE 33

1925-26PLANTER5'PUNCH31Kingston,AGENTS:POWER,PYRAMIDGASMOREMILEAGEMORE ..---u S E.---. APUREBRITISHPRODUCTH.M.BRANDON&COY., 44 ORANGESTREET, KINGSTON, Jamaica.ed,theguardhadstumbledoutofthethatchedshackwheretheyhadbeensleeping,gunswithfixed bayonetstrailingnoisily.Hewasacriminal,amurderer,caughtwithconsiderabledifficulty,sotheof ficersimplied,adangerousmanwhomtheyshouldwatchcarefully.HehaddemandedthatMonsieurSamatanbe notified,buttheyhadlaughedathim.Still,hereflected,Samatanwouldknowsoonenough;itwouldnotbelongbeforeallLeCaplearnedofwhathadhappened.Withhishandstiedbehindhimhehadbeenhurrieddowntotheoldfort,abayonetnowandthenprickinghimforwardwhenhisfeetlaggeddefiantly.Andnowfromabarredwindowheregardedtheemptybay.Hewalkedacrosstheroomandputhisshouldertothedoor;itwaslockedfirmly;therewasnogivetotheironstuddedplanks.Abar of sunlightfellonthestonefloorbeneaththewindow.Thesunwashigh;itmustbelateinthemorning.PurposelyhehadkepthisthoughtsfromVirginie.Shewassafe,hewasconfident.LeroyMangan,intuitiontoldhim,wouldnotholdagainsthertheescapadeoftheeveningpast;hewouldtrytomollifyherandwinherbacktoobedience.ButwhatwouldbeVirginie'sreaction?UnhesitatinglyJobnBushknewthatshewouldsuffernoretreat.Herwordsandhereyeshadtoldhim;herlipshadseal edtheircovenant.Itwascharacteristicofhisnaturethathewouldevenyetholdherapartfromthesituationwhichinvolvedhim,althoughshewasthecentraifigureinallthatnowconcernedhim.AllhislifehehadlivedwithmenandtheinheritanceofhisQuakerancestryhadgivenhimacoldnessofmannerthathislifehadintensifiedandhardened.Butbeneaththisausteritythatfounditsonlyapparentreliefinoccasionaldisplaysofrecklessdaringburnedthefire of aromanticnature of whichhealonerecognizedtheexistence.Ofteninthelonelyhours of solitudeinhiscabinorontheheavingdeckofthe brig hehadallowedhisimaginationtodrawhimselfthecentralfigureindesperateadventuresinwhichalwaysfigured agirl 01' hisownimagination,agirlsuchashenowsawintheliVing body ofVirginie.Strangeaswereallthehappeningsoftherecentpast,therewasnothingnewinthemtosurprisehim.Neverbeforehadhefeltthewarmmoistlips of awomangivenfreelytohisown,andyetoftenhehadimaginedthatdeliciousmoment;sooftenandsoclearlythatitseemed arealisation of somethinghealreadyknew.NotyethadhegivenhimselfentirelytoVirginie;therewasasurfacethathehadnotbrokenthroughthatstillseparatedthem.Notyethadhebaredtoherthehotlove of hispassionateinnernature.THEREwasasoundoffeetinthepassageandtwo voices indistinctthrOughthethickwalls.Thenakeyscraped,feelingforthelock;itclickedinthekeyholeandthedoorpushedslowlyopen.ThejailerandMonsieurSamatanentered.ForamomentthetwomenregardedBushasthoughstartlellbyhisappearance,andtheymightwellhavebeen,fortheyoungmanwhoconfrontedthemWithdishevelledandmattedhair,unshavenfaceandtorn lind bloodycoatpresentedacontrasttothealwaysimmaculateCaptainBushwhomtheyhadknown.MonsieurSamatanwasdrcssedinwhitelinenandcarrieda closedbasketinone"handandabamboocaneintheother.Hehandedthebaskettothejailerandbowedwitha fiourishofhisbroad-brimmedhat."1havecome,"hesaid,"totheassistanceofmyfriend,although1mustbecautiousbecause of thefeelingthattheinjurytoMonsieurManganhasengendered.Gubo"-hepointedwiththin,darkfingerstothejailer-"maybetrusted.Wecanspeakfreely:'"Tellme,"Bushbrokein,"howseriousisthisinjurythatitwasmyprivilegetoinfiictonMangan.andwhatisthepricethat1mustpay?Howlongcan1 be confinedhere?Whatwillhappentome?""LeroyManganwillnotdie,"theotheranswered."butfeelingishighagainstyou.PierreNicholas de mandsyour liCe andthereareotherswhowouldhaveyoushotforyourattemptonthelife of amanwhoholdsgreatprominencehere.Escapeisimpossible.Could1aidyou, 1woulddo so.Butthatcannotbe.CHAPTERVIBushshruggedhisshoulders."Letmespeak,gentlemen,"headdressedthetwoofficersinFrench."Enough of thisexaggeration.1andMonsieurMangandisagreedandblowsweregiven.That1wouldhaveescaped,1donotdeny;norshall1con cealthefactthatthisladywastoaccompanyme.ThereareauthoritiesinLe CapFrancaisetowhom1shallbetaken;letusbeaboutourbusiness, iC thatisyourintention."Thecalm,evenvoicewasnotwithout effect. Heputhisotherarmaboutheranddrewherclosetohim."Virginie,youmustreturn.Bebrave."Theninalowervoicehewhispered:"Godprotectyou,Virginie.Bereadywhen1comeagainforyou."Hefeltherlipsagainsthisownasherarms orew himdown tull"r. "Must1goback?"shequestioned."Yes,thereisnothingelsepossible."Thenwithanimpulsivepassionsheclungtohim."John,John!"shecriedsoftly,"1love you,1loveyou."AshewalkeddownthewhiteroadtoLeCapheglancedoverhisshoulder;a fewyardsbehindhimthetwohorsemenloomedmonstrous.Therewasnosoundbuttheclick of thehoofsonthestonyroadandthejingle of thebridlechains."Itisnecessary,"saidone of theriders,"tokeepyoureyestothefront.And,"headded,withanuglyinflectiontothewords,"themurdererofMonsieurManganneedexpectnoquarter iC heissofoolishastoattemptescape:'ITWASwithafeeling of perplexitythatJohnBushawakenedthefollowingmorning.Hismindgropedatfirstforanexplanation,forhealth and youthhadgivenhimabriefbutdreamlessslumberfromwhichheslowlyarousedhimself;thenina flashtheexperiencesofthepastnightwerevividlyrecalledandhebecameacutelyconsciousoftheachingshoulderwhereMangan'sshothadgivenhimasuperficialwound.Fromasmallwindowsetinthestonewallhecould seebetweentheironbarsapatch of blueskyandthroughtheaperturea coolbreezeblewsteadily,cleanandinvigorating.Aroundhimthemassivewalls,dingyandscratchedwithFrenchnamesandcoarsephrases,supportedalow-archedceillng. Op positethewindowwasadoorofwornmahoganywithasmallbarredopeninginthecentre.Thefloorwaspavedwithgreatunevenflags,moistandcold;andsetintothewallinonecornerwasapairofironringstoeachofwhichwasattachedashortlengthofironchain.Thestrawonwhichhehadbeensleepingwaspileddeepandmattedinacornerofthecell,andhesatupquicklyashisnosebecameconsciousofitsmusty,acridsmell. Stiffty hegottohisfeet.Hisbodywassoreandaching,andhisshoulderpainedwithburningtwinges.Heregardedhishands,blackandgrimyintheslantingbarofsunlight,anddiscoveredwhenhetouchedhisfacethatthestubbleofabeardwasalltooevident.Hewalkedtothelowwindowandpeeredthroughtheopening,hislungsdrinkinginthecoolairfromthewater.Beforehiminthemorningsunshinetheharbourextendedblueandsparklingfartotheeast,whereasmoothgreenpeakrearedlikeasentinelfromthesea.Almostfurtivelyhethrusthisfaceintothedeepopeninguntilitwaspressedagainstthebars.Nowaroundtheedgeofthestonehecould seewheretheHerculeshadanchored.Thebluewaterglitteredempty;theHerculeswasgone.Perhapsshehadbeenbroughtnearertotheland;.morelikely,shewasstandingouttosea.Thejuttingstonesandironbarsmadeitimpossibleforhimtosee.Withhiseyes fixedonthedistantshore,herecalledthelastfewhoursoftheprevicusnight.Hewondered,howManganfaredthatmorning.Hecouldnothavekilledhim.Hardaswastheblowhehadstruckwiththeleadeninkwell,itwasnotablowthatcarrieddeath.Itwouldleaveamark,however,onthatcold,Impassiveface,anineradicablemark.Thethoughtpleasedhim.Attheedgeofthetownhiscaptorshadawakenedaguard of soldiers;black,barefootandhalf-dress-

PAGE 34

PLANTER S'PUNCH,1925-26IMPORTERSUFRAPIDRELIABLE KINGSTON JA.Royal :\'Jail Bldg., 8PortRoyalSt.PIONEEROFLOWRATESHeadOffice: LONOOl';, E.C.33OldBroadSt.THEBEST ROUTE FOn JAMAICAAD O'fHEnWEST ISLDS.THEDIRECT WESTINDIACABLECO.,LTD.MARKYOUR MESSAGES "VIABERMUDA." bandtoC.P. H. Telegraph Offices. U. R. bandtoCommercialCableCo.U.S.A. band toPostalTelegraphCo.growth.Hishandsfoldedonhisbreastbeneaththesheetincreasedthesuggestionofdeath,aneffectwhichwouldhavebeencompletewereitnotpossibletoseetheevenriseandfall ofhisbreathing."Virginie!"Hisquickearhadcaughtherquietfootfallevenbeforeshereachedthebedside."Monsieur?""Youwillsprinklesomewateronthisclothfromthebasin."Hiswasastrangehardvoice, avoiceseeminglydevoid oftendernessorloveorpity,a colddeadvoice,judicial,impersonal."Perhaps,"hesaidyoumaywishnowtoexplainsomethings that happened,inorderthatImayplanhowbesttoconsiderthefuture."Thegirlliftedthebasinfromthetableandcarriedittothebedside.Withslenderfingersshe spat teredthewateronthecloth.Shedidnotanswer. 'H<\.S thisBushbeentaken?Youwillatleastan-sweraquestion?"Therewasanunexpectedglintinhisvoice, ahardnessthatmadeherinstinctivelyturnfromthebedandreplacethebasinonthetable."Hehasbeentaken,"sheechoed. "YouareawarethatIshallasktheextremepenalty?"Foramomentdizzinesscausedhertoputoutherhand to steadyherself.Anumbnessheldherbody. "Youwillaskthat?"sheansweredfaintly,"CanIforgetthatthismanhassoughttothwartmyWishes,thatlikeathiefheenteredmyhouse,thathetriedtokillmeandescapewithamemberofmyhouseholdwho,moreover,aidedhiminhisvilepurpose?"Sheheardhishands,rustlethesheetasheunfoldedthemandthrustthemoutstraightoneachsideuntilhelaystarkasaheroiccrucifix.Thethoughtheldherandshecoweredagainstthedoorasthoughfroma blow.Backthroughyearsofmemorysherecalledhim.Toothers,hehadalwaysbeencold,cruelandunforgiving.Butshehadneverbeforeassociatedthisaspectofthemanwithherself.Toherhehadbeenadistantyetsplendidpersonwhosecasualcaresshadwarmedheraffection.Neverhadsheforgottenherobligation;tohim,sheadmitted,sheowedall.Oneincidentalonethatstoodoutfromtheevenretrospect;thatwasthenighthehadtoldherofhis de cisionthatsheshouldbecomethebrideofPierreNi.cholas.Sherememberedthestifledcry of terrorthathadescapedherlips,howshehadfledfinallytohersmallwhiteroomandonher'kneessobbedouthermiserybeforetheivorycrucifixaboveherbed.Ithadrelievedher,thatimpassionedhourofcommunion.Butshehadrisenfromherkneesmennumbedintoablindfatalism.ShehadtaciUyacceptedherguardian'sedict,butinherinnerheartsheknewthatthegood GodtoWhomthateveningshehadweptoutherprayerwouldneverpermitthefinal fulfilment.Andsowithablind,unreasoning,unheedingfaithshehadgoneon,acceptingthebur dim ofeachday,buoyedby .. hehopeofanultimateandmiraculousliberation.Sherecalledinapassingflash ofthoughttheeveningsthatNicholashadspentinthehouseofherguardian.Notoncehadshepermittedtheslightestbreakdownofthebarrier.SherealizedthatthesuavePierreNicholasfeltembarrassmentitisformetodo so.Bestrong,monsieur,butbenotfoolhardy.Thegood God,whomwebothknow,willnotdesertyou."Theninalightertonehecontinued,takingthebasketinhishandandremovingthecover."Hereisa fowlandbread,somefruitanda flask of wine.Thefareof Guboiscoarse,butthebesthecanoffer you, so Ibringyouthesetrifles."Bushtookthebasketandsetitonthefloor;thenheclaspedthehandofSamataninhisown."Myfriend,"hesaid,"Ithankyou."Samatanavertedhiseyes."Butwhathaveyouheard?"Bushcontinued. "You havenottoldmeall.Tellmethetruth;itisakindness.Youknowwhatismyfate?"Themerchantwalkedslowlyacrossthestonefloorandstoodlookingoutthroughthebarredwin dow tothesea.InacornerGubosquattedonhishaunches,abunchofhugekeysthathung from hisbelttinklingagainstthestones."Idonotknow,"Samatansaidfinally,"whathasbeen finally decreed.Asyetthereisno decision,but,mygoodfriend"-heturnedandfacedBush-"i!youbelieveintheGod ofyourfathers,I bidyoupraytohim,forfromwhatIhearandfromwhatIknowofmypeople, youwillnotsee MademoiselleGoutier agaiIj, oranyothersofyourfriends.""YOUmean,"Bushinterrupted,"thatwhetherornotthisdogMangandiesIamto bekilled?""Yes. Youwerecapturedred-handed,monsieur,escapingfromanactwhichcanfindnojustificationintheeyes ofmypeople. Youwere inthecompanyofthewardofthemanwhomyouatt,1,cked,attemptingtoabductherfromthosewhoconsiderthemselvesherrightfulguardians.AndinthepersonsofCaptain'icholasandMonsieur youhavegiveninsultandpersonalinjurytotwowhoareamongthehighestinthekingdomof Christophe.""DoesMademoiselleknowofwhathasbefallen meT' "Shewillknowsoonenough.Manganwill live.Yourassaultwaspainfulbutnotfatal,"headded.Bushglancedatthejailersquattinginthecorn er."PerhapswhenIamtakenfromheretherewillbe a chance. Aquickdash.Myship;thatisshe,theHe1'cules;shefliestheEnglishflag."Samatanshookhishead."Icarrybutevilnews, my captain;thevessel ofwhichyouspeakisgone.Atdawnshesailed. Youmustfindanotherwaytoyourfreedom.""Shehassailed!"Bushshruggedhisshoulders."Yes,thatwastheorder.Andyet!Huggett-Iwouldnothavethought-butthen-."HeslappedSamatanlightlyontheshoulder."Come,myfriend.thereareyetcardsunplayedalthoughwemaynotknowtheirfaces. Go now. Iwillnotcompromiseyoubyyourpresencehere.PerhapsImayneedyoulater.Ithankyouforyourfriendshipwhichbade you come."Thetwo men claspedhands.Gubo,seeingthatthemeeting was atanend,unlockedthedoorandpushedopenthegreatoakpanel.Theyweregone,andBushheardthekeyclickinthelockandthesoundoftheirretreatingfeetmeltintothesilence.CasuallyheturnedtothebasketSamatanhadbrought.Beneathabitofwhiteclothwasaroastedfowl,twooranges,a half-loaf ofwheatbreadandaquartof wine.Thenhisfingersencounteredaknife-aslimsharpdaggerbladeinaleathersheath.Withafurtiveglanceheconcealedtheknifeinhisbreast.Thenheturnedhisheadquickly,hisearscatchingholdofthesilence.Therewasthesoundoffeetinthepassage.EQUALLYsilentwasthehouseofMonsieurMan-.ganthatbrightmorning.Froma cloudlessskyofburningbluethesunlightfloodedthehouseandgarden.Inthepenetratjnglighttheplasteredwallsflamedwhiteagainstthevividgreenofbananapalmsandmangoes.MonsieurMangan'sbedroomwasdarkened.Itwasagreatroomonthegroundfloorwithwhitewallsandahighceiling. On onesidetallgreenlatticeddoors, nowtightlyclosed, openedtothegarden,andthroughthechinkslittleneedles ofsunlightpenetrated,tonguesofstillflame, totheinnergloom. Oppositethedoorsandon'thefarside ofthechamberwasanenormousbedofredmahoganydesignedafterthenewfashionoftheEmpirewithgracefulcurvedheadandfoot.Thewhitemosquitobarwasdrawnbackandcaughtinabrasshookagainstthewall. SomeFrenchchairsandatable,allofredmahogany,onechairplacedat,thebedside, comprisedthefurniture,exceptamassivewardrObethatstoodatleasteightfeethighagainstthewallononesideoftheroom.Inthecentreoftheothersideandfacingthewardrobewasasmallwhite-panelleddoor.ThebrasslatchliftedquietlyandasthedooropenedVirginieenteredandsteppedsoftlyacrossthewaxedboardstothebedside.Asindeathshesawtheoutline of thelongleanbodybeneaththesheet..TallandcommandingasLeroyManganinvariatlyappeared,thewhiteexpanseofthegreatbeddwarfedhimalmosttoinsignificance.Helayuponhisback,hisheadsunkdeepinasinglepillow,hisface covered,exceptforthelowerhalf,withafoldednapkin.Belowtheclothwasvisiblethemouth,astraight,thinlineformedbytwobloodlesslips,andthe sharll jawnnwbluewithstubbleofthenight'sSolicited.DUNHILL8.8.8.018.LCOMOYIYour PatrQnage"LA', TROPIC-AL" "W"E ALSOKEEPINSTOCKACOMPLETEASSORTMENTOFPipes, Tobaccos, Cigarettes, Smokers tArticles, Etc., 24 KINGSTREET"KINGSTON"GOLOFINA"CIGARSTOBACCOEMPORIUMTHE 'AND Iwouldsuggest,mydearcaptain,thatyoupleadformercyandforgetspeedilytheunfortunateattachmentthathasbroughtthisdifficultyuponyou."Thesuggestionbroughta flushtoBush'scheek.Thethoughtthatsucharemarkcouldbemadetohimbythismanof colouraffrontedhim.ThenhesawinthebrowneyesofSamatanafriendlinessthatheknewtobe itwasalookthatcameouttohimlikeahelpinghand;alookthatbroughthisgratitudeinstantlytothefore.HeputahandonSamatan'sshoulder."My goodfriend,"hereplied,speakingalsoinFrench,"IcannottellyouhowdeeplyIappreciateyourcoming,althoughwhatyoutellmepromiseslittleformysecurity.YouhavereferredtoMade moiselleGoutier;thatis reasonformy pre senceinLeCap and wit)lOutherIshallnotleave,evenifmy frraedom begivenme."Samatan:shookhisheadsadly."'CaptainBush,"hesaid with-evident emotion,"wehavebeenfriends,yes?Iamamanof colour,butyouhavenotnoticedmyskin; you haveseenonlymyblood,whichisredlike your own. Youhavebeenbonourablewithme,andwehavemademoneytogetheranddrunkwinetogetherandwehaveeatenatthesametable.Andnowyouareaprisonerinmy cou,ntry. IcannottellyouhowgreatlyIdesiretoaidyOuandhowdifficult

PAGE 35

1925-26PLAN,TERS'PUNCH33HOLDEROFTHEBEST MARKS:FrolTI. 1to5yearsoldinPuncheons.Can'alsosupplyverychoicebrandsinCasesof12Bottles.BuyingAgentsWantedInallImportant Countries.POSTALADDRESS: 62-64Raw STREET. KIXGSTON,JA:UAICA. THEsoundof ahorse'shoofsstartledher.Someonewascomingupthedrive.Therewassi lence.Thenaman'sstepscrapedonthefloorofthevestibule.Shecouldhearitplainlyinthestillness.Thestepscamedownthehall.Ina mo mentthetapestrywouldbepartedand'hewould tnter theroom.Onlya few ofherguardian'smostintimatefriendscamesounceremoniously.Sheturnedherheadassheheardtherustleofthetapestry.PierreNicholasstoodinthedoorway.moppinghisbeaded forehe:.d withayellowhandkerchief.Hewasimmaculatelydressedintheuniformofthebody guard oftheEmperor;highblackboots,white l-reeches, andagreencoatheavilyornamentedwithgolt!.Hiswaistcoatwasofcream-colouredsatinwithbrassbuttons,andthehighwhitestockabouthisneckmetinaheavyruffleofsoftwhitefabric."Mademoiselle,"hesaid,bowinglow,"avisioninwhiteinthisquiethouseiscoolingonsohotaday.Itrust youareinhealthandhappiness."Virginiestudiedhimandhisglancedroppedbe forethegazeofherdeepdarkeyes.Shesawbeforeherinthedoorwayamanofperhapsfiveandthirty;tall,wellbuiltandalertinhiseverymovement,hissallOW faceslightlyinclinedtoheaviness.Hishairwasblackandstraight,thenosenarrowabovebut" EDICHARLEY,"JAMAICA. A.BC.5THEDITION(IMPROVED.) CABLE ADDRESS:Wedderburn's&Plummer's,Producer and ExporterofJamaica Rums.EDWINCHARLEY,"YouwillperhapsseeCaptainBush?Yes?Then,ifheasksyou, Iamwellandnoharmcometome.Hemustnotriskhislifeagainforme."Sheturnedandretracedherwaybeneaththeleafyroofofthegardenpathtothehouse.Whothisstrangenegrowasorwhencehehadcomedidnotforthemomentoccurtoher.Hermindcouldgrasponlythesinglethoughtwhichthosefewwrittenwordsimplied.Th'elifeofJohnBushwasforfeitandifshewouldhelphimherassistancemustbeimmediate.LeroyManganandPierreNicholaseitherofthemcouldsavehim.Butwouldthemanwhohadbeenassaultedinhisownhouseaidhisenemy?Thereweremenwhoevenundersuchacircumstancemightbe movedbyherentreaty,butnotLeroyMangan.Nicholas?Perhaps;therelayhersolitaryhope.Inthedining-roomLucienwassettingthetable.Itmustbenoon,then.Thedaywashalfgone. AlreadyprobablyJohn'sfatehadbeendecided.Perhapsbysunsetallwouldbeover.Thehorrorofthesituationseizedherwithallitsterriblesignificance;herhelplessness,thefatethatawaitedherandpartiCUlarlythefate of thismanwhohadbe come toherapersonificationofallthestrengthandbeautyandlove ofwhichshehadeverdreamed.inherpresence,andsheraisedhigherthewallbetweenthem.Tohimshewasinaccessible, incom prehensible.ThencamethateveningwhenJohnBushhadwalkedacrossthewaxedfloor ofthecandle-lightedroomandhisclearblueeyeshadsoughther own. thetouchofhishandhadsentatremorthroughher.Vaguelyshewonderedifthiswastheanswertoherprayer;ifthisYankeesailorinhisbrightbuttonedbluecoatwasthehandofGodstretcheddownforherdeliverance.SherememberedhimvividlyfromtbeyearsbeforewhenhehadvisitedLeCap.Withthepassionofbuddingwomanhoodshehadseizeduponhimandheroizedhiminherdaydreams,herloverandherchampion.Eversinceshehadfirstmethim,twoyearsago,shehadplayedwithhismemory.Sointheveryhour of herneedhehadcometoher.Surelyhehadcome bythedearGod'sdirection.Wearilysheregainedcontrolofherself.Shefeltweakbutstrangelycalmandcomposed."Virginie!"Thelowincisivevoicestartledher.Shecrossedtheroomtothebed."ThereissomethingIcanbringtoyou?"sheasked."No.Itisthis:Untilyoureceivemypermission,youwillnotleavethishouse.Undernocircumstanceswillyoutrytocommunicatewiththismanorwithanyoneconcerninghim.Youwillobeymeimplicitly?""Ishallnotpromise."Fromthebedcamenosoundormovement.Shewatchedtheleanjawprotrudingfromthedampnapkinandthethin,firmlyclosed lips.Sheknewthoselips.Notamonthpastshehadwatchedthemcloseinsilence.Thatwasthelastnightsheplead edwithhimtoreleaseherfromhispromisetoNicholas.Atfirstshehadsensedhisweakening.Ina coldwayManganlovedherasanausterefatherloveshischild.Buthisresolvecouldnotbeshaken;hehadclosedhisearstoherentreaties.Mangan'slong,whitefingersgropedalongthesheetforthebellcord.Bendingslightly,sheputthegreentasselinhisgrasp.Faroffinthehousesheheardthemetallicjingleashepulledthecord.Thatwasallthen.Sheknewhewouldnotspeakagain."IamgoIng,"shesaid."Ifyourequireme,Ishallbeinthedrawing-room.Thedoctorwillcome agaill intheevening."InthehallshemetLucien,herguardian'smanservant,asmallblackmanwhosesnow-whitehairandwrinkledfacegaveanindication of hisgreatage.Hewasbarefootbutworelongandheavilystarchedwhitecottontrousersandanold plumcolouredvelvetcoatwhichhadbeenatonetimethejJropertyofhismaster.TheoldmanshrankbackagainstthewallasVirginiepassed,tworolling,whiteeyeballsfollowingherasthoughheexpectedtoseeinhersomenewandunexpectedapparitionasterrifyingasthehappeningsofthenightbefore. As thoughsuddenlyrecollectingsomething,he lifted a black fingertohislips,hisfrightenedeyesstillrollinggrotesquely. "MademoiselleVirginie,manwaitingtoseeyouinmyhouse."HisvoicewasaraspingwhisperandtheFrenchwordscamealmostincoherentlyfromhistoothlessgums.ALSOFULLSTOCKSOFHEADQUARTERSINJAMAICAFORBURGUNDIES,BRANDIES,CLARETS,LIQUEURSandSAUTERNES.THEREwasnodoortothecabin,builtagainstthewallwithhalfa dozenothers;thesmallwhitewashedbuildingswiththeirthick-thatchedroofsofpalmpresentedarowofopendoorstothehard-troddenstripofearththatwastherecreationgroundof servants.Nowonlythreesmall,nakedblackchildrenplayedquietlyintheshade.Itwasdarkinsidethecabinandfora few secondsshestoodinthedoorframeadjustinghereyestothehalf-light.Thenshesawagiganticnegrorisefroma benchinthecornerandadvancetowardher.Shehadneverseenhimbeforeandinstinctivelysheshrankbackalittle.Thenshenoticedalookinthebrowneyesthatreassuredher."Whoareyou?"sheasked.Themanraisedahandandpointedathismouth.Thenheshookhis head violentlyand'aqueercluckingsoundcamefromhisthroat.Withslowfingershefumbledinhisbeltandproducedacrumpledpaper.EagerlyVirginietookitandspreaditout.Ifyou.wouldsavethelifeofyourfriendyoumustnotdelay.Itiswithinthepower ofeitherMonsieurManganorCaptainNicholastospare.AFRIEND.Impetuouslysheraisedherfacetothenegro, a dozenquestionsonherlips,butthemuteshookhishead.Again she readthepaper.VaguelysherealizedthatvengeancemovedswiftlyatLeCap."Canyouunderstandme?"sheasked."Canyouhear."Thenegro'sthicklipspartedfromhisgleamingteethandhenodded,smilinginaffirmation."Rememberthen,"shecontinued,"noonemustknowthatIhaveseenyouexceptthefriendthatsentyou.Tellhim,whoeverhe.maybe,thatIshalldoallthatIcan.Youcannotspeak,butyoucanhear.Theywillquestionyou.Youwillshakeyourhead,yes. Youunderstand?"Henoddedagain.JOHNNIE \V ALKERRed&BlackLabelSCOTCHWHISKY.J.&R.TENNENTLtd.,AleStoutandtheir !a1tlOUS Scotch Lager.CHARLEY'SV.S.o.RUM.VerySpecial Old.WM.GRANT&SONS,Liqueur & StandFastWhisky.KRUGCHAMPAGNE,TheClassicFrenchWine.CHARLEY'S"ROYALRESERVE"RUM.Everydrop15years old.

PAGE 36

34 PLANTER S'PUNCH1925-26UNITEDFRUITC()MPA.NY SERVICE.VESSELSSPECIALLYEQUIPPEDFORTROPICALTRA WEEKLYSAILINGSfromKINGSTONFORTNIGHTLYSAILINGS(NEWYORK-CRISTOBAL,C.Z.-andATLANTIC COLOMBIAN PORTS.ThroughBookings Via New York By RailtoallpartsIofU.S.A.andCanada.ITO ConnectionsatCristobal, C Z.,for:-IPANAMA-BOCAS.DEL.TORO-PORTLIMON-TELA,HONDURAS-HAVANA-NEWORLEANSandforthePACIFICCOASTof CENTRALandSOUTHAMERICA. l --TO,SANTIAGO(Cuba)BELIZE BARRIOS( TELA-Pto.CORTEZ-Pto.CASTILLA-UNITEDFRUITCOMPANY.HEADOFFICE:17BATTERYPLACE.40HARBOURSTREET.KINGSTON.NEWYORK.ELDERS&FYFFES,Limited. l=4IRST CLASSPASSENGER STEAMERS. REGULARWEEKLY KINGSTON.{ Avonmouth Docks, BRISTOL. TOGarston Docks, FORTNIGHTLYTO f TELA,HONDURAS,-PORT LIMON,COSTARICA,andCRISTOBAL, CA.NAL ZONE.. .For Rates andall infor.rnation, applyto':-UNI'l'EDFRUITCO..40HARBOURST.orELDERS&FYFFES,LTD.KINGSTON,JAMAICA.3l-32BOWST.,LONDON.w.e.2.HOTELS:-MyrtleBankHotel,Kingston;Hotel Titchfield,PortAntonio.

PAGE 37

1925-26 !'VI PLANTER S'PUNCHli!!!iiiil,j,ii'IiIii!ill!iiiiIiiill""Qiiiiifiiiii""!!iiil!!iiliiiit!!iiilli!iifliii!i!"iiiiliii' i7:PI!I!!!!!iiIi @"ii"!!i!!ii"!iliilliiil!i!hifiiiii!iiiliHi!iiiiilii""illiii!!i"'Ii!!!!iiii!"iii!tiiiiiiiI""iiifiii'iiliiiilliit!iiiiiiil!iiii!!i""iIi!iii" _yrtlr1Mauklante!,KI GSTON.THEMOSTMODERNANDLUXURIOUS HOTELS INTHETROPICS.REPLETEWITHEVERYDETAILOFSERVICEANDEQUIPMENT.THOMASG.S. RESIDIlNT MANAGER,UnitedFruitCo.'s,Hotels,Jamaic.,B.W.I.35II

PAGE 38

36PLANTER S'PUCH1925-26widenedslightlytoomuchatthenostrils;themouthwaslargeandthelips,fullandsensuous,weredrawnbackslightlyfromarowofperfectteeth;thechinwasheavyandtherewasanindicationoffatnessaboutthejaws."Willyoupleasebeseated?"shesaidfinally."ThereissomethingIwouldsaytoyou."Withaslightindicationofsurprisehe wal1l:ed acrosstheroomandsatdownbeforeher."Youare,of course,awareofallthathashappenedin {he lastfewhours?'Thecolourwasgonefromherfaceandhernailswhitenedasherfingersclenchedthetablerim."Yes,thestoryoftheseunhappyoccurrenceshasbeenbroughttome.""IloveCaptainBush."Nicholashadnotexpectedherstatement.Hisheavyfacetwitchedwithagitation.Withaforcedcalmnesshesaid:"Icanimaginethatamorethanordinaryinterestinthismanpromptedyouraction-mayIsay,mademoiselle,yourmostill-advisedandincomprehensibleaction.""Whatistobethefateof'CaptainBush?"AlookofmalevolentsatisfactionglfntedinNicholas'seyes.Hedidnotanswerherquestionimmediately,butwatchedthebarofsunshinethatlaylikeglowingmetalonthefioorbeforethedoor.Thenheansweredalmostcasually:"TheCaptain,thisBush,hasnowtwiceoffended.HehaswithoutprovocationattackedanofficeroftheEmperor,andlater,lastnight,heattemptedthemurderofMonsieurManganinhisownhouseandtheabductionofhisward.Heisnowaprisoner in-. FortPicolet.Itisorderedthathebeshotatsunset."A gasp, aquickintakeofherbreath,camefromthegirl'slips.Sheswayedslightly,thenshefiungherselfintothegreatstuffedchairofLeroyManganandherbodyquiveredwiththetorrentofheremotion.Nicholasgotupandwalkedtohersideandlaidhishandonhershoulder.Asthoughtouchedbyahotironsherecoiled.Like a woundedanimalshecowereddeeperinthechairasthoughtoescapehim."Calmyourself,mademoiselle.Thisfrenzycannotsaveyourlover.Thereareotherthingsthatcando more.Letustalksanelyandperhapstosomepurpose."SLOWLYVirginiestraightenedherself.Herdresshadslippedfromhershoulderbutshewasunconsciousofthe smoot1:l, whitecurvesthatitdis closed.Withasteady g:!ze ofappraisal,Nicholasregardedher.Hiseyeswerefixedonthewhiteskin;hesawherbreastriseandfallbeneaththesheerbodice."Heisto die to-day"sherepeated,"atsunset?""Yes, mademoiselle,unless-""Unless-"thewordcamefromherwithalittlecry. "Youmean,monsieur?""Youhaveforgottenourweddingday?""Ourweddingday?"Sherepeatedthewordswithoutunderstanding."IthasbeensetforEaster-""IfIdiebymyownhand,Ishallnever marryyou!" Hervoiceroseinahighscreamasshe spcke. "No,never!Oh,theverythoughtisim pO:5sible! You,you-Ih'ate you! Iloatheyou! Ishalldiebeforeyoutouchme.Go!"Quivering,sheregardedhim,a fiame ofterrorandangerscorchinghercheeks."Softly,mademoiselle.Hardwordsareevilmessengers.Youwouldsavethemanyoulove? Bit!n! Thatyetispossible. Iwouldmarryyou."Heleeredatthebareshoulders."Therearereasonsotherthanyourself.Ourweddingdayislongtowaitfur. A week,perhaps,andsoyouwillpromiseme,andthisBushlives! Ouit Yousayyoulovehim,andyouloatheme,PierreNicholas,intimateoftheEmperor.Howmuchdoyoulove?"Hermomentarypassionhadpassed.Dumbandstunned,shelookedathim.Theshiftingeyesdroppedbeforeher.Withanattemptatnonchalance,Nicholasfiickedthedustfromhisboot-topwiththeyellow "Youwillbarterhislifeformybody?"Hedidnotimmediatelyanswer."Doyounotunderstand,monsieur,thatI donotlove you,thatthethoughtofsuchamarriageisaterrortomeandthatI lovethismanwhomitisnowinyourpowertosave?Youaskmetomarryyou;youdesirethat?Ifsomeesteemformepromptsthatdesire,canyounotbegenerousandearnmyeternalgratitude?Oh,monsieur,Ibegof you, I implereyou, bemerciful!"Nicholasshifteduneasilyinhischair.Thenacunninglookcameintotheshifting 1lyes. "Youhavemyproposal,MademoiselleGoutier.Myorderlyisatthegate.Timepasses. IgonowtoMonsieurMangan.YouranswerwillsendmyorderlytoFortPicoletandhislifewillbespared.Persistinyourresolve,andIshallnotagain offer analternative.Thelifeofyourloverisinyourhand.IsityesornothatIshallhear?"Hewalkedtowardthedoor."Ehbien,"hecontinuedoverhisshoulder, ,"it isbestthatthisYankeecurshoulddie. Ouit" "Monsieur,"shesaid,hardlyabove awhisper,"youwillswearbythegood Godthatthisisthetruth,thathislifewillbesaved?" "Yes,if-" "Yes,"thewordburstfromher,"Iconsent."WithasmilePierreNicholasthrustasidethe tapestry andwalkeddownthehalltotheroomofLeroyMangan.CHAPTERVIITHEsoundoffeetthatJohnBushhadheardfromhiscellgrewloudinthecorridor.Thenoisestoppedabruptlybeforethedoor.Anorderwasgiven,gunbuttsrattled 9n thestone,akeyclickedinthelock.Theyounglieutenantwhoenteredwore a worn, green uniformandagiltscabbardhungathisknee;thebareswordhecarriedinhishand.Hewasatall,thin-hipped,wide-chestednegrowithskinsoblack.thathis face mighthavebeencutfromablockof ebony.Behindhimaguardofsixmenstoodatshamblingattention."MonsieurBush,"hesaidcourteouslyinexcellentFrench,"youwillaccompanyme,ifyouplease.Thecommandantdesiresyourimmediatepresence."HebowedandBushreturnedtheformality.ThelittleroomtowhichBushwasescortedwasdampandodorous. Onthewhitewashedwalls,namesandobsceneFrenchwordsandphraseswerescratchedorwrittenwithcharcoal.Throughthenarrowwindowswasaglimpseofthegreenofpalmtreesandafragmentofbluesky.Dirtystrawlitteredthefloorandinonecornera lowcotwaspiledwithsoiled bedlinen.Asmalltablestoodinthecentreoftheroom,andbehindit,inagildedchairupholsteredincrimsonbrocade,satAntoinePelletin,commandantofthegarrisonofLeCapFrancaise.IntheslantinglightfromthewindowsBushsawasmallmanwithclose-cutgrayhairandafacestrikingforitsunmistakablestampofcruelty.Hewasnotsoblackastheyounglieutenantoftheguard;therewasanashencolourtothewrinkledskinthathunginpouchesbeneaththeyellowisheyes,anashencolour.accentuatedbyastubbleofgrayhaironthebroadsquarejawsandacrosstheupperlip.Themouthwas loose andsensuousandthehalf-openedlipsdisclosed' arowofteethsharpandirregular.ThenheraisedhisheadandregardedBushwitha lookinwhichhateandsatisfactionwereclearlydominant."YouareconVicted,"GeneralPelletinbeganasthoughhereadfromthepaperinhishand,"ofasII I ImperialLite AssuranceCompany01 Canada JAMAICANOFFICE:71BARRY STREET. KINGSTON.JAMAICANORGAN'IZATIONIn every mannercarehasbeentakento S'O organisethebusinessasto serve theJamaicanpublicattheBranchOfficehe .. e.CIaimsarepaid,loan s grantedandinterimpoli.cies il:sued at theL0caI Office oncompletionofthenecessarypapers;InfacttheImperial.Lifeoffersallthe advantages ofaLocalCompany,andinadditionthehighinterestearningpowerof CClnadian In.stitutions. Lindo Bros.,&Co. 50 I'ortRoyal St, Kingston,Jamaica,JanuaryI16th, 1925. )Iessrs)Iunton &Hart, Agents ImperialLife Assurance Co., ofCanadaKingston.DearSirs,I haveyourletter noti(ying me oftheBonus pnyable on my poli cies with JOu.TheBonus. results areverygratifying arid farbeyondmy t'xpectatiolls. Suchresultsprovethat an EndowmentInsurancepolicy with theImperialLife com bineslifeinsuranceprotectionandinvestmentinaremarkablysatisfactory degree: Yoursfaithfully,PERCY LIKDO. TheImperialLifeBonusesarehighlysatisfactory.Thesurplusearnedduringtheyearshowsanincrease,andPcSlicy.holdersmayconfi.dentlyexpectasub.BONUSESstantialreturnontheirmoneyfromf:hissourceinaddi.tiontoLifeInsur-anceprotection. Il'll LOANSaremadeonREALESTATEinJamaicaandeveryfacilitygivenforspeedyrepayment.L /, !i!!iliitiiii!i.iiIiIiai!lniG!!if!i'i!!litIIQiI!!Iiiiii! i""'""""'T'emgmmrr

PAGE 39

1925-26.PLANTERS'PUNCH37 I',/ (G(Q)IRLE ILIT' 1M!ITTLEI[)), Import-ExportMerchants Fooo Products-Fruit-Produce.Etc.. Ice KINGSTONJAMAICA/," '" Thelieutenantlookedguardedlybehind Thecorridorwasempty."Yes, Iamyourfriend.butthatcannotsaveyou.AtFortPicoletMonsieurSamatantalkedwithyou,andsoIdaretobeafriendtoyou.Heknowstheorderthathasbeengiven.Perhapshecanhelp,forheisstrong. He'-============ 'BooksKingston:SheetMusicandInstruments andRecordsPhotographic GoodsRemingtonTypewritersSporting GoodsFancyGoods Electrical Supplies Office Supplies OfficeFurnitureSchool Supplies MagazinesCon!ectioneryDrugs&MedicinesPerfumeryStationeryTHETimesDepartmentstore 8-12 KingStreetOurDepartmentsinclnde ... High,ruinedwallsflankedtherightsideoftheroad.ThroughtallwindowsBushcouldlookattheskybeyond.Themasonrywasblackenedwithsmoke,thestonescrackedwiththeheatofflames.TherooflessroomsofwhatwasoncethefinestmansioninLeCapwerenowtenantedbyadozensquatterfamilies.InthatwidedoorwayRaymondFerrierhaddiedholdingtheentranceagainsttherevolutionarymobthatfilledthestreet,ablackfloodthatpouredwithfireandswordintothefrightenedtownfromthedistanthillsandfromthesmokingruins of plantationsontheplainwherebuta fewdaysbeforetheyhadbeenslaves.BUSHoftenhadheardstoriesofthatterriblenight.Nowitwashisturn,butnottodiefighting;hewastomeetdeathstandingbeforeawhitewashedwall,shotdownbyasquadofraggednegrosoldiers.Hewonderedwhenhisunclewouldhearofit.Perhapsnever.No,Huggettwouldreporttohim.ButperhapsHuggettwouldnotknow.Whatdiditmatter?Virginle?Heputthethoughtfromhim;itcouldnot, no,wouldnot,beWithheldfromher.Thetalllieutenantorderedahaltinthescantshadeof a figtree."Monsieur,"hesaidsoftlyinBush'searwhilethemensquattedontheground,theirgunsdroppedasachildthrowsdowna toy,"itishot;aminuteofrestwillrefreshyou."Therewasafriendlyglintintheblackeyes,anexpressionofpityin nis face."Merci!Canyoubutloosethecorda "little? Myhandsareswollenwithpain."Hegavethelieutenantalookofappreciationanda frieJ;ldly smilecurvedhislips."Thatisbetter,myfriend.Ithankyou."Againtheymarchedon.Thebuildingsofthetownbegantogivewaytonativehuts.Aheadwastheplain,shimmeringwithheatwaves.Therewerethebarracks.Ahighwallsurroundedanumberofbuildings,a solidwallofmasonrybuiltofblocksofstone"evidentlyrobbedfromruinedhousesinthetown. OneachofthefourcornerSwasasentryboxandinthecentreoftheeasternwalla low doorwaygaveingress.A couple ofsentriesinuniformslouchedabouttheentrance,whichwasfurtherguardedbytwobronzecannonsplacedoneitherside'andcoveringtheroad. One ofthesoldierspushedopenthedoorandinsinglefiletheywentthroughit.AsBushpassedtheshadowof the archheexperiencedagain the senseofhopelessnessthathadpossessedhimwhen he. stoodbeforeGeneralPelletininthelittleroominFortPicolet.Itwasanotherstep,irrevocablytaken,intheprogressofhisdestruction;anotherdoorhadclosedbetweenhimandthelibertythathadalwaysbeentheveryessenceofhisexistence.Anindescribablestenchgreetedhisnostrilsthesweet,sickishsmellofdecayingrefuse,thesmell or a placelongfrequentedbyunfortunatehumanity.Intheshadowofthewallstheyswarmed like fiies, twoorthreehundredprisoners,menandwomen,theirhalf-nakedbodiesdeckedinthepitifulragsofformergarments.Withsulleneyes-theyregardedhim,notasa fellowsuffererintheirmiserybutasanenemy, ahatedwhiteman.,Anoldwoman,herfaceobliteratedbydisease,clutchedathiscoatashepassedandcursedhiminaraspingvoice.Onthedistantsideofthecompoundwerethebuildingswherethemoredesperateprisonerswereconfined.Itwasthere,hesensed,thathewouldbeplaced.They.crossedthecompoundandthelieutenantdismissedtheguardandconductedBushtoasmallroomfoulwithrefuseofformeroccupants.Therewasnolightexceptthroughthebarredwindowinthedoorthroughwhichthegloomofthehallfeeblypenetrated.ThelieutenantputafriendlyhandonBush'sshoulder. "I amsorry,"hesaidsimply,"thatthismustbe.Itisnotwisethatweshouldincurthehateofanothernation.Ifyour'friendshearofthistheywillbeangry,eh?PerhapsashipofwarfromtheUnitedStateswillcomeandaskforyou.Ananswerwouldbehardtofind." "Iamafraid,"Bushanswered,"thatisnotlikely.WeareatwarwithEngland.Hergreat navy surroundsus.Thereare other mattersoffargreaterimportancetotheUnited State3 than the fateof asingleoneofherpeople. Youaremyfriend?"saultwithintenttokillonthe'person oftheEmperor'sofficer,CaptainPierreNicholas;ofattackingwiththesamepurposeMonsieurLeroyManganinhisownhouse,whichyouenteredbyforce;withtheattempttoabduct -the wardofMonsieurMangan,andwithotheractsof violenceagainstofficersandsubjectsoftheEmperor."Heturnedhiseyestothelieutenant."Thefiringsquadatsunset."UnderhistorncoatBushfelthisheartpounding;thesweattrickledinhotdropsfromhisfore head.Thehorrorofthesituationsickenedhim.Thenheflungbackhisshoulders.Hemustnotletthismansensehisagitation."So, Iunderstand,"Bush said withastudiedslowness,"thatI, acitizenoftheUnitedStatesofAmerica,amsentencedtobemurderedwithouttrialorhearing.Markyou"-hepointeda fingeratPelletin-"mycountrywillnotsufferthisinsulttopassunpunished.""Bah!"GeneralPelletinspatonthestraw."Whatisit,thesebraggingUnitedStates,araceoftradersandupstarts.Do we,whohaveruntheFrenchandtheEnglishintothesea,listentotheboastsofanAmerican?Whereisyourflag? Have nottheEnglishdrivenitfromeveryocean?DoIfearacountrysuchasthat?No!"Heglancedatthelieutenant."Tothecompound. Youhaveheard."FromthecornerofhiseyeBushestimatedthedistancetothenearestsoldier.Withaleaphecouldreachthetable.HecouldfeelhisfingerstightenaboutPelletin'sthroat.Itwasanidlethought;deathwouldonlycomethemoreswiftly.A fewhoursatleastofliferemained.Thelieutenanttouchedhiselbow.Pelletin'sheadwasbentoverthestrewntable.Therewasnothingnowthathecould doorsay;withhishead erect hewalkedoutintothecorridor;behindhimheheardthefeetoftheguardrustlinginthestraw.'LECAPwassimmeringinthesunshine;eventhepalmtreesseemedtodroopinthebreathlessheat.Inthelongstreetthatedgedtheharbour,dustrosefrombeneatheverypasser'sfeetandhung,a yellow cloud,intheair.Fromthewaterthesunwasreflectedasfromasheetofmetal,anddown trom thehigh,greenwallofLeMorneitwasflungbackagainonthestifledtown.OutsidethewallsofFortPicoleta dozennegroescrouchedintheshade._WithlanguidinteresttheywatchedJohnBushandtheguardemergefromtheentranceandturndownthestreet.HishandsweretiedbehindhisbackandBushcould feelthecordbitetheflesh.Fromhisforeheadsaltydropsofsweatcourseddownintohissmartingeyes.Hisbodyachedandyearnedforrestandsleep. A fewhoursmore,hethought,andthenperhapsitwouldbeover,andalongrestbegunina shallowpitonthemarshyplain.Severaltimesinhappierdayshehadriddenpastthebarracks,a collectionoflongthatchedbuildingsagainstthesouthernentrancetothecity.Therealsowasthewidefield ofsun-bakedclaywherethetroopsoftheEmperordrilled,adustyfleld,oraquagmireofslimymud,inaccordancewiththeweather.Fromthedrillgroundtheplainextendedtwentymilestothesouth,whereabruptlytherangeoftoweringmountainspiledupaprecipitousbarrier.Andthere,on ahighpeakoverlookingtheplain,wasthecitadeloftheEmperor,andinthegreenvalleyofMillotundertheshadowofthefortresswasthepalaceofSansSouci.Thedustcakedhistongueandthecordabouthiswristspainedcruelly.Attheroadsidepeoplestoppedtogazeathim.Theywereblack,ofvariousshadesandtypesoffeatures,andallregardedhimwithunfriendlyeyes. Afeelingofdespairdepressed.him.Neverhadhefeltsodesolate;inalltheworldtherecould be no place soalienandremoteasthiscrowdedstreetoftheHaitiancapital.Hedidnotblamethem.Theterrorofthedays'0 f Frenchslaverulewasalltoofreshintheirprimitiveminds.Hewasjustanotherwhite man, anintruderinablackman'scountrywon fortheblackmanandbytheblackmanthroughbloody sacrifice. A fewsmallshipswereatancnorintheharbour.BynowtheHerculeswasdoubtlesswellouttosea.Therewouldbea breezethere,beyondtheisland'slee. Ontheleftthewatercameupclose.totheroad.TherewasSamatan'swarehouse;therethe IAwy haddischargedhercargo. Ontherightacontinuousrowofbuildingslinedthestreet.TherewastheHoteldelaRepublique.Itbaskedinthesunshine;withintheclosedshutterstheairwouldbecoolanddampandtherewouldbethingstodrink.Hecouldhardlyswallowforthedustinhisthroat.One ofthesoldiersprickedhimInthebackwiththepointof abayonet.Atall,blackgirlattheroadsidelaughedinahigh,clearvoice.Theignomlnyofhispositionmadehisfaceflushhotly.ItwasatleastgoodtorealizethatVirginiecouldnotseehim,a dishevelledcaptivedrivenbyabandofblacksoldierstotheplaceofslaughter.Shewassafe;herealizedthatshemustbeagainsecureinMangan'skeeping. Shehadbeenbrave,andshehaddaredallforhim;hefeltherclinginglips,herlimp,youngbodyintheshelterofhisarms.WouldshemarryNicholas? Somehowthethoughtnolongerdisturbedhim.Hehadfelthercourage;heknewherlove,hewasassuredthatVlrginiewoulddiebeforeshewouldsurrendertoPierreNicholas....

PAGE 40

38 PLANTERS'PUNCH1925-26L. P. ALBERGA,wearstheringofDessalines.ButyouhaveangeredNicholas,andhe,too,isagreatman."Callinandsee me To-dayIfyouarenotfullyinsured.Insurances Pre,,;ously Effected MayNOJ beTotal!:y Inadequate.NICHOLASignoredtheinterruption."Sheistenaer,"hecontinued,"andbegs you toacceptyourlifeonthatbasis.Shedesiresneveragaintoseeyou."ooirepeat:You lie!'ThatMademoisellehasin terceded for meeventoyouispossible;therestisfalsehood." "So youdecline,eh?"Nicholasturnedslowlytowardthedoor."Youforget,monsieur,thatyouareyoung.Theworldisfilledwithyoungwomen. Is itnotchildishtothrowawayyourlifeforoneyoungwomanyoucanneverhave?Itisa finegesturethatyoumakeanda useless one.""Thereisthedoor. Youwillhonourmebyavailtngyourselfofit."Nicholaswheeledsuddenlyandthrustforwardhisface."Bah!You fool! YoutrytointerferewithCaptainNicholasandyouseetheconsequence! Ishallthinkofyouonmyweddingday.Yourefusemymercy, Bien! Weshallseewhoisthestronger.Thegunsshootandsomeonedigsaholeforyou No,thatisnotmyrevenge,Youmustbealive;youmustsaytoyourself,'ThisistheweddingdayofNicholas.'So!'ThisisthenightthatVirginie be comesthebrideofPierre.'Itisnotmynleasuretohaveyou dead. No,itismorepleasantformethatonthatnightyouarealivetothinkof me. You live,oryoudie,itisasIwish,AweekfromtodayIshallbe wed. Ibegofyoutothinkofme."AshespokethelastwordsNicholasbackedSWiftlytothedoor.Withajaritclosedbehindhim.Thenforamomenthisfaceappearedinthewindow."IhopeYOllwillenjoyyourself.ItistruethatIgiveyoulifebecause awomanhasaskeditofme.Itisyours,suchasyouwillfindit."ItwouldseemonlynaturalthatthissuddenreversionofBush'sfatewouldhaveliftedhim,atleastforthetime,fromthedespairthathadsettledabouthim;butitistohiscreditthatitwasnotsomuchhisownlifeordeaththatthenaffectedhimasthewordsofNicholaswhichtoldhimoftheimpendingmarriage.InthemainhebelievedwhatNicholashadtold him. To besure,hehaddetectedtheobvious fl
PAGE 41

1925-26PLANTERS'PUNCH39CHAPTERVIII NEXTTIMEBUY GOODYEAR.Jfitrunsonpetrol,itwillrunbetteronGOODYEAR.!!!tii!!!"",lii!liiiii!i"if!!ii"""iit!Ii''''''''il'""!i!ii!lilii!!!ii!!iI!iiilililiii"""!iiiRetailDealers Throughout the Island.BRYDEN&EVELYLV,Wholesale Distributors.ThroughouttheWorldMorePeopleRideonGoodyearTyresThanonAnyOtherMake. !otl< III ---'-"----_...""';....... t. 2-25-5 0 Of!>..iii !-, DOWNthecorridorcamefootsteps.Thedooropened,andthelieutenantflunghisarmsaboutBush'sshoulders.Ashebeganspeakingina voicethickwithemotion,hereleasedBushandregardedhimatarm'slength.Theblackfacewasalivewithgladness."Monsieur!Monami,thereisanorderfromCaptainTicholas,anofficialorder,thatyourlifeistobespared.Monami,itisamiraclethathewhohatedmostshouldshowsuchpity.""Hehashimselftoldme." "Ah,hehasbeenhereinhismercy.Butyoudonotknow."Hisfacegrewgrave."Itisnotfreedomyet. OnLeBonnetl'EvequetheEmperorcompleteshiscitadel."Fivethousandlabourthere,ofwhommanyareprisoners.Itistherethatyouaretobetaken,monsieur.Bebrave;bestrong.Itisnotacertaintyoflifethathasbeengrantedyou, forthousandshavediedatthatbitterwork;butitisatleastabetterthingthana bUllet,and"-hekickedaholeinthestraw-"agravethatisnotdeepenoughtokeepoutthedogs." HIgo?" "Now!Theday'islate.AlreadythesunislowagainstLeMorne.To-nighttheprisouersmarchalongthehighwaytoMillotandthecitadel.Itiswiththemthatyouwillgo,"Hefishedbeneaththegaycoatofhisuniformforsomethingathisbelt."Iamsorry,"hesaid,"thatitmustbeso,"Heheldoutaslenderchainthatterminatedinbraceletsofrustedsteel.Bushheldouthishands.Thewarmsmoothcircletsembracedthem."Good-by."Thenegroheldouthishand."Wecannotspeakagainbutperhapssomedaywemaymeet;youmayfindfreedomandyouwillnotforgetJeanRiou,whohadonlyfriendshipto give."Theirhandsmet."Ishallnotforget, IthankYOu." "Come."Heledthewaytothedoor. "Youwillwalkaheadwiththeguard," Oneitherside araggedsoldierfellinbesideBush.Noonespoke.Witheagerlungshedrewingreatbreathsofthewarmairofthecorridor:Afterthestiflingheatand stench ofthecellitseemedpureandalmostinvigorating.Aglareofsunlightstruckhiseyesastheypassedthroughthedoortothecom pound.Thereinthelatelightoftheafternoonitlaymuchashehadseenitinthemorningafewhoursago,hoursthatseemedaslongassomanydays.Onlytheblackswarmofprisonershadshiftedtheirposition;nowtheyclusteredintheshadow of thewesternwall.Withtheguardshufflingathissidehemarchedtowardthegate.Thethoughtof escapewasuppermostinhismind,butitseemednotthetime.ThenhebegantowonderhowtheywouldgettoMillot,andwhenthegangofprisonerswouldstart.Hewastbusspeculatingwhenafamiliarsoundmadehimlooksharplybehindhim.Fromthewesternwallofthecompoundtheweirdcrythathehadheardatnoondaywelledlouderand10uGerinthequietair.Moreeventhanthefirsttimehehadheardit,washestruckbythestrange,animalnoteinthemassedvoices.Therewasno.tuneorrhythm.Itwasawailingsound, plaintive, melancholy,awe-inspiring.AFeelingofABSOLUTESECURITYYOURSClaimsPaidExceed$92,000,000.P.R. CUMMING, Attorney&AgentforJamaica,60-62Port Hoyal St.,Kingston.-FOR.-PromptnessandLiberality 01 Settlements.FundsExceed$6,225,000 "} TheCompany withan enviable reputationofmorethan 74YEARSHeadOffice:'I'OlWNTO, ISYouareInsuredintheIfFROMoneofthebuildingsthreemenguardedby a dozensoldierswalkedacrossthecompoundatrightanglestothedirectioninwhichBushwasbeingtaken.Curiously,hewatchedthemapproachastheirpathsconverged. Allthreehadtheirhandspinionedbehindtheirbacks;allwerehatlessandthedisorderoftheirclothessuggestedsomedaysatleastofimprisonment.Theywereblack,buthewhowalkedinthefrontshowedinhislighterskina crossingofwhitebloodwhichwasalsoevidentinhisalmostaquilinefeatures. All \vere obviouslypersons 0: some intelligenceandstandinginthecommunity.One ofthesoldiersturnedtoBush,agrimlaughiuhisthroat."Thatmanthere"-heindicatedwithatossofhishead-"he,allthree,gotodie."Thenheadded,withignorantaweinhisvoice,"Christopheisstrong."Theypassed."Christopheisstrong."ThesentenceranginBush'sears.LikeareincarnatedNe ro,thisblackdespotruledhiskingdom.Underhimthepeople,ignorant,superstitiousandcowedbyfear,slavedathisharshcommand.Thepowerwasplacedinthehandsofafewchosenofficers.Andthefiring.squad,ordeathin -some otherform,awaitedthosewhodaredquestiontherightandjusticeoftheEmperor.ThesunhadsunkwellbelowLeMorne,whichnowroseexaggeratedintheblacknessofitsshad.ows.Behindtheclean-cutcrestthelightofthesunsetflamed'upintotheblue,barsof golden,lightthatradiatedandfadedimperceptibly,aluminoushazeasfromthedoorofamightyfurnace.Andnowwiththeeveningcame atremorofairfromthesea;anairfaint,coolandsalinethatstirredamongthefrondsof aroyalpalmbeforethegate,movinglistlesslythegreenplumesasthoughwithidlingfingers.Insidethegatea dozenmenwerecollected,man.acledintwos,wristtowrist.Allwerenegroes,bigpowerfulblackswithbroadshouldersandleanlimbs.

PAGE 42

40PLAN T ER'S'PUNCH1925-26 It wasevidentthat the Emperorfedonlyprisoners(Ifintelligencetothefiringsquadandconservedtheyoungandstrongoffendersforthegreatbuildingoperationswithwhichhewaschieflyconcerned.Bushstudiedtheirfaces. There wasnochance(Ifhelphere.Low-browed,thick-lippedandsullen,theyreturnedhisgazefromsteadyeyesthatseemedtoreflectnothoughtoremotion. A fewhadsquattedinthedust;therestidlyregardedtheircaptorsortinkeredwiththeirmanacles,asadogwillworrywiththeleashthattieshim..Thewailingoftheotherprisonershadstopped.Arrestedbythesilence,Bushturnedandwitheyessweptthewallsofthecompound.Evenashelooked,frombehindoneofthebuildingscamethesound(If a volley ofmusketryandasitdiedawayin a feeble echoagainstLeMorneawispofthinwhite smoke roseabovetheroofsandthewildcryofangel'and'terrorburstagainfromtheblackthrongintheshadowofthewall.AfeelingofmingledhorroranddisgustmadeBushturnawayhiseyesandlookdownthroughthe .gate tothebluewateroftheharbour.Alittleturnoffateandhemightnowbelyingthereinthedust.Butwhatwasthepriceofhisdeliverance?Thethoughtsickenedhimmorethanthethoughtofthedeaththathadbeenaverted.Hemustnotweaken, he toldhimself;toomuchdependedonhisstrengthandresourcefulnessinthesebriefsevendaysthatawaitedhim,daysfraught with disasterorsuccess.IT WASnight when theystartedoutalongthebroadwhiteroadthatledsouthfromLeCapFrancaisetothemountains.Ontheleft,theharbou.!"laysmoothandblackinthestarlight.Saltmarsheswereontheright,darkblotchesoflowvegetationbrokenhereandtherebyexpansesofsalinesoilthatglitteredlikesnow.Faraheadunderthepalebluenightskythelongwallofthemountainstoodasthoughofferinganimpassablebarriertothepeople (Iftheplain,atoweringfrontierbehindwhichdespotsmightfindsecurityfromalltheworld.Whitelaytheroad,alongwidebandof Whiteness,curvingslightlyfromtheharbour.Thedustwasthickandsoftandirritating.Hereandtheregreatflagsof cut stoneindicatedthatthewayhadoncebeensmoothlypaved.Nowitwasruttedandbroken,anothertragicmemoryofadepartedciv11ization. AdozeD.soldiersmarchedwiththeprisoners,andintherearfollowedan officer onhorseback.Withoutordertheymarched,ablackclusterofhumanbeingsstumblingforwardinthestarlight.Noparticularattentionwaspaidtotheprisonersbytheirguards;theshackledwristsmadeescape impossible.AndinthisstrangecompanyJohnBushfound.himself,eachmilethatpassedputtinghimthatmuchfartherfromthehouseofLeroyManganandthegirlwhoatthatmomentwaswatchingwithtired,Wistfuleyes,thesamestarswhichilluminedtheroadto tne citadel. .Shewassittinginthegarden,onthesameseatwhere,anothernightwhichnow seemedlongago,shehadsatwiththeyoungPhiladelphiacaptainandhadfirstheardfromhislipswordsof love.Within halt anhourshewouldhearthesoundof Nicholas'horse'onthedrive.Thenhewouldstandinthedoorwayandcalltoher.Forthefirsttimeinherlifeshedesiredhispresence,forto-nighthewouldbringnewsofthemanwhoalone filledherheart;themanwhoatthisveryminutewasstumblingalongtheruinedroadinthestarlighttothesraveryofthecitadel.Thenlikeanechotoherthoughtsheheardthebeatof ahorse'shoofs,anda fewminuteslaterPierreNichOlascalledhername.Sheanswered,"Oui,monsieur,"inwordsscarcelyabove awhisper,butheheardthemandcamedownthelow,broadsteps,hisspursjinglingonthestones.Thenshefelthimsitdownbesideher....ThatwaswhereJohnhadsat;thatheshouldsitthereintheplaceof 1I;er lover 'filled herwitha flare of anger.ShegotupquicklyandwithherbackturnedtoNicholasgazedblindlyintothecapacityoftheshadows. "1 ha.vekeptmypartoftheagreement,Virginie."Hisvoicewassmoothandplacating."Helives?"shequestioned. "He lives!""Isthatallyouhavetotellme?"shecried."Thathelives,mademoiselle-isnotthatenough?ButIshalltellyou more.AlreadyhesailsonhiswaytotheMoleandfromtherehewillby someshipreachAmericawithoutdifficulty."Hepaused,but the girlmadenosound;andhecontinued,evidentlysatisnedthatshewasacceptinghisstory."Iwishyou couldhaveseenhisgratitude,mademoiselle:itwastouching. That bravadooftheAmericanwasgone absolutely.Thefearofdeathwasinhisface.Hecouldnotstartquicklyenough, Iassureyou."Sheturnedandfacedhim."PierreNicnolas, I donot berieve this.Tooofteninlittlethingshave t knownyoutoforgetthetruth,to believe nowthisincrediblestory.IfJohnBushlives-andthatIdoubt -he hasneverleftLeCapinanymannersuchasyou describe.Whatproofdo youbringmethathelives?"Withscornshewatchedtheheavylipsstruggleforananswer.Inthestarlighthisface seemedverywhite,a bloodlessmask."JohnBushlives, Iswearit.Butforthelasttimeyouhaveseenhim.ThatIhavepreservedhislife is sufficient. Nowyoumustkeepyourpartofthebargain."Hespokeslowlyandwithatingeofanger."Bah!"Virginietappedthestonewiththetipofherslipper."Idonotbelieve you.Bringmeproofthathelives.Yourwordmeansnothingtome."Asthoughtostrikeher,Nicholassprangfromtheseat,butthegirlstoodmotionless,herimpenetrableeyessteadilyfixedonhis."So!"Hisvoicewasthickandthewordscamelikeasnarl. "This isawoman'strick!A proof! y:ou butseizeonthistocrawlfromyourpromise.ButI, too,littleone,canplaythesamegame.Aweek?Aweekrromto-night? Ouif Perhapsthetimeistoolong for youtowait.Ifyouwoulddelay,Iwouldhasten."Heturnedandtookasteptowardthehouse."Igototalkwith Monsieur Mangan.Inmyabsence,mademoiselle,remembermywords.Itisnotwellto cross toofarthewillofPierreNicholas."MOTIONLESSasastatue,Virginiestooduntilhewasgone;thensheflungherselfonthebench,herfaceburiedinherhands.WasJohnBushalive?Thehorrorofthe"uncertaintynumbedherbrain.The S;:ory ofthesailingvesselandhisgratitudefortheo.pportunitytoescapewasincredible.Butifhehadnotlefttheisland,wherecouldhe be concealed?ThereweredungeonsinthefoundationofFort Pico letwherehemightbeputawaytolingerandtodie. That wasmorelikely.ButwhatreasonwasthereforhertobelievethatBushwasalive?Surely,forthepurposesof Nicholas,itwerebetterthatheweredead;Leroy'Mangan,sheknew, would havenocompunction.Therewasafaintcrunchofgravelonthepath.Shepeeredintotheinkyshadow.Thatwasa footfall-therecould benomistakeinthesound-butnoservantsusedthatpath.Who'couldbespyinguponheratthistimeandplace?"Whois there?" shecalledina low, firm voice.Therewasnoanswer,butfromtheblacknessamancameintothestarlight,silentlyasamovingshadow.Therewasnotevenaperceptible sound ofhisfeetonthestonesofthepath.Sheretreatedastepwithalittlestartledintakeofherbreath.Thensherecognizedhim.Itwasthemanwhohadcometoherthatsamemorning.Shepointedtothehouse wilere theopen doors glowedwiththebrightyellowlightofcandlesandraisedacautioningfingertoher(OontinuedonPage 49) YOURNEEDSCOMEFIRSTWesellgoodsofqualityanddistinction.Weofferyouprotectionagain'stanythingthatmakesshoppingunpleasant.THE CROWN LIFE MANWILLSHOWYOU HOW BESTTOADAPTYOUR INSURANCETOYOUR NEEDS ANDTOYOUR INCOME, ONTHE MOS'}; FAV-OURABLE TERMS.We s pecializeinLadies'DressGoods,HosieryandMen'lOutfitting.,OurstockIIunrivalledforquality,selectionandgoodvalue.SASSO&MILLER,81BKINGST,.KINGSTON.:CROWN LIFE INSURANCE COMPANYCARGILL,CARGILL fi DUNN.GeneralAgents,4'DUKESTREET, KINGSTON.

PAGE 43

1925-26PLANTER S'PUNCH41 OUR TOBACCO INDUSTRY :ANDTHOSEWHOBUILTITUP: ,, THE PACKINGROO WHERETHE VABIO{;SBRANDSABE SORTED PACKEDHIOHLYSKILLED WORK:alENMAKING THE FAMOUS"OOLOFIKA"AND "LATROPICAL" CIOABS MESSRS.Machadoare,of course, abranchoftheBritish-AmericanTobaccoCompany,buttheJamaicafactoryenjoysanindividuality of itsown.Itisunderthepersonalmanagementandcontrolof Mr. PedroMachado, aVice-President of theBritish-.AmericanTobacco Company,andadirectdescendantoftheoriginalfoundersofthebusinessinJamaica.EmigratingfromCubasomesixtyyearsago,whenSpanishmisrulehaddrivenalltheCubansofthebetterclassestovigorousprotest,theMachadossettledinJamaica.Theyhadcapital,brains, energy, andanunequalledknowledgeof tobaccocultureandmanufacture.Theystartedinbusinesshere;they,andotheremigrantsfromtheneighbouringisland,madethetobaccoindustryofJamaica.TheyfoundthatJamaicapossessedexcellenttobaccosoils;theytrainedthenatives;theybegantosupplythelocalmarketwithcigarsandcigarettesandthentocreateforthesearticlesamarketabroad.Otherfactoriescameintoexistence.Thewell-known GolofinaCigarsweremanufactured,thecapitalbeingBritish-American.ThencamethemergingoftheGolofinaandMachado factories,witha saving inexpenditure;butcigarsbearingthenamesof"LaTropical"and"Golo fina," respectively,arestillmanufactured,thoughthedirectionandfactoryareunderonemanagement.ThetobaccoindustryisanimportantonetoJamaica,anditwillgrow. Mr.Machadosaysthatthereisplentyof good tobaccolandinthecountry,andconstantlyheisexperimentingatthe.productionofnewvarietiesof leaf.Hehassucceededincultivatingaleafforcigarettesof agoldenhueandexquisiteflavour;hebelievesthatwhatVirginiacandoJamaicacanalso do,andheisgoingtoproveit.IN CubaandPortoRicothenativecigarsandcigarettesareheavilyprotected;inJamaicatheyhavetobearanexcisedutymoreorlesscorrespondingtotheimportdutyleviedontheforeignarticle.Tl:.ustheindustrycannotbesaidtooweanythingtoGovernmentassistance.Ithashadtostandonitsmeritsalone;andthosemeritshadtobehighforittosurvive.Atfirst,anduptoquiterecentdays,itwasapparentlynotregardedasaveryimportantindustrytoJamaica.Butopinionhaschanged;itspotentialitiesaswellasitsactualpositionarebeingrecognised;theattitudeofEnglandtowardsEmpiretobacco isregardedaslikelytohaveahighlybeneficial eil'ect upontheJamaicatobaccoindustry.\Indeed,Jamaicacigarmanufacturerscouldoflatehavedone alargertradewithEnglandhadtheyagreedtomakecigarstobe soldthereunderthenameofsomeEnglishmanufacturer.Butthistheyhaveconsistentlyrefusedtodo; Messrs. MachadoespeciallycontendingthateverycigarpurportingtobeJamaicanmustbeofaqualitythatwillupholdthereputationoftheJamaicacigar,andthiscouldnotbeguaranteedunlessthename of aJamaicafactorywerestampeduponit.Bythecare of thisfirmforitsreputationJamaicabenefits.Andshewillbenefitstillmoreinthefuture.occupationtopayattentiontoanythingsavethejob to be accomplished.Heisdealingwithexpensivematerials.Mistakeswill costthefactorydear.Sobrainaswellaseyeisconcentratedonthework,andfromshaggy, shapeless masses of tobacco swiftlyemergelongdarkrollsandthentheperfectcigarasweknowit.Thesearetakentoanotherpartofthefactorytobe bandedandpackedintoboxesmadefromcedarandexcellently finished.Thentheseboxesaresenttothedowntownsellingdepot,in King Street,tohundreds of placesin the islandwheretheMachadoproductsaresold,andto differentcountries.Some ofthecigarettesgoasfarasChina.And so,inscatteredquarters of theworld,thenameof Machadoisknown. YoucanbuythesecigarsintheStrandorinPiccadillyto-day, youcanbuythemupinSanJosede Costa Rica,theyareingreatdemandinPanama.TheyhaveanexcellentfutureinEngland.Withthepreferencenow given byEnglandtoEmpiretobacco,theJamaicacigarandcigaretteshouldste.adilywintopopularfavourwithEnglishsmokers.FortheJamaicatobaccoisofveryfinequalityandhasonlytobeknowntobecome aseriousrivalofthefamousHavanas.WHENthemembersoftheParliamentaryDelegation,headedby Mr.J.H.Thomas,cametoJamaicainJanuary,1925, one oftheplacesthatsomeofthemvisitedwasthetobaccomanufactoryoftheMachado CompanyinVictoriaAvenue.Thosewhodidso expressedthemselvesasmostinterestedinwhatthey saw, andonecanwellbelievethem.Forthisisone ofthemodernestablishmentsofJamaica.anativemanufactoryconductedonup to-date linesandyetsoarrangedthatitcombinestro pical beautywithbusiness efficiencyandconvenience.THEbuilding itself lookslikea long, low, single story housewithmanywindows, not likeastructuredesigned especially forthemakingofcigarsandcigarettes.InHavana,forinstance,whenoneaskswhereisthegreattobaccofactoryofthatcity,oneisshownahighstone building,hardandwhite,whichmighteasilybe awarehouseandperhapswasoneatsomeformertime.InKingston,whenonewantstovisitthecity'stobacco factory, oneistakentoalonghouse,withredroofandgreenwindows, <,pen andairyandsituatedawayfrom.thedustythoroughfare.Infrontofitis a spaciouslawnwithhedgesoneitherside,thelawnitselfbeingseparatedfromthestreetby a lowornamentaliron-work fenceandabroadstripofconcretedsidewalk.Thehedges,allvividgreenandscarlet,thesmooth lawn,thebrightfreshpaintofthebuildingharmonisewiththeblueandgold oftheskyabove,anditisherethatthefamousJamaicacigarsandcigarettesaremade.Butthelawnisnotforspectacularpurposesalone,ithasaverydefiniteandparticularuse.Passbythisfactoryintheafternoon,anytimefromfouro'clock,andyouaresuretofindtennisbeingplayed.Theplayersaretheemployees ofthefactory.Thelawnwasmadeforthem.Itwas intended fortheirrecreation.justasthefactory building was designedwithaviewtotheircomfortandconvenience, forthis To baccoCompanyhasrecognisedthatahappyspiritmeansa goodworkerandthatpleasantsurroundingsconducetoefficiency.YOUenterthefactoryanytimefromeightintheforenoon,andyouwillfindthemenandwo menatwork.Themakingof cigarettesisdonebyspecialmachinery,machinerywhichalmostseemstothink,butwhich IS tendedandguided byskilfulhands.Themakingofcigarsisamatterforthehandonly,andeachbrandofcigarshasitsownclever workers.Thesearepaidbyresults,andasthecigarmakerisaskilledworkmanthepayisgood.WhenthereisgreatdemandforJamaicacigarsthesefel lowshavea lordlytime,beingproverbiallygenerouswiththeirmoney.Theyarealsoknownasamostintelligentclass of citizens,takinganinterestinpublicmattersbeyondwhattheuninformedstrangermightexpect.Theroominwhichtheyworkisairyandwelllighted.ApartofitIsshowninone of theillustrationsonthispage. Often ahumofconversationislieard;butoften aworkeris tooabsorbedinhis

PAGE 44

42PLANTERS'PUNCH1925-26(Continuedtr'omPage 27) edtorewardhisvirtuousexertions.Reducedtodespair,hewasabouttostrollhomewards,having,asheexpressedittohimself,beenmadea fool ofbyDouglassandMatilda,when,alittlewayupthestreet,hecaughtsightof amanstandingstilland evidently observinghismovementsclosely. Mr.Proudleigh'sheartgaveaviolentleap.Theoldgentleman,thoughanimatedbyacuriositywhichwasalmost religious becauseofitsintensityandofitsoriginina firmbeliefinhumandepravity,andthoughreadysometimestoindulgethatcuriosityattheriskofseriouspersonalconse Quences, wasnotamanofthetypefromwhichtheheroesofadventurearedrawn.You couldneverthinkofhimasleadingaforlornhope;youwould :rather feelthatatmomentsofrapidretreathewouldalwaysbereadytoshowtheway,inperson.Hewasreadytoshowthewaynow,tohimself,butapartfromthefactthathiskneesweretremblingandhislegsevincedastrangedisinclinationtoobeythecommandofhiswill,aninstinctwarnedhimthattoattemptto move offwouldassuredlyrenderhimliabletogravesuspicionsandperhapsanunpleasantencounterwiththepolice.Themanwatchinghimmightbe adetective,hisprolongedscrutinyofMortimer'sresidencemightberegardedasa professionalburglar'ssurveyof acribwhichheintended tocracklateroninthenight,whenallhonestfolkshouldbe asleep.ThesereflectionscamecrowdingintoMr.Proudleigh'smindanddeterminedhislineofaction.InwardlycursingthatdevotiontothecauseofmaritalfidelitywhichhadledhimtotrytospyuponMatilda,theoldmantremblinglywalkedtowardsthesilentwatcherwiththeintentionofaskingthatpersonifheknewexactlywhereSirMortimerSlimslamlived.AnanswerinthenegativeorintheaffirmativewouldhavesentMr.Proudleightothegateofthehouseinquestion,andthedetective,waItingtoseewhatshouldhappen,mightbe awitnessofhispoliteevenifnotover-cordialreceptionbytheLadyMatildaherself.ButassoonasMr.Proudleighgotnearenoughtothemanhedreaded,heexperiencedanothershockofsurprise.StandingtherewasMortimerhimself,whosecomparativelyearlyreturnfromthesceneofhisnight'sdutyMr.Proudleighhadneveroncetakenintoconsideration.Mortimerhadperceivedinthesemi-darknessofthestreetamanreconnoitringbeforehispremises,andhad,notunnaturally,pausedtoobservewhatthefellowintended.HisrecognitionofMr.Proudleightookplaceasecondortwobeforethelatterwasawarewhoitwasthathadbeenremarkinghismovements,andasMortimerhadnothingonhismindhewasnotdisconcertedasMr.Proudleighwas."Hallo,"saidhetotheoldman,"whatyoudoingbeforemehouseatthistime0'night?Anybodysickathome?"ForonewildmomentMr.ProudleighthoughtofannouncingtheterribleillnessofSamuelhisson-inlaw,orofSusan,butevenasthethoughtenteredhismindheknewthatthatstorywouldnotdo.Forifitwerebelieved,hecouldonlyexplainhispresencethereasduetoamissionofappealforhelp,whichwouldinfalliblybringMortimertoJones'shouseatonce. obodysickat'orne,medearSirSlimslam,"Mr.ProudleighassuredSirMortimervolubly;"notasinglesoulsick.Infact,themisallquitewellandwillcometosee.y'uassoonasdemcan.Howisyou'self?Amanlikeyououghtto'aveperfec'goodhealth,fory'uworkhardandyouisanoblegentleman."HereMr.ProudleighpausedinthevainhopethattheconversationofthenightwouldbeentirelyconfinedtothesubjectofhealthanditseverlastingcOTJtinuance."But,"laughedMortimerpleasantly,"Isureyoudidn'twalkallthisdistancefromyou'housetomy'ousetoaskmeaboutmehealth,Old Massa. Somethingmustbehup.Whatbringyououtheresolateto-night?""Mr.Mortimer,"repliedtheoldmanfirmly,"itisaverynicenight.""Thenightisallright,"answeredMortimer,nowslightlypuzzledandwonderingifMr.Proudleighhadbeenlookingupontherumwhenitwasredwithtoolovingandprolongeda gaze."Thenightisfine.Butyoudidn'tleaveyou'comfortable'orne to comean'tellmeso.Yetyoumustha'beenwaitingforme,for l noticeyouwastryingtopeepintomeplacean'.makeno efforttogoinside.Whatishup?""Iwasn'ttryingto peepintoyou'house,BrotherMort,mymostnoblelord,"asseveratedMr.Proudleigh."YouknowbetterdananybodyelsedatIwouldn'tdo at'inglikedat.Iwasonlylookin'.An' if amanhaveeye,himissupposedtolook.""Thatisallright,"Mortimerreadilyagreed."Butamanwillonlylookifhimseesomethingorexpectto seeit.An'ifyouwalkalongdistanceto com\! an'lookintomehouseafterteno'clockatnight,itmus'bebecauseyouexpecttoseesomething.Whyyouafraidtotellmewhatitis?""Yout'inkIwouldbeafraid of you,mymightyJamaicaThe --------duke?"gaspedMr.Proudleigh,whoseterrorwasnowgettingthebetterofhiswits."IwouldthrowmeselfuponyourSupplicationinsteadofrunaway.Youaredesortofmandat-"But,forthemoment,Mr.ProudleighcouldnotdecidewhatsortofmanSirMortimerwas,andsoleftthisimportantmatterinperpetualobscurity.SirMortimerwasnotapersonofgiantintellect.Hehadnottheintuitionsof genius.HewasmerelyaverycompetentyoungwaiterwhohadmadeinsalaryandtipsacomfortableliVing,andwhohadbeenrecentlyelevatedtoanOrderofKnighthood,whichdoubtlessheadornedquiteaswell as,intheirrespectivespheres,otherknights of otherOrdersdid.Butitrequirednogiantintellectorflash ofgeniusforhimtograspthatMr.Proudleighhadcometohishousethatnightforsomespecialreasonhewasendeavouringto con ceal.Thisconviction,notunnaturally,madehimresolveto findoutwhatMr.Proudleighhadinmind."Seehere,Mr.Proudleigh,"hesaidwithaperceptiblenoteofangerinhisvoice,"yOUcan'tfool me.HereIam,comin'frommeworkto-night,an'I findyououtsidemedomicilelikeathiefinde d:::rk, prowlin'aboutan'peepin'.An'whenIseeyou,y'uruntowardsmetotellmethenightisanicenight,an'thatyouwasn'tpeepin'butonlylookin'!WhatitallmeansIgottofind out, forthisispolicebusiness.Iknowandrespectsy'u,andIknowsyou'son-in-lawanddaughter,andallyou'fambily,butthem can't beawarewhatyoudoingtonight,an'ifIcallapolicemanan'give youinchargeforsuspiciousconduct,themwon'tblamemeforit,theywillsayitisyourfault.SoyouknownowwhatIgoingtodo." Of course,Mortimerintendedto donothingofthesort.Hewasmuchtoogood-natureda fellowtoadoptanysuchcourse;besides,hewouldnothaveoffended Mr.Proudleigh'sfamilyforworlds.ButMr.Proudleigh,feargrippingathisheart,couldnothavebeenexpectedtoreasoncalmlyatthatcriticalmomentofhislife.Hedidnotrealisethatnopolicemancould possiblyarresthimformerelylookingatanotherman'shouse.Sadtorelateheal lowedhimselfto'be bluffed completely.He felt thathewouldhavetotellthetruth,butmusttellitinsuchawayastoshowhimselftothebestadvantage."SirMortimer,melord,"saidtheoldman,"itisbecause I respec'youdatIamhereto-night.""Thankyou, Mr.Proudleigh,"saidSirMortimercalmly."Iamyou'frien'.""Goahead,sah.""Idoan'tliketo see nobodyteckameanadvantageof you.""Idon'tlikeitme self,"saidMortimerwithconviction."An'whenI see dewayMisterDouglassputyou'wifeina'busto-nightan'drive'erhome, Isaytomeself,'ifSirMortimerwas'ere,Douglasswouldn'tdodat,an'himnotactingfairandsquaretomynobleknight.""Youmean...youmean?"queriedMortimer."Whatyoumean?""Idoan'tmeanat'ing,myfrien,"Mr.Proudleighhastenedtoassurehim,forhedidnotlikethetoneinwhichMortimerhadaskedhisbriefbutpointed'question."Idoan'tmeanasinglet'ing.ButIteckt'oughtan'saytomeself, Imustprotectmyfrien'SirMortimerinterest.Youdoan'tknowwhatkineofmanIamyet,Mortimer.Iarea goodman.Youaskanybodyaboutmean'hearwhatdemsay.ButI will'avetotelly'ugoodnightnow,forI feelin'tired,an'mefootsisevenweakerdanwhenIwasinColon. So ef youwillexcuseme-""Inotexcusin'you adam!"saidMortimerbrutally. "Youwill'avetosaymoresinceyousaysomuchalready.Whatdoy'umeanaboutDouglassputtingmewifeina'busan'bringin'her'orne?Isthatallyoumeanstosay,oryou 'ave somethingmoreinyou'mind?Whyyoucomeallthislongwaytopeepintome'ousefromdeoutside?Whyyoutrytotellmea lie'bouthowthenightisfine?Whatyoutryin'tosay?Whatdoyouknow?WhatyouseeDouglassandMattydoin'? RemE:.mber, Idon'tforgetyouarea oldman,butdon'tgo toofarwithme. Iadvisey'uto beverycarefulto-night,Mr_Proudleigh,forsometimesole peoplegets'urt."Mr.Proudleighalreadyknewthatonlytoo well. Onceortwicehe,asanoldman-itsemeedtohimhehadalwaysbeenold-hadgothurtbadly,andhedesirednofurtherexperiencesinthatdirection.Butwhatwashetodo?"Ionlywantedtoseefo' meself, Marse Mortimer,"hemurmuredbrokenly."Ididn'tmeansno'arm.""Y'umean,'saidMortimer,"thatasyouwanttomixupmewifenamewithscandal,you, aoldsinnerthatoughttobeinyou'grave,comeallthiswayto-nighttospyupon'er.Thatiswhatyoumean.Whydidn'tyougoinside,youwort'lessolefeller?Whyyoustayoutsidelikeathiefindedark?You old Jezebel! Younotashamedofyou'self?""Imorethanshame,MisterMorty,"wailedtheoldgentleman."Ifeel soshamedatI couldsinkintodeground.Butdoan'ttecknonoticeofme;letdeporeolemango 'ornetohimbed,an'Godwillblessyou.Wishyoua goodnight,Marse Mort,an'sleep well,meson,sleepwell! I gone home,y'uhear?""No, Idon'thear,"snappedMortimer.j'Don'tyoudaretomoveyet.Iamthinkin'."AndsoMortimerwas.WhathadMr.Proudleighseen?WhathadarousedMr.Proudleigh'ssuspicions?Mortimerhadcomeintocontact,inthecourseofhisdailyandnightlyduties,withhundredsofladiesandgentlemen,andhewaswellawarethattheymixedfreelywithoneanother,didnotappeartoharbourmeansuspicions,andwouldthinknothingwhateveraboutamantakinghomeawomanfromanentertainment.Thatpeople ofoppositesexes,whethermarriedorsingle,couldbeonthefriendliesttermswithoneanotherandnoscandalorinnuendoesresult,heknew;and,unconsciously,hehadbeeninfluencedbytheirwayofthinkingandacting.Besides,hewasnothimselfsuspiciousbynature.ButherewasMr.Proudleigh,whomonlytheprospectofafreedrink stirredtounwontedphysicalexertion,confessmgthatdoubtsastotheconductorintentionsofDouglassandMatildahadbroughthimforthasaspythatnight,andsurelyMr.Proudleigh'speo plemustknowsomethingabouttheoldman'smis sion.Andperhapsitwasnotmerelythisnight'sbringinghomeofMatildabyDouglassthathadgivenJUSTINMcCARTHYLTD.14KING STREET STATIONERS,BOOKSELLERS,TOYDEALERSAlso GamesofallStylesforTable, and Out door ForTheXmasSeasonNowApproachingWATERMAN'SFOUNTAINPENS,THEIDEALOFTHEAGE.XMASANNUALS&PICTUREBOOKSfortheChildreningreatvarietyofstyles aho PresentationBooksbythebest Author; forChildrenandAdults. 'FANCYBOXESOFFANCYSTATIONERY asuperbassortment.XMASCARDS!acharmingLot,Single, Packet" Boxesetc.FIREWORKS!agrandassortment. PRESEMTATION GOODSinagreatflarielyofarticlestoselectfrom,tosuitallages. McCarthyLeads,andtheirPricesarereasonableonallLInes.andKeepallup-to-dateDoods.JUSTIN LTD.THEARISTOCRAT MART OF KINGSTON. GEORGE SONS...83KING STREET. Branches3-5&10WestQueenSt.We display our goods for the benefit of our discriminating Customers. We guarantee refinement in styles also high-grade quality and IOl(prices, TOSUITALLPOCKETS.

PAGE 45

1925-26PLANTER S'PUNCHAtlanticFruitCompany,---------LIMITED---------(INCORPORATED UNDER THELAWSOF JAMAI0AJ Manager:LINDSAYP.DOWNER .HEAD OFCOMPANY:1,King Street Kingston, Jamaica.43 andCARRIERSofTropicalFruits.STEAMSHIP, forPASSENGER SERVICE to Ne'VYork andPhiladelphia.PRINCIPALAGENCIESINJAMAICA:PortAntonioPortMariaRioBuenoPortMorant.OracabessaFalmouthMorantBay Rio NuevoMontegoBay Manchioneal St.Ann'sBayLuceaAnnottoBayGreenIsland

PAGE 46

44PLANTERS'PUNCH -1925-26 risetotheProudleighsuspicions.Mortimerhimselfhadknownthathiswife would begoingtothemeetingonbehalfoftheOppressed,andDouglasshadinformedhimthathewouldcallforherandtakeherhome.HehadbeenpleasedwithsuchattentionsfromaPermanentPresidentandMinisterPlenipotentiary;theyhadseemedtohimtoshowthedueandproperregardof onehighdignitaryforanother.Butotherpeople,evidently,weretakingquitea differentviewofthematter.Whatdidtheyknow,orbelieve?"Sinceyouwanttoknowwhatisgoin'oninmehouse, Mr.Proudleigh,"saidheatlength,"youbettercomewithmean'see.ButIadvise you tokeepawisetonguebetweenyou'teeth.Itisnotme alone,butDouglassan'Mattyyou'avetodealwith.""Iwouldpreffertogo 'ome,"Mr.Proudleighearnestlyassuredhim."Inotthinkin'ofwhatyoupreffer,"repliedMortimer,"youcominginsidewidme."Astheyapproachedthehouse,theyheardthesoundofconversationquiteaudiblyconducted;in deed, Mr.Proud leigh couldhaveremainedoutsideandmadeoutdistinctlymost of whatwasbeingsaid.Fifteenminutesagohehadstrivenvainlytocatchasingledefiniteword;now wholesentenceswere being showereduponhisearbyMr. Douglass.Mortimerwalkedveryquietly,advisingtheoldmansternlynottomakeunnecessarynoise.ItseemedeventoMr.Proudleigh'sfrightenedunderstandingthatMortimerwishedtocomeascloseaspossibletohisown residenceundetected.Butthecoupleinthelittlehallwereapparentlyoblivious oftheproximity of Mortimer,Mr.Proudleigh,oranybodyelse;theywereearnestlydiscussingtheaffairsoftheConfederation, and MortimerandMr.ProudleighheardMr.Douglassprotestthathewould never be satisfieduntilhisfriend,SirMortimer,whosebrainandcharacterweresuperblyabovetheaverage,consentedtoacceptadistinguishedpositionintheConfederation."Iwon'tleavehereto-night,LadySlimslam,"asseverated Mr. Douglass,"untilIseeyour'usbandan'persuadehimtotakeofficebefittinghisknighthoodandintelligence.That'swhatIamwaitingfor,thoughheismuchlater than Ididoriginallyexpect.ItistruethatConspicuousBrimstonehasdonatedtwentypoundstoourfunds,whichshallbe lodged to-morrowwithallduepointandcircumstances;butwewantintellectaswellasmoney;wewantsterlingcharacter;wewantprespective.Your'usbandmustconsentto'elpus.Thereis'acryfromMacedonia, 'comeoverand'elpus.'Thatismycrytohim.Pleaseuseyourinfiuencewithhimtoaccept, for Icannotcarryonthismightyworkalone."Thenthedoor opened,andMortimerandMr.Proudleighentered. If Matildaobservedthatherhusbandwasangryanddisturbed,shegavenoindicationofthat.Asfor Douglass,hewasinecstasiesthatMortimerhadarrivedatlast,and was verypleasedindeedtoseeMr.Proudleigh.Immediatelyafteranexchangeofgreetings,heimplored'Mortimertosharewithhimtheburdensandhonoursof office by becomingPermanent Vice-President andActingMinisterPlenipotentiaryoftheConfederationoftheOppressed.WhileMortimerhesitatedastowhatheshoulddo, Mr.DouglassaskedMr.Proudleigh if hethoughthisson-in-lawwouldbeupatthathour."Forifso, Iwilltakeawalkwithyou,sir,an'discusswithhimsomebusinessoftheConfederation.Nohouristoolatewhenoneisworkingfor'ispeople.""Ibelieve,"returnedMr.Proudleigh,"datJones is notassympathisingwidyourmovementlikeI am." "I may be abletopersuadehim,"saidMr. Douglass."Ishallbegladtoaccompanyyou." Mr. PToudleighdimlywonderedifMr. Douglassalsodesiredtoputhimthroughacatechismastowhyhewasoutthatnight;andknowingsomethingaboutthattruculentlittlegentleman,Mr.Proudleighfearedthatthesubsequentproceedingsmightbeunpleasant.Buthecouldonlysay, "Youcancomeefyoulike,MisterDouglass,thoughIt'inkJonesmustbe gonetobed by now.""Andyou,friendMortimer,"askedDouglasspleasantly,"willyou bePermanentVice-President?""Iamsurehewill,"criedMatilda;"afterall,Iwantto see me'usbandimportant.Hedeserveit,especiallyafterthewickedwayhebeen treated.""Don'ttalkofthat,"exclaimed Mr. DO.uglasspassionately."Itmakesme blood boil.Butwewillgeteven;weshall'aveawordortwotosaytothat.Well,SirMort, youagree,eh?"AndMortimeragreed,nowoncemorerestoredtosomethinglikegoodhumour,andMr. PToudleighassuredhimthatnomanwasbetterfitted for theVice-Presidency oftheOppressedthanhe.Thustheypartedcordially,withbutonecrypticobservationfromMortimerastothewisdomofelderlygentlemenkeepingsilenttonguesbetweentheirteeth.Mr. PToudleighmadeuphismindtobeverycircumspect.Hewouldsaynothingdefinitetohisfriendsandacquaintances.Hewould'merelyhintthings,forhewasbynomeanscertainthattheconductofDouglassandMatildawasaltogetherwhatsohighamoralistashe would naturallydesireittobe.CHAPTERSEVEN' LADY BRIMSTONEANGERED"OOUGLASSisanungratefulman,"assertedLadyBrimstone,andMr.Proudleighsigni fiedhisagreementbyvigorously attackinc thedishofsalt-fishandackee,sweetpota-toesandroastedyam,thatshehadplaced beforehim.Mr. PToudleighdidnotwanttocommithim. self insomanywordstoanopinionofMr. Douglass,butthevigourwithwhichheassaultedthefoodbeforehimsuggestedthathewastramplingmetaphoricallyonthecarcassofMr.NicodemusDouglass."Andyouyou'self, Mr. PToudleigh,hearhimsaythatMortimer'avemoresensethanmehusbandan'mustbe Vice-President, forallthatme'usbandhaveismoney!""But,medearMrs. Conspicuous,"imploredMr.Proudleigh,"IbegyounottotellasouldatItelly'uso. If itwasn'tdatI loveyouan'you'husban'Iwouldn'tha'saida word,butIcouldn'thearwhatI didhearan'notlety'uknow.""Itwouldn'tha'binafriendlyactfor Y9u tokeepitsecretawayfromme,"agreedLadyBrim '3tone. "An'thoughMr.Douglasssaythathewantcharacteran'intellectinhissociety,hewerequickenoughtoteckmehusban'smoney,an'God'only kIroWS whatbecomeofit."Mr.Proudleighfilledhismouthwithsalt-fishasasignofhissympathywiththefears of LadyBrimstone."An'youthink,"continuedtheladyconfidential ly,"thatthereisreallysomethingbetweenDouglass 3n' Matilda,eh?"Youhavethesamethoughtlikeme, eh, Mr.Proudlelgh?""Iwouldn'tsuspicionanybody,LadyB.,"repliedthehigh-mindedmoralist,"butafterI leavedehousedatnightIteckathoughtan'saytomeseU:howitisdatwhenIwassolongoutsideatfirs' Icouldn'thearat'ing,anddatwhenmeandMortywasgoin'inweheardemtalksoloudan'plain?Whatwasthemtalkin'aboutso beforethatthemdidn'twantnobodyto'ear?Itisnotmybusiness,an' if dereis onet'ingI do,itistominemeownbusiness.Butl.thaveafunnylook,medearLadyBrimstone,an'nobodycanteckdatoutofmemind.""Tcho!"sneeredLadyBrimstone,"Iknowfromlongagothatitwasgoln'tobeso,an'Isaidso. IknowMatildaSlImslammorethan'erownmotherknowher.Mortyisnotdoln'sowellnowashewas2TEMPLELANEKINGSTONHARDWAREANDLUMBERMERCHANT.

PAGE 47

1925-26PLANTERS'PU-CH45PRESCRIPTIONSCAREFULLYANDACCURATELYDISPENSED.OppositeBankofNovaScotia.American Iced SodaDrinksofFine }'Iavoured SyrupsandIce <':ream. hehadsensedmorethanMortimerhaddone.ButtheseedsofsuspicionhehadplantedinMortimer'smindthatnighthadneverwitheredanddied;andsincethentherehadbeenkindlyfriends,anxioustobringaboutquarrelsandseparations,tosuggestt()MortimerthattheStateofDenmarkwasnotinperfectcondition."Thatoldman,Proudleigh,ismakingalotofmischief,"saidDouglassslowly. "He beginallthis:'"Can'ty'udosomethingtostophim,then?" de mandedMatilda."Y'unotgoin'tolethimteckawaymegoodnameashelike?""No; but hegoneprettyfaralready,"admittedDouglassthoughtfully."An'BrimstonegoingODverypeculiar.Troublemaybecoming,Mat:'"Thenwhatyougoingtodo?""Ican'tsayyet.Wemus'watchit.Perhapsitwillbeallright;1willsoonknow.ButinthemeantimeIamgoingtogetthatoldrascal,Proudleigh,tokeepasilenttongue,ifI'avetofrightenthesoulouthiswits."Andashesaidthis,the lit tlebutfierceandoverbearingPresidentofthe Op pressedlookedquitecapableofoppressingMr.Proudleighuntilthatgentlemanshouldcollapsewithfear.Hehadnotlongtowaitforhisopportunity.A.coupleofdaysafterthisconversationDouglassmettheoldmanstrollingaimlessly,asitseemed,in the direction of Mortimer'shouse,whichseemedtohaveforMr.Proudleighanalmostdeadlyfascination."Hey,you!"Mr.Douglasshailed,andMr.Proudleighgatheredfromthisformofaddressthatallwallnotwell. "Yes,mynoble--"hebegan;butDouglasscuthimshort."Don'twantanycomplimentsfromyou,sir.Imerelycallyoutotellyouthat1amabadman.Youunderstand?Averybadman!"Mr.Proudleighunderstoodhimverywellindeed.Inhiscase,asinsomanyothers,aguiltyconscienceneedednoaccuser.Hewantedtoprotestthat he thoughtMr.Douglassa goodman,averyexcellentandvirtuousman,butthewordswouldnotcomefluently. SohewaitedtohearinwhatparticularmannerthebadnessofMr.Douglassnowproposedtoexpressitself."Ihatea l,iar," said Mr.Douglass;"1hateamanwhogoaboutan'makemischief.Iamnotafraidofanybody;Iwhodon'tafraidoftheBritishGovernl<::lNGSTON, JAMAleA.DEALERINPureDrugs,Patent MedicinE:'s,'Perfumery, Confectionery,Teas, &c., &c., 20 KING SPECIALTIES:MANUFACTUREUS: h HISTAULlSHII> OLD RUM Bod NATIVEt:ELlmRATlm WINES. "LA-PALOMA" CIGARSDispensing Chemist and DruggistG.EustaceBurke& Bro., Ltd.EXPORTERSANDIMPORTERS.Wine,Rum.SpiritandGeneralCommissionMerchants.Then don't forgettotTyourLAPALOMACIGARS.4& 15 KING &PORTROYALSTREETS,KINGSTON, JAMAICA.E.D.KINKEAD,When you wanttheMaterials for a' realPLANTER'SPUNCH,call atYouseehowlowtheyare?"Y'uwouldthinktheywaspurelikesnowan'spotlesslikealambthemself,theysofondofsuspicioningotherpeople.Why theY' thinkwedoin'anythingwrong?""Wedonothingwrong!"protestedMr.Douglassstoutly."Ican't'elplOVing sosweetafemalelikeyou,an'ifyoucareforme,whoistoblame?Lovecomeasitlikes,an'ifyou'avethemisfortunetobetiedup,well,thatisnotourfault.Lethimthatiswithoutsincastthefirs'stone.If1wastotellwhat1knowaboutsome ofthem,alotthat'sgoingtochurchandsingingloudwouldn'tholduptheir 'eds." "Me, tOlJ," assertedMatilda."Wenotdoinganythingworsethanotherpeople,an'thereforethemhavenorighttotalkaboutus.Butthemtalkin'allthesame.An'supposeMortyteckasuspicionofus,whatwegoingtodo?"Mr.DouglasshadashrewdideathatMortimerhadalreadybecome suspicious.MortimerhadletfallcertainlittlehintswhichDouglasshadbeenquicktounderstand.Some oftheladiesintheConfederationhadalsogrownjealousofMatilda,whonowspokewithauthorityattheweeklymeetings,confidentofthesupportofthePermanent Pre sident.He,indeed,realisedthatsheactedindiscreetlyinthis,butMatildalovedtoshow off andwouldriskmuchtogratifyhervanity.ShedelightedinbeingaLady,shedelightedevenmoreinbeingthefavouriteofthePermanentPresidentwho,asheadofanorganisationwithfundsinthebank,wasinhereyesamuchbiggermanthanaknightwhowasoutof aregularjob.Mortimerhadforeseen,moretrulythanhehimselfhadgrasped,thatassoonasMatildahadsecuredthellositionofa lawfullyweddedwifeshewould developinnotdesirabledirections.Shethoughtlessofherpositionasamarriedwomanthanshehadbelievedshewoulddo,andMr.Douglass'sadventonthescenehadcausedhertothinkmuchlessofMortimer.Shehadanelementoftheadventuressinhercomposition.ShefoundaconstantthrillinherintriguewithDouglass.ThathadcometoaclimaxontheverynightwhenMr.Proudleighhadstartedtospyuponthem;itwaswhilethatgentlemanwasprowlingoutsidethehouse,inaspiritofdisinterestedvirtue,thatMatildahadtakenDouglassforherloverde fin,itely. Mr.Proudleighhada flairforsuchthings;before,an'Douglassdressupand'aveplentyoflIatteryan'talk;an'Mattydon't'avenoprinciple.Sowhatyoutoexpect?Whenpussgoneout,ratrunabout.Mortyisoutveryfrequent,nightaswell as day,an'PresidentDouglasscancallaroundto see howLadySlimslamgettingon.Heknowverywell howshegettingonallthetime.Bothofthemaregettingonquite sweet. SoitisPresidentDoug lassthis,an'LadySlimslamthat. Lady Slimslam!Y'ueverhearsuchfoolishness?""ButyouareaLadyPotentatess,"Mr.Proudleighremindedher,anxiousthatsheshouldunderstandthatherespectedhertitleandposition,andnotunmindfuloffuturemeals."Medearole gentleman,"criedMrs.Brimstonebitterly,"itisonlywefoolishJamaicapeoplethattalkin'abouttitleandPotentatean'therest;butsincewhenyouever